F484063

General Info

Members Datasets Scaffolds Average Seq Length
867 411 840 284

Family's Representative Sequence

Representative Sequence 3300048928|Ga0496125_0000079|Ga0496125_0000079_210263_211231
Length 322
Sequence VRVTVGDGGPDAAPGCDVVHNQGMVAPRATALGGRTGAVVLADADVPAALAVCAVDPVASVLASSRLLQAAEQGVRRAGGELWGYAEDGALHAVCWVGANLVPVLGTSDPDVVSRALTAFADLGAARGRRCSSIVGAAEPVLGLWSRLRRSWPAEREVRAHQPSMVLDTDPRVAPDPRVRRSRPDEYDLVLPACVRMFTEEVGYSPASGPGGPYEVRVRRLVEEGRSFVLVDRGTWRRPRVVFKAEVPAVALGVAQVQGVWVEPERRGERLSEGGMAAVVEATRADVAPVVSLYVNGYNTRAVRAYEAVGFREVGAYATVLF

Samples

Sample ID Description Type Environment
1 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
2 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
3 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
4 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
5 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
6 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
7 2738541272 Promicromonospora sp. AC04 Isolate Unclassified
8 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
9 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
10 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
11 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
12 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
13 2808606394 Promicromonospora sp. C35 Isolate Unclassified
14 2811994880 Cellulomonas sp. SLBN-39 Isolate Unclassified
15 2839986021 Cellulosimicrobium cellulans JZ5 Isolate Unclassified
16 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
17 2884994152 Cellulomonas sp. H30R-01 Isolate Rhizosphere
18 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
19 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
20 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
21 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
22 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
23 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
24 2932431166 Cellulosimicrobium sp. 4261 Isolate Rhizosphere
25 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
26 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
27 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
28 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
29 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
30 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
31 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
32 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
33 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
34 3300003285 Grassland soil microbial communities from Hopland, California, USA - Sample H3_Rhizo_39 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
35 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
36 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
37 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
38 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
39 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
40 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
41 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
42 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
43 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
44 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
45 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
46 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
47 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
48 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
49 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
50 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
51 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
52 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
53 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
54 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
55 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
56 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
57 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
58 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
59 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
60 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
61 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
62 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
63 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
64 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
65 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
66 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
67 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
68 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
69 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
70 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
71 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
72 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
73 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
74 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
75 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
76 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
77 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
78 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
79 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
80 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
81 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
82 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
83 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
84 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
85 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
86 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
87 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
88 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
89 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
90 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
91 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
92 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
93 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
94 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
95 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
96 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
97 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
98 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
99 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
100 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
101 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
102 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
103 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
104 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
105 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
106 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
107 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
108 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
109 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
110 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
111 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
112 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
113 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
114 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
115 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
116 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
117 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
118 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
119 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
120 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
121 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
122 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
123 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
124 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
125 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
126 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
127 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
128 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
129 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
130 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
131 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
132 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
133 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
134 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
135 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
136 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
137 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
138 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
139 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
140 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
141 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
142 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
143 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
144 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
145 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
146 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
147 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
148 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
149 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
150 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
151 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
152 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
153 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
154 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
155 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
156 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
157 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
158 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
159 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
214 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
218 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
219 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
220 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
221 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
