F484063
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 867 | 411 | 840 | 284 |
Family's Representative Sequence
| Representative Sequence | 3300048928|Ga0496125_0000079|Ga0496125_0000079_210263_211231 |
| Length | 322 |
| Sequence | VRVTVGDGGPDAAPGCDVVHNQGMVAPRATALGGRTGAVVLADADVPAALAVCAVDPVASVLASSRLLQAAEQGVRRAGGELWGYAEDGALHAVCWVGANLVPVLGTSDPDVVSRALTAFADLGAARGRRCSSIVGAAEPVLGLWSRLRRSWPAEREVRAHQPSMVLDTDPRVAPDPRVRRSRPDEYDLVLPACVRMFTEEVGYSPASGPGGPYEVRVRRLVEEGRSFVLVDRGTWRRPRVVFKAEVPAVALGVAQVQGVWVEPERRGERLSEGGMAAVVEATRADVAPVVSLYVNGYNTRAVRAYEAVGFREVGAYATVLF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221687 | Mycobacterium sp. Root135 | Isolate | Unclassified |
| 2 | 2643221690 | Cellulomonas sp. Root485 | Isolate | Unclassified |
| 3 | 2643221694 | Cellulomonas sp. Root137 | Isolate | Unclassified |
| 4 | 2643221715 | Mycobacterium sp. Root265 | Isolate | Unclassified |
| 5 | 2643221722 | Cellulomonas sp. Root930 | Isolate | Unclassified |
| 6 | 2728369276 | Kineococcus rhizosphaerae DSM 19711 | Isolate | Rhizosphere |
| 7 | 2738541272 | Promicromonospora sp. AC04 | Isolate | Unclassified |
| 8 | 2738541274 | Mycobacterium sp. YR708 | Isolate | Unclassified |
| 9 | 2738543027 | Promicromonospora sp. CF082 | Isolate | Unclassified |
| 10 | 2738543028 | Mycobacterium sp. YR782 | Isolate | Unclassified |
| 11 | 2758568522 | Promicromonospora thailandica SAI-039 | Isolate | Unclassified |
| 12 | 2758568621 | Promicromonospora sukumoe SAI-064 | Isolate | Unclassified |
| 13 | 2808606394 | Promicromonospora sp. C35 | Isolate | Unclassified |
| 14 | 2811994880 | Cellulomonas sp. SLBN-39 | Isolate | Unclassified |
| 15 | 2839986021 | Cellulosimicrobium cellulans JZ5 | Isolate | Unclassified |
| 16 | 2842134933 | Mycolicibacterium obuense SEMIA 442 | Isolate | Nodule |
| 17 | 2884994152 | Cellulomonas sp. H30R-01 | Isolate | Rhizosphere |
| 18 | 2887478801 | Catellatospora paridis NEAU-CL2 | Isolate | Rhizosphere |
| 19 | 2902792274 | Mycolicibacterium sp. P9-64 | Isolate | Unclassified |
| 20 | 2902799365 | Mycolicibacterium sp. P1-5 | Isolate | Unclassified |
| 21 | 2902810491 | Mycolicibacterium sp. P9-22 | Isolate | Unclassified |
| 22 | 2902837492 | Mycolicibacterium sp. P1-18 | Isolate | Unclassified |
| 23 | 2929212328 | Mycolicibacterium sp. R-73050 Hybrid assembly | Isolate | Unclassified |
| 24 | 2932431166 | Cellulosimicrobium sp. 4261 | Isolate | Rhizosphere |
| 25 | 2939582691 | Mycolicibacterium sp. 624 | Isolate | Rhizosphere |
| 26 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 27 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 28 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 29 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 30 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 31 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 32 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 33 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 34 | 3300003285 | Grassland soil microbial communities from Hopland, California, USA - Sample H3_Rhizo_39 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 35 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 36 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 37 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 41 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 44 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 46 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 56 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 69 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 73 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 74 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 75 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 77 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 81 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 82 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 84 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 85 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 86 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 88 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 89 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 90 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 91 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 92 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 93 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 94 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 95 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 96 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 97 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 98 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 99 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 100 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 102 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 103 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 104 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 105 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 106 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 107 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 108 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 109 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 110 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 111 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 112 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 113 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 114 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 115 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 116 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 129 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300012481 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 | Metagenome | Rhizosphere |
| 132 | 3300012483 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 | Metagenome | Rhizosphere |
| 133 | 3300012485 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 | Metagenome | Rhizosphere |
| 134 | 3300012488 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 | Metagenome | Rhizosphere |
| 135 | 3300012506 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 | Metagenome | Rhizosphere |
| 136 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 137 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 152 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 153 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 154 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 155 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 156 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 157 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 158 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 159 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 214 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 218 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 219 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 220 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 221 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 222 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 223 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 224 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 225 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 226 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 227 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 228 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 229 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 230 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 231 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 232 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 233 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 234 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 235 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 236 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 237 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 238 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 239 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 240 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 241 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 242 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 243 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 244 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 245 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 246 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 247 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 248 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 249 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 250 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 251 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 252 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 253 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 254 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 255 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 256 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 257 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 258 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 259 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 260 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 261 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 262 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 263 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 264 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 265 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 266 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 267 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 268 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 269 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 270 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 271 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 272 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 273 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 274 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 275 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 276 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 277 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 278 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 279 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 280 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 281 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 282 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 283 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 337 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 338 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 339 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 340 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 341 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 342 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 343 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 344 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 345 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 346 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 347 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 348 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 349 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 350 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 351 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 352 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 353 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 354 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 355 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 356 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 357 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 358 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 359 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 360 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 361 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 362 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 363 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 365 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 366 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 367 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 368 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 369 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 370 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 371 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 372 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 374 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 375 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 376 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 377 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 378 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 380 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 381 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 382 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 383 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 384 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 385 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 386 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 387 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 388 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 389 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 390 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 391 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 392 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 393 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 394 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 395 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 396 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 399 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 400 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 401 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 402 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 403 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 404 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 405 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 406 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 407 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 408 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 409 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 410 | 8001781756 | Catellatospora tritici NEAU-YM18 | Isolate | Rhizosphere |
| 411 | 8056579771 | Promicromonospora iranensis UTMC 00792 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.85 |
| Metatranscriptomes | 1.04 |
| Isolates | 3.11 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.34 |
| Nodule | 0.12 |
| Rhizoplane | 9.8 |
| Rhizosphere | 71.86 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.88 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJNas_1002016 | 3300000546 | Bacteria | 2595 |
| 2 | JGI24746J21847_1005052 | 3300001977 | Bacteria | 2066 |
| 3 | JGI24743J22301_10015602 | 3300001991 | Bacteria | 1411 |
| 4 | JGI24750J21931_1003896 | 3300002070 | Bacteria | 1798 |
| 5 | JGI24745J21846_1000595 | 3300002073 | Bacteria | 3245 |
| 6 | JGI24748J21848_1004782 | 3300002074 | Bacteria | 1558 |
| 7 | JGI24742J22300_10003385 | 3300002244 | Bacteria | 2587 |
| 8 | JGI24751J29686_10008463 | 3300002459 | Bacteria | 2106 |
| 9 | Ga0007423J48922_100409 | 3300003285 | Bacteria | 4520 |
| 10 | rootH2_10157116 | 3300003320 | Bacteria | 1960 |
| 11 | Ga0055540_1001773 | 3300003792 | Bacteria | 12303 |
| 12 | Ga0055540_1002004 | 3300003792 | Bacteria | 11361 |
| 13 | Ga0070658_10089642 | 3300005327 | Bacteria | 2533 |
| 14 | Ga0070676_10003560 | 3300005328 | Bacteria | 8147 |
| 15 | Ga0070683_100006536 | 3300005329 | Bacteria | 9790 |
| 16 | Ga0070683_100026274 | 3300005329 | Bacteria | 5240 |
| 17 | Ga0070683_100123072 | 3300005329 | Bacteria | 2451 |
| 18 | Ga0070690_100098649 | 3300005330 | Bacteria | 1934 |
| 19 | Ga0070690_100316738 | 3300005330 | Bacteria | 1123 |
| 20 | Ga0070666_10022380 | 3300005335 | Bacteria | 4105 |
| 21 | Ga0070666_10222154 | 3300005335 | Bacteria | 1333 |