222 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
223 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
224 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
225 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
226 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
227 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
228 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
229 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
230 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
231 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
232 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
233 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
234 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
235 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
236 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
237 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
238 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
239 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
240 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
241 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
242 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
243 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
244 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
245 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
246 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
247 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
248 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
249 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
250 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
251 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
252 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
253 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
254 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
255 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
256 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
257 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
258 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
259 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
260 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
261 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
262 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
263 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
264 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
265 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
266 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
267 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
268 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
269 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
270 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
271 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
272 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
273 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
274 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
275 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
276 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
277 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
278 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
279 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
280 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
281 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
282 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
283 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
284 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
285 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
286 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
287 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
288 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
289 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
290 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
291 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
292 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
293 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
294 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
295 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
296 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
297 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
298 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
299 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
300 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
301 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
302 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
303 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
304 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
305 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
306 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
307 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
308 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
309 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
310 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
311 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
312 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
313 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
314 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
315 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
316 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
317 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
318 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
319 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
320 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
321 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
322 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
323 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
324 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
325 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
326 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
327 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
328 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
329 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
330 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
331 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
332 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
333 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
334 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
335 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
336 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
337 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
338 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
339 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
340 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
341 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
342 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
343 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
344 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
345 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
346 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
347 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
348 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
349 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
350 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
351 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
352 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
353 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
354 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
355 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
356 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
357 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
358 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
359 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
360 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
361 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
362 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
363 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
364 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
365 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
366 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
367 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
368 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
369 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
370 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
371 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
372 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
373 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
374 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
375 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
376 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
377 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
378 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
379 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
380 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
381 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
382 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
383 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
384 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
385 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
386 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
387 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
388 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
389 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
390 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
391 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
392 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
393 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
394 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
395 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
396 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
397 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
398 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
399 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
400 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
401 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
402 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
403 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
404 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
405 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
406 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
407 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
408 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
409 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
410 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
411 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.85
Metatranscriptomes 1.04
Isolates 3.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.34
Nodule 0.12
Rhizoplane 9.8
Rhizosphere 71.86
Stem 0
Stem Tuber 0
Unclassified 8.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1002016 3300000546 Bacteria 2595
2 JGI24746J21847_1005052 3300001977 Bacteria 2066
3 JGI24743J22301_10015602 3300001991 Bacteria 1411
4 JGI24750J21931_1003896 3300002070 Bacteria 1798
5 JGI24745J21846_1000595 3300002073 Bacteria 3245
6 JGI24748J21848_1004782 3300002074 Bacteria 1558
7 JGI24742J22300_10003385 3300002244 Bacteria 2587
8 JGI24751J29686_10008463 3300002459 Bacteria 2106
9 Ga0007423J48922_100409 3300003285 Bacteria 4520
10 rootH2_10157116 3300003320 Bacteria 1960
11 Ga0055540_1001773 3300003792 Bacteria 12303
12 Ga0055540_1002004 3300003792 Bacteria 11361
13 Ga0070658_10089642 3300005327 Bacteria 2533
14 Ga0070676_10003560 3300005328 Bacteria 8147
15 Ga0070683_100006536 3300005329 Bacteria 9790
16 Ga0070683_100026274 3300005329 Bacteria 5240
17 Ga0070683_100123072 3300005329 Bacteria 2451
18 Ga0070690_100098649 3300005330 Bacteria 1934
19 Ga0070690_100316738 3300005330 Bacteria 1123
20 Ga0070666_10022380 3300005335 Bacteria 4105
21 Ga0070666_10222154 3300005335 Bacteria 1333
22 Ga0070682_100043875 3300005337 Bacteria 2766
23 Ga0070682_100070268 3300005337 Bacteria 2238
24 Ga0068868_100001925 3300005338 Bacteria 14255
25 Ga0068868_100214843 3300005338 Bacteria 1608
26 Ga0070660_100337678 3300005339 Bacteria 1239
27 Ga0070660_100360014 3300005339 Bacteria 1199
28 Ga0070689_100417573 3300005340 Bacteria 1136
29 Ga0070691_10019777 3300005341 Bacteria 3109
30 Ga0070687_100111861 3300005343 Bacteria 1547
31 Ga0070687_100168780 3300005343 Bacteria 1300
32 Ga0070692_10080896 3300005345 Bacteria 1749
33 Ga0070692_10089477 3300005345 Bacteria 1671
34 Ga0070668_100000140 3300005347 Bacteria 45946
35 Ga0070668_100000721 3300005347 Bacteria 22652
36 Ga0070668_100483453 3300005347 Bacteria 1070
37 Ga0070669_100019162 3300005353 Bacteria 4889
38 Ga0070669_100111779 3300005353 Bacteria 2074
39 Ga0070675_100078300 3300005354 Bacteria 2752
40 Ga0070671_100023362 3300005355 Bacteria 5060
41 Ga0070671_100185484 3300005355 Bacteria 1762
42 Ga0070671_100424353 3300005355 Bacteria 1139
43 Ga0070674_100001316 3300005356 Bacteria 13057
44 Ga0070673_100187500 3300005364 Bacteria 1774
45 Ga0070688_100023636 3300005365 Bacteria 3617
46 Ga0070688_100418205 3300005365 Bacteria 996
47 Ga0070659_100052771 3300005366 Bacteria 3198
48 Ga0070659_100087194 3300005366 Bacteria 2499
49 Ga0070659_100240088 3300005366 Bacteria 1499
50 Ga0070667_100000408 3300005367 Bacteria 45977
51 Ga0070667_100001695 3300005367 Bacteria 19697
52 Ga0070667_100121550 3300005367 Bacteria 2271
53 Ga0070667_100175346 3300005367 Bacteria 1894
54 Ga0070709_10241601 3300005434 Bacteria 1297
55 Ga0070714_100006869 3300005435 Bacteria 8823
56 Ga0070714_100109541 3300005435 Bacteria 2443
57 Ga0070713_100052927 3300005436 Bacteria 3362
58 Ga0070713_100071745 3300005436 Bacteria 2927
59 Ga0070713_100114138 3300005436 Bacteria 2359
60 Ga0070713_100301330 3300005436 Bacteria 1475
61 Ga0070710_10001921 3300005437 Bacteria 9843
62 Ga0070710_10006772 3300005437 Bacteria 5525
63 Ga0070701_10000646 3300005438 Bacteria 12182
64 Ga0070711_100006335 3300005439 Bacteria 7127
65 Ga0070711_100113640 3300005439 Bacteria 1991
66 Ga0070711_100134054 3300005439 Bacteria 1848
67 Ga0070700_100000668 3300005441 Bacteria 16973
68 Ga0070700_100138521 3300005441 Bacteria 1651
69 Ga0070708_100003731 3300005445 Bacteria 11945
70 Ga0070708_100394472 3300005445 Bacteria 1305
71 Ga0070663_100014150 3300005455 Bacteria 5114
72 Ga0070663_100119505 3300005455 Bacteria 1989
73 Ga0070663_100119880 3300005455 Bacteria 1986
74 Ga0070663_100132313 3300005455 Bacteria 1895
75 Ga0070678_100000061 3300005456 Bacteria 39817
76 Ga0070678_100266111 3300005456 Bacteria 1444
77 Ga0070678_100461315 3300005456 Bacteria 1114
78 Ga0068867_100008795 3300005459 Bacteria 7130
79 Ga0070706_100040530 3300005467 Bacteria 4299
80 Ga0070706_100083639 3300005467 Bacteria 2957
81 Ga0070707_100012429 3300005468 Bacteria 7951
82 Ga0070698_100001201 3300005471 Bacteria 28730
83 Ga0070698_100066428 3300005471 Bacteria 3630
84 Ga0070679_100051372 3300005530 Bacteria 4106
85 Ga0070679_100117806 3300005530 Bacteria 2641
86 Ga0070679_100379427 3300005530 Bacteria 1360
87 Ga0070679_100529802 3300005530 Bacteria 1122
88 Ga0070684_100108603 3300005535 Bacteria 2486
89 Ga0070684_100241191 3300005535 Bacteria 1651
90 Ga0070684_100307367 3300005535 Bacteria 1456
91 Ga0068853_100000950 3300005539 Bacteria 20343
92 Ga0068853_100032218 3300005539 Bacteria 4439
93 Ga0068853_100168374 3300005539 Bacteria 1981
94 Ga0068853_100605557 3300005539 Bacteria 1041
95 Ga0070672_100260079 3300005543 Bacteria 1463
96 Ga0070686_100098808 3300005544 Bacteria 1968
97 Ga0070695_100118508 3300005545 Bacteria 1808
98 Ga0070696_100004064 3300005546 Bacteria 9756
99 Ga0070665_100003972 3300005548 Bacteria 15589
100 Ga0070665_100008318 3300005548 Bacteria 10494
101 Ga0070665_100047716 3300005548 Bacteria 4298
102 Ga0070665_100066715 3300005548 Bacteria 3610
103 Ga0070704_100008843 3300005549 Bacteria 6061
104 Ga0070704_100156561 3300005549 Bacteria 1797
105 Ga0068855_100125375 3300005563 Bacteria 2936
106 Ga0070664_100076835 3300005564 Bacteria 2870
107 Ga0068857_100131939 3300005577 Bacteria 2253
108 Ga0068854_100003941 3300005578 Bacteria 9302
109 Ga0068854_100103759 3300005578 Bacteria 2135
110 Ga0068856_100069718 3300005614 Bacteria 3477
111 Ga0070702_100001059 3300005615 Bacteria 10974
112 Ga0070702_100327176 3300005615 Bacteria 1070
113 Ga0068852_100078126 3300005616 Bacteria 2928
114 Ga0068852_100120735 3300005616 Bacteria 2399
115 Ga0068852_100620758 3300005616 Bacteria 1087
116 Ga0068859_100000542 3300005617 Bacteria 37422
117 Ga0068859_100006779 3300005617 Bacteria 11635
118 Ga0068859_100614276 3300005617 Bacteria 1180
119 Ga0068864_100124452 3300005618 Bacteria 2309
120 Ga0068864_100166572 3300005618 Bacteria 2007
121 Ga0068866_10001389 3300005718 Bacteria 10436
122 Ga0068861_100000122 3300005719 Bacteria 39876
123 Ga0068861_100047044 3300005719 Bacteria 3255
124 Ga0068870_10311905 3300005840 Bacteria 997
125 Ga0068863_100000352 3300005841 Bacteria 46727
126 Ga0068863_100007618 3300005841 Bacteria 10587
127 Ga0068863_100176670 3300005841 Bacteria 2049
128 Ga0068863_100223395 3300005841 Bacteria 1815
129 Ga0068863_100266909 3300005841 Bacteria 1656
130 Ga0068858_100030398 3300005842 Bacteria 5015
131 Ga0068858_100116828 3300005842 Bacteria 2493
132 Ga0068860_100000542 3300005843 Bacteria 45977
133 Ga0068860_100001605 3300005843 Bacteria 24276
134 Ga0068862_100000422 3300005844 Bacteria 45975
135 Ga0068862_100003787 3300005844 Bacteria 12889
136 Ga0081455_10054128 3300005937 Bacteria 3423
137 Ga0081455_10330040 3300005937 Bacteria 1083
138 Ga0081538_10126763 3300005981 Bacteria 1211
139 Ga0081540_1000009 3300005983 Bacteria 193562
140 Ga0070717_10300905 3300006028 Bacteria 1426
141 Ga0075365_10002311 3300006038 Bacteria 9275
142 Ga0075365_10006639 3300006038 Bacteria 6388
143 Ga0075365_10034327 3300006038 Bacteria 3276
144 Ga0075365_10069690 3300006038 Bacteria 2364
145 Ga0075368_10010682 3300006042 Bacteria 3324
146 Ga0075363_100000575 3300006048 Bacteria 12051
147 Ga0075363_100001506 3300006048 Bacteria 8895
148 Ga0075363_100003105 3300006048 Bacteria 6970
149 Ga0075363_100083952 3300006048 Bacteria 1746
150 Ga0075363_100088045 3300006048 Bacteria 1706
151 Ga0075363_100102255 3300006048 Bacteria 1587
152 Ga0075363_100218048 3300006048 Bacteria 1093
153 Ga0075364_10007282 3300006051 Bacteria 6564
154 Ga0075364_10010478 3300006051 Bacteria 5600
155 Ga0075364_10018608 3300006051 Bacteria 4351
156 Ga0075364_10020437 3300006051 Bacteria 4164
157 Ga0075364_10025330 3300006051 Bacteria 3775
158 Ga0075364_10026875 3300006051 Bacteria 3674
159 Ga0075364_10056886 3300006051 Bacteria 2561
160 Ga0075364_10105487 3300006051 Bacteria 1877
161 Ga0075364_10150446 3300006051 Bacteria 1569
162 Ga0075364_10184613 3300006051 Bacteria 1412
163 Ga0070715_10070379 3300006163 Bacteria 1561
164 Ga0070716_100182027 3300006173 Bacteria 1380
165 Ga0070716_100208374 3300006173 Bacteria 1304
166 Ga0070716_100221822 3300006173 Bacteria 1271
167 Ga0070716_100390296 3300006173 Bacteria 998
168 Ga0070712_100002266 3300006175 Bacteria 11843
169 Ga0070712_100003385 3300006175 Bacteria 9809
170 Ga0070712_100067471 3300006175 Bacteria 2545
171 Ga0075367_10044122 3300006178 Bacteria 2612
172 Ga0075367_10053000 3300006178 Bacteria 2403
173 Ga0075369_10000575 3300006186 Bacteria 11600
174 Ga0075369_10017701 3300006186 Bacteria 2893
175 Ga0075369_10028499 3300006186 Bacteria 2341
176 Ga0075369_10038689 3300006186 Bacteria 2036
177 Ga0075369_10044797 3300006186 Bacteria 1901
178 Ga0075369_10057658 3300006186 Bacteria 1690
179 Ga0075370_10000287 3300006353 Bacteria 18091
180 Ga0075370_10007884 3300006353 Bacteria 5448
181 Ga0075370_10046679 3300006353 Bacteria 2452
182 Ga0075370_10114042 3300006353 Bacteria 1570
183 Ga0075428_100025753 3300006844 Bacteria 6515
184 Ga0075428_100062477 3300006844 Bacteria 4077
185 Ga0075430_100077042 3300006846 Bacteria 2795
186 Ga0075430_100079496 3300006846 Bacteria 2748