| 22 | Ga0070682_100043875 | 3300005337 | Bacteria | 2766 |
| 23 | Ga0070682_100070268 | 3300005337 | Bacteria | 2238 |
| 24 | Ga0068868_100001925 | 3300005338 | Bacteria | 14255 |
| 25 | Ga0068868_100214843 | 3300005338 | Bacteria | 1608 |
| 26 | Ga0070660_100337678 | 3300005339 | Bacteria | 1239 |
| 27 | Ga0070660_100360014 | 3300005339 | Bacteria | 1199 |
| 28 | Ga0070689_100417573 | 3300005340 | Bacteria | 1136 |
| 29 | Ga0070691_10019777 | 3300005341 | Bacteria | 3109 |
| 30 | Ga0070687_100111861 | 3300005343 | Bacteria | 1547 |
| 31 | Ga0070687_100168780 | 3300005343 | Bacteria | 1300 |
| 32 | Ga0070692_10080896 | 3300005345 | Bacteria | 1749 |
| 33 | Ga0070692_10089477 | 3300005345 | Bacteria | 1671 |
| 34 | Ga0070668_100000140 | 3300005347 | Bacteria | 45946 |
| 35 | Ga0070668_100000721 | 3300005347 | Bacteria | 22652 |
| 36 | Ga0070668_100483453 | 3300005347 | Bacteria | 1070 |
| 37 | Ga0070669_100019162 | 3300005353 | Bacteria | 4889 |
| 38 | Ga0070669_100111779 | 3300005353 | Bacteria | 2074 |
| 39 | Ga0070675_100078300 | 3300005354 | Bacteria | 2752 |
| 40 | Ga0070671_100023362 | 3300005355 | Bacteria | 5060 |
| 41 | Ga0070671_100185484 | 3300005355 | Bacteria | 1762 |
| 42 | Ga0070671_100424353 | 3300005355 | Bacteria | 1139 |
| 43 | Ga0070674_100001316 | 3300005356 | Bacteria | 13057 |
| 44 | Ga0070673_100187500 | 3300005364 | Bacteria | 1774 |
| 45 | Ga0070688_100023636 | 3300005365 | Bacteria | 3617 |
| 46 | Ga0070688_100418205 | 3300005365 | Bacteria | 996 |
| 47 | Ga0070659_100052771 | 3300005366 | Bacteria | 3198 |
| 48 | Ga0070659_100087194 | 3300005366 | Bacteria | 2499 |
| 49 | Ga0070659_100240088 | 3300005366 | Bacteria | 1499 |
| 50 | Ga0070667_100000408 | 3300005367 | Bacteria | 45977 |
| 51 | Ga0070667_100001695 | 3300005367 | Bacteria | 19697 |
| 52 | Ga0070667_100121550 | 3300005367 | Bacteria | 2271 |
| 53 | Ga0070667_100175346 | 3300005367 | Bacteria | 1894 |
| 54 | Ga0070709_10241601 | 3300005434 | Bacteria | 1297 |
| 55 | Ga0070714_100006869 | 3300005435 | Bacteria | 8823 |
| 56 | Ga0070714_100109541 | 3300005435 | Bacteria | 2443 |
| 57 | Ga0070713_100052927 | 3300005436 | Bacteria | 3362 |
| 58 | Ga0070713_100071745 | 3300005436 | Bacteria | 2927 |
| 59 | Ga0070713_100114138 | 3300005436 | Bacteria | 2359 |
| 60 | Ga0070713_100301330 | 3300005436 | Bacteria | 1475 |
| 61 | Ga0070710_10001921 | 3300005437 | Bacteria | 9843 |
| 62 | Ga0070710_10006772 | 3300005437 | Bacteria | 5525 |
| 63 | Ga0070701_10000646 | 3300005438 | Bacteria | 12182 |
| 64 | Ga0070711_100006335 | 3300005439 | Bacteria | 7127 |
| 65 | Ga0070711_100113640 | 3300005439 | Bacteria | 1991 |
| 66 | Ga0070711_100134054 | 3300005439 | Bacteria | 1848 |
| 67 | Ga0070700_100000668 | 3300005441 | Bacteria | 16973 |
| 68 | Ga0070700_100138521 | 3300005441 | Bacteria | 1651 |
| 69 | Ga0070708_100003731 | 3300005445 | Bacteria | 11945 |
| 70 | Ga0070708_100394472 | 3300005445 | Bacteria | 1305 |
| 71 | Ga0070663_100014150 | 3300005455 | Bacteria | 5114 |
| 72 | Ga0070663_100119505 | 3300005455 | Bacteria | 1989 |
| 73 | Ga0070663_100119880 | 3300005455 | Bacteria | 1986 |
| 74 | Ga0070663_100132313 | 3300005455 | Bacteria | 1895 |
| 75 | Ga0070678_100000061 | 3300005456 | Bacteria | 39817 |
| 76 | Ga0070678_100266111 | 3300005456 | Bacteria | 1444 |
| 77 | Ga0070678_100461315 | 3300005456 | Bacteria | 1114 |
| 78 | Ga0068867_100008795 | 3300005459 | Bacteria | 7130 |
| 79 | Ga0070706_100040530 | 3300005467 | Bacteria | 4299 |
| 80 | Ga0070706_100083639 | 3300005467 | Bacteria | 2957 |
| 81 | Ga0070707_100012429 | 3300005468 | Bacteria | 7951 |
| 82 | Ga0070698_100001201 | 3300005471 | Bacteria | 28730 |
| 83 | Ga0070698_100066428 | 3300005471 | Bacteria | 3630 |
| 84 | Ga0070679_100051372 | 3300005530 | Bacteria | 4106 |
| 85 | Ga0070679_100117806 | 3300005530 | Bacteria | 2641 |
| 86 | Ga0070679_100379427 | 3300005530 | Bacteria | 1360 |
| 87 | Ga0070679_100529802 | 3300005530 | Bacteria | 1122 |
| 88 | Ga0070684_100108603 | 3300005535 | Bacteria | 2486 |
| 89 | Ga0070684_100241191 | 3300005535 | Bacteria | 1651 |
| 90 | Ga0070684_100307367 | 3300005535 | Bacteria | 1456 |
| 91 | Ga0068853_100000950 | 3300005539 | Bacteria | 20343 |
| 92 | Ga0068853_100032218 | 3300005539 | Bacteria | 4439 |
| 93 | Ga0068853_100168374 | 3300005539 | Bacteria | 1981 |
| 94 | Ga0068853_100605557 | 3300005539 | Bacteria | 1041 |
| 95 | Ga0070672_100260079 | 3300005543 | Bacteria | 1463 |
| 96 | Ga0070686_100098808 | 3300005544 | Bacteria | 1968 |
| 97 | Ga0070695_100118508 | 3300005545 | Bacteria | 1808 |
| 98 | Ga0070696_100004064 | 3300005546 | Bacteria | 9756 |
| 99 | Ga0070665_100003972 | 3300005548 | Bacteria | 15589 |
| 100 | Ga0070665_100008318 | 3300005548 | Bacteria | 10494 |
| 101 | Ga0070665_100047716 | 3300005548 | Bacteria | 4298 |
| 102 | Ga0070665_100066715 | 3300005548 | Bacteria | 3610 |
| 103 | Ga0070704_100008843 | 3300005549 | Bacteria | 6061 |
| 104 | Ga0070704_100156561 | 3300005549 | Bacteria | 1797 |
| 105 | Ga0068855_100125375 | 3300005563 | Bacteria | 2936 |
| 106 | Ga0070664_100076835 | 3300005564 | Bacteria | 2870 |
| 107 | Ga0068857_100131939 | 3300005577 | Bacteria | 2253 |
| 108 | Ga0068854_100003941 | 3300005578 | Bacteria | 9302 |
| 109 | Ga0068854_100103759 | 3300005578 | Bacteria | 2135 |
| 110 | Ga0068856_100069718 | 3300005614 | Bacteria | 3477 |
| 111 | Ga0070702_100001059 | 3300005615 | Bacteria | 10974 |
| 112 | Ga0070702_100327176 | 3300005615 | Bacteria | 1070 |
| 113 | Ga0068852_100078126 | 3300005616 | Bacteria | 2928 |
| 114 | Ga0068852_100120735 | 3300005616 | Bacteria | 2399 |
| 115 | Ga0068852_100620758 | 3300005616 | Bacteria | 1087 |
| 116 | Ga0068859_100000542 | 3300005617 | Bacteria | 37422 |
| 117 | Ga0068859_100006779 | 3300005617 | Bacteria | 11635 |
| 118 | Ga0068859_100614276 | 3300005617 | Bacteria | 1180 |
| 119 | Ga0068864_100124452 | 3300005618 | Bacteria | 2309 |
| 120 | Ga0068864_100166572 | 3300005618 | Bacteria | 2007 |
| 121 | Ga0068866_10001389 | 3300005718 | Bacteria | 10436 |
| 122 | Ga0068861_100000122 | 3300005719 | Bacteria | 39876 |
| 123 | Ga0068861_100047044 | 3300005719 | Bacteria | 3255 |
| 124 | Ga0068870_10311905 | 3300005840 | Bacteria | 997 |
| 125 | Ga0068863_100000352 | 3300005841 | Bacteria | 46727 |
| 126 | Ga0068863_100007618 | 3300005841 | Bacteria | 10587 |
| 127 | Ga0068863_100176670 | 3300005841 | Bacteria | 2049 |
| 128 | Ga0068863_100223395 | 3300005841 | Bacteria | 1815 |
| 129 | Ga0068863_100266909 | 3300005841 | Bacteria | 1656 |
| 130 | Ga0068858_100030398 | 3300005842 | Bacteria | 5015 |
| 131 | Ga0068858_100116828 | 3300005842 | Bacteria | 2493 |
| 132 | Ga0068860_100000542 | 3300005843 | Bacteria | 45977 |
| 133 | Ga0068860_100001605 | 3300005843 | Bacteria | 24276 |
| 134 | Ga0068862_100000422 | 3300005844 | Bacteria | 45975 |
| 135 | Ga0068862_100003787 | 3300005844 | Bacteria | 12889 |
| 136 | Ga0081455_10054128 | 3300005937 | Bacteria | 3423 |
| 137 | Ga0081455_10330040 | 3300005937 | Bacteria | 1083 |
| 138 | Ga0081538_10126763 | 3300005981 | Bacteria | 1211 |
| 139 | Ga0081540_1000009 | 3300005983 | Bacteria | 193562 |
| 140 | Ga0070717_10300905 | 3300006028 | Bacteria | 1426 |
| 141 | Ga0075365_10002311 | 3300006038 | Bacteria | 9275 |
| 142 | Ga0075365_10006639 | 3300006038 | Bacteria | 6388 |
| 143 | Ga0075365_10034327 | 3300006038 | Bacteria | 3276 |
| 144 | Ga0075365_10069690 | 3300006038 | Bacteria | 2364 |
| 145 | Ga0075368_10010682 | 3300006042 | Bacteria | 3324 |
| 146 | Ga0075363_100000575 | 3300006048 | Bacteria | 12051 |
| 147 | Ga0075363_100001506 | 3300006048 | Bacteria | 8895 |
| 148 | Ga0075363_100003105 | 3300006048 | Bacteria | 6970 |
| 149 | Ga0075363_100083952 | 3300006048 | Bacteria | 1746 |
| 150 | Ga0075363_100088045 | 3300006048 | Bacteria | 1706 |
| 151 | Ga0075363_100102255 | 3300006048 | Bacteria | 1587 |
| 152 | Ga0075363_100218048 | 3300006048 | Bacteria | 1093 |
| 153 | Ga0075364_10007282 | 3300006051 | Bacteria | 6564 |
| 154 | Ga0075364_10010478 | 3300006051 | Bacteria | 5600 |
| 155 | Ga0075364_10018608 | 3300006051 | Bacteria | 4351 |
| 156 | Ga0075364_10020437 | 3300006051 | Bacteria | 4164 |
| 157 | Ga0075364_10025330 | 3300006051 | Bacteria | 3775 |
| 158 | Ga0075364_10026875 | 3300006051 | Bacteria | 3674 |
| 159 | Ga0075364_10056886 | 3300006051 | Bacteria | 2561 |
| 160 | Ga0075364_10105487 | 3300006051 | Bacteria | 1877 |
| 161 | Ga0075364_10150446 | 3300006051 | Bacteria | 1569 |
| 162 | Ga0075364_10184613 | 3300006051 | Bacteria | 1412 |
| 163 | Ga0070715_10070379 | 3300006163 | Bacteria | 1561 |
| 164 | Ga0070716_100182027 | 3300006173 | Bacteria | 1380 |
| 165 | Ga0070716_100208374 | 3300006173 | Bacteria | 1304 |
| 166 | Ga0070716_100221822 | 3300006173 | Bacteria | 1271 |
| 167 | Ga0070716_100390296 | 3300006173 | Bacteria | 998 |
| 168 | Ga0070712_100002266 | 3300006175 | Bacteria | 11843 |
| 169 | Ga0070712_100003385 | 3300006175 | Bacteria | 9809 |
| 170 | Ga0070712_100067471 | 3300006175 | Bacteria | 2545 |
| 171 | Ga0075367_10044122 | 3300006178 | Bacteria | 2612 |
| 172 | Ga0075367_10053000 | 3300006178 | Bacteria | 2403 |
| 173 | Ga0075369_10000575 | 3300006186 | Bacteria | 11600 |
| 174 | Ga0075369_10017701 | 3300006186 | Bacteria | 2893 |
| 175 | Ga0075369_10028499 | 3300006186 | Bacteria | 2341 |
| 176 | Ga0075369_10038689 | 3300006186 | Bacteria | 2036 |
| 177 | Ga0075369_10044797 | 3300006186 | Bacteria | 1901 |
| 178 | Ga0075369_10057658 | 3300006186 | Bacteria | 1690 |
| 179 | Ga0075370_10000287 | 3300006353 | Bacteria | 18091 |
| 180 | Ga0075370_10007884 | 3300006353 | Bacteria | 5448 |
| 181 | Ga0075370_10046679 | 3300006353 | Bacteria | 2452 |
| 182 | Ga0075370_10114042 | 3300006353 | Bacteria | 1570 |
| 183 | Ga0075428_100025753 | 3300006844 | Bacteria | 6515 |
| 184 | Ga0075428_100062477 | 3300006844 | Bacteria | 4077 |
| 185 | Ga0075430_100077042 | 3300006846 | Bacteria | 2795 |
| 186 | Ga0075430_100079496 | 3300006846 | Bacteria | 2748 |
| 187 | Ga0075430_100152002 | 3300006846 | Bacteria | 1927 |
| 188 | Ga0075431_100008579 | 3300006847 | Bacteria | 10232 |
| 189 | Ga0075431_100044970 | 3300006847 | Bacteria | 4552 |
| 190 | Ga0075434_100393054 | 3300006871 | Bacteria | 1407 |
| 191 | Ga0068865_100134110 | 3300006881 | Bacteria | 1858 |
| 192 | Ga0068865_100145768 | 3300006881 | Bacteria | 1790 |
| 193 | Ga0097620_100000542 | 3300006931 | Bacteria | 37422 |
| 194 | Ga0097620_100006779 | 3300006931 | Bacteria | 11635 |
| 195 | Ga0097620_100614312 | 3300006931 | Bacteria | 1180 |
| 196 | Ga0105250_10063163 | 3300009092 | Bacteria | 1490 |
| 197 | Ga0105240_10229594 | 3300009093 | Bacteria | 2158 |
| 198 | Ga0105240_10629624 | 3300009093 | Bacteria | 1178 |
| 199 | Ga0111539_10706926 | 3300009094 | Bacteria | 1173 |
| 200 | Ga0105245_10003195 | 3300009098 | Bacteria | 14659 |
| 201 | Ga0105245_10163986 | 3300009098 | Bacteria | 2111 |
| 202 | Ga0105247_10000058 | 3300009101 | Bacteria | 131442 |
| 203 | Ga0105247_10000456 | 3300009101 | Bacteria | 34514 |
| 204 | Ga0105247_10090669 | 3300009101 | Bacteria | 1940 |
| 205 | Ga0105247_10202802 | 3300009101 | Bacteria | 1334 |
| 206 | Ga0114129_10005311 | 3300009147 | Bacteria | 18176 |
| 207 | Ga0114129_10022769 | 3300009147 | Bacteria | 8884 |
| 208 | Ga0114129_10129234 | 3300009147 | Bacteria | 3472 |
| 209 | Ga0105241_10010121 | 3300009174 | Bacteria | 6924 |
| 210 | Ga0105242_10013523 | 3300009176 | Bacteria | 6312 |
| 211 | Ga0105248_10000465 | 3300009177 | Bacteria | 46197 |
| 212 | Ga0105248_10007739 | 3300009177 | Bacteria | 11797 |
| 213 | Ga0105248_10060085 | 3300009177 | Bacteria | 4267 |
| 214 | Ga0105237_10000346 | 3300009545 | Bacteria | 65318 |
| 215 | Ga0105237_10282367 | 3300009545 | Bacteria | 1663 |
| 216 | Ga0105249_10000087 | 3300009553 | Bacteria | 131590 |
| 217 | Ga0105249_10061472 | 3300009553 | Bacteria | 3447 |
| 218 | Ga0105249_10362262 | 3300009553 | Bacteria | 1472 |
| 219 | Ga0099796_10023707 | 3300010159 | Bacteria | 1919 |
| 220 | Ga0105239_10006651 | 3300010375 | Bacteria | 13378 |
| 221 | Ga0105239_10008590 | 3300010375 | Bacteria | 11583 |
| 222 | Ga0105239_10203058 | 3300010375 | Bacteria | 2221 |
| 223 | Ga0105239_10533218 | 3300010375 | Bacteria | 1336 |
| 224 | Ga0105246_10081852 | 3300011119 | Bacteria | 2303 |
| 225 | Ga0157320_1001111 | 3300012481 | Bacteria | 1291 |
| 226 | Ga0157337_1000560 | 3300012483 | Bacteria | 1740 |
| 227 | Ga0157325_1000878 | 3300012485 | Bacteria | 1267 |
| 228 | Ga0157343_1002179 | 3300012488 | Bacteria | 1046 |
| 229 | Ga0157324_1001796 | 3300012506 | Bacteria | 1234 |
| 230 | Ga0157342_1002632 | 3300012507 | Bacteria | 1475 |
| 231 | Ga0157373_10066671 | 3300013100 | Bacteria | 2546 |
| 232 | Ga0157370_10162352 | 3300013104 | Bacteria | 2079 |
| 233 | Ga0157370_10378440 | 3300013104 | Bacteria | 1304 |
| 234 | Ga0157369_10080943 | 3300013105 | Bacteria | 3476 |
| 235 | Ga0157369_10085162 | 3300013105 | Bacteria | 3378 |
| 236 | Ga0157374_10002901 | 3300013296 | Bacteria | 14368 |
| 237 | Ga0157378_10001141 | 3300013297 | Bacteria | 24154 |
| 238 | Ga0163162_10002035 | 3300013306 | Bacteria | 19024 |
| 239 | Ga0163162_10196156 | 3300013306 | Bacteria | 2148 |
| 240 | Ga0163162_10256413 | 3300013306 | Bacteria | 1881 |
| 241 | Ga0163162_10318504 | 3300013306 | Bacteria | 1688 |
| 242 | Ga0157372_10002481 | 3300013307 | Bacteria | 19997 |
| 243 | Ga0157375_10001315 | 3300013308 | Bacteria | 21408 |
| 244 | Ga0157375_10300101 | 3300013308 | Bacteria | 1770 |
| 245 | Ga0163163_10012227 | 3300014325 | Bacteria | 7813 |
| 246 | Ga0163163_10069609 | 3300014325 | Bacteria | 3503 |
| 247 | Ga0157380_10010801 | 3300014326 | Bacteria | 6582 |
| 248 | Ga0157380_10078474 | 3300014326 | Bacteria | 2694 |
| 249 | Ga0157380_10345549 | 3300014326 | Bacteria | 1390 |
| 250 | Ga0157377_10086006 | 3300014745 | Bacteria | 1847 |
| 251 | Ga0157379_10078582 | 3300014968 | Bacteria | 2955 |
| 252 | Ga0157379_10256357 | 3300014968 | Bacteria | 1589 |
| 253 | Ga0157379_10598719 | 3300014968 | Bacteria | 1029 |
| 254 | Ga0157376_10418342 | 3300014969 | Bacteria | 1300 |
| 255 | Ga0163161_10008010 | 3300017792 | Bacteria | 7307 |
| 256 | Ga0163161_10235268 | 3300017792 | Bacteria | 1423 |
| 257 | Ga0206356_10810878 | 3300020070 | Bacteria | 2156 |
| 258 | Ga0206350_11663349 | 3300020080 | Bacteria | 1862 |
| 259 | Ga0206354_10912145 | 3300020081 | Bacteria | 2929 |
| 260 | Ga0206353_10272952 | 3300020082 | Bacteria | 2341 |
| 261 | Ga0206353_10728243 | 3300020082 | Bacteria | 2083 |
| 262 | Ga0206353_10730323 | 3300020082 | Bacteria | 1924 |
| 263 | Ga0213876_10003290 | 3300021384 | Bacteria | 9273 |
| 264 | Ga0213876_10079654 | 3300021384 | Bacteria | 1731 |
| 265 | Ga0213876_10101977 | 3300021384 | Bacteria | 1521 |
| 266 | Ga0213876_10162039 | 3300021384 | Bacteria | 1190 |
| 267 | Ga0213875_10002694 | 3300021388 | Bacteria | 10486 |
| 268 | Ga0213875_10120299 | 3300021388 | Bacteria | 1227 |
| 269 | Ga0213875_10133357 | 3300021388 | Bacteria | 1161 |
| 270 | Ga0224712_10074188 | 3300022467 | Bacteria | 1389 |
| 271 | Ga0228598_1008297 | 3300024227 | Bacteria | 2101 |
| 272 | Ga0209051_1000374 | 3300025303 | Bacteria | 64311 |
| 273 | Ga0209051_1001633 | 3300025303 | Bacteria | 18182 |
| 274 | Ga0209051_1010559 | 3300025303 | Bacteria | 4646 |
| 275 | Ga0209051_1014037 | 3300025303 | Bacteria | 3765 |
| 276 | Ga0207692_10002728 | 3300025898 | Bacteria | 6814 |
| 277 | Ga0207692_10045226 | 3300025898 | Bacteria | 2201 |
| 278 | Ga0207692_10099818 | 3300025898 | Bacteria | 1591 |
| 279 | Ga0207692_10171875 | 3300025898 | Bacteria | 1256 |
| 280 | Ga0207642_10000428 | 3300025899 | Bacteria | 12682 |
| 281 | Ga0207710_10000085 | 3300025900 | Bacteria | 131447 |
| 282 | Ga0207710_10002660 | 3300025900 | Bacteria | 8233 |
| 283 | Ga0207688_10000504 | 3300025901 | Bacteria | 18809 |
| 284 | Ga0207688_10091412 | 3300025901 | Bacteria | 1748 |
| 285 | Ga0207680_10059263 | 3300025903 | Bacteria | 2324 |
| 286 | Ga0207647_10043111 | 3300025904 | Bacteria | 2825 |
| 287 | Ga0207647_10082703 | 3300025904 | Bacteria | 1923 |
| 288 | Ga0207699_10003180 | 3300025906 | Bacteria | 7813 |
| 289 | Ga0207699_10009261 | 3300025906 | Bacteria | 4895 |
| 290 | Ga0207699_10019000 | 3300025906 | Bacteria | 3654 |
| 291 | Ga0207699_10147453 | 3300025906 | Bacteria | 1553 |
| 292 | Ga0207699_10324694 | 3300025906 | Bacteria | 1081 |