187 Ga0075430_100152002 3300006846 Bacteria 1927
188 Ga0075431_100008579 3300006847 Bacteria 10232
189 Ga0075431_100044970 3300006847 Bacteria 4552
190 Ga0075434_100393054 3300006871 Bacteria 1407
191 Ga0068865_100134110 3300006881 Bacteria 1858
192 Ga0068865_100145768 3300006881 Bacteria 1790
193 Ga0097620_100000542 3300006931 Bacteria 37422
194 Ga0097620_100006779 3300006931 Bacteria 11635
195 Ga0097620_100614312 3300006931 Bacteria 1180
196 Ga0105250_10063163 3300009092 Bacteria 1490
197 Ga0105240_10229594 3300009093 Bacteria 2158
198 Ga0105240_10629624 3300009093 Bacteria 1178
199 Ga0111539_10706926 3300009094 Bacteria 1173
200 Ga0105245_10003195 3300009098 Bacteria 14659
201 Ga0105245_10163986 3300009098 Bacteria 2111
202 Ga0105247_10000058 3300009101 Bacteria 131442
203 Ga0105247_10000456 3300009101 Bacteria 34514
204 Ga0105247_10090669 3300009101 Bacteria 1940
205 Ga0105247_10202802 3300009101 Bacteria 1334
206 Ga0114129_10005311 3300009147 Bacteria 18176
207 Ga0114129_10022769 3300009147 Bacteria 8884
208 Ga0114129_10129234 3300009147 Bacteria 3472
209 Ga0105241_10010121 3300009174 Bacteria 6924
210 Ga0105242_10013523 3300009176 Bacteria 6312
211 Ga0105248_10000465 3300009177 Bacteria 46197
212 Ga0105248_10007739 3300009177 Bacteria 11797
213 Ga0105248_10060085 3300009177 Bacteria 4267
214 Ga0105237_10000346 3300009545 Bacteria 65318
215 Ga0105237_10282367 3300009545 Bacteria 1663
216 Ga0105249_10000087 3300009553 Bacteria 131590
217 Ga0105249_10061472 3300009553 Bacteria 3447
218 Ga0105249_10362262 3300009553 Bacteria 1472
219 Ga0099796_10023707 3300010159 Bacteria 1919
220 Ga0105239_10006651 3300010375 Bacteria 13378
221 Ga0105239_10008590 3300010375 Bacteria 11583
222 Ga0105239_10203058 3300010375 Bacteria 2221
223 Ga0105239_10533218 3300010375 Bacteria 1336
224 Ga0105246_10081852 3300011119 Bacteria 2303
225 Ga0157320_1001111 3300012481 Bacteria 1291
226 Ga0157337_1000560 3300012483 Bacteria 1740
227 Ga0157325_1000878 3300012485 Bacteria 1267
228 Ga0157343_1002179 3300012488 Bacteria 1046
229 Ga0157324_1001796 3300012506 Bacteria 1234
230 Ga0157342_1002632 3300012507 Bacteria 1475
231 Ga0157373_10066671 3300013100 Bacteria 2546
232 Ga0157370_10162352 3300013104 Bacteria 2079
233 Ga0157370_10378440 3300013104 Bacteria 1304
234 Ga0157369_10080943 3300013105 Bacteria 3476
235 Ga0157369_10085162 3300013105 Bacteria 3378
236 Ga0157374_10002901 3300013296 Bacteria 14368
237 Ga0157378_10001141 3300013297 Bacteria 24154
238 Ga0163162_10002035 3300013306 Bacteria 19024
239 Ga0163162_10196156 3300013306 Bacteria 2148
240 Ga0163162_10256413 3300013306 Bacteria 1881
241 Ga0163162_10318504 3300013306 Bacteria 1688
242 Ga0157372_10002481 3300013307 Bacteria 19997
243 Ga0157375_10001315 3300013308 Bacteria 21408
244 Ga0157375_10300101 3300013308 Bacteria 1770
245 Ga0163163_10012227 3300014325 Bacteria 7813
246 Ga0163163_10069609 3300014325 Bacteria 3503
247 Ga0157380_10010801 3300014326 Bacteria 6582
248 Ga0157380_10078474 3300014326 Bacteria 2694
249 Ga0157380_10345549 3300014326 Bacteria 1390
250 Ga0157377_10086006 3300014745 Bacteria 1847
251 Ga0157379_10078582 3300014968 Bacteria 2955
252 Ga0157379_10256357 3300014968 Bacteria 1589
253 Ga0157379_10598719 3300014968 Bacteria 1029
254 Ga0157376_10418342 3300014969 Bacteria 1300
255 Ga0163161_10008010 3300017792 Bacteria 7307
256 Ga0163161_10235268 3300017792 Bacteria 1423
257 Ga0206356_10810878 3300020070 Bacteria 2156
258 Ga0206350_11663349 3300020080 Bacteria 1862
259 Ga0206354_10912145 3300020081 Bacteria 2929
260 Ga0206353_10272952 3300020082 Bacteria 2341
261 Ga0206353_10728243 3300020082 Bacteria 2083
262 Ga0206353_10730323 3300020082 Bacteria 1924
263 Ga0213876_10003290 3300021384 Bacteria 9273
264 Ga0213876_10079654 3300021384 Bacteria 1731
265 Ga0213876_10101977 3300021384 Bacteria 1521
266 Ga0213876_10162039 3300021384 Bacteria 1190
267 Ga0213875_10002694 3300021388 Bacteria 10486
268 Ga0213875_10120299 3300021388 Bacteria 1227
269 Ga0213875_10133357 3300021388 Bacteria 1161
270 Ga0224712_10074188 3300022467 Bacteria 1389
271 Ga0228598_1008297 3300024227 Bacteria 2101
272 Ga0209051_1000374 3300025303 Bacteria 64311
273 Ga0209051_1001633 3300025303 Bacteria 18182
274 Ga0209051_1010559 3300025303 Bacteria 4646
275 Ga0209051_1014037 3300025303 Bacteria 3765
276 Ga0207692_10002728 3300025898 Bacteria 6814
277 Ga0207692_10045226 3300025898 Bacteria 2201
278 Ga0207692_10099818 3300025898 Bacteria 1591
279 Ga0207692_10171875 3300025898 Bacteria 1256
280 Ga0207642_10000428 3300025899 Bacteria 12682
281 Ga0207710_10000085 3300025900 Bacteria 131447
282 Ga0207710_10002660 3300025900 Bacteria 8233
283 Ga0207688_10000504 3300025901 Bacteria 18809
284 Ga0207688_10091412 3300025901 Bacteria 1748
285 Ga0207680_10059263 3300025903 Bacteria 2324
286 Ga0207647_10043111 3300025904 Bacteria 2825
287 Ga0207647_10082703 3300025904 Bacteria 1923
288 Ga0207699_10003180 3300025906 Bacteria 7813
289 Ga0207699_10009261 3300025906 Bacteria 4895
290 Ga0207699_10019000 3300025906 Bacteria 3654
291 Ga0207699_10147453 3300025906 Bacteria 1553
292 Ga0207699_10324694 3300025906 Bacteria 1081
293 Ga0207645_10006092 3300025907 Bacteria 8671
294 Ga0207645_10305810 3300025907 Bacteria 1059
295 Ga0207643_10007955 3300025908 Bacteria 5689
296 Ga0207705_10210219 3300025909 Bacteria 1476
297 Ga0207705_10214350 3300025909 Bacteria 1461
298 Ga0207684_10071576 3300025910 Bacteria 2946
299 Ga0207684_10079001 3300025910 Bacteria 2799
300 Ga0207707_10007438 3300025912 Bacteria 9542
301 Ga0207707_10318444 3300025912 Bacteria 1343
302 Ga0207671_10010010 3300025914 Bacteria 7867
303 Ga0207671_10417212 3300025914 Bacteria 1068
304 Ga0207693_10000189 3300025915 Bacteria 56358
305 Ga0207693_10000743 3300025915 Bacteria 29363
306 Ga0207693_10020666 3300025915 Bacteria 5235
307 Ga0207693_10041360 3300025915 Bacteria 3628
308 Ga0207663_10006285 3300025916 Bacteria 6065
309 Ga0207663_10055689 3300025916 Bacteria 2483
310 Ga0207663_10111286 3300025916 Bacteria 1858
311 Ga0207663_10408253 3300025916 Bacteria 1040
312 Ga0207663_10455504 3300025916 Bacteria 987
313 Ga0207662_10322918 3300025918 Bacteria 1031
314 Ga0207657_10022671 3300025919 Bacteria 5868
315 Ga0207657_10072884 3300025919 Bacteria 2904
316 Ga0207657_10175928 3300025919 Bacteria 1732
317 Ga0207657_10178552 3300025919 Bacteria 1717
318 Ga0207652_10357253 3300025921 Bacteria 1319
319 Ga0207646_10042204 3300025922 Bacteria 4099
320 Ga0207646_10415267 3300025922 Bacteria 1215
321 Ga0207681_10001891 3300025923 Bacteria 13394
322 Ga0207681_10017104 3300025923 Bacteria 4549
323 Ga0207659_10116885 3300025926 Bacteria 2037
324 Ga0207687_10004168 3300025927 Bacteria 9682
325 Ga0207700_10009342 3300025928 Bacteria 6120
326 Ga0207700_10013024 3300025928 Bacteria 5392
327 Ga0207700_10016756 3300025928 Bacteria 4878
328 Ga0207700_10019742 3300025928 Bacteria 4558
329 Ga0207700_10126873 3300025928 Bacteria 2077
330 Ga0207700_10237475 3300025928 Bacteria 1552
331 Ga0207664_10001128 3300025929 Bacteria 17796
332 Ga0207664_10006033 3300025929 Bacteria 8297
333 Ga0207664_10019807 3300025929 Bacteria 4979
334 Ga0207664_10043434 3300025929 Bacteria 3515
335 Ga0207664_10082344 3300025929 Bacteria 2621
336 Ga0207664_10272283 3300025929 Bacteria 1484
337 Ga0207644_10126237 3300025931 Bacteria 1953
338 Ga0207690_10061846 3300025932 Bacteria 2547
339 Ga0207690_10092039 3300025932 Bacteria 2145
340 Ga0207690_10229092 3300025932 Bacteria 1425
341 Ga0207706_10001089 3300025933 Bacteria 27567
342 Ga0207706_10022821 3300025933 Bacteria 5614
343 Ga0207706_10031536 3300025933 Bacteria 4721
344 Ga0207686_10014685 3300025934 Bacteria 4366
345 Ga0207670_10031218 3300025936 Bacteria 3411
346 Ga0207670_10433663 3300025936 Bacteria 1057
347 Ga0207669_10001764 3300025937 Bacteria 9183
348 Ga0207704_10002051 3300025938 Bacteria 9014
349 Ga0207704_10095565 3300025938 Bacteria 1965
350 Ga0207704_10131259 3300025938 Bacteria 1735
351 Ga0207665_10001533 3300025939 Bacteria 15547
352 Ga0207665_10010016 3300025939 Bacteria 6224
353 Ga0207665_10037081 3300025939 Bacteria 3243
354 Ga0207665_10158823 3300025939 Bacteria 1625
355 Ga0207665_10365146 3300025939 Bacteria 1092
356 Ga0207691_10039908 3300025940 Bacteria 4341
357 Ga0207711_10000071 3300025941 Bacteria 112825
358 Ga0207711_10084560 3300025941 Bacteria 2777
359 Ga0207689_10001274 3300025942 Bacteria 24296
360 Ga0207651_10155507 3300025960 Bacteria 1786
361 Ga0207651_10471971 3300025960 Bacteria 1080
362 Ga0207712_10000040 3300025961 Bacteria 180255
363 Ga0207668_10000208 3300025972 Bacteria 39588
364 Ga0207668_10001301 3300025972 Bacteria 14828
365 Ga0207668_10171930 3300025972 Bacteria 1700
366 Ga0207640_10002912 3300025981 Bacteria 9192
367 Ga0207658_10000121 3300025986 Bacteria 84805
368 Ga0207658_10014319 3300025986 Bacteria 5431
369 Ga0207677_10000688 3300026023 Bacteria 20006
370 Ga0207677_10064885 3300026023 Bacteria 2545
371 Ga0207703_10083706 3300026035 Bacteria 2666
372 Ga0207703_10265569 3300026035 Bacteria 1553
373 Ga0207639_10001989 3300026041 Bacteria 13757
374 Ga0207639_10019463 3300026041 Bacteria 4842
375 Ga0207639_10219188 3300026041 Bacteria 1642
376 Ga0207678_10022754 3300026067 Bacteria 5488
377 Ga0207678_10029966 3300026067 Bacteria 4750
378 Ga0207678_10036534 3300026067 Bacteria 4276
379 Ga0207678_10179167 3300026067 Bacteria 1810
380 Ga0207678_10254511 3300026067 Bacteria 1504
381 Ga0207678_10296461 3300026067 Bacteria 1389
382 Ga0207708_10025321 3300026075 Bacteria 4488
383 Ga0207708_10096973 3300026075 Bacteria 2279
384 Ga0207702_10005527 3300026078 Bacteria 11045
385 Ga0207702_10328063 3300026078 Bacteria 1459
386 Ga0207641_10000485 3300026088 Bacteria 44793
387 Ga0207641_10001669 3300026088 Bacteria 21601
388 Ga0207641_10210463 3300026088 Bacteria 1798
389 Ga0207641_10255848 3300026088 Bacteria 1637
390 Ga0207648_10011780 3300026089 Bacteria 8218
391 Ga0207648_10369689 3300026089 Bacteria 1295
392 Ga0207676_10097556 3300026095 Bacteria 2428
393 Ga0207676_10107838 3300026095 Bacteria 2324
394 Ga0207676_10335546 3300026095 Bacteria 1393
395 Ga0207674_10020822 3300026116 Bacteria 7079
396 Ga0207674_10086649 3300026116 Bacteria 3126
397 Ga0207675_100000325 3300026118 Bacteria 45410
398 Ga0207675_100050760 3300026118 Bacteria 3871
399 Ga0207675_100108396 3300026118 Bacteria 2619
400 Ga0207675_100566335 3300026118 Bacteria 1136
401 Ga0207675_100813110 3300026118 Bacteria 948
402 Ga0207683_10001450 3300026121 Bacteria 21423
403 Ga0207683_10002228 3300026121 Bacteria 17053
404 Ga0207698_10082268 3300026142 Bacteria 2602
405 Ga0207698_10179610 3300026142 Bacteria 1873
406 Ga0207698_10191376 3300026142 Bacteria 1823
407 Ga0207698_10528392 3300026142 Bacteria 1152
408 Ga0209813_10031716 3300027866 Bacteria 1561
409 Ga0268266_10004980 3300028379 Bacteria 12563
410 Ga0268266_10005247 3300028379 Bacteria 12167
411 Ga0268266_10031978 3300028379 Bacteria 4471
412 Ga0268265_10000004 3300028380 Bacteria 648376
413 Ga0268265_10010963 3300028380 Bacteria 6121
414 Ga0268264_10000133 3300028381 Bacteria 179929
415 Ga0268264_10012339 3300028381 Bacteria 7034
416 Ga0268264_10472293 3300028381 Bacteria 1218
417 Ga0265337_1002649 3300028556 Bacteria 8061
418 Ga0265319_1023792 3300028563 Bacteria 2214
419 Ga0265334_10000870 3300028573 Bacteria 15120
420 Ga0265318_10028794 3300028577 Bacteria 2169
421 Ga0265323_10001759 3300028653 Bacteria 10286
422 Ga0265322_10003925 3300028654 Bacteria 4456
423 Ga0265336_10010405 3300028666 Bacteria 3184
424 Ga0265338_10001142 3300028800 Bacteria 43907
425 Ga0265338_10009484 3300028800 Bacteria 11596
426 Ga0265338_10181845 3300028800 Bacteria 1602
427 Ga0265338_10306689 3300028800 Bacteria 1152
428 Ga0265324_10000666 3300029957 Bacteria 23164
429 Ga0265332_10001385 3300031238 Bacteria 13659
430 Ga0265325_10014436 3300031241 Bacteria 4464
431 Ga0265329_10065381 3300031242 Bacteria 1151
432 Ga0265340_10087533 3300031247 Bacteria 1459
433 Ga0265339_10045029 3300031249 Bacteria 2430
434 Ga0265314_10007872 3300031711 Bacteria 9197
435 Ga0265342_10001467 3300031712 Bacteria 21941
436 Ga0307405_10117105 3300031731 Bacteria 1816
437 Ga0307413_10110240 3300031824 Bacteria 1841
438 Ga0307410_10280110 3300031852 Bacteria 1308
439 Ga0307416_100105520 3300032002 Bacteria 2467
440 Ga0307416_100682247 3300032002 Bacteria 1115
441 Ga0307415_100089643 3300032126 Bacteria 2222
442 Ga0307415_100239283 3300032126 Bacteria 1467
443 Ga0373926_0000765 3300035083 Bacteria 9006
444 Ga0373934_0009621 3300035086 Bacteria 3623
445 Ga0373923_0001164 3300035111 Bacteria 7315
446 Ga0373936_0013060 3300035113 Bacteria 3167
447 Ga0373936_0049067 3300035113 Bacteria 1705
448 Ga0373953_0032669 3300035117 Bacteria 2031
449 Ga0373954_0017440 3300035118 Bacteria 3225
450 Ga0373956_0003365 3300035119 Bacteria 6439
451 Ga0373956_0052379 3300035119 Bacteria 1835
452 Ga0373956_0162917 3300035119 Bacteria 1051
453 Ga0373943_0002009 3300035170 Bacteria 9214
454 Ga0373946_0000515 3300035171 Bacteria 12831
455 Ga0373942_0020308 3300035207 Bacteria 1667
456 Ga0373931_0009215 3300035691 Bacteria 4714
457 Ga0373931_0033382 3300035691 Bacteria 2667
458 Ga0373931_0110279 3300035691 Bacteria 1560
459 Ga0373935_0000488 3300035692 Bacteria 20506
460 Ga0373935_0039125 3300035692 Bacteria 2972
461 Ga0373933_0018935 3300035724 Bacteria 3878
462 Ga0373947_0000113 3300035725 Bacteria 40170
463 Ga0373937_0012529 3300036401 Bacteria 7460
464 Ga0373937_0128069 3300036401 Bacteria 2369
465 Ga0373937_0536088 3300036401 Bacteria 1112
466 Ga0372808_011090 3300036459 Bacteria 1273
467 Ga0373925_0000384 3300037068 Bacteria 45543
468 Ga0373925_0012546 3300037068 Bacteria 6140
469 Ga0373925_0166408 3300037068 Bacteria 1739
470 Ga0395899_0003096 3300037312 Bacteria 13237
471 Ga0395898_0019127 3300037466 Bacteria 6974
472 Ga0436364_0166036 3300037853 Bacteria 1699
473 Ga0436364_0256774 3300037853 Bacteria 34884
474 Ga0436364_0321419 3300037853 Bacteria 2008
475 Ga0436364_0542227 3300037853 Bacteria 5024
476 Ga0436364_0577957 3300037853 Bacteria 4656
477 Ga0436364_0584067 3300037853 Bacteria 157477
478 Ga0436364_0976891 3300037853 Bacteria 1862
479 Ga0436364_1179018 3300037853 Bacteria 9173
480 Ga0436365_0792290 3300039437 Bacteria 4040
481 Ga0436365_1378611 3300039437 Bacteria 178407
482 Ga0436365_1417225 3300039437 Bacteria 6842
483 Ga0436365_1640827 3300039437 Bacteria 22352
484 Ga0436360_1375602 3300039438 Bacteria 1647
485 Ga0436361_1011110 3300039447 Bacteria 1436
486 Ga0436361_1177073 3300039447 Bacteria 862
487 Ga0436363_0109061 3300039450 Bacteria 1536
488 Ga0436363_0781631 3300039450 Bacteria 5117
489 Ga0436363_1124457 3300039450 Bacteria 898
490 Ga0439466_0020266 3300041411 Bacteria 2370
491 Ga0439466_0034855 3300041411 Bacteria 1704
492 Ga0439466_0047681 3300041411 Bacteria 1411
493 Ga0439465_0003626 3300041413 Bacteria 5038
494 Ga0439465_0012682 3300041413 Bacteria 2636
495 Ga0439465_0017398 3300041413 Bacteria 2244
496 Ga0439465_0018610 3300041413 Bacteria 2170
497 Ga0439465_0120449 3300041413 Bacteria 920
498 Ga0451853_3968863 3300041512 Bacteria 1310
499 Ga0439431_0000223 3300041997 Bacteria 11496
500 Ga0439442_031735 3300042002 Bacteria 1104
501 Ga0439434_0002239 3300042435 Bacteria 5611
502 Ga0439434_0008604 3300042435 Bacteria 2995
503 Ga0466969_0015046 3300044656 Bacteria 4058
504 Ga0466972_0009068 3300044658 Bacteria 4996
505 Ga0466972_0012833 3300044658 Bacteria 4208
506 Ga0466972_0022560 3300044658 Bacteria 3133
507 Ga0466965_0006718 3300044683 Bacteria 5248
508 Ga0466965_0284599 3300044683 Bacteria 894
509 Ga0466966_0015855 3300044684 Bacteria 4980
510 Ga0466966_0026947 3300044684 Bacteria 3748
511 Ga0466961_0007565 3300044693 Bacteria 6916
512 Ga0466961_0034568 3300044693 Bacteria 3245
513 Ga0466963_0066894 3300044694 Bacteria 2411
514 Ga0466964_0153453 3300044706 Bacteria 1070
515 Ga0466971_0009900 3300044719 Bacteria 4163
516 Ga0466971_0031204 3300044719 Bacteria 2386
517 Ga0466971_0059790 3300044719 Bacteria 1722
518 Ga0466968_0000170 3300044735 Bacteria 19904
519 Ga0466968_0009892 3300044735 Bacteria 3681
520 Ga0466968_0021214 3300044735 Bacteria 2629
521 Ga0466968_0044145 3300044735 Bacteria 1889
522 Ga0466970_0023560 3300044765 Bacteria 3215
523 Ga0466970_0063050 3300044765 Bacteria 1987
524 Ga0466970_0132124 3300044765 Bacteria 1372
525 Ga0466957_0004576 3300044842 Bacteria 7727
526 Ga0466957_0023286 3300044842 Bacteria 3660
527 Ga0466960_0000215 3300044901 Bacteria 19879
528 Ga0466960_0000976 3300044901 Bacteria 10169
529 Ga0466960_0002924 3300044901 Bacteria 6502
530 Ga0466959_0011763 3300045049 Bacteria 6300
531 Ga0466959_0030379 3300045049 Bacteria 4000
532 Ga0466959_0061259 3300045049 Bacteria 2736
533 Ga0466959_0108279 3300045049 Bacteria 1985
534 Ga0466959_0113975 3300045049 Bacteria 1927
535 Ga0466958_0008792 3300045836 Bacteria 5608
536 Ga0466958_0009085 3300045836 Bacteria 5523
537 Ga0466958_0073046 3300045836 Bacteria 2101
538 Ga0466958_0138118 3300045836 Bacteria 1534
539 Ga0466958_0331143 3300045836 Bacteria 979
540 Ga0466967_0020224 3300045976 Bacteria 5374
541 Ga0466967_0029940 3300045976 Bacteria 4562
542 Ga0466967_0053479 3300045976 Bacteria 3549
543 Ga0466967_0087163 3300045976 Bacteria 2830
544 Ga0466967_0105439 3300045976 Bacteria 2582
545 Ga0466967_0136917 3300045976 Bacteria 2278
546 Ga0466967_0190816 3300045976 Bacteria 1936
547 Ga0495592_0113781 3300046454 Bacteria 1911
548 Ga0495603_0003763 3300046455 Bacteria 9021
549 Ga0495629_0002692 3300046459 Bacteria 13615
550 Ga0495629_0064786 3300046459 Bacteria 2551
551 Ga0495638_0006493 3300046460 Bacteria 8504
552 Ga0495651_0040615 3300046462 Bacteria 3617
553 Ga0495653_0125326 3300046463 Bacteria 1825
554 Ga0495580_0026504 3300046472 Bacteria 4225
555 Ga0495582_0000741 3300046473 Bacteria 18037
556 Ga0495639_0002161 3300046475 Bacteria 8668
557 Ga0495639_0016604 3300046475 Bacteria 3198
558 Ga0495664_0013862 3300046477 Bacteria 4570
559 Ga0495664_0156176 3300046477 Bacteria 1384
560 Ga0495606_0001336 3300046507 Bacteria 33549
561 Ga0495606_0119931 3300046507 Bacteria 1575
562 Ga0495608_0021905 3300046511 Bacteria 4382
563 Ga0495608_0050637 3300046511 Bacteria 2755
564 Ga0495628_0011936 3300046516 Bacteria 7327
565 Ga0495630_0010159 3300046517 Bacteria 6785
566 Ga0495630_0058729 3300046517 Bacteria 2884
567 Ga0495630_0327631 3300046517 Bacteria 1171
568 Ga0495648_0001738 3300046524 Bacteria 21055
569 Ga0495666_0002890 3300046526 Bacteria 8600
570 Ga0495652_0456585 3300046529 Bacteria 893
571 Ga0495654_0176126 3300046530 Bacteria 929
572 Ga0495665_0000906 3300046531 Bacteria 15593
573 Ga0495665_0046289 3300046531 Bacteria 2310
574 Ga0495640_0001961 3300046533 Bacteria 16417
575 Ga0495586_0038012 3300046535 Bacteria 2584
576 Ga0495645_0241705 3300046543 Bacteria 1204
577 Ga0495667_0089327 3300046559 Bacteria 1997
578 Ga0495668_0000103 3300046616 Bacteria 135853
579 Ga0495668_0013468 3300046616 Bacteria 4821
580 Ga0495634_0014605 3300046642 Bacteria 5656
581 Ga0495611_0084262 3300046648 Bacteria 1465
582 Ga0495625_0001256 3300046660 Bacteria 32015
583 Ga0495635_0090410 3300046663 Bacteria 2094
584 Ga0495635_0160770 3300046663 Bacteria 1528
585 Ga0495588_0091440 3300046674 Bacteria 1594
586 Ga0495657_0052689 3300046675 Bacteria 2726
587 Ga0495623_0099589 3300046679 Bacteria 1772
588 Ga0495646_0050920 3300046680 Bacteria 2507
589 Ga0495647_0084602 3300046681 Bacteria 1291
590 Ga0495658_0014104 3300046683 Bacteria 4075
591 Ga0495658_0111451 3300046683 Bacteria 1645
592 Ga0495613_0001650 3300046689 Bacteria 16986
593 Ga0495624_0008396 3300046690 Bacteria 7206
594 Ga0495624_0011180 3300046690 Bacteria 6176
595 Ga0495649_0142910 3300046694 Bacteria 1259
596 Ga0495600_0014313 3300046809 Bacteria 4997
597 Ga0495581_0000263 3300047315 Bacteria 25263
598 Ga0495604_0063128 3300047317 Bacteria 2826
599 Ga0495674_0053332 3300047319 Bacteria 3555
600 Ga0495672_0001155 3300047320 Bacteria 26703
601 Ga0495672_0030117 3300047320 Bacteria 3410
602 Ga0495676_0012085 3300047321 Bacteria 7787
603 Ga0495680_0040434 3300047322 Bacteria 3716
604 Ga0495680_0051429 3300047322 Bacteria 3216
605 Ga0495680_0056799 3300047322 Bacteria 3029
606 Ga0495683_0056358 3300047323 Bacteria 1955
607 Ga0495675_0060131 3300047444 Bacteria 2408
608 Ga0495673_0000708 3300047469 Bacteria 32330
609 Ga0495684_0096501 3300047471 Bacteria 2237
610 Ga0495686_0002058 3300047472 Bacteria 19803