| 293 | Ga0207645_10006092 | 3300025907 | Bacteria | 8671 |
| 294 | Ga0207645_10305810 | 3300025907 | Bacteria | 1059 |
| 295 | Ga0207643_10007955 | 3300025908 | Bacteria | 5689 |
| 296 | Ga0207705_10210219 | 3300025909 | Bacteria | 1476 |
| 297 | Ga0207705_10214350 | 3300025909 | Bacteria | 1461 |
| 298 | Ga0207684_10071576 | 3300025910 | Bacteria | 2946 |
| 299 | Ga0207684_10079001 | 3300025910 | Bacteria | 2799 |
| 300 | Ga0207707_10007438 | 3300025912 | Bacteria | 9542 |
| 301 | Ga0207707_10318444 | 3300025912 | Bacteria | 1343 |
| 302 | Ga0207671_10010010 | 3300025914 | Bacteria | 7867 |
| 303 | Ga0207671_10417212 | 3300025914 | Bacteria | 1068 |
| 304 | Ga0207693_10000189 | 3300025915 | Bacteria | 56358 |
| 305 | Ga0207693_10000743 | 3300025915 | Bacteria | 29363 |
| 306 | Ga0207693_10020666 | 3300025915 | Bacteria | 5235 |
| 307 | Ga0207693_10041360 | 3300025915 | Bacteria | 3628 |
| 308 | Ga0207663_10006285 | 3300025916 | Bacteria | 6065 |
| 309 | Ga0207663_10055689 | 3300025916 | Bacteria | 2483 |
| 310 | Ga0207663_10111286 | 3300025916 | Bacteria | 1858 |
| 311 | Ga0207663_10408253 | 3300025916 | Bacteria | 1040 |
| 312 | Ga0207663_10455504 | 3300025916 | Bacteria | 987 |
| 313 | Ga0207662_10322918 | 3300025918 | Bacteria | 1031 |
| 314 | Ga0207657_10022671 | 3300025919 | Bacteria | 5868 |
| 315 | Ga0207657_10072884 | 3300025919 | Bacteria | 2904 |
| 316 | Ga0207657_10175928 | 3300025919 | Bacteria | 1732 |
| 317 | Ga0207657_10178552 | 3300025919 | Bacteria | 1717 |
| 318 | Ga0207652_10357253 | 3300025921 | Bacteria | 1319 |
| 319 | Ga0207646_10042204 | 3300025922 | Bacteria | 4099 |
| 320 | Ga0207646_10415267 | 3300025922 | Bacteria | 1215 |
| 321 | Ga0207681_10001891 | 3300025923 | Bacteria | 13394 |
| 322 | Ga0207681_10017104 | 3300025923 | Bacteria | 4549 |
| 323 | Ga0207659_10116885 | 3300025926 | Bacteria | 2037 |
| 324 | Ga0207687_10004168 | 3300025927 | Bacteria | 9682 |
| 325 | Ga0207700_10009342 | 3300025928 | Bacteria | 6120 |
| 326 | Ga0207700_10013024 | 3300025928 | Bacteria | 5392 |
| 327 | Ga0207700_10016756 | 3300025928 | Bacteria | 4878 |
| 328 | Ga0207700_10019742 | 3300025928 | Bacteria | 4558 |
| 329 | Ga0207700_10126873 | 3300025928 | Bacteria | 2077 |
| 330 | Ga0207700_10237475 | 3300025928 | Bacteria | 1552 |
| 331 | Ga0207664_10001128 | 3300025929 | Bacteria | 17796 |
| 332 | Ga0207664_10006033 | 3300025929 | Bacteria | 8297 |
| 333 | Ga0207664_10019807 | 3300025929 | Bacteria | 4979 |
| 334 | Ga0207664_10043434 | 3300025929 | Bacteria | 3515 |
| 335 | Ga0207664_10082344 | 3300025929 | Bacteria | 2621 |
| 336 | Ga0207664_10272283 | 3300025929 | Bacteria | 1484 |
| 337 | Ga0207644_10126237 | 3300025931 | Bacteria | 1953 |
| 338 | Ga0207690_10061846 | 3300025932 | Bacteria | 2547 |
| 339 | Ga0207690_10092039 | 3300025932 | Bacteria | 2145 |
| 340 | Ga0207690_10229092 | 3300025932 | Bacteria | 1425 |
| 341 | Ga0207706_10001089 | 3300025933 | Bacteria | 27567 |
| 342 | Ga0207706_10022821 | 3300025933 | Bacteria | 5614 |
| 343 | Ga0207706_10031536 | 3300025933 | Bacteria | 4721 |
| 344 | Ga0207686_10014685 | 3300025934 | Bacteria | 4366 |
| 345 | Ga0207670_10031218 | 3300025936 | Bacteria | 3411 |
| 346 | Ga0207670_10433663 | 3300025936 | Bacteria | 1057 |
| 347 | Ga0207669_10001764 | 3300025937 | Bacteria | 9183 |
| 348 | Ga0207704_10002051 | 3300025938 | Bacteria | 9014 |
| 349 | Ga0207704_10095565 | 3300025938 | Bacteria | 1965 |
| 350 | Ga0207704_10131259 | 3300025938 | Bacteria | 1735 |
| 351 | Ga0207665_10001533 | 3300025939 | Bacteria | 15547 |
| 352 | Ga0207665_10010016 | 3300025939 | Bacteria | 6224 |
| 353 | Ga0207665_10037081 | 3300025939 | Bacteria | 3243 |
| 354 | Ga0207665_10158823 | 3300025939 | Bacteria | 1625 |
| 355 | Ga0207665_10365146 | 3300025939 | Bacteria | 1092 |
| 356 | Ga0207691_10039908 | 3300025940 | Bacteria | 4341 |
| 357 | Ga0207711_10000071 | 3300025941 | Bacteria | 112825 |
| 358 | Ga0207711_10084560 | 3300025941 | Bacteria | 2777 |
| 359 | Ga0207689_10001274 | 3300025942 | Bacteria | 24296 |
| 360 | Ga0207651_10155507 | 3300025960 | Bacteria | 1786 |
| 361 | Ga0207651_10471971 | 3300025960 | Bacteria | 1080 |
| 362 | Ga0207712_10000040 | 3300025961 | Bacteria | 180255 |
| 363 | Ga0207668_10000208 | 3300025972 | Bacteria | 39588 |
| 364 | Ga0207668_10001301 | 3300025972 | Bacteria | 14828 |
| 365 | Ga0207668_10171930 | 3300025972 | Bacteria | 1700 |
| 366 | Ga0207640_10002912 | 3300025981 | Bacteria | 9192 |
| 367 | Ga0207658_10000121 | 3300025986 | Bacteria | 84805 |
| 368 | Ga0207658_10014319 | 3300025986 | Bacteria | 5431 |
| 369 | Ga0207677_10000688 | 3300026023 | Bacteria | 20006 |
| 370 | Ga0207677_10064885 | 3300026023 | Bacteria | 2545 |
| 371 | Ga0207703_10083706 | 3300026035 | Bacteria | 2666 |
| 372 | Ga0207703_10265569 | 3300026035 | Bacteria | 1553 |
| 373 | Ga0207639_10001989 | 3300026041 | Bacteria | 13757 |
| 374 | Ga0207639_10019463 | 3300026041 | Bacteria | 4842 |
| 375 | Ga0207639_10219188 | 3300026041 | Bacteria | 1642 |
| 376 | Ga0207678_10022754 | 3300026067 | Bacteria | 5488 |
| 377 | Ga0207678_10029966 | 3300026067 | Bacteria | 4750 |
| 378 | Ga0207678_10036534 | 3300026067 | Bacteria | 4276 |
| 379 | Ga0207678_10179167 | 3300026067 | Bacteria | 1810 |
| 380 | Ga0207678_10254511 | 3300026067 | Bacteria | 1504 |
| 381 | Ga0207678_10296461 | 3300026067 | Bacteria | 1389 |
| 382 | Ga0207708_10025321 | 3300026075 | Bacteria | 4488 |
| 383 | Ga0207708_10096973 | 3300026075 | Bacteria | 2279 |
| 384 | Ga0207702_10005527 | 3300026078 | Bacteria | 11045 |
| 385 | Ga0207702_10328063 | 3300026078 | Bacteria | 1459 |
| 386 | Ga0207641_10000485 | 3300026088 | Bacteria | 44793 |
| 387 | Ga0207641_10001669 | 3300026088 | Bacteria | 21601 |
| 388 | Ga0207641_10210463 | 3300026088 | Bacteria | 1798 |
| 389 | Ga0207641_10255848 | 3300026088 | Bacteria | 1637 |
| 390 | Ga0207648_10011780 | 3300026089 | Bacteria | 8218 |
| 391 | Ga0207648_10369689 | 3300026089 | Bacteria | 1295 |
| 392 | Ga0207676_10097556 | 3300026095 | Bacteria | 2428 |
| 393 | Ga0207676_10107838 | 3300026095 | Bacteria | 2324 |
| 394 | Ga0207676_10335546 | 3300026095 | Bacteria | 1393 |
| 395 | Ga0207674_10020822 | 3300026116 | Bacteria | 7079 |
| 396 | Ga0207674_10086649 | 3300026116 | Bacteria | 3126 |
| 397 | Ga0207675_100000325 | 3300026118 | Bacteria | 45410 |
| 398 | Ga0207675_100050760 | 3300026118 | Bacteria | 3871 |
| 399 | Ga0207675_100108396 | 3300026118 | Bacteria | 2619 |
| 400 | Ga0207675_100566335 | 3300026118 | Bacteria | 1136 |
| 401 | Ga0207675_100813110 | 3300026118 | Bacteria | 948 |
| 402 | Ga0207683_10001450 | 3300026121 | Bacteria | 21423 |
| 403 | Ga0207683_10002228 | 3300026121 | Bacteria | 17053 |
| 404 | Ga0207698_10082268 | 3300026142 | Bacteria | 2602 |
| 405 | Ga0207698_10179610 | 3300026142 | Bacteria | 1873 |
| 406 | Ga0207698_10191376 | 3300026142 | Bacteria | 1823 |
| 407 | Ga0207698_10528392 | 3300026142 | Bacteria | 1152 |
| 408 | Ga0209813_10031716 | 3300027866 | Bacteria | 1561 |
| 409 | Ga0268266_10004980 | 3300028379 | Bacteria | 12563 |
| 410 | Ga0268266_10005247 | 3300028379 | Bacteria | 12167 |
| 411 | Ga0268266_10031978 | 3300028379 | Bacteria | 4471 |
| 412 | Ga0268265_10000004 | 3300028380 | Bacteria | 648376 |
| 413 | Ga0268265_10010963 | 3300028380 | Bacteria | 6121 |
| 414 | Ga0268264_10000133 | 3300028381 | Bacteria | 179929 |
| 415 | Ga0268264_10012339 | 3300028381 | Bacteria | 7034 |
| 416 | Ga0268264_10472293 | 3300028381 | Bacteria | 1218 |
| 417 | Ga0265337_1002649 | 3300028556 | Bacteria | 8061 |
| 418 | Ga0265319_1023792 | 3300028563 | Bacteria | 2214 |
| 419 | Ga0265334_10000870 | 3300028573 | Bacteria | 15120 |
| 420 | Ga0265318_10028794 | 3300028577 | Bacteria | 2169 |
| 421 | Ga0265323_10001759 | 3300028653 | Bacteria | 10286 |
| 422 | Ga0265322_10003925 | 3300028654 | Bacteria | 4456 |
| 423 | Ga0265336_10010405 | 3300028666 | Bacteria | 3184 |
| 424 | Ga0265338_10001142 | 3300028800 | Bacteria | 43907 |
| 425 | Ga0265338_10009484 | 3300028800 | Bacteria | 11596 |
| 426 | Ga0265338_10181845 | 3300028800 | Bacteria | 1602 |
| 427 | Ga0265338_10306689 | 3300028800 | Bacteria | 1152 |
| 428 | Ga0265324_10000666 | 3300029957 | Bacteria | 23164 |
| 429 | Ga0265332_10001385 | 3300031238 | Bacteria | 13659 |
| 430 | Ga0265325_10014436 | 3300031241 | Bacteria | 4464 |
| 431 | Ga0265329_10065381 | 3300031242 | Bacteria | 1151 |
| 432 | Ga0265340_10087533 | 3300031247 | Bacteria | 1459 |
| 433 | Ga0265339_10045029 | 3300031249 | Bacteria | 2430 |
| 434 | Ga0265314_10007872 | 3300031711 | Bacteria | 9197 |
| 435 | Ga0265342_10001467 | 3300031712 | Bacteria | 21941 |
| 436 | Ga0307405_10117105 | 3300031731 | Bacteria | 1816 |
| 437 | Ga0307413_10110240 | 3300031824 | Bacteria | 1841 |
| 438 | Ga0307410_10280110 | 3300031852 | Bacteria | 1308 |
| 439 | Ga0307416_100105520 | 3300032002 | Bacteria | 2467 |
| 440 | Ga0307416_100682247 | 3300032002 | Bacteria | 1115 |
| 441 | Ga0307415_100089643 | 3300032126 | Bacteria | 2222 |
| 442 | Ga0307415_100239283 | 3300032126 | Bacteria | 1467 |
| 443 | Ga0373926_0000765 | 3300035083 | Bacteria | 9006 |
| 444 | Ga0373934_0009621 | 3300035086 | Bacteria | 3623 |
| 445 | Ga0373923_0001164 | 3300035111 | Bacteria | 7315 |
| 446 | Ga0373936_0013060 | 3300035113 | Bacteria | 3167 |
| 447 | Ga0373936_0049067 | 3300035113 | Bacteria | 1705 |
| 448 | Ga0373953_0032669 | 3300035117 | Bacteria | 2031 |
| 449 | Ga0373954_0017440 | 3300035118 | Bacteria | 3225 |
| 450 | Ga0373956_0003365 | 3300035119 | Bacteria | 6439 |
| 451 | Ga0373956_0052379 | 3300035119 | Bacteria | 1835 |
| 452 | Ga0373956_0162917 | 3300035119 | Bacteria | 1051 |
| 453 | Ga0373943_0002009 | 3300035170 | Bacteria | 9214 |
| 454 | Ga0373946_0000515 | 3300035171 | Bacteria | 12831 |
| 455 | Ga0373942_0020308 | 3300035207 | Bacteria | 1667 |
| 456 | Ga0373931_0009215 | 3300035691 | Bacteria | 4714 |
| 457 | Ga0373931_0033382 | 3300035691 | Bacteria | 2667 |
| 458 | Ga0373931_0110279 | 3300035691 | Bacteria | 1560 |
| 459 | Ga0373935_0000488 | 3300035692 | Bacteria | 20506 |
| 460 | Ga0373935_0039125 | 3300035692 | Bacteria | 2972 |
| 461 | Ga0373933_0018935 | 3300035724 | Bacteria | 3878 |
| 462 | Ga0373947_0000113 | 3300035725 | Bacteria | 40170 |
| 463 | Ga0373937_0012529 | 3300036401 | Bacteria | 7460 |
| 464 | Ga0373937_0128069 | 3300036401 | Bacteria | 2369 |
| 465 | Ga0373937_0536088 | 3300036401 | Bacteria | 1112 |
| 466 | Ga0372808_011090 | 3300036459 | Bacteria | 1273 |
| 467 | Ga0373925_0000384 | 3300037068 | Bacteria | 45543 |
| 468 | Ga0373925_0012546 | 3300037068 | Bacteria | 6140 |
| 469 | Ga0373925_0166408 | 3300037068 | Bacteria | 1739 |
| 470 | Ga0395899_0003096 | 3300037312 | Bacteria | 13237 |
| 471 | Ga0395898_0019127 | 3300037466 | Bacteria | 6974 |
| 472 | Ga0436364_0166036 | 3300037853 | Bacteria | 1699 |
| 473 | Ga0436364_0256774 | 3300037853 | Bacteria | 34884 |
| 474 | Ga0436364_0321419 | 3300037853 | Bacteria | 2008 |
| 475 | Ga0436364_0542227 | 3300037853 | Bacteria | 5024 |
| 476 | Ga0436364_0577957 | 3300037853 | Bacteria | 4656 |
| 477 | Ga0436364_0584067 | 3300037853 | Bacteria | 157477 |
| 478 | Ga0436364_0976891 | 3300037853 | Bacteria | 1862 |
| 479 | Ga0436364_1179018 | 3300037853 | Bacteria | 9173 |
| 480 | Ga0436365_0792290 | 3300039437 | Bacteria | 4040 |
| 481 | Ga0436365_1378611 | 3300039437 | Bacteria | 178407 |
| 482 | Ga0436365_1417225 | 3300039437 | Bacteria | 6842 |
| 483 | Ga0436365_1640827 | 3300039437 | Bacteria | 22352 |
| 484 | Ga0436360_1375602 | 3300039438 | Bacteria | 1647 |
| 485 | Ga0436361_1011110 | 3300039447 | Bacteria | 1436 |
| 486 | Ga0436361_1177073 | 3300039447 | Bacteria | 862 |
| 487 | Ga0436363_0109061 | 3300039450 | Bacteria | 1536 |
| 488 | Ga0436363_0781631 | 3300039450 | Bacteria | 5117 |
| 489 | Ga0436363_1124457 | 3300039450 | Bacteria | 898 |
| 490 | Ga0439466_0020266 | 3300041411 | Bacteria | 2370 |
| 491 | Ga0439466_0034855 | 3300041411 | Bacteria | 1704 |
| 492 | Ga0439466_0047681 | 3300041411 | Bacteria | 1411 |
| 493 | Ga0439465_0003626 | 3300041413 | Bacteria | 5038 |
| 494 | Ga0439465_0012682 | 3300041413 | Bacteria | 2636 |
| 495 | Ga0439465_0017398 | 3300041413 | Bacteria | 2244 |
| 496 | Ga0439465_0018610 | 3300041413 | Bacteria | 2170 |
| 497 | Ga0439465_0120449 | 3300041413 | Bacteria | 920 |
| 498 | Ga0451853_3968863 | 3300041512 | Bacteria | 1310 |
| 499 | Ga0439431_0000223 | 3300041997 | Bacteria | 11496 |
| 500 | Ga0439442_031735 | 3300042002 | Bacteria | 1104 |
| 501 | Ga0439434_0002239 | 3300042435 | Bacteria | 5611 |
| 502 | Ga0439434_0008604 | 3300042435 | Bacteria | 2995 |
| 503 | Ga0466969_0015046 | 3300044656 | Bacteria | 4058 |
| 504 | Ga0466972_0009068 | 3300044658 | Bacteria | 4996 |
| 505 | Ga0466972_0012833 | 3300044658 | Bacteria | 4208 |
| 506 | Ga0466972_0022560 | 3300044658 | Bacteria | 3133 |
| 507 | Ga0466965_0006718 | 3300044683 | Bacteria | 5248 |
| 508 | Ga0466965_0284599 | 3300044683 | Bacteria | 894 |
| 509 | Ga0466966_0015855 | 3300044684 | Bacteria | 4980 |
| 510 | Ga0466966_0026947 | 3300044684 | Bacteria | 3748 |
| 511 | Ga0466961_0007565 | 3300044693 | Bacteria | 6916 |
| 512 | Ga0466961_0034568 | 3300044693 | Bacteria | 3245 |
| 513 | Ga0466963_0066894 | 3300044694 | Bacteria | 2411 |
| 514 | Ga0466964_0153453 | 3300044706 | Bacteria | 1070 |
| 515 | Ga0466971_0009900 | 3300044719 | Bacteria | 4163 |
| 516 | Ga0466971_0031204 | 3300044719 | Bacteria | 2386 |
| 517 | Ga0466971_0059790 | 3300044719 | Bacteria | 1722 |
| 518 | Ga0466968_0000170 | 3300044735 | Bacteria | 19904 |
| 519 | Ga0466968_0009892 | 3300044735 | Bacteria | 3681 |
| 520 | Ga0466968_0021214 | 3300044735 | Bacteria | 2629 |
| 521 | Ga0466968_0044145 | 3300044735 | Bacteria | 1889 |
| 522 | Ga0466970_0023560 | 3300044765 | Bacteria | 3215 |
| 523 | Ga0466970_0063050 | 3300044765 | Bacteria | 1987 |
| 524 | Ga0466970_0132124 | 3300044765 | Bacteria | 1372 |
| 525 | Ga0466957_0004576 | 3300044842 | Bacteria | 7727 |
| 526 | Ga0466957_0023286 | 3300044842 | Bacteria | 3660 |
| 527 | Ga0466960_0000215 | 3300044901 | Bacteria | 19879 |
| 528 | Ga0466960_0000976 | 3300044901 | Bacteria | 10169 |
| 529 | Ga0466960_0002924 | 3300044901 | Bacteria | 6502 |
| 530 | Ga0466959_0011763 | 3300045049 | Bacteria | 6300 |
| 531 | Ga0466959_0030379 | 3300045049 | Bacteria | 4000 |
| 532 | Ga0466959_0061259 | 3300045049 | Bacteria | 2736 |
| 533 | Ga0466959_0108279 | 3300045049 | Bacteria | 1985 |
| 534 | Ga0466959_0113975 | 3300045049 | Bacteria | 1927 |
| 535 | Ga0466958_0008792 | 3300045836 | Bacteria | 5608 |
| 536 | Ga0466958_0009085 | 3300045836 | Bacteria | 5523 |
| 537 | Ga0466958_0073046 | 3300045836 | Bacteria | 2101 |
| 538 | Ga0466958_0138118 | 3300045836 | Bacteria | 1534 |
| 539 | Ga0466958_0331143 | 3300045836 | Bacteria | 979 |
| 540 | Ga0466967_0020224 | 3300045976 | Bacteria | 5374 |
| 541 | Ga0466967_0029940 | 3300045976 | Bacteria | 4562 |
| 542 | Ga0466967_0053479 | 3300045976 | Bacteria | 3549 |
| 543 | Ga0466967_0087163 | 3300045976 | Bacteria | 2830 |
| 544 | Ga0466967_0105439 | 3300045976 | Bacteria | 2582 |
| 545 | Ga0466967_0136917 | 3300045976 | Bacteria | 2278 |
| 546 | Ga0466967_0190816 | 3300045976 | Bacteria | 1936 |
| 547 | Ga0495592_0113781 | 3300046454 | Bacteria | 1911 |
| 548 | Ga0495603_0003763 | 3300046455 | Bacteria | 9021 |
| 549 | Ga0495629_0002692 | 3300046459 | Bacteria | 13615 |
| 550 | Ga0495629_0064786 | 3300046459 | Bacteria | 2551 |
| 551 | Ga0495638_0006493 | 3300046460 | Bacteria | 8504 |
| 552 | Ga0495651_0040615 | 3300046462 | Bacteria | 3617 |
| 553 | Ga0495653_0125326 | 3300046463 | Bacteria | 1825 |
| 554 | Ga0495580_0026504 | 3300046472 | Bacteria | 4225 |
| 555 | Ga0495582_0000741 | 3300046473 | Bacteria | 18037 |
| 556 | Ga0495639_0002161 | 3300046475 | Bacteria | 8668 |
| 557 | Ga0495639_0016604 | 3300046475 | Bacteria | 3198 |
| 558 | Ga0495664_0013862 | 3300046477 | Bacteria | 4570 |
| 559 | Ga0495664_0156176 | 3300046477 | Bacteria | 1384 |
| 560 | Ga0495606_0001336 | 3300046507 | Bacteria | 33549 |
| 561 | Ga0495606_0119931 | 3300046507 | Bacteria | 1575 |
| 562 | Ga0495608_0021905 | 3300046511 | Bacteria | 4382 |
| 563 | Ga0495608_0050637 | 3300046511 | Bacteria | 2755 |
| 564 | Ga0495628_0011936 | 3300046516 | Bacteria | 7327 |
| 565 | Ga0495630_0010159 | 3300046517 | Bacteria | 6785 |
| 566 | Ga0495630_0058729 | 3300046517 | Bacteria | 2884 |