611 Ga0495686_0226075 3300047472 Bacteria 1062
612 Ga0495593_0001834 3300047673 Bacteria 12650
613 Ga0495593_0007464 3300047673 Bacteria 6395
614 Ga0495602_0032252 3300048088 Bacteria 4935
615 Ga0495614_0035816 3300048089 Bacteria 2132
616 Ga0495626_0000461 3300048091 Bacteria 41460
617 Ga0495626_0024357 3300048091 Bacteria 2968
618 Ga0496100_0010615 3300048903 Bacteria 5219
619 Ga0496100_0041110 3300048903 Bacteria 2945
620 Ga0496100_0056441 3300048903 Bacteria 2569
621 Ga0496100_0057581 3300048903 Bacteria 2546
622 Ga0496100_0161472 3300048903 Bacteria 1607
623 Ga0496100_0400995 3300048903 Bacteria 1045
624 Ga0496100_0413148 3300048903 Bacteria 1029
625 Ga0496101_0000077 3300048904 Bacteria 109236
626 Ga0496101_0009771 3300048904 Bacteria 6318
627 Ga0496101_0015917 3300048904 Bacteria 5074
628 Ga0496101_0021950 3300048904 Bacteria 4388
629 Ga0496101_0061879 3300048904 Bacteria 2720
630 Ga0496101_0092140 3300048904 Bacteria 2256
631 Ga0496101_0215208 3300048904 Bacteria 1490
632 Ga0496101_0353731 3300048904 Bacteria 1155
633 Ga0496102_0000037 3300048905 Bacteria 199368
634 Ga0496102_0000251 3300048905 Bacteria 70253
635 Ga0496102_0003075 3300048905 Bacteria 14131
636 Ga0496102_0063349 3300048905 Bacteria 3385
637 Ga0496102_0113661 3300048905 Bacteria 2526
638 Ga0496102_0153245 3300048905 Bacteria 2166
639 Ga0496102_0383493 3300048905 Bacteria 1322
640 Ga0496102_0442665 3300048905 Bacteria 1219
641 Ga0496103_0000004 3300048906 Bacteria 510080
642 Ga0496103_0000990 3300048906 Bacteria 20036
643 Ga0496103_0004671 3300048906 Bacteria 8294
644 Ga0496103_0036445 3300048906 Bacteria 3012
645 Ga0496104_0029752 3300048907 Bacteria 5068
646 Ga0496104_0051338 3300048907 Bacteria 3892
647 Ga0496104_0164267 3300048907 Bacteria 2129
648 Ga0496104_0281674 3300048907 Bacteria 1575
649 Ga0496104_0537996 3300048907 Bacteria 1079
650 Ga0496105_0001753 3300048908 Bacteria 15527
651 Ga0496105_0159289 3300048908 Bacteria 1853
652 Ga0496106_0001893 3300048909 Bacteria 15673
653 Ga0496106_0003936 3300048909 Bacteria 11090
654 Ga0496106_0116951 3300048909 Bacteria 2080
655 Ga0496106_0219695 3300048909 Bacteria 1515
656 Ga0496106_0317509 3300048909 Bacteria 1250
657 Ga0496106_0508580 3300048909 Bacteria 967
658 Ga0496107_0000516 3300048910 Bacteria 21498
659 Ga0496107_0021871 3300048910 Bacteria 4519
660 Ga0496107_0147240 3300048910 Bacteria 1741
661 Ga0496107_0159872 3300048910 Bacteria 1669
662 Ga0496107_0238751 3300048910 Bacteria 1352
663 Ga0496108_0000985 3300048911 Bacteria 22155
664 Ga0496108_0055065 3300048911 Bacteria 3339
665 Ga0496108_0073165 3300048911 Bacteria 2894
666 Ga0496108_0158340 3300048911 Bacteria 1956
667 Ga0496108_0163421 3300048911 Bacteria 1925
668 Ga0496108_0236535 3300048911 Bacteria 1589
669 Ga0496109_0067923 3300048912 Bacteria 3266
670 Ga0496109_0097485 3300048912 Bacteria 2725
671 Ga0496109_0112964 3300048912 Bacteria 2526
672 Ga0496109_0129241 3300048912 Bacteria 2357
673 Ga0496109_0319740 3300048912 Bacteria 1464
674 Ga0496109_0540610 3300048912 Bacteria 1099
675 Ga0496110_0044929 3300048913 Bacteria 3859
676 Ga0496110_0057528 3300048913 Bacteria 3423
677 Ga0496110_0308811 3300048913 Bacteria 1441
678 Ga0496110_0412740 3300048913 Bacteria 1231
679 Ga0496110_0458166 3300048913 Bacteria 1162
680 Ga0496111_0167342 3300048914 Bacteria 1633
681 Ga0496111_0323264 3300048914 Bacteria 1143
682 Ga0496112_0041223 3300048915 Bacteria 4516
683 Ga0496112_0053869 3300048915 Bacteria 3952
684 Ga0496112_0065270 3300048915 Bacteria 3593
685 Ga0496112_0160339 3300048915 Bacteria 2216
686 Ga0496112_0299157 3300048915 Bacteria 1555
687 Ga0496112_0319794 3300048915 Bacteria 1496
688 Ga0496112_0365714 3300048915 Bacteria 1384
689 Ga0496113_0023349 3300048916 Bacteria 4385
690 Ga0496113_0125046 3300048916 Bacteria 2013
691 Ga0496113_0160315 3300048916 Bacteria 1778
692 Ga0496113_0165649 3300048916 Bacteria 1749
693 Ga0496113_0168979 3300048916 Bacteria 1731
694 Ga0496113_0391404 3300048916 Bacteria 1116
695 Ga0496114_0000849 3300048917 Bacteria 22880
696 Ga0496114_0005631 3300048917 Bacteria 9828
697 Ga0496114_0084856 3300048917 Bacteria 2682
698 Ga0496114_0178200 3300048917 Bacteria 1855
699 Ga0496114_0540680 3300048917 Bacteria 1030
700 Ga0496115_0001951 3300048918 Bacteria 14718
701 Ga0496115_0259022 3300048918 Bacteria 1431
702 Ga0496115_0346325 3300048918 Bacteria 1212
703 Ga0496116_0000056 3300048919 Bacteria 282554
704 Ga0496117_0000003 3300048920 Bacteria 1881097
705 Ga0496117_0002020 3300048920 Bacteria 26893
706 Ga0496117_0033521 3300048920 Bacteria 3881
707 Ga0496117_0260586 3300048920 Bacteria 940
708 Ga0496118_0000001 3300048921 Bacteria 1881100
709 Ga0496118_0032711 3300048921 Bacteria 4277
710 Ga0496118_0034681 3300048921 Bacteria 4111
711 Ga0496119_0034519 3300048922 Bacteria 3329
712 Ga0496119_0040475 3300048922 Bacteria 2980
713 Ga0496119_0171592 3300048922 Bacteria 1145
714 Ga0496120_0006402 3300048923 Bacteria 9048
715 Ga0496120_0019927 3300048923 Bacteria 4277
716 Ga0496120_0049691 3300048923 Bacteria 2406
717 Ga0496121_0019322 3300048924 Bacteria 6818
718 Ga0496122_0001777 3300048925 Bacteria 33035
719 Ga0496122_0004513 3300048925 Bacteria 17191
720 Ga0496122_0007065 3300048925 Bacteria 12608
721 Ga0496123_0001305 3300048926 Bacteria 35428
722 Ga0496123_0005870 3300048926 Bacteria 12159
723 Ga0496124_0005518 3300048927 Bacteria 14201
724 Ga0496124_0090520 3300048927 Bacteria 2495
725 Ga0496125_0000079 3300048928 Bacteria 230066
726 Ga0496125_0011321 3300048928 Bacteria 8934
727 Ga0496125_0088506 3300048928 Bacteria 2333
728 Ga0496125_0093569 3300048928 Bacteria 2242
729 Ga0496126_0000735 3300048929 Bacteria 59474
730 Ga0496126_0014618 3300048929 Bacteria 7927
731 Ga0496126_0015136 3300048929 Bacteria 7769
732 Ga0496126_0015649 3300048929 Bacteria 7621
733 Ga0496126_0024059 3300048929 Bacteria 5886
734 Ga0496126_0045618 3300048929 Bacteria 4026
735 Ga0496126_0119174 3300048929 Bacteria 2290
736 Ga0501032_0056083 3300049569 Bacteria 2649
737 Ga0501032_0060342 3300049569 Bacteria 2543
738 Ga0501032_0182474 3300049569 Bacteria 1374
739 Ga0501033_0026959 3300049570 Bacteria 4322
740 Ga0501033_0154317 3300049570 Bacteria 1655
741 Ga0501034_0002114 3300049571 Bacteria 24741
742 Ga0501034_0055564 3300049571 Bacteria 3984
743 Ga0501034_0084203 3300049571 Bacteria 3182
744 Ga0501034_0187097 3300049571 Bacteria 2034
745 Ga0501034_0345457 3300049571 Bacteria 1417
746 Ga0501034_0404107 3300049571 Bacteria 1288
747 Ga0501036_0104904 3300049572 Bacteria 2390
748 Ga0501037_0001890 3300049573 Bacteria 15230
749 Ga0501037_0014338 3300049573 Bacteria 5839
750 Ga0501038_0008303 3300049574 Bacteria 9557
751 Ga0501039_0000951 3300049575 Bacteria 21054
752 Ga0501043_0001755 3300049579 Bacteria 18680
753 Ga0501043_0004425 3300049579 Bacteria 11411
754 Ga0501043_0070913 3300049579 Bacteria 2737
755 Ga0501043_0137219 3300049579 Bacteria 1916
756 Ga0501043_0272354 3300049579 Bacteria 1299
757 Ga0501046_0005106 3300049580 Bacteria 11778
758 Ga0501046_0008048 3300049580 Bacteria 9214
759 Ga0501047_0001950 3300049581 Bacteria 19827
760 Ga0501047_0117374 3300049581 Bacteria 2542
761 Ga0501047_0164112 3300049581 Bacteria 2092
762 Ga0501047_0176255 3300049581 Bacteria 2005
763 Ga0501047_0476651 3300049581 Bacteria 1076
764 Ga0501047_0558464 3300049581 Bacteria 969
765 Ga0501048_0003785 3300049582 Bacteria 11546
766 Ga0501048_0236494 3300049582 Bacteria 1296
767 Ga0501067_0234043 3300049583 Bacteria 1022
768 Ga0501069_0020740 3300049585 Bacteria 3564
769 Ga0501069_0045295 3300049585 Bacteria 2437
770 Ga0501070_0005284 3300049586 Bacteria 11015
771 Ga0501070_0015755 3300049586 Bacteria 6357
772 Ga0501070_0035570 3300049586 Bacteria 4161
773 Ga0501073_0014064 3300049589 Bacteria 5814
774 Ga0501073_0043339 3300049589 Bacteria 3173
775 Ga0501073_0285305 3300049589 Bacteria 1139
776 Ga0501073_0318809 3300049589 Bacteria 1073
777 Ga0501074_0001629 3300049590 Bacteria 15213
778 Ga0501074_0197163 3300049590 Bacteria 1435
779 Ga0501080_0257036 3300049742 Bacteria 1592
780 Ga0501080_0279676 3300049742 Bacteria 1517
781 Ga0501035_0001031 3300049822 Bacteria 29291
782 Ga0501035_0002606 3300049822 Bacteria 17611
783 Ga0501035_0012495 3300049822 Bacteria 7845
784 Ga0501044_0001769 3300049823 Bacteria 25264
785 Ga0501044_0004936 3300049823 Bacteria 14917
786 Ga0501044_0022732 3300049823 Bacteria 6677
787 Ga0501044_0034133 3300049823 Bacteria 5340
788 Ga0501044_0542799 3300049823 Bacteria 1060
789 nmdc:mga03683_21801_c1 3300050489 Bacteria 2475
790 nmdc:mga03n38_107347_c1 3300050490 Bacteria 1355
791 nmdc:mga03n38_51374_c1 3300050490 Bacteria 1841
792 nmdc:mga03n38_80418_c1 3300050490 Bacteria 1530
793 nmdc:mga00v17_13203_c1 3300050491 Bacteria 4577
794 nmdc:mga00v17_15026_c1 3300050491 Bacteria 4338
795 nmdc:mga00v17_163178_c1 3300050491 Bacteria 1435
796 nmdc:mga00v17_17192_c1 3300050491 Bacteria 4088
797 nmdc:mga00v17_19115_c1 3300050491 Bacteria 3905
798 nmdc:mga00v17_32423_c1 3300050491 Bacteria 3088
799 nmdc:mga00v17_4361_c1 3300050491 Bacteria 7351
800 nmdc:mga00v17_484748_c1 3300050491 Bacteria 802
801 nmdc:mga00v17_8290_c1 3300050491 Bacteria 5589
802 nmdc:mga0yw44_20059_c1 3300050492 Bacteria 3701
803 nmdc:mga0yw44_243492_c1 3300050492 Bacteria 1196
804 nmdc:mga0yw44_40216_c1 3300050492 Bacteria 2776
805 nmdc:mga0yw44_44143_c1 3300050492 Bacteria 2665
806 nmdc:mga06z11_11103_c1 3300050494 Bacteria 3870
807 nmdc:mga04h51_36647_c1 3300050495 Bacteria 1579
808 nmdc:mga07m45_3242_c1 3300050496 Bacteria 7816
809 nmdc:mga07m45_60598_c2 3300050496 Bacteria 1285
810 nmdc:mga05p37_38534_c1 3300050507 Bacteria 5863
811 nmdc:mga0qj67_7034_c1 3300050509 Bacteria 8295
812 nmdc:mga0qj67_72643_c1 3300050509 Bacteria 2747
813 nmdc:mga06r32_2512_c1 3300050510 Bacteria 16405
814 nmdc:mga06r32_51989_c1 3300050510 Bacteria 3923
815 nmdc:mga08y16_522175_c1 3300050511 Bacteria 1204
816 nmdc:mga0rr50_138433_c1 3300050513 Bacteria 1956
817 nmdc:mga0sz30_14784_c1 3300050516 Bacteria 3078
818 nmdc:mga0sz30_15665_c1 3300050516 Bacteria 1646
819 nmdc:mga0sz30_1985_c1 3300050516 Bacteria 7317
820 nmdc:mga0sz30_4443_c1 3300050516 Bacteria 5066
821 nmdc:mga0sz30_90242_c1 3300050516 Bacteria 1333
822 Ga0500635_0005140 3300053080 Bacteria 3413
823 Ga0495595_0019342 3300053084 Bacteria 2954
824 Ga0495595_0140202 3300053084 Bacteria 1186
825 Ga0495619_0003141 3300053085 Bacteria 10711
826 Ga0500643_002707 3300053087 Bacteria 8905
827 Ga0500643_005848 3300053087 Bacteria 5229
828 Ga0500641_0047176 3300053096 Bacteria 1761
829 Ga0500556_0003029 3300053104 Bacteria 5049
830 Ga0500562_006252 3300053108 Bacteria 3005
831 Ga0500652_001797 3300053131 Bacteria 6496
832 Ga0500652_017942 3300053131 Bacteria 2603
833 Ga0500658_0074833 3300053134 Bacteria 1437
834 Ga0500588_0013486 3300053146 Bacteria 2052
835 Ga0500616_0025979 3300053153 Bacteria 3246
836 Ga0500620_051564 3300053155 Bacteria 1380
837 Ga0500627_0005307 3300053158 Bacteria 4270
838 Ga0500645_000195 3300053730 Bacteria 47101
839 Ga0466962_0007816 3300061719 Bacteria 5126
840 Ga0466962_0083994 3300061719 Bacteria 1523

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048920 Ga0496117_0260586 Ga0496117_0260586_65_919 246
2 3300010375 Ga0105239_10533218 Ga0105239_105332182 248
3 3300026067 Ga0207678_10296461 Ga0207678_102964612 248
4 3300039450 Ga0436363_0781631 Ga0436363_0781631_620_1366 248
5 3300045836 Ga0466958_0331143 Ga0466958_0331143_25_771 248
6 3300045976 Ga0466967_0087163 Ga0466967_0087163_16_762 248
7 3300046530 Ga0495654_0176126 Ga0495654_0176126_19_765 248
8 3300048904 Ga0496101_0353731 Ga0496101_0353731_16_762 248
9 3300048913 Ga0496110_0412740 Ga0496110_0412740_23_769 248
10 3300048929 Ga0496126_0015649 Ga0496126_0015649_4954_5700 248
11 3300049581 Ga0501047_0558464 Ga0501047_0558464_24_770 248
12 3300050491 nmdc:mga00v17_484748_c1 nmdc:mga00v17_484748_c1_33_779 248
13 3300050492 nmdc:mga0yw44_40216_c1 nmdc:mga0yw44_40216_c1_1452_2198 248
14 3300050516 nmdc:mga0sz30_15665_c1 nmdc:mga0sz30_15665_c1_889_1635 248
15 3300036401 Ga0373937_0536088 Ga0373937_0536088_337_1101 249
16 3300048904 Ga0496101_0215208 Ga0496101_0215208_424_1278 250
17 3300048911 Ga0496108_0236535 Ga0496108_0236535_602_1456 250
18 3300005535 Ga0070684_100307367 Ga0070684_1003073672 258
19 3300031852 Ga0307410_10280110 Ga0307410_102801102 258
20 3300006038 Ga0075365_10069690 Ga0075365_100696902 259
21 iso_pu_bacteria 2932431166 2932433507 262
22 3300048925 Ga0496122_0004513 Ga0496122_0004513_11167_12009 263
23 3300048926 Ga0496123_0001305 Ga0496123_0001305_4110_4952 263
24 3300048927 Ga0496124_0005518 Ga0496124_0005518_7201_8043 263
25 3300050491 nmdc:mga00v17_32423_c1 nmdc:mga00v17_32423_c1_826_1617 263
26 iso_pu_bacteria 2884994152 2884995038 264
27 iso_pu_bacteria 2643221690 2644506579 265
28 iso_pu_bacteria 2643221694 2644526507 265
29 iso_pu_bacteria 2643221722 2644671173 265
30 3300039447 Ga0436361_1177073 Ga0436361_1177073_30_833 267
31 3300048923 Ga0496120_0049691 Ga0496120_0049691_977_1906 267
32 3300003285 Ga0007423J48922_100409 Ga0007423J48922_1004094 268
33 3300006844 Ga0075428_100062477 Ga0075428_1000624774 268
34 3300006846 Ga0075430_100077042 Ga0075430_1000770423 268
35 3300006847 Ga0075431_100008579 Ga0075431_10000857911 268
36 3300031824 Ga0307413_10110240 Ga0307413_101102402 268
37 3300041413 Ga0439465_0120449 Ga0439465_0120449_95_901 268
38 3300048922 Ga0496119_0171592 Ga0496119_0171592_317_1123 268
39 3300050510 nmdc:mga06r32_2512_c1 nmdc:mga06r32_2512_c1_7935_8759 268
40 3300013308 Ga0157375_10300101 Ga0157375_103001012 269
41 3300032002 Ga0307416_100682247 Ga0307416_1006822471 269
42 3300047472 Ga0495686_0226075 Ga0495686_0226075_187_996 269
43 3300048913 Ga0496110_0308811 Ga0496110_0308811_365_1285 269
44 3300049569 Ga0501032_0060342 Ga0501032_0060342_1324_2211 269
45 3300049571 Ga0501034_0345457 Ga0501034_0345457_294_1181 269
46 3300049579 Ga0501043_0272354 Ga0501043_0272354_167_1054 269
47 3300049580 Ga0501046_0005106 Ga0501046_0005106_928_1815 269
48 3300049581 Ga0501047_0164112 Ga0501047_0164112_645_1532 269
49 3300049583 Ga0501067_0234043 Ga0501067_0234043_103_990 269
50 3300049589 Ga0501073_0318809 Ga0501073_0318809_11_898 269
51 3300049822 Ga0501035_0012495 Ga0501035_0012495_330_1217 269
52 3300049823 Ga0501044_0542799 Ga0501044_0542799_98_985 269
53 iso_pu_bacteria 2728369276 2729905568 269
54 iso_pu_bacteria 2738541272 2738692451 269
55 iso_pu_bacteria 2738543027 2739323538 269
56 iso_pu_bacteria 2758568522 2760303579 269
57 iso_pu_bacteria 2758568621 2760622566 269
58 iso_pu_bacteria 2808606394 2809027315 269
59 iso_pu_bacteria 2887478801 2887481970 269
60 iso_pu_bacteria 8001781756 8001781862 269
61 iso_pu_bacteria 8056579771 8056584053 269
62 3300003792 Ga0055540_1001773 Ga0055540_100177311 270
63 3300045976 Ga0466967_0190816 Ga0466967_0190816_384_1205 270
64 3300048911 Ga0496108_0158340 Ga0496108_0158340_667_1560 270
65 3300048920 Ga0496117_0033521 Ga0496117_0033521_1524_2423 270
66 3300048921 Ga0496118_0032711 Ga0496118_0032711_400_1299 270
67 3300048925 Ga0496122_0001777 Ga0496122_0001777_22311_23210 270
68 3300048928 Ga0496125_0011321 Ga0496125_0011321_6206_7096 270
69 3300049571 Ga0501034_0404107 Ga0501034_0404107_117_1013 270
70 iso_pu_bacteria 2811994880 2812365547 270
71 3300009147 Ga0114129_10005311 Ga0114129_100053117 271
72 3300009147 Ga0114129_10129234 Ga0114129_101292343 271
73 3300046459 Ga0495629_0064786 Ga0495629_0064786_1091_1945 271
74 3300046475 Ga0495639_0016604 Ga0495639_0016604_594_1448 271
75 3300046477 Ga0495664_0156176 Ga0495664_0156176_215_1069 271
76 3300046517 Ga0495630_0327631 Ga0495630_0327631_56_910 271
77 3300046690 Ga0495624_0008396 Ga0495624_0008396_1750_2604 271
78 3300047319 Ga0495674_0053332 Ga0495674_0053332_1521_2375 271
79 3300047673 Ga0495593_0001834 Ga0495593_0001834_2568_3422 271
80 3300048928 Ga0496125_0088506 Ga0496125_0088506_726_1580 271
81 3300048929 Ga0496126_0024059 Ga0496126_0024059_1295_2149 271
82 3300053730 Ga0500645_000195 Ga0500645_000195_38722_39576 271
83 3300005467 Ga0070706_100040530 Ga0070706_1000405303 272
84 3300025910 Ga0207684_10071576 Ga0207684_100715763 272
85 3300046507 Ga0495606_0001336 Ga0495606_0001336_2547_3383 272
86 3300046616 Ga0495668_0000103 Ga0495668_0000103_116053_116889 272
87 3300046660 Ga0495625_0001256 Ga0495625_0001256_14521_15357 272
88 3300047323 Ga0495683_0056358 Ga0495683_0056358_223_1059 272
89 3300048091 Ga0495626_0000461 Ga0495626_0000461_21648_22484 272
90 3300050492 nmdc:mga0yw44_243492_c1 nmdc:mga0yw44_243492_c1_242_1105 273
91 iso_pu_bacteria 2839986021 2839989406 273
92 3300037312 Ga0395899_0003096 Ga0395899_0003096_2360_3208 274
93 3300048928 Ga0496125_0000079 Ga0496125_0000079_210263_211231 274
94 3300005327 Ga0070658_10089642 Ga0070658_100896422 275
95 3300005329 Ga0070683_100006536 Ga0070683_1000065367 275
96 3300005329 Ga0070683_100026274 Ga0070683_1000262745 275
97 3300005330 Ga0070690_100316738 Ga0070690_1003167381 275
98 3300005335 Ga0070666_10222154 Ga0070666_102221542 275
99 3300005337 Ga0070682_100070268 Ga0070682_1000702682 275
100 3300005339 Ga0070660_100337678 Ga0070660_1003376782 275
101 3300005340 Ga0070689_100417573 Ga0070689_1004175731 275
102 3300005343 Ga0070687_100168780 Ga0070687_1001687802 275
103 3300005345 Ga0070692_10080896 Ga0070692_100808961 275
104 3300005345 Ga0070692_10089477 Ga0070692_100894772 275
105 3300005354 Ga0070675_100078300 Ga0070675_1000783003 275
106 3300005355 Ga0070671_100185484 Ga0070671_1001854841 275
107 3300005364 Ga0070673_100187500 Ga0070673_1001875002 275
108 3300005365 Ga0070688_100418205 Ga0070688_1004182051 275
109 3300005366 Ga0070659_100087194 Ga0070659_1000871943 275
110 3300005366 Ga0070659_100240088 Ga0070659_1002400882 275
111 3300005367 Ga0070667_100121550 Ga0070667_1001215504 275
112 3300005435 Ga0070714_100006869 Ga0070714_1000068698 275
113 3300005435 Ga0070714_100109541 Ga0070714_1001095413 275
114 3300005436 Ga0070713_100052927 Ga0070713_1000529273 275
115 3300005436 Ga0070713_100071745 Ga0070713_1000717452 275
116 3300005436 Ga0070713_100114138 Ga0070713_1001141383 275
117 3300005436 Ga0070713_100301330 Ga0070713_1003013302 275
118 3300005439 Ga0070711_100113640 Ga0070711_1001136402 275
119 3300005439 Ga0070711_100134054 Ga0070711_1001340542 275
120 3300005445 Ga0070708_100003731 Ga0070708_1000037312 275
121 3300005445 Ga0070708_100394472 Ga0070708_1003944722 275
122 3300005455 Ga0070663_100014150 Ga0070663_1000141507 275
123 3300005467 Ga0070706_100083639 Ga0070706_1000836392 275
124 3300005468 Ga0070707_100012429 Ga0070707_1000124293 275
125 3300005471 Ga0070698_100001201 Ga0070698_10000120114 275
126 3300005471 Ga0070698_100066428 Ga0070698_1000664283 275
127 3300005530 Ga0070679_100051372 Ga0070679_1000513722 275
128 3300005530 Ga0070679_100117806 Ga0070679_1001178063 275
129 3300005530 Ga0070679_100379427 Ga0070679_1003794272 275
130 3300005530 Ga0070679_100529802 Ga0070679_1005298021 275
131 3300005535 Ga0070684_100241191 Ga0070684_1002411911 275
132 3300005539 Ga0068853_100605557 Ga0068853_1006055571 275
133 3300005564 Ga0070664_100076835 Ga0070664_1000768352 275
134 3300005577 Ga0068857_100131939 Ga0068857_1001319391 275
135 3300005614 Ga0068856_100069718 Ga0068856_1000697182 275
136 3300005615 Ga0070702_100327176 Ga0070702_1003271761 275
137 3300005616 Ga0068852_100620758 Ga0068852_1006207582 275
138 3300005618 Ga0068864_100166572 Ga0068864_1001665722 275
139 3300005840 Ga0068870_10311905 Ga0068870_103119051 275
140 3300005841 Ga0068863_100176670 Ga0068863_1001766702 275
141 3300005983 Ga0081540_1000009 Ga0081540_100000986 275
142 3300006028 Ga0070717_10300905 Ga0070717_103009052 275
143 3300006173 Ga0070716_100182027 Ga0070716_1001820272 275
144 3300006173 Ga0070716_100208374 Ga0070716_1002083741 275
145 3300006173 Ga0070716_100390296 Ga0070716_1003902961 275
146 3300006175 Ga0070712_100003385 Ga0070712_1000033851 275
147 3300006871 Ga0075434_100393054 Ga0075434_1003930542 275
148 3300006881 Ga0068865_100145768 Ga0068865_1001457681 275
149 3300009093 Ga0105240_10229594 Ga0105240_102295943 275
150 3300009093 Ga0105240_10629624 Ga0105240_106296242 275
151 3300009098 Ga0105245_10163986 Ga0105245_101639862 275
152 3300012481 Ga0157320_1001111 Ga0157320_10011112 275
153 3300012483 Ga0157337_1000560 Ga0157337_10005602 275
154 3300012485 Ga0157325_1000878 Ga0157325_10008782 275