| 567 | Ga0495630_0327631 | 3300046517 | Bacteria | 1171 |
| 568 | Ga0495648_0001738 | 3300046524 | Bacteria | 21055 |
| 569 | Ga0495666_0002890 | 3300046526 | Bacteria | 8600 |
| 570 | Ga0495652_0456585 | 3300046529 | Bacteria | 893 |
| 571 | Ga0495654_0176126 | 3300046530 | Bacteria | 929 |
| 572 | Ga0495665_0000906 | 3300046531 | Bacteria | 15593 |
| 573 | Ga0495665_0046289 | 3300046531 | Bacteria | 2310 |
| 574 | Ga0495640_0001961 | 3300046533 | Bacteria | 16417 |
| 575 | Ga0495586_0038012 | 3300046535 | Bacteria | 2584 |
| 576 | Ga0495645_0241705 | 3300046543 | Bacteria | 1204 |
| 577 | Ga0495667_0089327 | 3300046559 | Bacteria | 1997 |
| 578 | Ga0495668_0000103 | 3300046616 | Bacteria | 135853 |
| 579 | Ga0495668_0013468 | 3300046616 | Bacteria | 4821 |
| 580 | Ga0495634_0014605 | 3300046642 | Bacteria | 5656 |
| 581 | Ga0495611_0084262 | 3300046648 | Bacteria | 1465 |
| 582 | Ga0495625_0001256 | 3300046660 | Bacteria | 32015 |
| 583 | Ga0495635_0090410 | 3300046663 | Bacteria | 2094 |
| 584 | Ga0495635_0160770 | 3300046663 | Bacteria | 1528 |
| 585 | Ga0495588_0091440 | 3300046674 | Bacteria | 1594 |
| 586 | Ga0495657_0052689 | 3300046675 | Bacteria | 2726 |
| 587 | Ga0495623_0099589 | 3300046679 | Bacteria | 1772 |
| 588 | Ga0495646_0050920 | 3300046680 | Bacteria | 2507 |
| 589 | Ga0495647_0084602 | 3300046681 | Bacteria | 1291 |
| 590 | Ga0495658_0014104 | 3300046683 | Bacteria | 4075 |
| 591 | Ga0495658_0111451 | 3300046683 | Bacteria | 1645 |
| 592 | Ga0495613_0001650 | 3300046689 | Bacteria | 16986 |
| 593 | Ga0495624_0008396 | 3300046690 | Bacteria | 7206 |
| 594 | Ga0495624_0011180 | 3300046690 | Bacteria | 6176 |
| 595 | Ga0495649_0142910 | 3300046694 | Bacteria | 1259 |
| 596 | Ga0495600_0014313 | 3300046809 | Bacteria | 4997 |
| 597 | Ga0495581_0000263 | 3300047315 | Bacteria | 25263 |
| 598 | Ga0495604_0063128 | 3300047317 | Bacteria | 2826 |
| 599 | Ga0495674_0053332 | 3300047319 | Bacteria | 3555 |
| 600 | Ga0495672_0001155 | 3300047320 | Bacteria | 26703 |
| 601 | Ga0495672_0030117 | 3300047320 | Bacteria | 3410 |
| 602 | Ga0495676_0012085 | 3300047321 | Bacteria | 7787 |
| 603 | Ga0495680_0040434 | 3300047322 | Bacteria | 3716 |
| 604 | Ga0495680_0051429 | 3300047322 | Bacteria | 3216 |
| 605 | Ga0495680_0056799 | 3300047322 | Bacteria | 3029 |
| 606 | Ga0495683_0056358 | 3300047323 | Bacteria | 1955 |
| 607 | Ga0495675_0060131 | 3300047444 | Bacteria | 2408 |
| 608 | Ga0495673_0000708 | 3300047469 | Bacteria | 32330 |
| 609 | Ga0495684_0096501 | 3300047471 | Bacteria | 2237 |
| 610 | Ga0495686_0002058 | 3300047472 | Bacteria | 19803 |
| 611 | Ga0495686_0226075 | 3300047472 | Bacteria | 1062 |
| 612 | Ga0495593_0001834 | 3300047673 | Bacteria | 12650 |
| 613 | Ga0495593_0007464 | 3300047673 | Bacteria | 6395 |
| 614 | Ga0495602_0032252 | 3300048088 | Bacteria | 4935 |
| 615 | Ga0495614_0035816 | 3300048089 | Bacteria | 2132 |
| 616 | Ga0495626_0000461 | 3300048091 | Bacteria | 41460 |
| 617 | Ga0495626_0024357 | 3300048091 | Bacteria | 2968 |
| 618 | Ga0496100_0010615 | 3300048903 | Bacteria | 5219 |
| 619 | Ga0496100_0041110 | 3300048903 | Bacteria | 2945 |
| 620 | Ga0496100_0056441 | 3300048903 | Bacteria | 2569 |
| 621 | Ga0496100_0057581 | 3300048903 | Bacteria | 2546 |
| 622 | Ga0496100_0161472 | 3300048903 | Bacteria | 1607 |
| 623 | Ga0496100_0400995 | 3300048903 | Bacteria | 1045 |
| 624 | Ga0496100_0413148 | 3300048903 | Bacteria | 1029 |
| 625 | Ga0496101_0000077 | 3300048904 | Bacteria | 109236 |
| 626 | Ga0496101_0009771 | 3300048904 | Bacteria | 6318 |
| 627 | Ga0496101_0015917 | 3300048904 | Bacteria | 5074 |
| 628 | Ga0496101_0021950 | 3300048904 | Bacteria | 4388 |
| 629 | Ga0496101_0061879 | 3300048904 | Bacteria | 2720 |
| 630 | Ga0496101_0092140 | 3300048904 | Bacteria | 2256 |
| 631 | Ga0496101_0215208 | 3300048904 | Bacteria | 1490 |
| 632 | Ga0496101_0353731 | 3300048904 | Bacteria | 1155 |
| 633 | Ga0496102_0000037 | 3300048905 | Bacteria | 199368 |
| 634 | Ga0496102_0000251 | 3300048905 | Bacteria | 70253 |
| 635 | Ga0496102_0003075 | 3300048905 | Bacteria | 14131 |
| 636 | Ga0496102_0063349 | 3300048905 | Bacteria | 3385 |
| 637 | Ga0496102_0113661 | 3300048905 | Bacteria | 2526 |
| 638 | Ga0496102_0153245 | 3300048905 | Bacteria | 2166 |
| 639 | Ga0496102_0383493 | 3300048905 | Bacteria | 1322 |
| 640 | Ga0496102_0442665 | 3300048905 | Bacteria | 1219 |
| 641 | Ga0496103_0000004 | 3300048906 | Bacteria | 510080 |
| 642 | Ga0496103_0000990 | 3300048906 | Bacteria | 20036 |
| 643 | Ga0496103_0004671 | 3300048906 | Bacteria | 8294 |
| 644 | Ga0496103_0036445 | 3300048906 | Bacteria | 3012 |
| 645 | Ga0496104_0029752 | 3300048907 | Bacteria | 5068 |
| 646 | Ga0496104_0051338 | 3300048907 | Bacteria | 3892 |
| 647 | Ga0496104_0164267 | 3300048907 | Bacteria | 2129 |
| 648 | Ga0496104_0281674 | 3300048907 | Bacteria | 1575 |
| 649 | Ga0496104_0537996 | 3300048907 | Bacteria | 1079 |
| 650 | Ga0496105_0001753 | 3300048908 | Bacteria | 15527 |
| 651 | Ga0496105_0159289 | 3300048908 | Bacteria | 1853 |
| 652 | Ga0496106_0001893 | 3300048909 | Bacteria | 15673 |
| 653 | Ga0496106_0003936 | 3300048909 | Bacteria | 11090 |
| 654 | Ga0496106_0116951 | 3300048909 | Bacteria | 2080 |
| 655 | Ga0496106_0219695 | 3300048909 | Bacteria | 1515 |
| 656 | Ga0496106_0317509 | 3300048909 | Bacteria | 1250 |
| 657 | Ga0496106_0508580 | 3300048909 | Bacteria | 967 |
| 658 | Ga0496107_0000516 | 3300048910 | Bacteria | 21498 |
| 659 | Ga0496107_0021871 | 3300048910 | Bacteria | 4519 |
| 660 | Ga0496107_0147240 | 3300048910 | Bacteria | 1741 |
| 661 | Ga0496107_0159872 | 3300048910 | Bacteria | 1669 |
| 662 | Ga0496107_0238751 | 3300048910 | Bacteria | 1352 |
| 663 | Ga0496108_0000985 | 3300048911 | Bacteria | 22155 |
| 664 | Ga0496108_0055065 | 3300048911 | Bacteria | 3339 |
| 665 | Ga0496108_0073165 | 3300048911 | Bacteria | 2894 |
| 666 | Ga0496108_0158340 | 3300048911 | Bacteria | 1956 |
| 667 | Ga0496108_0163421 | 3300048911 | Bacteria | 1925 |
| 668 | Ga0496108_0236535 | 3300048911 | Bacteria | 1589 |
| 669 | Ga0496109_0067923 | 3300048912 | Bacteria | 3266 |
| 670 | Ga0496109_0097485 | 3300048912 | Bacteria | 2725 |
| 671 | Ga0496109_0112964 | 3300048912 | Bacteria | 2526 |
| 672 | Ga0496109_0129241 | 3300048912 | Bacteria | 2357 |
| 673 | Ga0496109_0319740 | 3300048912 | Bacteria | 1464 |
| 674 | Ga0496109_0540610 | 3300048912 | Bacteria | 1099 |
| 675 | Ga0496110_0044929 | 3300048913 | Bacteria | 3859 |
| 676 | Ga0496110_0057528 | 3300048913 | Bacteria | 3423 |
| 677 | Ga0496110_0308811 | 3300048913 | Bacteria | 1441 |
| 678 | Ga0496110_0412740 | 3300048913 | Bacteria | 1231 |
| 679 | Ga0496110_0458166 | 3300048913 | Bacteria | 1162 |
| 680 | Ga0496111_0167342 | 3300048914 | Bacteria | 1633 |
| 681 | Ga0496111_0323264 | 3300048914 | Bacteria | 1143 |
| 682 | Ga0496112_0041223 | 3300048915 | Bacteria | 4516 |
| 683 | Ga0496112_0053869 | 3300048915 | Bacteria | 3952 |
| 684 | Ga0496112_0065270 | 3300048915 | Bacteria | 3593 |
| 685 | Ga0496112_0160339 | 3300048915 | Bacteria | 2216 |
| 686 | Ga0496112_0299157 | 3300048915 | Bacteria | 1555 |
| 687 | Ga0496112_0319794 | 3300048915 | Bacteria | 1496 |
| 688 | Ga0496112_0365714 | 3300048915 | Bacteria | 1384 |
| 689 | Ga0496113_0023349 | 3300048916 | Bacteria | 4385 |
| 690 | Ga0496113_0125046 | 3300048916 | Bacteria | 2013 |
| 691 | Ga0496113_0160315 | 3300048916 | Bacteria | 1778 |
| 692 | Ga0496113_0165649 | 3300048916 | Bacteria | 1749 |
| 693 | Ga0496113_0168979 | 3300048916 | Bacteria | 1731 |
| 694 | Ga0496113_0391404 | 3300048916 | Bacteria | 1116 |
| 695 | Ga0496114_0000849 | 3300048917 | Bacteria | 22880 |
| 696 | Ga0496114_0005631 | 3300048917 | Bacteria | 9828 |
| 697 | Ga0496114_0084856 | 3300048917 | Bacteria | 2682 |
| 698 | Ga0496114_0178200 | 3300048917 | Bacteria | 1855 |
| 699 | Ga0496114_0540680 | 3300048917 | Bacteria | 1030 |
| 700 | Ga0496115_0001951 | 3300048918 | Bacteria | 14718 |
| 701 | Ga0496115_0259022 | 3300048918 | Bacteria | 1431 |
| 702 | Ga0496115_0346325 | 3300048918 | Bacteria | 1212 |
| 703 | Ga0496116_0000056 | 3300048919 | Bacteria | 282554 |
| 704 | Ga0496117_0000003 | 3300048920 | Bacteria | 1881097 |
| 705 | Ga0496117_0002020 | 3300048920 | Bacteria | 26893 |
| 706 | Ga0496117_0033521 | 3300048920 | Bacteria | 3881 |
| 707 | Ga0496117_0260586 | 3300048920 | Bacteria | 940 |
| 708 | Ga0496118_0000001 | 3300048921 | Bacteria | 1881100 |
| 709 | Ga0496118_0032711 | 3300048921 | Bacteria | 4277 |
| 710 | Ga0496118_0034681 | 3300048921 | Bacteria | 4111 |
| 711 | Ga0496119_0034519 | 3300048922 | Bacteria | 3329 |
| 712 | Ga0496119_0040475 | 3300048922 | Bacteria | 2980 |
| 713 | Ga0496119_0171592 | 3300048922 | Bacteria | 1145 |
| 714 | Ga0496120_0006402 | 3300048923 | Bacteria | 9048 |
| 715 | Ga0496120_0019927 | 3300048923 | Bacteria | 4277 |
| 716 | Ga0496120_0049691 | 3300048923 | Bacteria | 2406 |
| 717 | Ga0496121_0019322 | 3300048924 | Bacteria | 6818 |
| 718 | Ga0496122_0001777 | 3300048925 | Bacteria | 33035 |
| 719 | Ga0496122_0004513 | 3300048925 | Bacteria | 17191 |
| 720 | Ga0496122_0007065 | 3300048925 | Bacteria | 12608 |
| 721 | Ga0496123_0001305 | 3300048926 | Bacteria | 35428 |
| 722 | Ga0496123_0005870 | 3300048926 | Bacteria | 12159 |
| 723 | Ga0496124_0005518 | 3300048927 | Bacteria | 14201 |
| 724 | Ga0496124_0090520 | 3300048927 | Bacteria | 2495 |
| 725 | Ga0496125_0000079 | 3300048928 | Bacteria | 230066 |
| 726 | Ga0496125_0011321 | 3300048928 | Bacteria | 8934 |
| 727 | Ga0496125_0088506 | 3300048928 | Bacteria | 2333 |
| 728 | Ga0496125_0093569 | 3300048928 | Bacteria | 2242 |
| 729 | Ga0496126_0000735 | 3300048929 | Bacteria | 59474 |
| 730 | Ga0496126_0014618 | 3300048929 | Bacteria | 7927 |
| 731 | Ga0496126_0015136 | 3300048929 | Bacteria | 7769 |
| 732 | Ga0496126_0015649 | 3300048929 | Bacteria | 7621 |
| 733 | Ga0496126_0024059 | 3300048929 | Bacteria | 5886 |
| 734 | Ga0496126_0045618 | 3300048929 | Bacteria | 4026 |
| 735 | Ga0496126_0119174 | 3300048929 | Bacteria | 2290 |
| 736 | Ga0501032_0056083 | 3300049569 | Bacteria | 2649 |
| 737 | Ga0501032_0060342 | 3300049569 | Bacteria | 2543 |
| 738 | Ga0501032_0182474 | 3300049569 | Bacteria | 1374 |
| 739 | Ga0501033_0026959 | 3300049570 | Bacteria | 4322 |
| 740 | Ga0501033_0154317 | 3300049570 | Bacteria | 1655 |
| 741 | Ga0501034_0002114 | 3300049571 | Bacteria | 24741 |
| 742 | Ga0501034_0055564 | 3300049571 | Bacteria | 3984 |
| 743 | Ga0501034_0084203 | 3300049571 | Bacteria | 3182 |
| 744 | Ga0501034_0187097 | 3300049571 | Bacteria | 2034 |
| 745 | Ga0501034_0345457 | 3300049571 | Bacteria | 1417 |
| 746 | Ga0501034_0404107 | 3300049571 | Bacteria | 1288 |
| 747 | Ga0501036_0104904 | 3300049572 | Bacteria | 2390 |
| 748 | Ga0501037_0001890 | 3300049573 | Bacteria | 15230 |
| 749 | Ga0501037_0014338 | 3300049573 | Bacteria | 5839 |
| 750 | Ga0501038_0008303 | 3300049574 | Bacteria | 9557 |
| 751 | Ga0501039_0000951 | 3300049575 | Bacteria | 21054 |
| 752 | Ga0501043_0001755 | 3300049579 | Bacteria | 18680 |
| 753 | Ga0501043_0004425 | 3300049579 | Bacteria | 11411 |
| 754 | Ga0501043_0070913 | 3300049579 | Bacteria | 2737 |
| 755 | Ga0501043_0137219 | 3300049579 | Bacteria | 1916 |
| 756 | Ga0501043_0272354 | 3300049579 | Bacteria | 1299 |
| 757 | Ga0501046_0005106 | 3300049580 | Bacteria | 11778 |
| 758 | Ga0501046_0008048 | 3300049580 | Bacteria | 9214 |
| 759 | Ga0501047_0001950 | 3300049581 | Bacteria | 19827 |
| 760 | Ga0501047_0117374 | 3300049581 | Bacteria | 2542 |
| 761 | Ga0501047_0164112 | 3300049581 | Bacteria | 2092 |
| 762 | Ga0501047_0176255 | 3300049581 | Bacteria | 2005 |
| 763 | Ga0501047_0476651 | 3300049581 | Bacteria | 1076 |
| 764 | Ga0501047_0558464 | 3300049581 | Bacteria | 969 |
| 765 | Ga0501048_0003785 | 3300049582 | Bacteria | 11546 |
| 766 | Ga0501048_0236494 | 3300049582 | Bacteria | 1296 |
| 767 | Ga0501067_0234043 | 3300049583 | Bacteria | 1022 |
| 768 | Ga0501069_0020740 | 3300049585 | Bacteria | 3564 |
| 769 | Ga0501069_0045295 | 3300049585 | Bacteria | 2437 |
| 770 | Ga0501070_0005284 | 3300049586 | Bacteria | 11015 |
| 771 | Ga0501070_0015755 | 3300049586 | Bacteria | 6357 |
| 772 | Ga0501070_0035570 | 3300049586 | Bacteria | 4161 |
| 773 | Ga0501073_0014064 | 3300049589 | Bacteria | 5814 |
| 774 | Ga0501073_0043339 | 3300049589 | Bacteria | 3173 |
| 775 | Ga0501073_0285305 | 3300049589 | Bacteria | 1139 |
| 776 | Ga0501073_0318809 | 3300049589 | Bacteria | 1073 |
| 777 | Ga0501074_0001629 | 3300049590 | Bacteria | 15213 |
| 778 | Ga0501074_0197163 | 3300049590 | Bacteria | 1435 |
| 779 | Ga0501080_0257036 | 3300049742 | Bacteria | 1592 |
| 780 | Ga0501080_0279676 | 3300049742 | Bacteria | 1517 |
| 781 | Ga0501035_0001031 | 3300049822 | Bacteria | 29291 |
| 782 | Ga0501035_0002606 | 3300049822 | Bacteria | 17611 |
| 783 | Ga0501035_0012495 | 3300049822 | Bacteria | 7845 |
| 784 | Ga0501044_0001769 | 3300049823 | Bacteria | 25264 |
| 785 | Ga0501044_0004936 | 3300049823 | Bacteria | 14917 |
| 786 | Ga0501044_0022732 | 3300049823 | Bacteria | 6677 |
| 787 | Ga0501044_0034133 | 3300049823 | Bacteria | 5340 |
| 788 | Ga0501044_0542799 | 3300049823 | Bacteria | 1060 |
| 789 | nmdc:mga03683_21801_c1 | 3300050489 | Bacteria | 2475 |
| 790 | nmdc:mga03n38_107347_c1 | 3300050490 | Bacteria | 1355 |
| 791 | nmdc:mga03n38_51374_c1 | 3300050490 | Bacteria | 1841 |
| 792 | nmdc:mga03n38_80418_c1 | 3300050490 | Bacteria | 1530 |
| 793 | nmdc:mga00v17_13203_c1 | 3300050491 | Bacteria | 4577 |
| 794 | nmdc:mga00v17_15026_c1 | 3300050491 | Bacteria | 4338 |
| 795 | nmdc:mga00v17_163178_c1 | 3300050491 | Bacteria | 1435 |
| 796 | nmdc:mga00v17_17192_c1 | 3300050491 | Bacteria | 4088 |
| 797 | nmdc:mga00v17_19115_c1 | 3300050491 | Bacteria | 3905 |
| 798 | nmdc:mga00v17_32423_c1 | 3300050491 | Bacteria | 3088 |
| 799 | nmdc:mga00v17_4361_c1 | 3300050491 | Bacteria | 7351 |
| 800 | nmdc:mga00v17_484748_c1 | 3300050491 | Bacteria | 802 |
| 801 | nmdc:mga00v17_8290_c1 | 3300050491 | Bacteria | 5589 |
| 802 | nmdc:mga0yw44_20059_c1 | 3300050492 | Bacteria | 3701 |
| 803 | nmdc:mga0yw44_243492_c1 | 3300050492 | Bacteria | 1196 |
| 804 | nmdc:mga0yw44_40216_c1 | 3300050492 | Bacteria | 2776 |
| 805 | nmdc:mga0yw44_44143_c1 | 3300050492 | Bacteria | 2665 |
| 806 | nmdc:mga06z11_11103_c1 | 3300050494 | Bacteria | 3870 |
| 807 | nmdc:mga04h51_36647_c1 | 3300050495 | Bacteria | 1579 |
| 808 | nmdc:mga07m45_3242_c1 | 3300050496 | Bacteria | 7816 |
| 809 | nmdc:mga07m45_60598_c2 | 3300050496 | Bacteria | 1285 |
| 810 | nmdc:mga05p37_38534_c1 | 3300050507 | Bacteria | 5863 |
| 811 | nmdc:mga0qj67_7034_c1 | 3300050509 | Bacteria | 8295 |
| 812 | nmdc:mga0qj67_72643_c1 | 3300050509 | Bacteria | 2747 |
| 813 | nmdc:mga06r32_2512_c1 | 3300050510 | Bacteria | 16405 |
| 814 | nmdc:mga06r32_51989_c1 | 3300050510 | Bacteria | 3923 |
| 815 | nmdc:mga08y16_522175_c1 | 3300050511 | Bacteria | 1204 |
| 816 | nmdc:mga0rr50_138433_c1 | 3300050513 | Bacteria | 1956 |
| 817 | nmdc:mga0sz30_14784_c1 | 3300050516 | Bacteria | 3078 |
| 818 | nmdc:mga0sz30_15665_c1 | 3300050516 | Bacteria | 1646 |
| 819 | nmdc:mga0sz30_1985_c1 | 3300050516 | Bacteria | 7317 |
| 820 | nmdc:mga0sz30_4443_c1 | 3300050516 | Bacteria | 5066 |
| 821 | nmdc:mga0sz30_90242_c1 | 3300050516 | Bacteria | 1333 |
| 822 | Ga0500635_0005140 | 3300053080 | Bacteria | 3413 |
| 823 | Ga0495595_0019342 | 3300053084 | Bacteria | 2954 |
| 824 | Ga0495595_0140202 | 3300053084 | Bacteria | 1186 |
| 825 | Ga0495619_0003141 | 3300053085 | Bacteria | 10711 |
| 826 | Ga0500643_002707 | 3300053087 | Bacteria | 8905 |
| 827 | Ga0500643_005848 | 3300053087 | Bacteria | 5229 |
| 828 | Ga0500641_0047176 | 3300053096 | Bacteria | 1761 |
| 829 | Ga0500556_0003029 | 3300053104 | Bacteria | 5049 |
| 830 | Ga0500562_006252 | 3300053108 | Bacteria | 3005 |
| 831 | Ga0500652_001797 | 3300053131 | Bacteria | 6496 |
| 832 | Ga0500652_017942 | 3300053131 | Bacteria | 2603 |
| 833 | Ga0500658_0074833 | 3300053134 | Bacteria | 1437 |
| 834 | Ga0500588_0013486 | 3300053146 | Bacteria | 2052 |
| 835 | Ga0500616_0025979 | 3300053153 | Bacteria | 3246 |
| 836 | Ga0500620_051564 | 3300053155 | Bacteria | 1380 |
| 837 | Ga0500627_0005307 | 3300053158 | Bacteria | 4270 |
| 838 | Ga0500645_000195 | 3300053730 | Bacteria | 47101 |
| 839 | Ga0466962_0007816 | 3300061719 | Bacteria | 5126 |
| 840 | Ga0466962_0083994 | 3300061719 | Bacteria | 1523 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048920 | Ga0496117_0260586 | Ga0496117_0260586_65_919 | 246 |
| 2 | 3300010375 | Ga0105239_10533218 | Ga0105239_105332182 | 248 |
| 3 | 3300026067 | Ga0207678_10296461 | Ga0207678_102964612 | 248 |
| 4 | 3300039450 | Ga0436363_0781631 | Ga0436363_0781631_620_1366 | 248 |
| 5 | 3300045836 | Ga0466958_0331143 | Ga0466958_0331143_25_771 | 248 |
| 6 | 3300045976 | Ga0466967_0087163 | Ga0466967_0087163_16_762 | 248 |
| 7 | 3300046530 | Ga0495654_0176126 | Ga0495654_0176126_19_765 | 248 |
| 8 | 3300048904 | Ga0496101_0353731 | Ga0496101_0353731_16_762 | 248 |
| 9 | 3300048913 | Ga0496110_0412740 | Ga0496110_0412740_23_769 | 248 |
| 10 | 3300048929 | Ga0496126_0015649 | Ga0496126_0015649_4954_5700 | 248 |
| 11 | 3300049581 | Ga0501047_0558464 | Ga0501047_0558464_24_770 | 248 |
| 12 | 3300050491 | nmdc:mga00v17_484748_c1 | nmdc:mga00v17_484748_c1_33_779 | 248 |
| 13 | 3300050492 | nmdc:mga0yw44_40216_c1 | nmdc:mga0yw44_40216_c1_1452_2198 | 248 |
| 14 | 3300050516 | nmdc:mga0sz30_15665_c1 | nmdc:mga0sz30_15665_c1_889_1635 | 248 |
| 15 | 3300036401 | Ga0373937_0536088 | Ga0373937_0536088_337_1101 | 249 |
| 16 | 3300048904 | Ga0496101_0215208 | Ga0496101_0215208_424_1278 | 250 |
| 17 | 3300048911 | Ga0496108_0236535 | Ga0496108_0236535_602_1456 | 250 |
| 18 | 3300005535 | Ga0070684_100307367 | Ga0070684_1003073672 | 258 |
| 19 | 3300031852 | Ga0307410_10280110 | Ga0307410_102801102 | 258 |
| 20 | 3300006038 | Ga0075365_10069690 | Ga0075365_100696902 | 259 |
| 21 | iso_pu_bacteria | 2932431166 | 2932433507 | 262 |
| 22 | 3300048925 | Ga0496122_0004513 | Ga0496122_0004513_11167_12009 | 263 |
| 23 | 3300048926 | Ga0496123_0001305 | Ga0496123_0001305_4110_4952 | 263 |
| 24 | 3300048927 | Ga0496124_0005518 | Ga0496124_0005518_7201_8043 | 263 |
| 25 | 3300050491 | nmdc:mga00v17_32423_c1 | nmdc:mga00v17_32423_c1_826_1617 | 263 |
| 26 | iso_pu_bacteria | 2884994152 | 2884995038 | 264 |
| 27 | iso_pu_bacteria | 2643221690 | 2644506579 | 265 |
| 28 | iso_pu_bacteria | 2643221694 | 2644526507 | 265 |
| 29 | iso_pu_bacteria | 2643221722 | 2644671173 | 265 |
| 30 | 3300039447 | Ga0436361_1177073 | Ga0436361_1177073_30_833 | 267 |
| 31 | 3300048923 | Ga0496120_0049691 | Ga0496120_0049691_977_1906 | 267 |
| 32 | 3300003285 | Ga0007423J48922_100409 | Ga0007423J48922_1004094 | 268 |
| 33 | 3300006844 | Ga0075428_100062477 | Ga0075428_1000624774 | 268 |
| 34 | 3300006846 | Ga0075430_100077042 | Ga0075430_1000770423 | 268 |
| 35 | 3300006847 | Ga0075431_100008579 | Ga0075431_10000857911 | 268 |
| 36 | 3300031824 | Ga0307413_10110240 | Ga0307413_101102402 | 268 |
| 37 | 3300041413 | Ga0439465_0120449 | Ga0439465_0120449_95_901 | 268 |
| 38 | 3300048922 | Ga0496119_0171592 | Ga0496119_0171592_317_1123 | 268 |
| 39 | 3300050510 | nmdc:mga06r32_2512_c1 | nmdc:mga06r32_2512_c1_7935_8759 | 268 |
| 40 | 3300013308 | Ga0157375_10300101 | Ga0157375_103001012 | 269 |
| 41 | 3300032002 | Ga0307416_100682247 | Ga0307416_1006822471 | 269 |
| 42 | 3300047472 | Ga0495686_0226075 | Ga0495686_0226075_187_996 | 269 |
| 43 | 3300048913 | Ga0496110_0308811 | Ga0496110_0308811_365_1285 | 269 |
| 44 | 3300049569 | Ga0501032_0060342 | Ga0501032_0060342_1324_2211 | 269 |
| 45 | 3300049571 | Ga0501034_0345457 | Ga0501034_0345457_294_1181 | 269 |
| 46 | 3300049579 | Ga0501043_0272354 | Ga0501043_0272354_167_1054 | 269 |
| 47 | 3300049580 | Ga0501046_0005106 | Ga0501046_0005106_928_1815 | 269 |
| 48 | 3300049581 | Ga0501047_0164112 | Ga0501047_0164112_645_1532 | 269 |
| 49 | 3300049583 | Ga0501067_0234043 | Ga0501067_0234043_103_990 | 269 |
| 50 | 3300049589 | Ga0501073_0318809 | Ga0501073_0318809_11_898 | 269 |
| 51 | 3300049822 | Ga0501035_0012495 | Ga0501035_0012495_330_1217 | 269 |
| 52 | 3300049823 | Ga0501044_0542799 | Ga0501044_0542799_98_985 | 269 |
| 53 | iso_pu_bacteria | 2728369276 | 2729905568 | 269 |
| 54 | iso_pu_bacteria | 2738541272 | 2738692451 | 269 |
| 55 | iso_pu_bacteria | 2738543027 | 2739323538 | 269 |
| 56 | iso_pu_bacteria | 2758568522 | 2760303579 | 269 |
| 57 | iso_pu_bacteria | 2758568621 | 2760622566 | 269 |
| 58 | iso_pu_bacteria | 2808606394 | 2809027315 | 269 |
| 59 | iso_pu_bacteria | 2887478801 | 2887481970 | 269 |
| 60 | iso_pu_bacteria | 8001781756 | 8001781862 | 269 |
| 61 | iso_pu_bacteria | 8056579771 | 8056584053 | 269 |
| 62 | 3300003792 | Ga0055540_1001773 | Ga0055540_100177311 | 270 |
| 63 | 3300045976 | Ga0466967_0190816 | Ga0466967_0190816_384_1205 | 270 |
| 64 | 3300048911 | Ga0496108_0158340 | Ga0496108_0158340_667_1560 | 270 |
| 65 | 3300048920 | Ga0496117_0033521 | Ga0496117_0033521_1524_2423 | 270 |
| 66 | 3300048921 | Ga0496118_0032711 | Ga0496118_0032711_400_1299 | 270 |
| 67 | 3300048925 | Ga0496122_0001777 | Ga0496122_0001777_22311_23210 | 270 |
| 68 | 3300048928 | Ga0496125_0011321 | Ga0496125_0011321_6206_7096 | 270 |
| 69 | 3300049571 | Ga0501034_0404107 | Ga0501034_0404107_117_1013 | 270 |
| 70 | iso_pu_bacteria | 2811994880 | 2812365547 | 270 |
| 71 | 3300009147 | Ga0114129_10005311 | Ga0114129_100053117 | 271 |
| 72 | 3300009147 | Ga0114129_10129234 | Ga0114129_101292343 | 271 |
| 73 | 3300046459 | Ga0495629_0064786 | Ga0495629_0064786_1091_1945 | 271 |
| 74 | 3300046475 | Ga0495639_0016604 | Ga0495639_0016604_594_1448 | 271 |
| 75 | 3300046477 | Ga0495664_0156176 | Ga0495664_0156176_215_1069 | 271 |
| 76 | 3300046517 | Ga0495630_0327631 | Ga0495630_0327631_56_910 | 271 |
| 77 | 3300046690 | Ga0495624_0008396 | Ga0495624_0008396_1750_2604 | 271 |
| 78 | 3300047319 | Ga0495674_0053332 | Ga0495674_0053332_1521_2375 | 271 |
| 79 | 3300047673 | Ga0495593_0001834 | Ga0495593_0001834_2568_3422 | 271 |
| 80 | 3300048928 | Ga0496125_0088506 | Ga0496125_0088506_726_1580 | 271 |
| 81 | 3300048929 | Ga0496126_0024059 | Ga0496126_0024059_1295_2149 | 271 |
| 82 | 3300053730 | Ga0500645_000195 | Ga0500645_000195_38722_39576 | 271 |
| 83 | 3300005467 | Ga0070706_100040530 | Ga0070706_1000405303 | 272 |
| 84 | 3300025910 | Ga0207684_10071576 | Ga0207684_100715763 | 272 |
| 85 | 3300046507 | Ga0495606_0001336 | Ga0495606_0001336_2547_3383 | 272 |
| 86 | 3300046616 | Ga0495668_0000103 | Ga0495668_0000103_116053_116889 | 272 |
| 87 | 3300046660 | Ga0495625_0001256 | Ga0495625_0001256_14521_15357 | 272 |
| 88 | 3300047323 | Ga0495683_0056358 | Ga0495683_0056358_223_1059 | 272 |
| 89 | 3300048091 | Ga0495626_0000461 | Ga0495626_0000461_21648_22484 | 272 |
| 90 | 3300050492 | nmdc:mga0yw44_243492_c1 | nmdc:mga0yw44_243492_c1_242_1105 | 273 |
| 91 | iso_pu_bacteria | 2839986021 | 2839989406 | 273 |
| 92 | 3300037312 | Ga0395899_0003096 | Ga0395899_0003096_2360_3208 | 274 |
| 93 | 3300048928 | Ga0496125_0000079 | Ga0496125_0000079_210263_211231 | 274 |
| 94 | 3300005327 | Ga0070658_10089642 | Ga0070658_100896422 | 275 |
| 95 | 3300005329 | Ga0070683_100006536 | Ga0070683_1000065367 | 275 |
| 96 | 3300005329 | Ga0070683_100026274 | Ga0070683_1000262745 | 275 |
| 97 | 3300005330 | Ga0070690_100316738 | Ga0070690_1003167381 | 275 |
| 98 | 3300005335 | Ga0070666_10222154 | Ga0070666_102221542 | 275 |
| 99 | 3300005337 | Ga0070682_100070268 | Ga0070682_1000702682 | 275 |
| 100 | 3300005339 | Ga0070660_100337678 | Ga0070660_1003376782 | 275 |
| 101 | 3300005340 | Ga0070689_100417573 | Ga0070689_1004175731 | 275 |
| 102 | 3300005343 | Ga0070687_100168780 | Ga0070687_1001687802 | 275 |
| 103 | 3300005345 | Ga0070692_10080896 | Ga0070692_100808961 | 275 |
| 104 | 3300005345 | Ga0070692_10089477 | Ga0070692_100894772 | 275 |
| 105 | 3300005354 | Ga0070675_100078300 | Ga0070675_1000783003 | 275 |
| 106 | 3300005355 | Ga0070671_100185484 | Ga0070671_1001854841 | 275 |
| 107 | 3300005364 | Ga0070673_100187500 | Ga0070673_1001875002 | 275 |
| 108 | 3300005365 | Ga0070688_100418205 | Ga0070688_1004182051 | 275 |
| 109 | 3300005366 | Ga0070659_100087194 | Ga0070659_1000871943 | 275 |
| 110 | 3300005366 | Ga0070659_100240088 | Ga0070659_1002400882 | 275 |
| 111 | 3300005367 | Ga0070667_100121550 | Ga0070667_1001215504 | 275 |
| 112 | 3300005435 | Ga0070714_100006869 | Ga0070714_1000068698 | 275 |
| 113 | 3300005435 | Ga0070714_100109541 | Ga0070714_1001095413 | 275 |
| 114 | 3300005436 | Ga0070713_100052927 | Ga0070713_1000529273 | 275 |
| 115 | 3300005436 | Ga0070713_100071745 | Ga0070713_1000717452 | 275 |
| 116 | 3300005436 | Ga0070713_100114138 | Ga0070713_1001141383 | 275 |
| 117 | 3300005436 | Ga0070713_100301330 | Ga0070713_1003013302 | 275 |
| 118 | 3300005439 | Ga0070711_100113640 | Ga0070711_1001136402 | 275 |
| 119 | 3300005439 | Ga0070711_100134054 | Ga0070711_1001340542 | 275 |
| 120 | 3300005445 | Ga0070708_100003731 | Ga0070708_1000037312 | 275 |
| 121 | 3300005445 | Ga0070708_100394472 | Ga0070708_1003944722 | 275 |
| 122 | 3300005455 | Ga0070663_100014150 | Ga0070663_1000141507 | 275 |
| 123 | 3300005467 | Ga0070706_100083639 | Ga0070706_1000836392 | 275 |
| 124 | 3300005468 | Ga0070707_100012429 | Ga0070707_1000124293 | 275 |
| 125 | 3300005471 | Ga0070698_100001201 | Ga0070698_10000120114 | 275 |
| 126 | 3300005471 | Ga0070698_100066428 | Ga0070698_1000664283 | 275 |
| 127 | 3300005530 | Ga0070679_100051372 | Ga0070679_1000513722 | 275 |
| 128 | 3300005530 | Ga0070679_100117806 | Ga0070679_1001178063 | 275 |
| 129 | 3300005530 | Ga0070679_100379427 | Ga0070679_1003794272 | 275 |
| 130 | 3300005530 | Ga0070679_100529802 | Ga0070679_1005298021 | 275 |
| 131 | 3300005535 | Ga0070684_100241191 | Ga0070684_1002411911 | 275 |
| 132 | 3300005539 | Ga0068853_100605557 | Ga0068853_1006055571 | 275 |
| 133 | 3300005564 | Ga0070664_100076835 | Ga0070664_1000768352 | 275 |
| 134 | 3300005577 | Ga0068857_100131939 | Ga0068857_1001319391 | 275 |
| 135 | 3300005614 | Ga0068856_100069718 | Ga0068856_1000697182 | 275 |
| 136 | 3300005615 | Ga0070702_100327176 | Ga0070702_1003271761 | 275 |
| 137 | 3300005616 | Ga0068852_100620758 | Ga0068852_1006207582 | 275 |
| 138 | 3300005618 | Ga0068864_100166572 | Ga0068864_1001665722 | 275 |
| 139 | 3300005840 | Ga0068870_10311905 | Ga0068870_103119051 | 275 |
| 140 | 3300005841 | Ga0068863_100176670 | Ga0068863_1001766702 | 275 |
| 141 | 3300005983 | Ga0081540_1000009 | Ga0081540_100000986 | 275 |
| 142 | 3300006028 | Ga0070717_10300905 | Ga0070717_103009052 | 275 |
| 143 | 3300006173 | Ga0070716_100182027 | Ga0070716_1001820272 | 275 |
| 144 | 3300006173 | Ga0070716_100208374 | Ga0070716_1002083741 | 275 |
| 145 | 3300006173 | Ga0070716_100390296 | Ga0070716_1003902961 | 275 |
| 146 | 3300006175 | Ga0070712_100003385 | Ga0070712_1000033851 | 275 |
| 147 | 3300006871 | Ga0075434_100393054 | Ga0075434_1003930542 | 275 |
| 148 | 3300006881 | Ga0068865_100145768 | Ga0068865_1001457681 | 275 |
| 149 | 3300009093 | Ga0105240_10229594 | Ga0105240_102295943 | 275 |
| 150 | 3300009093 | Ga0105240_10629624 | Ga0105240_106296242 | 275 |
| 151 | 3300009098 | Ga0105245_10163986 | Ga0105245_101639862 | 275 |
| 152 | 3300012481 | Ga0157320_1001111 | Ga0157320_10011112 | 275 |
| 153 | 3300012483 | Ga0157337_1000560 | Ga0157337_10005602 | 275 |
| 154 | 3300012485 | Ga0157325_1000878 | Ga0157325_10008782 | 275 |
| 155 | 3300012488 | Ga0157343_1002179 | Ga0157343_10021791 | 275 |
| 156 | 3300012506 | Ga0157324_1001796 | Ga0157324_10017962 | 275 |
| 157 | 3300012507 | Ga0157342_1002632 | Ga0157342_10026321 | 275 |
| 158 | 3300013100 | Ga0157373_10066671 | Ga0157373_100666712 | 275 |
| 159 | 3300013104 | Ga0157370_10162352 | Ga0157370_101623522 | 275 |
| 160 | 3300013104 | Ga0157370_10378440 | Ga0157370_103784402 | 275 |
| 161 | 3300013105 | Ga0157369_10080943 | Ga0157369_100809432 | 275 |
| 162 | 3300014326 | Ga0157380_10345549 | Ga0157380_103455492 | 275 |
| 163 | 3300014745 | Ga0157377_10086006 | Ga0157377_100860062 | 275 |
| 164 | 3300014969 | Ga0157376_10418342 | Ga0157376_104183422 | 275 |
| 165 | 3300017792 | Ga0163161_10235268 | Ga0163161_102352681 | 275 |
| 166 | 3300020070 | Ga0206356_10810878 | Ga0206356_108108783 | 275 |
| 167 | 3300020080 | Ga0206350_11663349 | Ga0206350_116633492 | 275 |
| 168 | 3300020081 | Ga0206354_10912145 | Ga0206354_109121453 | 275 |
| 169 | 3300020082 | Ga0206353_10272952 | Ga0206353_102729523 | 275 |
| 170 | 3300020082 | Ga0206353_10728243 | Ga0206353_107282431 | 275 |
| 171 | 3300020082 | Ga0206353_10730323 | Ga0206353_107303233 | 275 |
| 172 | 3300021388 | Ga0213875_10002694 | Ga0213875_100026945 | 275 |
| 173 | 3300021388 | Ga0213875_10120299 | Ga0213875_101202991 | 275 |
| 174 | 3300021388 | Ga0213875_10133357 | Ga0213875_101333571 | 275 |
| 175 | 3300022467 | Ga0224712_10074188 | Ga0224712_100741882 | 275 |
| 176 | 3300024227 | Ga0228598_1008297 | Ga0228598_10082972 | 275 |
| 177 | 3300025898 | Ga0207692_10099818 | Ga0207692_100998181 | 275 |
| 178 | 3300025898 | Ga0207692_10171875 | Ga0207692_101718751 | 275 |
| 179 | 3300025901 | Ga0207688_10091412 | Ga0207688_100914122 | 275 |
| 180 | 3300025904 | Ga0207647_10082703 | Ga0207647_100827031 | 275 |
| 181 | 3300025906 | Ga0207699_10003180 | Ga0207699_100031804 | 275 |
| 182 | 3300025906 | Ga0207699_10009261 | Ga0207699_100092615 | 275 |
| 183 | 3300025906 | Ga0207699_10019000 | Ga0207699_100190002 | 275 |
| 184 | 3300025906 | Ga0207699_10147453 | Ga0207699_101474532 | 275 |
| 185 | 3300025906 | Ga0207699_10324694 | Ga0207699_103246942 | 275 |
| 186 | 3300025907 | Ga0207645_10305810 | Ga0207645_103058101 | 275 |
| 187 | 3300025908 | Ga0207643_10007955 | Ga0207643_100079551 | 275 |
| 188 | 3300025909 | Ga0207705_10210219 | Ga0207705_102102192 | 275 |
| 189 | 3300025909 | Ga0207705_10214350 | Ga0207705_102143501 | 275 |
| 190 | 3300025910 | Ga0207684_10079001 | Ga0207684_100790012 | 275 |
| 191 | 3300025912 | Ga0207707_10007438 | Ga0207707_100074382 | 275 |
| 192 | 3300025912 | Ga0207707_10318444 | Ga0207707_103184441 | 275 |
| 193 | 3300025915 | Ga0207693_10020666 | Ga0207693_100206664 | 275 |
| 194 | 3300025915 | Ga0207693_10041360 | Ga0207693_100413602 | 275 |
| 195 | 3300025916 | Ga0207663_10055689 | Ga0207663_100556892 | 275 |
| 196 | 3300025916 | Ga0207663_10408253 | Ga0207663_104082532 | 275 |
| 197 | 3300025916 | Ga0207663_10455504 | Ga0207663_104555041 | 275 |
| 198 | 3300025918 | Ga0207662_10322918 | Ga0207662_103229181 | 275 |
| 199 | 3300025919 | Ga0207657_10022671 | Ga0207657_100226715 | 275 |
| 200 | 3300025919 | Ga0207657_10178552 | Ga0207657_101785522 | 275 |
| 201 | 3300025921 | Ga0207652_10357253 | Ga0207652_103572532 | 275 |
| 202 | 3300025922 | Ga0207646_10042204 | Ga0207646_100422044 | 275 |
| 203 | 3300025922 | Ga0207646_10415267 | Ga0207646_104152672 | 275 |
| 204 | 3300025926 | Ga0207659_10116885 | Ga0207659_101168851 | 275 |
| 205 | 3300025928 | Ga0207700_10009342 | Ga0207700_100093425 | 275 |
| 206 | 3300025928 | Ga0207700_10013024 | Ga0207700_100130245 | 275 |
| 207 | 3300025928 | Ga0207700_10016756 | Ga0207700_100167563 | 275 |
| 208 | 3300025928 | Ga0207700_10019742 | Ga0207700_100197424 | 275 |
| 209 | 3300025928 | Ga0207700_10126873 | Ga0207700_101268732 | 275 |
| 210 | 3300025928 | Ga0207700_10237475 | Ga0207700_102374752 | 275 |
| 211 | 3300025929 | Ga0207664_10001128 | Ga0207664_1000112815 | 275 |
| 212 | 3300025929 | Ga0207664_10006033 | Ga0207664_100060337 | 275 |
| 213 | 3300025929 | Ga0207664_10019807 | Ga0207664_100198074 | 275 |
| 214 | 3300025929 | Ga0207664_10043434 | Ga0207664_100434342 | 275 |
| 215 | 3300025929 | Ga0207664_10082344 | Ga0207664_100823442 | 275 |
| 216 | 3300025933 | Ga0207706_10022821 | Ga0207706_100228214 | 275 |
| 217 | 3300025936 | Ga0207670_10433663 | Ga0207670_104336632 | 275 |
| 218 | 3300025938 | Ga0207704_10131259 | Ga0207704_101312591 | 275 |
| 219 | 3300025939 | Ga0207665_10010016 | Ga0207665_100100164 | 275 |
| 220 | 3300025939 | Ga0207665_10037081 | Ga0207665_100370811 | 275 |
| 221 | 3300025939 | Ga0207665_10158823 | Ga0207665_101588231 | 275 |
| 222 | 3300025939 | Ga0207665_10365146 | Ga0207665_103651462 | 275 |
| 223 | 3300025960 | Ga0207651_10471971 | Ga0207651_104719711 | 275 |
| 224 | 3300026067 | Ga0207678_10029966 | Ga0207678_100299664 | 275 |
| 225 | 3300026067 | Ga0207678_10254511 | Ga0207678_102545111 | 275 |
| 226 | 3300026078 | Ga0207702_10005527 | Ga0207702_100055274 | 275 |
| 227 | 3300026078 | Ga0207702_10328063 | Ga0207702_103280632 | 275 |
| 228 | 3300026089 | Ga0207648_10369689 | Ga0207648_103696891 | 275 |
| 229 | 3300026095 | Ga0207676_10107838 | Ga0207676_101078381 | 275 |
| 230 | 3300026116 | Ga0207674_10020822 | Ga0207674_100208224 | 275 |