155 3300012488 Ga0157343_1002179 Ga0157343_10021791 275
156 3300012506 Ga0157324_1001796 Ga0157324_10017962 275
157 3300012507 Ga0157342_1002632 Ga0157342_10026321 275
158 3300013100 Ga0157373_10066671 Ga0157373_100666712 275
159 3300013104 Ga0157370_10162352 Ga0157370_101623522 275
160 3300013104 Ga0157370_10378440 Ga0157370_103784402 275
161 3300013105 Ga0157369_10080943 Ga0157369_100809432 275
162 3300014326 Ga0157380_10345549 Ga0157380_103455492 275
163 3300014745 Ga0157377_10086006 Ga0157377_100860062 275
164 3300014969 Ga0157376_10418342 Ga0157376_104183422 275
165 3300017792 Ga0163161_10235268 Ga0163161_102352681 275
166 3300020070 Ga0206356_10810878 Ga0206356_108108783 275
167 3300020080 Ga0206350_11663349 Ga0206350_116633492 275
168 3300020081 Ga0206354_10912145 Ga0206354_109121453 275
169 3300020082 Ga0206353_10272952 Ga0206353_102729523 275
170 3300020082 Ga0206353_10728243 Ga0206353_107282431 275
171 3300020082 Ga0206353_10730323 Ga0206353_107303233 275
172 3300021388 Ga0213875_10002694 Ga0213875_100026945 275
173 3300021388 Ga0213875_10120299 Ga0213875_101202991 275
174 3300021388 Ga0213875_10133357 Ga0213875_101333571 275
175 3300022467 Ga0224712_10074188 Ga0224712_100741882 275
176 3300024227 Ga0228598_1008297 Ga0228598_10082972 275
177 3300025898 Ga0207692_10099818 Ga0207692_100998181 275
178 3300025898 Ga0207692_10171875 Ga0207692_101718751 275
179 3300025901 Ga0207688_10091412 Ga0207688_100914122 275
180 3300025904 Ga0207647_10082703 Ga0207647_100827031 275
181 3300025906 Ga0207699_10003180 Ga0207699_100031804 275
182 3300025906 Ga0207699_10009261 Ga0207699_100092615 275
183 3300025906 Ga0207699_10019000 Ga0207699_100190002 275
184 3300025906 Ga0207699_10147453 Ga0207699_101474532 275
185 3300025906 Ga0207699_10324694 Ga0207699_103246942 275
186 3300025907 Ga0207645_10305810 Ga0207645_103058101 275
187 3300025908 Ga0207643_10007955 Ga0207643_100079551 275
188 3300025909 Ga0207705_10210219 Ga0207705_102102192 275
189 3300025909 Ga0207705_10214350 Ga0207705_102143501 275
190 3300025910 Ga0207684_10079001 Ga0207684_100790012 275
191 3300025912 Ga0207707_10007438 Ga0207707_100074382 275
192 3300025912 Ga0207707_10318444 Ga0207707_103184441 275
193 3300025915 Ga0207693_10020666 Ga0207693_100206664 275
194 3300025915 Ga0207693_10041360 Ga0207693_100413602 275
195 3300025916 Ga0207663_10055689 Ga0207663_100556892 275
196 3300025916 Ga0207663_10408253 Ga0207663_104082532 275
197 3300025916 Ga0207663_10455504 Ga0207663_104555041 275
198 3300025918 Ga0207662_10322918 Ga0207662_103229181 275
199 3300025919 Ga0207657_10022671 Ga0207657_100226715 275
200 3300025919 Ga0207657_10178552 Ga0207657_101785522 275
201 3300025921 Ga0207652_10357253 Ga0207652_103572532 275
202 3300025922 Ga0207646_10042204 Ga0207646_100422044 275
203 3300025922 Ga0207646_10415267 Ga0207646_104152672 275
204 3300025926 Ga0207659_10116885 Ga0207659_101168851 275
205 3300025928 Ga0207700_10009342 Ga0207700_100093425 275
206 3300025928 Ga0207700_10013024 Ga0207700_100130245 275
207 3300025928 Ga0207700_10016756 Ga0207700_100167563 275
208 3300025928 Ga0207700_10019742 Ga0207700_100197424 275
209 3300025928 Ga0207700_10126873 Ga0207700_101268732 275
210 3300025928 Ga0207700_10237475 Ga0207700_102374752 275
211 3300025929 Ga0207664_10001128 Ga0207664_1000112815 275
212 3300025929 Ga0207664_10006033 Ga0207664_100060337 275
213 3300025929 Ga0207664_10019807 Ga0207664_100198074 275
214 3300025929 Ga0207664_10043434 Ga0207664_100434342 275
215 3300025929 Ga0207664_10082344 Ga0207664_100823442 275
216 3300025933 Ga0207706_10022821 Ga0207706_100228214 275
217 3300025936 Ga0207670_10433663 Ga0207670_104336632 275
218 3300025938 Ga0207704_10131259 Ga0207704_101312591 275
219 3300025939 Ga0207665_10010016 Ga0207665_100100164 275
220 3300025939 Ga0207665_10037081 Ga0207665_100370811 275
221 3300025939 Ga0207665_10158823 Ga0207665_101588231 275
222 3300025939 Ga0207665_10365146 Ga0207665_103651462 275
223 3300025960 Ga0207651_10471971 Ga0207651_104719711 275
224 3300026067 Ga0207678_10029966 Ga0207678_100299664 275
225 3300026067 Ga0207678_10254511 Ga0207678_102545111 275
226 3300026078 Ga0207702_10005527 Ga0207702_100055274 275
227 3300026078 Ga0207702_10328063 Ga0207702_103280632 275
228 3300026089 Ga0207648_10369689 Ga0207648_103696891 275
229 3300026095 Ga0207676_10107838 Ga0207676_101078381 275
230 3300026116 Ga0207674_10020822 Ga0207674_100208224 275
231 3300026116 Ga0207674_10086649 Ga0207674_100866492 275
232 3300026118 Ga0207675_100108396 Ga0207675_1001083962 275
233 3300026121 Ga0207683_10001450 Ga0207683_1000145018 275
234 3300026142 Ga0207698_10528392 Ga0207698_105283921 275
235 3300028556 Ga0265337_1002649 Ga0265337_10026493 275
236 3300028563 Ga0265319_1023792 Ga0265319_10237922 275
237 3300028573 Ga0265334_10000870 Ga0265334_100008702 275
238 3300028577 Ga0265318_10028794 Ga0265318_100287942 275
239 3300028653 Ga0265323_10001759 Ga0265323_100017592 275
240 3300028654 Ga0265322_10003925 Ga0265322_100039252 275
241 3300028666 Ga0265336_10010405 Ga0265336_100104052 275
242 3300028800 Ga0265338_10001142 Ga0265338_1000114246 275
243 3300028800 Ga0265338_10009484 Ga0265338_100094842 275
244 3300028800 Ga0265338_10181845 Ga0265338_101818452 275
245 3300028800 Ga0265338_10306689 Ga0265338_103066891 275
246 3300029957 Ga0265324_10000666 Ga0265324_1000066611 275
247 3300031238 Ga0265332_10001385 Ga0265332_100013852 275
248 3300031241 Ga0265325_10014436 Ga0265325_100144363 275
249 3300031242 Ga0265329_10065381 Ga0265329_100653811 275
250 3300031247 Ga0265340_10087533 Ga0265340_100875332 275
251 3300031249 Ga0265339_10045029 Ga0265339_100450292 275
252 3300031711 Ga0265314_10007872 Ga0265314_100078722 275
253 3300031712 Ga0265342_10001467 Ga0265342_1000146717 275
254 3300035083 Ga0373926_0000765 Ga0373926_0000765_3802_4659 275
255 3300035086 Ga0373934_0009621 Ga0373934_0009621_305_1162 275
256 3300035111 Ga0373923_0001164 Ga0373923_0001164_860_1717 275
257 3300035113 Ga0373936_0013060 Ga0373936_0013060_1433_2290 275
258 3300035113 Ga0373936_0049067 Ga0373936_0049067_416_1270 275
259 3300035117 Ga0373953_0032669 Ga0373953_0032669_1054_1911 275
260 3300035118 Ga0373954_0017440 Ga0373954_0017440_2053_2910 275
261 3300035119 Ga0373956_0003365 Ga0373956_0003365_2849_3703 275
262 3300035119 Ga0373956_0052379 Ga0373956_0052379_467_1324 275
263 3300035119 Ga0373956_0162917 Ga0373956_0162917_21_878 275
264 3300035170 Ga0373943_0002009 Ga0373943_0002009_5088_5945 275
265 3300035171 Ga0373946_0000515 Ga0373946_0000515_2171_3028 275
266 3300035207 Ga0373942_0020308 Ga0373942_0020308_76_933 275
267 3300035691 Ga0373931_0009215 Ga0373931_0009215_1461_2318 275
268 3300035692 Ga0373935_0000488 Ga0373935_0000488_6659_7516 275
269 3300035692 Ga0373935_0039125 Ga0373935_0039125_1514_2371 275
270 3300035724 Ga0373933_0018935 Ga0373933_0018935_1083_1940 275
271 3300035725 Ga0373947_0000113 Ga0373947_0000113_1891_2748 275
272 3300036401 Ga0373937_0012529 Ga0373937_0012529_1967_2824 275
273 3300036401 Ga0373937_0128069 Ga0373937_0128069_1183_2037 275
274 3300036459 Ga0372808_011090 Ga0372808_011090_141_995 275
275 3300037068 Ga0373925_0000384 Ga0373925_0000384_39971_40825 275
276 3300037068 Ga0373925_0012546 Ga0373925_0012546_3796_4653 275
277 3300037068 Ga0373925_0166408 Ga0373925_0166408_637_1491 275
278 3300037466 Ga0395898_0019127 Ga0395898_0019127_4987_5841 275
279 3300037853 Ga0436364_0166036 Ga0436364_0166036_277_1134 275
280 3300037853 Ga0436364_0321419 Ga0436364_0321419_466_1320 275
281 3300037853 Ga0436364_0542227 Ga0436364_0542227_2684_3541 275
282 3300037853 Ga0436364_0584067 Ga0436364_0584067_145856_146710 275
283 3300037853 Ga0436364_0976891 Ga0436364_0976891_929_1786 275
284 3300037853 Ga0436364_1179018 Ga0436364_1179018_3018_3875 275
285 3300039438 Ga0436360_1375602 Ga0436360_1375602_728_1582 275
286 3300039450 Ga0436363_1124457 Ga0436363_1124457_20_877 275
287 3300044694 Ga0466963_0066894 Ga0466963_0066894_168_1022 275
288 3300046454 Ga0495592_0113781 Ga0495592_0113781_740_1597 275
289 3300046455 Ga0495603_0003763 Ga0495603_0003763_5032_5889 275
290 3300046459 Ga0495629_0002692 Ga0495629_0002692_6452_7309 275
291 3300046462 Ga0495651_0040615 Ga0495651_0040615_1189_2043 275
292 3300046463 Ga0495653_0125326 Ga0495653_0125326_40_897 275
293 3300046472 Ga0495580_0026504 Ga0495580_0026504_1058_1915 275
294 3300046473 Ga0495582_0000741 Ga0495582_0000741_12177_13034 275
295 3300046475 Ga0495639_0002161 Ga0495639_0002161_2659_3516 275
296 3300046477 Ga0495664_0013862 Ga0495664_0013862_1055_1912 275
297 3300046511 Ga0495608_0021905 Ga0495608_0021905_2258_3115 275
298 3300046511 Ga0495608_0050637 Ga0495608_0050637_1340_2194 275
299 3300046516 Ga0495628_0011936 Ga0495628_0011936_3812_4669 275
300 3300046517 Ga0495630_0010159 Ga0495630_0010159_1140_1997 275
301 3300046517 Ga0495630_0058729 Ga0495630_0058729_1500_2354 275
302 3300046526 Ga0495666_0002890 Ga0495666_0002890_3809_4666 275
303 3300046529 Ga0495652_0456585 Ga0495652_0456585_24_878 275
304 3300046531 Ga0495665_0000906 Ga0495665_0000906_5819_6676 275
305 3300046531 Ga0495665_0046289 Ga0495665_0046289_1222_2079 275
306 3300046533 Ga0495640_0001961 Ga0495640_0001961_11626_12483 275
307 3300046535 Ga0495586_0038012 Ga0495586_0038012_1267_2124 275
308 3300046543 Ga0495645_0241705 Ga0495645_0241705_98_955 275
309 3300046559 Ga0495667_0089327 Ga0495667_0089327_53_907 275
310 3300046642 Ga0495634_0014605 Ga0495634_0014605_3836_4693 275
311 3300046663 Ga0495635_0090410 Ga0495635_0090410_51_908 275
312 3300046674 Ga0495588_0091440 Ga0495588_0091440_515_1372 275
313 3300046675 Ga0495657_0052689 Ga0495657_0052689_679_1536 275
314 3300046679 Ga0495623_0099589 Ga0495623_0099589_283_1140 275
315 3300046680 Ga0495646_0050920 Ga0495646_0050920_724_1581 275
316 3300046681 Ga0495647_0084602 Ga0495647_0084602_412_1269 275
317 3300046683 Ga0495658_0111451 Ga0495658_0111451_316_1173 275
318 3300046689 Ga0495613_0001650 Ga0495613_0001650_3825_4682 275
319 3300046690 Ga0495624_0011180 Ga0495624_0011180_1702_2559 275
320 3300046809 Ga0495600_0014313 Ga0495600_0014313_183_1040 275
321 3300047315 Ga0495581_0000263 Ga0495581_0000263_20586_21443 275
322 3300047317 Ga0495604_0063