| 231 | 3300026116 | Ga0207674_10086649 | Ga0207674_100866492 | 275 |
| 232 | 3300026118 | Ga0207675_100108396 | Ga0207675_1001083962 | 275 |
| 233 | 3300026121 | Ga0207683_10001450 | Ga0207683_1000145018 | 275 |
| 234 | 3300026142 | Ga0207698_10528392 | Ga0207698_105283921 | 275 |
| 235 | 3300028556 | Ga0265337_1002649 | Ga0265337_10026493 | 275 |
| 236 | 3300028563 | Ga0265319_1023792 | Ga0265319_10237922 | 275 |
| 237 | 3300028573 | Ga0265334_10000870 | Ga0265334_100008702 | 275 |
| 238 | 3300028577 | Ga0265318_10028794 | Ga0265318_100287942 | 275 |
| 239 | 3300028653 | Ga0265323_10001759 | Ga0265323_100017592 | 275 |
| 240 | 3300028654 | Ga0265322_10003925 | Ga0265322_100039252 | 275 |
| 241 | 3300028666 | Ga0265336_10010405 | Ga0265336_100104052 | 275 |
| 242 | 3300028800 | Ga0265338_10001142 | Ga0265338_1000114246 | 275 |
| 243 | 3300028800 | Ga0265338_10009484 | Ga0265338_100094842 | 275 |
| 244 | 3300028800 | Ga0265338_10181845 | Ga0265338_101818452 | 275 |
| 245 | 3300028800 | Ga0265338_10306689 | Ga0265338_103066891 | 275 |
| 246 | 3300029957 | Ga0265324_10000666 | Ga0265324_1000066611 | 275 |
| 247 | 3300031238 | Ga0265332_10001385 | Ga0265332_100013852 | 275 |
| 248 | 3300031241 | Ga0265325_10014436 | Ga0265325_100144363 | 275 |
| 249 | 3300031242 | Ga0265329_10065381 | Ga0265329_100653811 | 275 |
| 250 | 3300031247 | Ga0265340_10087533 | Ga0265340_100875332 | 275 |
| 251 | 3300031249 | Ga0265339_10045029 | Ga0265339_100450292 | 275 |
| 252 | 3300031711 | Ga0265314_10007872 | Ga0265314_100078722 | 275 |
| 253 | 3300031712 | Ga0265342_10001467 | Ga0265342_1000146717 | 275 |
| 254 | 3300035083 | Ga0373926_0000765 | Ga0373926_0000765_3802_4659 | 275 |
| 255 | 3300035086 | Ga0373934_0009621 | Ga0373934_0009621_305_1162 | 275 |
| 256 | 3300035111 | Ga0373923_0001164 | Ga0373923_0001164_860_1717 | 275 |
| 257 | 3300035113 | Ga0373936_0013060 | Ga0373936_0013060_1433_2290 | 275 |
| 258 | 3300035113 | Ga0373936_0049067 | Ga0373936_0049067_416_1270 | 275 |
| 259 | 3300035117 | Ga0373953_0032669 | Ga0373953_0032669_1054_1911 | 275 |
| 260 | 3300035118 | Ga0373954_0017440 | Ga0373954_0017440_2053_2910 | 275 |
| 261 | 3300035119 | Ga0373956_0003365 | Ga0373956_0003365_2849_3703 | 275 |
| 262 | 3300035119 | Ga0373956_0052379 | Ga0373956_0052379_467_1324 | 275 |
| 263 | 3300035119 | Ga0373956_0162917 | Ga0373956_0162917_21_878 | 275 |
| 264 | 3300035170 | Ga0373943_0002009 | Ga0373943_0002009_5088_5945 | 275 |
| 265 | 3300035171 | Ga0373946_0000515 | Ga0373946_0000515_2171_3028 | 275 |
| 266 | 3300035207 | Ga0373942_0020308 | Ga0373942_0020308_76_933 | 275 |
| 267 | 3300035691 | Ga0373931_0009215 | Ga0373931_0009215_1461_2318 | 275 |
| 268 | 3300035692 | Ga0373935_0000488 | Ga0373935_0000488_6659_7516 | 275 |
| 269 | 3300035692 | Ga0373935_0039125 | Ga0373935_0039125_1514_2371 | 275 |
| 270 | 3300035724 | Ga0373933_0018935 | Ga0373933_0018935_1083_1940 | 275 |
| 271 | 3300035725 | Ga0373947_0000113 | Ga0373947_0000113_1891_2748 | 275 |
| 272 | 3300036401 | Ga0373937_0012529 | Ga0373937_0012529_1967_2824 | 275 |
| 273 | 3300036401 | Ga0373937_0128069 | Ga0373937_0128069_1183_2037 | 275 |
| 274 | 3300036459 | Ga0372808_011090 | Ga0372808_011090_141_995 | 275 |
| 275 | 3300037068 | Ga0373925_0000384 | Ga0373925_0000384_39971_40825 | 275 |
| 276 | 3300037068 | Ga0373925_0012546 | Ga0373925_0012546_3796_4653 | 275 |
| 277 | 3300037068 | Ga0373925_0166408 | Ga0373925_0166408_637_1491 | 275 |
| 278 | 3300037466 | Ga0395898_0019127 | Ga0395898_0019127_4987_5841 | 275 |
| 279 | 3300037853 | Ga0436364_0166036 | Ga0436364_0166036_277_1134 | 275 |
| 280 | 3300037853 | Ga0436364_0321419 | Ga0436364_0321419_466_1320 | 275 |
| 281 | 3300037853 | Ga0436364_0542227 | Ga0436364_0542227_2684_3541 | 275 |
| 282 | 3300037853 | Ga0436364_0584067 | Ga0436364_0584067_145856_146710 | 275 |
| 283 | 3300037853 | Ga0436364_0976891 | Ga0436364_0976891_929_1786 | 275 |
| 284 | 3300037853 | Ga0436364_1179018 | Ga0436364_1179018_3018_3875 | 275 |
| 285 | 3300039438 | Ga0436360_1375602 | Ga0436360_1375602_728_1582 | 275 |
| 286 | 3300039450 | Ga0436363_1124457 | Ga0436363_1124457_20_877 | 275 |
| 287 | 3300044694 | Ga0466963_0066894 | Ga0466963_0066894_168_1022 | 275 |
| 288 | 3300046454 | Ga0495592_0113781 | Ga0495592_0113781_740_1597 | 275 |
| 289 | 3300046455 | Ga0495603_0003763 | Ga0495603_0003763_5032_5889 | 275 |
| 290 | 3300046459 | Ga0495629_0002692 | Ga0495629_0002692_6452_7309 | 275 |
| 291 | 3300046462 | Ga0495651_0040615 | Ga0495651_0040615_1189_2043 | 275 |
| 292 | 3300046463 | Ga0495653_0125326 | Ga0495653_0125326_40_897 | 275 |
| 293 | 3300046472 | Ga0495580_0026504 | Ga0495580_0026504_1058_1915 | 275 |
| 294 | 3300046473 | Ga0495582_0000741 | Ga0495582_0000741_12177_13034 | 275 |
| 295 | 3300046475 | Ga0495639_0002161 | Ga0495639_0002161_2659_3516 | 275 |
| 296 | 3300046477 | Ga0495664_0013862 | Ga0495664_0013862_1055_1912 | 275 |
| 297 | 3300046511 | Ga0495608_0021905 | Ga0495608_0021905_2258_3115 | 275 |
| 298 | 3300046511 | Ga0495608_0050637 | Ga0495608_0050637_1340_2194 | 275 |
| 299 | 3300046516 | Ga0495628_0011936 | Ga0495628_0011936_3812_4669 | 275 |
| 300 | 3300046517 | Ga0495630_0010159 | Ga0495630_0010159_1140_1997 | 275 |
| 301 | 3300046517 | Ga0495630_0058729 | Ga0495630_0058729_1500_2354 | 275 |
| 302 | 3300046526 | Ga0495666_0002890 | Ga0495666_0002890_3809_4666 | 275 |
| 303 | 3300046529 | Ga0495652_0456585 | Ga0495652_0456585_24_878 | 275 |
| 304 | 3300046531 | Ga0495665_0000906 | Ga0495665_0000906_5819_6676 | 275 |
| 305 | 3300046531 | Ga0495665_0046289 | Ga0495665_0046289_1222_2079 | 275 |
| 306 | 3300046533 | Ga0495640_0001961 | Ga0495640_0001961_11626_12483 | 275 |
| 307 | 3300046535 | Ga0495586_0038012 | Ga0495586_0038012_1267_2124 | 275 |
| 308 | 3300046543 | Ga0495645_0241705 | Ga0495645_0241705_98_955 | 275 |
| 309 | 3300046559 | Ga0495667_0089327 | Ga0495667_0089327_53_907 | 275 |
| 310 | 3300046642 | Ga0495634_0014605 | Ga0495634_0014605_3836_4693 | 275 |
| 311 | 3300046663 | Ga0495635_0090410 | Ga0495635_0090410_51_908 | 275 |
| 312 | 3300046674 | Ga0495588_0091440 | Ga0495588_0091440_515_1372 | 275 |
| 313 | 3300046675 | Ga0495657_0052689 | Ga0495657_0052689_679_1536 | 275 |
| 314 | 3300046679 | Ga0495623_0099589 | Ga0495623_0099589_283_1140 | 275 |
| 315 | 3300046680 | Ga0495646_0050920 | Ga0495646_0050920_724_1581 | 275 |
| 316 | 3300046681 | Ga0495647_0084602 | Ga0495647_0084602_412_1269 | 275 |
| 317 | 3300046683 | Ga0495658_0111451 | Ga0495658_0111451_316_1173 | 275 |
| 318 | 3300046689 | Ga0495613_0001650 | Ga0495613_0001650_3825_4682 | 275 |
| 319 | 3300046690 | Ga0495624_0011180 | Ga0495624_0011180_1702_2559 | 275 |
| 320 | 3300046809 | Ga0495600_0014313 | Ga0495600_0014313_183_1040 | 275 |
| 321 | 3300047315 | Ga0495581_0000263 | Ga0495581_0000263_20586_21443 | 275 |
| 322 | 3300047317 | Ga0495604_0063128 | Ga0495604_0063128_664_1518 | 275 |
| 323 | 3300047321 | Ga0495676_0012085 | Ga0495676_0012085_3857_4714 | 275 |
| 324 | 3300047322 | Ga0495680_0040434 | Ga0495680_0040434_1196_2053 | 275 |
| 325 | 3300047322 | Ga0495680_0051429 | Ga0495680_0051429_1092_1949 | 275 |
| 326 | 3300047322 | Ga0495680_0056799 | Ga0495680_0056799_1085_1939 | 275 |
| 327 | 3300047444 | Ga0495675_0060131 | Ga0495675_0060131_739_1596 | 275 |
| 328 | 3300047471 | Ga0495684_0096501 | Ga0495684_0096501_1323_2180 | 275 |
| 329 | 3300047673 | Ga0495593_0007464 | Ga0495593_0007464_594_1451 | 275 |
| 330 | 3300048088 | Ga0495602_0032252 | Ga0495602_0032252_3828_4685 | 275 |
| 331 | 3300048089 | Ga0495614_0035816 | Ga0495614_0035816_798_1655 | 275 |
| 332 | 3300048903 | Ga0496100_0400995 | Ga0496100_0400995_87_944 | 275 |
| 333 | 3300048903 | Ga0496100_0413148 | Ga0496100_0413148_142_999 | 275 |
| 334 | 3300048905 | Ga0496102_0383493 | Ga0496102_0383493_49_906 | 275 |
| 335 | 3300048907 | Ga0496104_0029752 | Ga0496104_0029752_3948_4805 | 275 |
| 336 | 3300048910 | Ga0496107_0238751 | Ga0496107_0238751_33_890 | 275 |
| 337 | 3300048915 | Ga0496112_0319794 | Ga0496112_0319794_450_1304 | 275 |
| 338 | 3300048916 | Ga0496113_0160315 | Ga0496113_0160315_205_1059 | 275 |
| 339 | 3300048916 | Ga0496113_0168979 | Ga0496113_0168979_815_1672 | 275 |
| 340 | 3300048916 | Ga0496113_0391404 | Ga0496113_0391404_210_1067 | 275 |
| 341 | 3300048918 | Ga0496115_0259022 | Ga0496115_0259022_203_1057 | 275 |
| 342 | 3300048918 | Ga0496115_0346325 | Ga0496115_0346325_312_1169 | 275 |
| 343 | 3300048929 | Ga0496126_0015136 | Ga0496126_0015136_6796_7650 | 275 |
| 344 | 3300048929 | Ga0496126_0119174 | Ga0496126_0119174_800_1654 | 275 |
| 345 | 3300050513 | nmdc:mga0rr50_138433_c1 | nmdc:mga0rr50_138433_c1_783_1640 | 275 |
| 346 | 3300053084 | Ga0495595_0019342 | Ga0495595_0019342_229_1086 | 275 |
| 347 | 3300053084 | Ga0495595_0140202 | Ga0495595_0140202_225_1079 | 275 |
| 348 | 3300053085 | Ga0495619_0003141 | Ga0495619_0003141_1390_2247 | 275 |
| 349 | 3300044683 | Ga0466965_0284599 | Ga0466965_0284599_19_849 | 276 |
| 350 | 3300049585 | Ga0501069_0020740 | Ga0501069_0020740_879_1724 | 276 |
| 351 | 3300049586 | Ga0501070_0015755 | Ga0501070_0015755_1215_2060 | 276 |
| 352 | 3300049589 | Ga0501073_0285305 | Ga0501073_0285305_83_928 | 276 |
| 353 | 3300049590 | Ga0501074_0197163 | Ga0501074_0197163_188_1033 | 276 |
| 354 | 3300049742 | Ga0501080_0279676 | Ga0501080_0279676_316_1161 | 276 |
| 355 | 3300049579 | Ga0501043_0001755 | Ga0501043_0001755_7792_8643 | 278 |
| 356 | 3300049581 | Ga0501047_0001950 | Ga0501047_0001950_18842_19693 | 278 |
| 357 | 3300049582 | Ga0501048_0003785 | Ga0501048_0003785_10393_11244 | 278 |
| 358 | 3300049590 | Ga0501074_0001629 | Ga0501074_0001629_4360_5211 | 278 |
| 359 | 3300037853 | Ga0436364_0256774 | Ga0436364_0256774_19778_20617 | 279 |
| 360 | 3300039437 | Ga0436365_0792290 | Ga0436365_0792290_610_1449 | 279 |
| 361 | 3300046524 | Ga0495648_0001738 | Ga0495648_0001738_10224_11063 | 279 |
| 362 | 3300046616 | Ga0495668_0013468 | Ga0495668_0013468_1051_1890 | 279 |
| 363 | 3300047320 | Ga0495672_0001155 | Ga0495672_0001155_8701_9540 | 279 |
| 364 | 3300047469 | Ga0495673_0000708 | Ga0495673_0000708_10093_10932 | 279 |
| 365 | 3300048903 | Ga0496100_0057581 | Ga0496100_0057581_683_1522 | 279 |
| 366 | 3300048905 | Ga0496102_0000251 | Ga0496102_0000251_26829_27668 | 279 |
| 367 | 3300048906 | Ga0496103_0000990 | Ga0496103_0000990_18577_19416 | 279 |
| 368 | 3300048909 | Ga0496106_0508580 | Ga0496106_0508580_69_908 | 279 |
| 369 | 3300048910 | Ga0496107_0159872 | Ga0496107_0159872_76_915 | 279 |
| 370 | 3300048912 | Ga0496109_0540610 | Ga0496109_0540610_202_1041 | 279 |
| 371 | 3300048920 | Ga0496117_0002020 | Ga0496117_0002020_2733_3572 | 279 |
| 372 | 3300048921 | Ga0496118_0034681 | Ga0496118_0034681_2749_3588 | 279 |
| 373 | 3300048922 | Ga0496119_0040475 | Ga0496119_0040475_1147_1986 | 279 |
| 374 | 3300048923 | Ga0496120_0019927 | Ga0496120_0019927_3414_4253 | 279 |
| 375 | 3300048924 | Ga0496121_0019322 | Ga0496121_0019322_5492_6331 | 279 |
| 376 | 3300048927 | Ga0496124_0090520 | Ga0496124_0090520_1343_2182 | 279 |
| 377 | 3300048928 | Ga0496125_0093569 | Ga0496125_0093569_1090_1929 | 279 |
| 378 | 3300048929 | Ga0496126_0045618 | Ga0496126_0045618_963_1802 | 279 |
| 379 | 3300053155 | Ga0500620_051564 | Ga0500620_051564_477_1316 | 279 |
| 380 | iso_pu_bacteria | 2643221687 | 2644486398 | 280 |
| 381 | iso_pu_bacteria | 2643221715 | 2644637323 | 280 |
| 382 | iso_pu_bacteria | 2738541274 | 2738706126 | 280 |
| 383 | iso_pu_bacteria | 2738543028 | 2739332974 | 280 |
| 384 | iso_pu_bacteria | 2842134933 | 2842138393 | 280 |
| 385 | iso_pu_bacteria | 2902792274 | 2902798491 | 280 |
| 386 | iso_pu_bacteria | 2902799365 | 2902801583 | 280 |
| 387 | iso_pu_bacteria | 2902810491 | 2902815482 | 280 |
| 388 | iso_pu_bacteria | 2902837492 | 2902840185 | 280 |
| 389 | iso_pu_bacteria | 2929212328 | 2929214979 | 280 |
| 390 | iso_pu_bacteria | 2939582691 | 2939587360 | 280 |
| 391 | 3300025932 | Ga0207690_10229092 | Ga0207690_102290922 | 281 |
| 392 | 3300003320 | rootH2_10157116 | rootH2_101571162 | 283 |
| 393 | 3300005434 | Ga0070709_10241601 | Ga0070709_102416012 | 283 |
| 394 | 3300005456 | Ga0070678_100266111 | Ga0070678_1002661112 | 283 |
| 395 | 3300009545 | Ga0105237_10282367 | Ga0105237_102823672 | 283 |
| 396 | 3300013105 | Ga0157369_10085162 | Ga0157369_100851622 | 283 |
| 397 | 3300025898 | Ga0207692_10045226 | Ga0207692_100452262 | 283 |
| 398 | 3300025914 | Ga0207671_10417212 | Ga0207671_104172121 | 283 |
| 399 | 3300049585 | Ga0501069_0045295 | Ga0501069_0045295_848_1699 | 283 |
| 400 | 3300000546 | LJNas_1002016 | LJNas_10020161 | 284 |
| 401 | 3300001977 | JGI24746J21847_1005052 | JGI24746J21847_10050522 | 284 |
| 402 | 3300001991 | JGI24743J22301_10015602 | JGI24743J22301_100156021 | 284 |
| 403 | 3300002070 | JGI24750J21931_1003896 | JGI24750J21931_10038962 | 284 |
| 404 | 3300002073 | JGI24745J21846_1000595 | JGI24745J21846_10005952 | 284 |
| 405 | 3300002074 | JGI24748J21848_1004782 | JGI24748J21848_10047822 | 284 |
| 406 | 3300002244 | JGI24742J22300_10003385 | JGI24742J22300_100033852 | 284 |
| 407 | 3300002459 | JGI24751J29686_10008463 | JGI24751J29686_100084632 | 284 |
| 408 | 3300003792 | Ga0055540_1002004 | Ga0055540_10020044 | 284 |
| 409 | 3300005328 | Ga0070676_10003560 | Ga0070676_100035603 | 284 |
| 410 | 3300005329 | Ga0070683_100123072 | Ga0070683_1001230722 | 284 |
| 411 | 3300005330 | Ga0070690_100098649 | Ga0070690_1000986492 | 284 |
| 412 | 3300005335 | Ga0070666_10022380 | Ga0070666_100223802 | 284 |
| 413 | 3300005337 | Ga0070682_100043875 | Ga0070682_1000438753 | 284 |
| 414 | 3300005338 | Ga0068868_100001925 | Ga0068868_1000019257 | 284 |
| 415 | 3300005338 | Ga0068868_100214843 | Ga0068868_1002148432 | 284 |
| 416 | 3300005339 | Ga0070660_100360014 | Ga0070660_1003600141 | 284 |
| 417 | 3300005341 | Ga0070691_10019777 | Ga0070691_100197772 | 284 |
| 418 | 3300005343 | Ga0070687_100111861 | Ga0070687_1001118611 | 284 |
| 419 | 3300005347 | Ga0070668_100000140 | Ga0070668_10000014042 | 284 |
| 420 | 3300005347 | Ga0070668_100000721 | Ga0070668_1000007213 | 284 |
| 421 | 3300005347 | Ga0070668_100483453 | Ga0070668_1004834531 | 284 |
| 422 | 3300005353 | Ga0070669_100019162 | Ga0070669_1000191626 | 284 |
| 423 | 3300005353 | Ga0070669_100111779 | Ga0070669_1001117792 | 284 |
| 424 | 3300005355 | Ga0070671_100023362 | Ga0070671_1000233623 | 284 |
| 425 | 3300005355 | Ga0070671_100424353 | Ga0070671_1004243531 | 284 |
| 426 | 3300005356 | Ga0070674_100001316 | Ga0070674_1000013164 | 284 |
| 427 | 3300005365 | Ga0070688_100023636 | Ga0070688_1000236362 | 284 |
| 428 | 3300005366 | Ga0070659_100052771 | Ga0070659_1000527712 | 284 |
| 429 | 3300005367 | Ga0070667_100000408 | Ga0070667_10000040851 | 284 |
| 430 | 3300005367 | Ga0070667_100001695 | Ga0070667_10000169516 | 284 |
| 431 | 3300005367 | Ga0070667_100175346 | Ga0070667_1001753462 | 284 |
| 432 | 3300005437 | Ga0070710_10001921 | Ga0070710_100019218 | 284 |
| 433 | 3300005437 | Ga0070710_10006772 | Ga0070710_100067722 | 284 |
| 434 | 3300005438 | Ga0070701_10000646 | Ga0070701_100006465 | 284 |
| 435 | 3300005439 | Ga0070711_100006335 | Ga0070711_1000063354 | 284 |
| 436 | 3300005441 | Ga0070700_100000668 | Ga0070700_1000006682 | 284 |
| 437 | 3300005441 | Ga0070700_100138521 | Ga0070700_1001385212 | 284 |
| 438 | 3300005455 | Ga0070663_100119505 | Ga0070663_1001195052 | 284 |
| 439 | 3300005455 | Ga0070663_100119880 | Ga0070663_1001198802 | 284 |
| 440 | 3300005455 | Ga0070663_100132313 | Ga0070663_1001323132 | 284 |
| 441 | 3300005456 | Ga0070678_100000061 | Ga0070678_10000006116 | 284 |
| 442 | 3300005456 | Ga0070678_100461315 | Ga0070678_1004613151 | 284 |
| 443 | 3300005459 | Ga0068867_100008795 | Ga0068867_1000087953 | 284 |
| 444 | 3300005535 | Ga0070684_100108603 | Ga0070684_1001086033 | 284 |
| 445 | 3300005539 | Ga0068853_100000950 | Ga0068853_10000095011 | 284 |
| 446 | 3300005539 | Ga0068853_100032218 | Ga0068853_1000322183 | 284 |
| 447 | 3300005539 | Ga0068853_100168374 | Ga0068853_1001683743 | 284 |
| 448 | 3300005543 | Ga0070672_100260079 | Ga0070672_1002600791 | 284 |
| 449 | 3300005544 | Ga0070686_100098808 | Ga0070686_1000988082 | 284 |
| 450 | 3300005545 | Ga0070695_100118508 | Ga0070695_1001185082 | 284 |
| 451 | 3300005546 | Ga0070696_100004064 | Ga0070696_1000040642 | 284 |
| 452 | 3300005548 | Ga0070665_100003972 | Ga0070665_10000397215 | 284 |
| 453 | 3300005548 | Ga0070665_100008318 | Ga0070665_1000083189 | 284 |
| 454 | 3300005548 | Ga0070665_100047716 | Ga0070665_1000477161 | 284 |
| 455 | 3300005548 | Ga0070665_100066715 | Ga0070665_1000667153 | 284 |
| 456 | 3300005549 | Ga0070704_100008843 | Ga0070704_1000088433 | 284 |
| 457 | 3300005549 | Ga0070704_100156561 | Ga0070704_1001565612 | 284 |
| 458 | 3300005563 | Ga0068855_100125375 | Ga0068855_1001253752 | 284 |
| 459 | 3300005578 | Ga0068854_100003941 | Ga0068854_10000394111 | 284 |
| 460 | 3300005578 | Ga0068854_100103759 | Ga0068854_1001037592 | 284 |
| 461 | 3300005615 | Ga0070702_100001059 | Ga0070702_1000010592 | 284 |
| 462 | 3300005616 | Ga0068852_100078126 | Ga0068852_1000781262 | 284 |
| 463 | 3300005616 | Ga0068852_100120735 | Ga0068852_1001207352 | 284 |
| 464 | 3300005617 | Ga0068859_100000542 | Ga0068859_1000005423 | 284 |
| 465 | 3300005617 | Ga0068859_100006779 | Ga0068859_1000067795 | 284 |
| 466 | 3300005617 | Ga0068859_100614276 | Ga0068859_1006142762 | 284 |
| 467 | 3300005618 | Ga0068864_100124452 | Ga0068864_1001244523 | 284 |
| 468 | 3300005718 | Ga0068866_10001389 | Ga0068866_100013897 | 284 |
| 469 | 3300005719 | Ga0068861_100000122 | Ga0068861_10000012227 | 284 |
| 470 | 3300005719 | Ga0068861_100047044 | Ga0068861_1000470442 | 284 |
| 471 | 3300005841 | Ga0068863_100000352 | Ga0068863_1000003525 | 284 |
| 472 | 3300005841 | Ga0068863_100007618 | Ga0068863_1000076183 | 284 |
| 473 | 3300005841 | Ga0068863_100223395 | Ga0068863_1002233952 | 284 |
| 474 | 3300005841 | Ga0068863_100266909 | Ga0068863_1002669092 | 284 |
| 475 | 3300005842 | Ga0068858_100030398 | Ga0068858_1000303983 | 284 |
| 476 | 3300005842 | Ga0068858_100116828 | Ga0068858_1001168282 | 284 |
| 477 | 3300005843 | Ga0068860_100000542 | Ga0068860_10000054252 | 284 |
| 478 | 3300005843 | Ga0068860_100001605 | Ga0068860_1000016053 | 284 |
| 479 | 3300005844 | Ga0068862_100000422 | Ga0068862_10000042250 | 284 |
| 480 | 3300005844 | Ga0068862_100003787 | Ga0068862_1000037874 | 284 |
| 481 | 3300005937 | Ga0081455_10054128 | Ga0081455_100541282 | 284 |
| 482 | 3300005937 | Ga0081455_10330040 | Ga0081455_103300402 | 284 |
| 483 | 3300005981 | Ga0081538_10126763 | Ga0081538_101267632 | 284 |
| 484 | 3300006038 | Ga0075365_10002311 | Ga0075365_100023116 | 284 |
| 485 | 3300006038 | Ga0075365_10006639 | Ga0075365_100066393 | 284 |
| 486 | 3300006038 | Ga0075365_10034327 | Ga0075365_100343273 | 284 |
| 487 | 3300006042 | Ga0075368_10010682 | Ga0075368_100106823 | 284 |
| 488 | 3300006048 | Ga0075363_100000575 | Ga0075363_1000005759 | 284 |
| 489 | 3300006048 | Ga0075363_100001506 | Ga0075363_1000015064 | 284 |
| 490 | 3300006048 | Ga0075363_100003105 | Ga0075363_1000031053 | 284 |
| 491 | 3300006048 | Ga0075363_100083952 | Ga0075363_1000839522 | 284 |
| 492 | 3300006048 | Ga0075363_100088045 | Ga0075363_1000880452 | 284 |
| 493 | 3300006048 | Ga0075363_100102255 | Ga0075363_1001022552 | 284 |
| 494 | 3300006048 | Ga0075363_100218048 | Ga0075363_1002180482 | 284 |
| 495 | 3300006051 | Ga0075364_10007282 | Ga0075364_100072826 | 284 |
| 496 | 3300006051 | Ga0075364_10010478 | Ga0075364_100104784 | 284 |
| 497 | 3300006051 | Ga0075364_10018608 | Ga0075364_100186083 | 284 |
| 498 | 3300006051 | Ga0075364_10020437 | Ga0075364_100204373 | 284 |
| 499 | 3300006051 | Ga0075364_10025330 | Ga0075364_100253302 | 284 |
| 500 | 3300006051 | Ga0075364_10026875 | Ga0075364_100268752 | 284 |
| 501 | 3300006051 | Ga0075364_10056886 | Ga0075364_100568861 | 284 |
| 502 | 3300006051 | Ga0075364_10105487 | Ga0075364_101054872 | 284 |
| 503 | 3300006051 | Ga0075364_10150446 | Ga0075364_101504462 | 284 |
| 504 | 3300006051 | Ga0075364_10184613 | Ga0075364_101846132 | 284 |
| 505 | 3300006163 | Ga0070715_10070379 | Ga0070715_100703792 | 284 |
| 506 | 3300006173 | Ga0070716_100221822 | Ga0070716_1002218222 | 284 |
| 507 | 3300006175 | Ga0070712_100002266 | Ga0070712_1000022664 | 284 |
| 508 | 3300006175 | Ga0070712_100067471 | Ga0070712_1000674712 | 284 |
| 509 | 3300006178 | Ga0075367_10044122 | Ga0075367_100441222 | 284 |
| 510 | 3300006178 | Ga0075367_10053000 | Ga0075367_100530002 | 284 |
| 511 | 3300006186 | Ga0075369_10000575 | Ga0075369_1000057512 | 284 |
| 512 | 3300006186 | Ga0075369_10017701 | Ga0075369_100177012 | 284 |
| 513 | 3300006186 | Ga0075369_10028499 | Ga0075369_100284993 | 284 |
| 514 | 3300006186 | Ga0075369_10038689 | Ga0075369_100386892 | 284 |
| 515 | 3300006186 | Ga0075369_10044797 | Ga0075369_100447972 | 284 |
| 516 | 3300006186 | Ga0075369_10057658 | Ga0075369_100576582 | 284 |
| 517 | 3300006353 | Ga0075370_10000287 | Ga0075370_100002873 | 284 |
| 518 | 3300006353 | Ga0075370_10007884 | Ga0075370_100078845 | 284 |
| 519 | 3300006353 | Ga0075370_10046679 | Ga0075370_100466792 | 284 |
| 520 | 3300006353 | Ga0075370_10114042 | Ga0075370_101140422 | 284 |
| 521 | 3300006844 | Ga0075428_100025753 | Ga0075428_1000257537 | 284 |
| 522 | 3300006846 | Ga0075430_100079496 | Ga0075430_1000794962 | 284 |
| 523 | 3300006846 | Ga0075430_100152002 | Ga0075430_1001520022 | 284 |
| 524 | 3300006847 | Ga0075431_100044970 | Ga0075431_1000449704 | 284 |
| 525 | 3300006881 | Ga0068865_100134110 | Ga0068865_1001341102 | 284 |
| 526 | 3300006931 | Ga0097620_100000542 | Ga0097620_1000005423 | 284 |
| 527 | 3300006931 | Ga0097620_100006779 | Ga0097620_1000067795 | 284 |
| 528 | 3300006931 | Ga0097620_100614312 | Ga0097620_1006143122 | 284 |
| 529 | 3300009092 | Ga0105250_10063163 | Ga0105250_100631632 | 284 |
| 530 | 3300009094 | Ga0111539_10706926 | Ga0111539_107069261 | 284 |
| 531 | 3300009098 | Ga0105245_10003195 | Ga0105245_100031957 | 284 |
| 532 | 3300009101 | Ga0105247_10000058 | Ga0105247_1000005852 | 284 |
| 533 | 3300009101 | Ga0105247_10000456 | Ga0105247_1000045614 | 284 |
| 534 | 3300009101 | Ga0105247_10090669 | Ga0105247_100906691 | 284 |
| 535 | 3300009101 | Ga0105247_10202802 | Ga0105247_102028022 | 284 |
| 536 | 3300009147 | Ga0114129_10022769 | Ga0114129_100227693 | 284 |
| 537 | 3300009174 | Ga0105241_10010121 | Ga0105241_100101216 | 284 |
| 538 | 3300009176 | Ga0105242_10013523 | Ga0105242_100135235 | 284 |
| 539 | 3300009177 | Ga0105248_10000465 | Ga0105248_1000046553 | 284 |
| 540 | 3300009177 | Ga0105248_10007739 | Ga0105248_100077397 | 284 |
| 541 | 3300009177 | Ga0105248_10060085 | Ga0105248_100600852 | 284 |
| 542 | 3300009545 | Ga0105237_10000346 | Ga0105237_1000034629 | 284 |
| 543 | 3300009553 | Ga0105249_10000087 | Ga0105249_1000008785 | 284 |
| 544 | 3300009553 | Ga0105249_10061472 | Ga0105249_100614723 | 284 |
| 545 | 3300009553 | Ga0105249_10362262 | Ga0105249_103622622 | 284 |
| 546 | 3300010159 | Ga0099796_10023707 | Ga0099796_100237072 | 284 |
| 547 | 3300010375 | Ga0105239_10006651 | Ga0105239_100066513 | 284 |
| 548 | 3300010375 | Ga0105239_10008590 | Ga0105239_100085902 | 284 |
| 549 | 3300010375 | Ga0105239_10203058 | Ga0105239_102030582 | 284 |
| 550 | 3300011119 | Ga0105246_10081852 | Ga0105246_100818521 | 284 |
| 551 | 3300013296 | Ga0157374_10002901 | Ga0157374_1000290115 | 284 |
| 552 | 3300013297 | Ga0157378_10001141 | Ga0157378_1000114117 | 284 |
| 553 | 3300013306 | Ga0163162_10002035 | Ga0163162_1000203517 | 284 |
| 554 | 3300013306 | Ga0163162_10196156 | Ga0163162_101961562 | 284 |
| 555 | 3300013306 | Ga0163162_10256413 | Ga0163162_102564132 | 284 |
| 556 | 3300013306 | Ga0163162_10318504 | Ga0163162_103185041 | 284 |
| 557 | 3300013307 | Ga0157372_10002481 | Ga0157372_1000248114 | 284 |
| 558 | 3300013308 | Ga0157375_10001315 | Ga0157375_1000131519 | 284 |
| 559 | 3300014325 | Ga0163163_10012227 | Ga0163163_100122279 | 284 |
| 560 | 3300014325 | Ga0163163_10069609 | Ga0163163_100696092 | 284 |
| 561 | 3300014326 | Ga0157380_10010801 | Ga0157380_100108012 | 284 |
| 562 | 3300014326 | Ga0157380_10078474 | Ga0157380_100784742 | 284 |
| 563 | 3300014968 | Ga0157379_10078582 | Ga0157379_100785822 | 284 |
| 564 | 3300014968 | Ga0157379_10256357 | Ga0157379_102563572 | 284 |
| 565 | 3300014968 | Ga0157379_10598719 | Ga0157379_105987191 | 284 |
| 566 | 3300017792 | Ga0163161_10008010 | Ga0163161_100080103 | 284 |
| 567 | 3300021384 | Ga0213876_10003290 | Ga0213876_100032903 | 284 |
| 568 | 3300021384 | Ga0213876_10079654 | Ga0213876_100796541 | 284 |
| 569 | 3300021384 | Ga0213876_10101977 | Ga0213876_101019772 | 284 |
| 570 | 3300021384 | Ga0213876_10162039 | Ga0213876_101620391 | 284 |
| 571 | 3300025303 | Ga0209051_1000374 | Ga0209051_100037431 | 284 |
| 572 | 3300025303 | Ga0209051_1001633 | Ga0209051_100163310 | 284 |
| 573 | 3300025303 | Ga0209051_1010559 | Ga0209051_10105593 | 284 |
| 574 | 3300025303 | Ga0209051_1014037 | Ga0209051_10140372 | 284 |
| 575 | 3300025898 | Ga0207692_10002728 | Ga0207692_100027284 | 284 |
| 576 | 3300025899 | Ga0207642_10000428 | Ga0207642_100004283 | 284 |
| 577 | 3300025900 | Ga0207710_10000085 | Ga0207710_1000008550 | 284 |
| 578 | 3300025900 | Ga0207710_10002660 | Ga0207710_100026604 | 284 |
| 579 | 3300025901 | Ga0207688_10000504 | Ga0207688_100005047 | 284 |
| 580 | 3300025903 | Ga0207680_10059263 | Ga0207680_100592632 | 284 |
| 581 | 3300025904 | Ga0207647_10043111 | Ga0207647_100431112 | 284 |
| 582 | 3300025907 | Ga0207645_10006092 | Ga0207645_100060923 | 284 |
| 583 | 3300025914 | Ga0207671_10010010 | Ga0207671_100100105 | 284 |
| 584 | 3300025915 | Ga0207693_10000189 | Ga0207693_1000018957 | 284 |
| 585 | 3300025915 | Ga0207693_10000743 | Ga0207693_100007432 | 284 |
| 586 | 3300025916 | Ga0207663_10006285 | Ga0207663_100062855 | 284 |
| 587 | 3300025916 | Ga0207663_10111286 | Ga0207663_101112862 | 284 |
| 588 | 3300025919 | Ga0207657_10072884 | Ga0207657_100728842 | 284 |
| 589 | 3300025919 | Ga0207657_10175928 | Ga0207657_101759282 | 284 |
| 590 | 3300025923 | Ga0207681_10001891 | Ga0207681_1000189110 | 284 |
| 591 | 3300025923 | Ga0207681_10017104 | Ga0207681_100171042 | 284 |
| 592 | 3300025927 | Ga0207687_10004168 | Ga0207687_100041686 | 284 |
| 593 | 3300025929 | Ga0207664_10272283 | Ga0207664_102722831 | 284 |
| 594 | 3300025931 | Ga0207644_10126237 | Ga0207644_101262373 | 284 |
| 595 | 3300025932 | Ga0207690_10061846 | Ga0207690_100618462 | 284 |
| 596 | 3300025932 | Ga0207690_10092039 | Ga0207690_100920393 | 284 |
| 597 | 3300025933 | Ga0207706_10001089 | Ga0207706_1000108925 | 284 |
| 598 | 3300025933 | Ga0207706_10031536 | Ga0207706_100315364 | 284 |
| 599 | 3300025934 | Ga0207686_10014685 | Ga0207686_100146852 | 284 |
| 600 | 3300025936 | Ga0207670_10031218 | Ga0207670_100312183 | 284 |
| 601 | 3300025937 | Ga0207669_10001764 | Ga0207669_100017644 | 284 |
| 602 | 3300025938 | Ga0207704_10002051 | Ga0207704_100020514 | 284 |
| 603 | 3300025938 | Ga0207704_10095565 | Ga0207704_100955652 | 284 |
| 604 | 3300025939 | Ga0207665_10001533 | Ga0207665_100015339 | 284 |
| 605 | 3300025940 | Ga0207691_10039908 | Ga0207691_100399083 | 284 |
| 606 | 3300025941 | Ga0207711_10000071 | Ga0207711_1000007166 | 284 |
| 607 | 3300025941 | Ga0207711_10084560 | Ga0207711_100845602 | 284 |
| 608 | 3300025942 | Ga0207689_10001274 | Ga0207689_1000127421 | 284 |
| 609 | 3300025960 | Ga0207651_10155507 | Ga0207651_101555072 | 284 |
| 610 | 3300025961 | Ga0207712_10000040 | Ga0207712_10000040136 | 284 |
| 611 | 3300025972 | Ga0207668_10000208 | Ga0207668_1000020835 | 284 |
| 612 | 3300025972 | Ga0207668_10001301 | Ga0207668_100013018 | 284 |
| 613 | 3300025972 | Ga0207668_10171930 | Ga0207668_101719301 | 284 |
| 614 | 3300025981 | Ga0207640_10002912 | Ga0207640_100029126 | 284 |
| 615 | 3300025986 | Ga0207658_10000121 | Ga0207658_1000012136 | 284 |
| 616 | 3300025986 | Ga0207658_10014319 | Ga0207658_100143193 | 284 |
| 617 | 3300026023 | Ga0207677_10000688 | Ga0207677_1000068820 | 284 |
| 618 | 3300026023 | Ga0207677_10064885 | Ga0207677_100648853 | 284 |
| 619 | 3300026035 | Ga0207703_10083706 | Ga0207703_100837063 | 284 |
| 620 | 3300026035 | Ga0207703_10265569 | Ga0207703_102655692 | 284 |
| 621 | 3300026041 | Ga0207639_10001989 | Ga0207639_100019897 | 284 |
| 622 | 3300026041 | Ga0207639_10019463 | Ga0207639_100194632 | 284 |
| 623 | 3300026041 | Ga0207639_10219188 | Ga0207639_102191882 | 284 |
| 624 | 3300026067 | Ga0207678_10022754 | Ga0207678_100227545 | 284 |
| 625 | 3300026067 | Ga0207678_10036534 | Ga0207678_100365344 | 284 |
| 626 | 3300026067 | Ga0207678_10179167 | Ga0207678_101791672 | 284 |
| 627 | 3300026075 | Ga0207708_10025321 | Ga0207708_100253212 | 284 |
| 628 | 3300026075 | Ga0207708_10096973 | Ga0207708_100969733 | 284 |
| 629 | 3300026088 | Ga0207641_10000485 | Ga0207641_1000048547 | 284 |
| 630 | 3300026088 | Ga0207641_10001669 | Ga0207641_1000166921 | 284 |
| 631 | 3300026088 | Ga0207641_10210463 | Ga0207641_102104632 | 284 |
| 632 | 3300026088 | Ga0207641_10255848 | Ga0207641_102558482 | 284 |
| 633 | 3300026089 | Ga0207648_10011780 | Ga0207648_100117807 | 284 |
| 634 | 3300026095 | Ga0207676_10097556 | Ga0207676_100975562 | 284 |
| 635 | 3300026095 | Ga0207676_10335546 | Ga0207676_103355462 | 284 |
| 636 | 3300026118 | Ga0207675_100000325 | Ga0207675_10000032531 | 284 |
| 637 | 3300026118 | Ga0207675_100050760 | Ga0207675_1000507604 | 284 |
| 638 | 3300026118 | Ga0207675_100566335 | Ga0207675_1005663352 | 284 |
| 639 | 3300026118 | Ga0207675_100813110 | Ga0207675_1008131101 | 284 |
| 640 | 3300026121 | Ga0207683_10002228 | Ga0207683_100022288 | 284 |
| 641 | 3300026142 | Ga0207698_10082268 | Ga0207698_100822682 | 284 |
| 642 | 3300026142 | Ga0207698_10179610 | Ga0207698_101796102 | 284 |
| 643 | 3300026142 | Ga0207698_10191376 | Ga0207698_101913761 | 284 |
| 644 | 3300027866 | Ga0209813_10031716 | Ga0209813_100317162 | 284 |
| 645 | 3300028379 | Ga0268266_10004980 | Ga0268266_100049803 | 284 |
| 646 | 3300028379 | Ga0268266_10005247 | Ga0268266_100052472 | 284 |
| 647 | 3300028379 | Ga0268266_10031978 | Ga0268266_100319783 | 284 |
| 648 | 3300028380 | Ga0268265_10000004 | Ga0268265_10000004501 | 284 |
| 649 | 3300028380 | Ga0268265_10010963 | Ga0268265_100109633 | 284 |
| 650 | 3300028381 | Ga0268264_10000133 | Ga0268264_10000133136 | 284 |
| 651 | 3300028381 | Ga0268264_10012339 | Ga0268264_100123394 | 284 |
| 652 | 3300028381 | Ga0268264_10472293 | Ga0268264_104722931 | 284 |
| 653 | 3300031731 | Ga0307405_10117105 | Ga0307405_101171052 | 284 |
| 654 | 3300032002 | Ga0307416_100105520 | Ga0307416_1001055202 | 284 |
| 655 | 3300032126 | Ga0307415_100089643 | Ga0307415_1000896432 | 284 |
| 656 | 3300032126 | Ga0307415_100239283 | Ga0307415_1002392832 | 284 |
| 657 | 3300035691 | Ga0373931_0033382 | Ga0373931_0033382_599_1453 | 284 |
| 658 | 3300035691 | Ga0373931_0110279 | Ga0373931_0110279_194_1048 | 284 |
| 659 | 3300037853 | Ga0436364_0577957 | Ga0436364_0577957_1262_2116 | 284 |
| 660 | 3300039437 | Ga0436365_1378611 | Ga0436365_1378611_54591_55445 | 284 |
| 661 | 3300039437 | Ga0436365_1417225 | Ga0436365_1417225_5839_6693 | 284 |
| 662 | 3300039437 | Ga0436365_1640827 | Ga0436365_1640827_15168_16022 | 284 |
| 663 | 3300039447 | Ga0436361_1011110 | Ga0436361_1011110_174_1028 | 284 |
| 664 | 3300039450 | Ga0436363_0109061 | Ga0436363_0109061_532_1386 | 284 |
| 665 | 3300041411 | Ga0439466_0020266 | Ga0439466_0020266_1493_2347 | 284 |
| 666 | 3300041411 | Ga0439466_0034855 | Ga0439466_0034855_820_1674 | 284 |
| 667 | 3300041411 | Ga0439466_0047681 | Ga0439466_0047681_156_1010 | 284 |
| 668 | 3300041413 | Ga0439465_0003626 | Ga0439465_0003626_463_1317 | 284 |
| 669 | 3300041413 | Ga0439465_0012682 | Ga0439465_0012682_1186_2040 | 284 |
| 670 | 3300041413 | Ga0439465_0017398 | Ga0439465_0017398_469_1323 | 284 |
| 671 | 3300041413 | Ga0439465_0018610 | Ga0439465_0018610_597_1451 | 284 |
| 672 | 3300041512 | Ga0451853_3968863 | Ga0451853_3968863_361_1215 | 284 |
| 673 | 3300041997 | Ga0439431_0000223 | Ga0439431_0000223_7675_8529 | 284 |
| 674 | 3300042002 | Ga0439442_031735 | Ga0439442_031735_163_1017 | 284 |
| 675 | 3300042435 | Ga0439434_0002239 | Ga0439434_0002239_3138_3992 | 284 |
| 676 | 3300042435 | Ga0439434_0008604 | Ga0439434_0008604_267_1121 | 284 |
| 677 | 3300044656 | Ga0466969_0015046 | Ga0466969_0015046_1012_1866 | 284 |
| 678 | 3300044658 | Ga0466972_0009068 | Ga0466972_0009068_2223_3077 | 284 |
| 679 | 3300044658 | Ga0466972_0012833 | Ga0466972_0012833_1971_2825 | 284 |
| 680 | 3300044658 | Ga0466972_0022560 | Ga0466972_0022560_54_908 | 284 |
| 681 | 3300044683 | Ga0466965_0006718 | Ga0466965_0006718_3567_4421 | 284 |
| 682 | 3300044684 | Ga0466966_0015855 | Ga0466966_0015855_912_1766 | 284 |
| 683 | 3300044684 | Ga0466966_0026947 | Ga0466966_0026947_2763_3617 | 284 |
| 684 | 3300044693 | Ga0466961_0007565 | Ga0466961_0007565_4998_5852 | 284 |
| 685 | 3300044693 | Ga0466961_0034568 | Ga0466961_0034568_319_1173 | 284 |
| 686 | 3300044706 | Ga0466964_0153453 | Ga0466964_0153453_36_890 | 284 |
| 687 | 3300044719 | Ga0466971_0009900 | Ga0466971_0009900_101_955 | 284 |
| 688 | 3300044719 | Ga0466971_0031204 | Ga0466971_0031204_1386_2240 | 284 |
| 689 | 3300044719 | Ga0466971_0059790 | Ga0466971_0059790_143_997 | 284 |
| 690 | 3300044735 | Ga0466968_0000170 | Ga0466968_0000170_4797_5651 | 284 |
| 691 | 3300044735 | Ga0466968_0009892 | Ga0466968_0009892_2102_2956 | 284 |
| 692 | 3300044735 | Ga0466968_0021214 | Ga0466968_0021214_906_1760 | 284 |
| 693 | 3300044735 | Ga0466968_0044145 | Ga0466968_0044145_163_1017 | 284 |
| 694 | 3300044765 | Ga0466970_0023560 | Ga0466970_0023560_2257_3111 | 284 |
| 695 | 3300044765 | Ga0466970_0063050 | Ga0466970_0063050_215_1069 | 284 |
| 696 | 3300044765 | Ga0466970_0132124 | Ga0466970_0132124_502_1356 | 284 |
| 697 | 3300044842 | Ga0466957_0004576 | Ga0466957_0004576_919_1773 | 284 |
| 698 | 3300044842 | Ga0466957_0023286 | Ga0466957_0023286_14_868 | 284 |
| 699 | 3300044901 | Ga0466960_0000215 | Ga0466960_0000215_7830_8684 | 284 |
| 700 | 3300044901 | Ga0466960_0000976 | Ga0466960_0000976_4607_5461 | 284 |
| 701 | 3300044901 | Ga0466960_0002924 | Ga0466960_0002924_4689_5543 | 284 |
| 702 | 3300045049 | Ga0466959_0011763 | Ga0466959_0011763_3559_4413 | 284 |
| 703 | 3300045049 | Ga0466959_0030379 | Ga0466959_0030379_601_1455 | 284 |
| 704 | 3300045049 | Ga0466959_0061259 | Ga0466959_0061259_643_1497 | 284 |
| 705 | 3300045049 | Ga0466959_0108279 | Ga0466959_0108279_915_1769 | 284 |
| 706 | 3300045049 | Ga0466959_0113975 | Ga0466959_0113975_514_1368 | 284 |
| 707 | 3300045836 | Ga0466958_0008792 | Ga0466958_0008792_4462_5316 | 284 |
| 708 | 3300045836 | Ga0466958_0009085 | Ga0466958_0009085_3513_4367 | 284 |
| 709 | 3300045836 | Ga0466958_0073046 | Ga0466958_0073046_454_1308 | 284 |
| 710 | 3300045836 | Ga0466958_0138118 | Ga0466958_0138118_161_1015 | 284 |
| 711 | 3300045976 | Ga0466967_0020224 | Ga0466967_0020224_934_1788 | 284 |
| 712 | 3300045976 | Ga0466967_0029940 | Ga0466967_0029940_1504_2358 | 284 |
| 713 | 3300045976 | Ga0466967_0053479 | Ga0466967_0053479_1526_2380 | 284 |
| 714 | 3300045976 | Ga0466967_0105439 | Ga0466967_0105439_247_1101 | 284 |
| 715 | 3300045976 | Ga0466967_0136917 | Ga0466967_0136917_644_1498 | 284 |
| 716 | 3300046460 | Ga0495638_0006493 | Ga0495638_0006493_143_997 | 284 |
| 717 | 3300046507 | Ga0495606_0119931 | Ga0495606_0119931_52_906 | 284 |
| 718 | 3300046648 | Ga0495611_0084262 | Ga0495611_0084262_511_1365 | 284 |
| 719 | 3300046663 | Ga0495635_0160770 | Ga0495635_0160770_539_1393 | 284 |
| 720 | 3300046683 | Ga0495658_0014104 | Ga0495658_0014104_2347_3201 | 284 |
| 721 | 3300046694 | Ga0495649_0142910 | Ga0495649_0142910_392_1246 | 284 |
| 722 | 3300047320 | Ga0495672_0030117 | Ga0495672_0030117_48_902 | 284 |
| 723 | 3300047472 | Ga0495686_0002058 | Ga0495686_0002058_12293_13147 | 284 |
| 724 | 3300048091 | Ga0495626_0024357 | Ga0495626_0024357_728_1582 | 284 |
| 725 | 3300048903 | Ga0496100_0010615 | Ga0496100_0010615_4089_4943 | 284 |
| 726 | 3300048903 | Ga0496100_0041110 | Ga0496100_0041110_356_1210 | 284 |
| 727 | 3300048903 | Ga0496100_0056441 | Ga0496100_0056441_515_1369 | 284 |
| 728 | 3300048903 | Ga0496100_0161472 | Ga0496100_0161472_428_1282 | 284 |
| 729 | 3300048904 | Ga0496101_0000077 | Ga0496101_0000077_64597_65451 | 284 |
| 730 | 3300048904 | Ga0496101_0009771 | Ga0496101_0009771_4222_5076 | 284 |
| 731 | 3300048904 | Ga0496101_0015917 | Ga0496101_0015917_137_991 | 284 |
| 732 | 3300048904 | Ga0496101_0021950 | Ga0496101_0021950_899_1753 | 284 |
| 733 | 3300048904 | Ga0496101_0061879 | Ga0496101_0061879_1775_2629 | 284 |
| 734 | 3300048904 | Ga0496101_0092140 | Ga0496101_0092140_453_1307 | 284 |
| 735 | 3300048905 | Ga0496102_0000037 | Ga0496102_0000037_133755_134609 | 284 |
| 736 | 3300048905 | Ga0496102_0003075 | Ga0496102_0003075_8910_9764 | 284 |
| 737 | 3300048905 | Ga0496102_0063349 | Ga0496102_0063349_2287_3141 | 284 |
| 738 | 3300048905 | Ga0496102_0113661 | Ga0496102_0113661_1377_2231 | 284 |
| 739 | 3300048905 | Ga0496102_0153245 | Ga0496102_0153245_1202_2056 | 284 |
| 740 | 3300048905 | Ga0496102_0442665 | Ga0496102_0442665_82_936 | 284 |
| 741 | 3300048906 | Ga0496103_0000004 | Ga0496103_0000004_444467_445321 | 284 |
| 742 | 3300048906 | Ga0496103_0004671 | Ga0496103_0004671_5810_6664 | 284 |
| 743 | 3300048906 | Ga0496103_0036445 | Ga0496103_0036445_952_1806 | 284 |
| 744 | 3300048907 | Ga0496104_0051338 | Ga0496104_0051338_2584_3438 | 284 |
| 745 | 3300048907 | Ga0496104_0164267 | Ga0496104_0164267_371_1225 | 284 |
| 746 | 3300048907 | Ga0496104_0281674 | Ga0496104_0281674_694_1548 | 284 |
| 747 | 3300048907 | Ga0496104_0537996 | Ga0496104_0537996_160_1014 | 284 |
| 748 | 3300048908 | Ga0496105_0001753 | Ga0496105_0001753_12934_13788 | 284 |
| 749 | 3300048908 | Ga0496105_0159289 | Ga0496105_0159289_646_1500 | 284 |
| 750 | 3300048909 | Ga0496106_0001893 | Ga0496106_0001893_2990_3844 | 284 |
| 751 | 3300048909 | Ga0496106_0003936 | Ga0496106_0003936_2587_3441 | 284 |
| 752 | 3300048909 | Ga0496106_0116951 | Ga0496106_0116951_666_1520 | 284 |
| 753 | 3300048909 | Ga0496106_0219695 | Ga0496106_0219695_199_1053 | 284 |
| 754 | 3300048909 | Ga0496106_0317509 | Ga0496106_0317509_157_1011 | 284 |
| 755 | 3300048910 | Ga0496107_0000516 | Ga0496107_0000516_16009_16863 | 284 |
| 756 | 3300048910 | Ga0496107_0021871 | Ga0496107_0021871_2851_3705 | 284 |
| 757 | 3300048910 | Ga0496107_0147240 | Ga0496107_0147240_579_1433 | 284 |
| 758 | 3300048911 | Ga0496108_0000985 | Ga0496108_0000985_11022_11876 | 284 |
| 759 | 3300048911 | Ga0496108_0055065 | Ga0496108_0055065_1482_2345 | 284 |
| 760 | 3300048911 | Ga0496108_0073165 | Ga0496108_0073165_1060_1914 | 284 |
| 761 | 3300048911 | Ga0496108_0163421 | Ga0496108_0163421_610_1464 | 284 |
| 762 | 3300048912 | Ga0496109_0067923 | Ga0496109_0067923_1770_2624 | 284 |
| 763 | 3300048912 | Ga0496109_0097485 | Ga0496109_0097485_1095_1958 | 284 |
| 764 | 3300048912 | Ga0496109_0112964 | Ga0496109_0112964_845_1699 | 284 |
| 765 | 3300048912 | Ga0496109_0129241 | Ga0496109_0129241_785_1639 | 284 |
| 766 | 3300048912 | Ga0496109_0319740 | Ga0496109_0319740_357_1211 | 284 |
| 767 | 3300048913 | Ga0496110_0044929 | Ga0496110_0044929_751_1605 | 284 |
| 768 | 3300048913 | Ga0496110_0057528 | Ga0496110_0057528_802_1656 | 284 |
| 769 | 3300048913 | Ga0496110_0458166 | Ga0496110_0458166_159_1013 | 284 |
| 770 | 3300048914 | Ga0496111_0167342 | Ga0496111_0167342_446_1300 | 284 |
| 771 | 3300048914 | Ga0496111_0323264 | Ga0496111_0323264_213_1067 | 284 |
| 772 | 3300048915 | Ga0496112_0041223 | Ga0496112_0041223_2283_3137 | 284 |
| 773 | 3300048915 | Ga0496112_0053869 | Ga0496112_0053869_1326_2180 | 284 |
| 774 | 3300048915 | Ga0496112_0065270 | Ga0496112_0065270_763_1617 | 284 |
| 775 | 3300048915 | Ga0496112_0160339 | Ga0496112_0160339_359_1213 | 284 |
| 776 | 3300048915 | Ga0496112_0299157 | Ga0496112_0299157_426_1280 | 284 |
| 777 | 3300048915 | Ga0496112_0365714 | Ga0496112_0365714_175_1029 | 284 |
| 778 | 3300048916 | Ga0496113_0023349 | Ga0496113_0023349_2084_2938 | 284 |
| 779 | 3300048916 | Ga0496113_0125046 | Ga0496113_0125046_842_1696 | 284 |
| 780 | 3300048916 | Ga0496113_0165649 | Ga0496113_0165649_232_1086 | 284 |
| 781 | 3300048917 | Ga0496114_0000849 | Ga0496114_0000849_19267_20121 | 284 |
| 782 | 3300048917 | Ga0496114_0005631 | Ga0496114_0005631_4658_5512 | 284 |
| 783 | 3300048917 | Ga0496114_0084856 | Ga0496114_0084856_424_1287 | 284 |
| 784 | 3300048917 | Ga0496114_0178200 | Ga0496114_0178200_131_985 | 284 |
| 785 | 3300048917 | Ga0496114_0540680 | Ga0496114_0540680_45_899 | 284 |
| 786 | 3300048918 | Ga0496115_0001951 | Ga0496115_0001951_12217_13071 | 284 |
| 787 | 3300048919 | Ga0496116_0000056 | Ga0496116_0000056_237374_238228 | 284 |
| 788 | 3300048920 | Ga0496117_0000003 | Ga0496117_0000003_1642870_1643724 | 284 |
| 789 | 3300048921 | Ga0496118_0000001 | Ga0496118_0000001_1642873_1643727 | 284 |
| 790 | 3300048922 | Ga0496119_0034519 | Ga0496119_0034519_856_1710 | 284 |
| 791 | 3300048923 | Ga0496120_0006402 | Ga0496120_0006402_6697_7551 | 284 |
| 792 | 3300048925 | Ga0496122_0007065 | Ga0496122_0007065_10242_11096 | 284 |
| 793 | 3300048926 | Ga0496123_0005870 | Ga0496123_0005870_6205_7059 | 284 |
| 794 | 3300048929 | Ga0496126_0000735 | Ga0496126_0000735_43904_44758 | 284 |
| 795 | 3300048929 | Ga0496126_0014618 | Ga0496126_0014618_688_1542 | 284 |
| 796 | 3300049569 | Ga0501032_0056083 | Ga0501032_0056083_1246_2100 | 284 |
| 797 | 3300049569 | Ga0501032_0182474 | Ga0501032_0182474_116_976 | 284 |
| 798 | 3300049570 | Ga0501033_0026959 | Ga0501033_0026959_497_1351 | 284 |
| 799 | 3300049570 | Ga0501033_0154317 | Ga0501033_0154317_238_1092 | 284 |
| 800 | 3300049571 | Ga0501034_0002114 | Ga0501034_0002114_22965_23819 | 284 |
| 801 | 3300049571 | Ga0501034_0055564 | Ga0501034_0055564_798_1652 | 284 |
| 802 | 3300049571 | Ga0501034_0084203 | Ga0501034_0084203_798_1652 | 284 |
| 803 | 3300049571 | Ga0501034_0187097 | Ga0501034_0187097_35_889 | 284 |
| 804 | 3300049572 | Ga0501036_0104904 | Ga0501036_0104904_1047_1901 | 284 |
| 805 | 3300049573 | Ga0501037_0001890 | Ga0501037_0001890_9153_10007 | 284 |
| 806 | 3300049573 | Ga0501037_0014338 | Ga0501037_0014338_1462_2316 | 284 |
| 807 | 3300049574 | Ga0501038_0008303 | Ga0501038_0008303_6031_6885 | 284 |
| 808 | 3300049575 | Ga0501039_0000951 | Ga0501039_0000951_15104_15958 | 284 |
| 809 | 3300049579 | Ga0501043_0004425 | Ga0501043_0004425_5039_5893 | 284 |
| 810 | 3300049579 | Ga0501043_0070913 | Ga0501043_0070913_821_1675 | 284 |
| 811 | 3300049579 | Ga0501043_0137219 | Ga0501043_0137219_50_904 | 284 |
| 812 | 3300049580 | Ga0501046_0008048 | Ga0501046_0008048_337_1191 | 284 |
| 813 | 3300049581 | Ga0501047_0117374 | Ga0501047_0117374_1599_2453 | 284 |
| 814 | 3300049581 | Ga0501047_0176255 | Ga0501047_0176255_753_1607 | 284 |
| 815 | 3300049581 | Ga0501047_0476651 | Ga0501047_0476651_94_948 | 284 |
| 816 | 3300049582 | Ga0501048_0236494 | Ga0501048_0236494_170_1024 | 284 |
| 817 | 3300049586 | Ga0501070_0005284 | Ga0501070_0005284_8691_9545 | 284 |
| 818 | 3300049586 | Ga0501070_0035570 | Ga0501070_0035570_1947_2801 | 284 |
| 819 | 3300049589 | Ga0501073_0014064 | Ga0501073_0014064_2063_2917 | 284 |
| 820 | 3300049589 | Ga0501073_0043339 | Ga0501073_0043339_1502_2356 | 284 |
| 821 | 3300049742 | Ga0501080_0257036 | Ga0501080_0257036_447_1301 | 284 |
| 822 | 3300049822 | Ga0501035_0001031 | Ga0501035_0001031_11754_12608 | 284 |
| 823 | 3300049822 | Ga0501035_0002606 | Ga0501035_0002606_2726_3580 | 284 |
| 824 | 3300049823 | Ga0501044_0001769 | Ga0501044_0001769_359_1213 | 284 |
| 825 | 3300049823 | Ga0501044_0004936 | Ga0501044_0004936_1843_2697 | 284 |
| 826 | 3300049823 | Ga0501044_0022732 | Ga0501044_0022732_4058_4912 | 284 |
| 827 | 3300049823 | Ga0501044_0034133 | Ga0501044_0034133_3683_4543 | 284 |
| 828 | 3300050489 | nmdc:mga03683_21801_c1 | nmdc:mga03683_21801_c1_676_1530 | 284 |
| 829 | 3300050490 | nmdc:mga03n38_107347_c1 | nmdc:mga03n38_107347_c1_143_997 | 284 |
| 830 | 3300050490 | nmdc:mga03n38_51374_c1 | nmdc:mga03n38_51374_c1_572_1426 | 284 |
| 831 | 3300050490 | nmdc:mga03n38_80418_c1 | nmdc:mga03n38_80418_c1_482_1336 | 284 |
| 832 | 3300050491 | nmdc:mga00v17_13203_c1 | nmdc:mga00v17_13203_c1_3042_3896 | 284 |
| 833 | 3300050491 | nmdc:mga00v17_15026_c1 | nmdc:mga00v17_15026_c1_1067_1921 | 284 |
| 834 | 3300050491 | nmdc:mga00v17_163178_c1 | nmdc:mga00v17_163178_c1_314_1168 | 284 |
| 835 | 3300050491 | nmdc:mga00v17_17192_c1 | nmdc:mga00v17_17192_c1_2815_3669 | 284 |
| 836 | 3300050491 | nmdc:mga00v17_19115_c1 | nmdc:mga00v17_19115_c1_1731_2585 | 284 |
| 837 | 3300050491 | nmdc:mga00v17_4361_c1 | nmdc:mga00v17_4361_c1_6319_7173 | 284 |
| 838 | 3300050491 | nmdc:mga00v17_8290_c1 | nmdc:mga00v17_8290_c1_4433_5287 | 284 |
| 839 | 3300050492 | nmdc:mga0yw44_20059_c1 | nmdc:mga0yw44_20059_c1_2373_3227 | 284 |
| 840 | 3300050492 | nmdc:mga0yw44_44143_c1 | nmdc:mga0yw44_44143_c1_1048_1902 | 284 |
| 841 | 3300050494 | nmdc:mga06z11_11103_c1 | nmdc:mga06z11_11103_c1_615_1469 | 284 |
| 842 | 3300050495 | nmdc:mga04h51_36647_c1 | nmdc:mga04h51_36647_c1_511_1365 | 284 |
| 843 | 3300050496 | nmdc:mga07m45_3242_c1 | nmdc:mga07m45_3242_c1_3104_3958 | 284 |
| 844 | 3300050496 | nmdc:mga07m45_60598_c2 | nmdc:mga07m45_60598_c2_39_893 | 284 |
| 845 | 3300050507 | nmdc:mga05p37_38534_c1 | nmdc:mga05p37_38534_c1_3371_4225 | 284 |
| 846 | 3300050509 | nmdc:mga0qj67_7034_c1 | nmdc:mga0qj67_7034_c1_6822_7676 | 284 |
| 847 | 3300050509 | nmdc:mga0qj67_72643_c1 | nmdc:mga0qj67_72643_c1_1094_1948 | 284 |
| 848 | 3300050510 | nmdc:mga06r32_51989_c1 | nmdc:mga06r32_51989_c1_2620_3474 | 284 |
| 849 | 3300050511 | nmdc:mga08y16_522175_c1 | nmdc:mga08y16_522175_c1_244_1098 | 284 |
| 850 | 3300050516 | nmdc:mga0sz30_14784_c1 | nmdc:mga0sz30_14784_c1_419_1273 | 284 |
| 851 | 3300050516 | nmdc:mga0sz30_1985_c1 | nmdc:mga0sz30_1985_c1_2507_3361 | 284 |
| 852 | 3300050516 | nmdc:mga0sz30_4443_c1 | nmdc:mga0sz30_4443_c1_3488_4342 | 284 |
| 853 | 3300050516 | nmdc:mga0sz30_90242_c1 | nmdc:mga0sz30_90242_c1_210_1103 | 284 |
| 854 | 3300053080 | Ga0500635_0005140 | Ga0500635_0005140_1336_2190 | 284 |
| 855 | 3300053087 | Ga0500643_002707 | Ga0500643_002707_5000_5854 | 284 |
| 856 | 3300053087 | Ga0500643_005848 | Ga0500643_005848_658_1512 | 284 |
| 857 | 3300053096 | Ga0500641_0047176 | Ga0500641_0047176_377_1231 | 284 |
| 858 | 3300053104 | Ga0500556_0003029 | Ga0500556_0003029_831_1685 | 284 |
| 859 | 3300053108 | Ga0500562_006252 | Ga0500562_006252_1153_2007 | 284 |
| 860 | 3300053131 | Ga0500652_001797 | Ga0500652_001797_4539_5393 | 284 |
| 861 | 3300053131 | Ga0500652_017942 | Ga0500652_017942_208_1062 | 284 |
| 862 | 3300053134 | Ga0500658_0074833 | Ga0500658_0074833_207_1061 | 284 |
| 863 | 3300053146 | Ga0500588_0013486 | Ga0500588_0013486_244_1098 | 284 |
| 864 | 3300053153 | Ga0500616_0025979 | Ga0500616_0025979_1108_1962 | 284 |
| 865 | 3300053158 | Ga0500627_0005307 | Ga0500627_0005307_2994_3848 | 284 |
| 866 | 3300061719 | Ga0466962_0007816 | Ga0466962_0007816_3744_4598 | 284 |
| 867 | 3300061719 | Ga0466962_0083994 | Ga0466962_0083994_74_928 | 284 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5i0c-assembly1.cif.gz_A | crystal structure of predicted acyltransferase yjdj with acyl-coa n-acyltransferase domain from escherichia coli str. k-12 | 0.8931 | 193 | 250 |
| 5isv-assembly2.cif.gz_B | crystal structure of the ribosomal-protein-s18-alanine n-acetyltransferase from escherichia coli | 0.8338 | 194 | 283 |
| 3d2p-assembly1.cif.gz_A | crystal structure of n-acetylglutamate synthase from neisseria gonorrhoeae complexed with coenzyme a and l-arginine | 0.8261 | 185 | 248 |
| 2cnt-assembly4.cif.gz_D | rimi - ribosomal s18 n-alpha-protein acetyltransferase in complex with coenzymea. | 0.8113 | 194 | 283 |
| 7ypu-assembly2.cif.gz_D | orfe-coa-glycylthricin complex | 0.8075 | 193 | 280 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I6XFI7_58_284_3.40.630.30 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.9967 | 58 | 284 | 3.40.630.30 |
| af_I6XFI7_58_284_3.40.630.30 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.9923 | 58 | 284 | 3.40.630.30 |
| 5i0cA00 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.8752 | 193 | 250 | 3.40.630.30 |
| af_D4A230_16_108_3.40.630.30 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.8548 | 193 | 254 | 3.40.630.30 |
| af_E7EZI9_69_205_3.40.630.30 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.8511 | 194 | 275 | 3.40.630.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A842GSR9-F1-model_v4 | deleted | 0.9925 | 15 | 284 |
|
| AF-A0A0U0SN66-F1-model_v4 | Gcn5-related N-acetyltransferase (EC 2.3.1.-) | 0.9915 | 131 | 284 |
GO:0016747
|
| AF-K5B8N6-F1-model_v4 | Acetyltransferase family protein | 0.9909 | 146 | 284 |
GO:0016747
|
| AF-C0ZY28-F1-model_v4 | N-acetyltransferase domain-containing protein | 0.9879 | 15 | 284 |
GO:0016747
|
| AF-A0A840F0N9-F1-model_v4 | N-acetyltransferase domain-containing protein | 0.9861 | 25 | 284 |
GO:0016747
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar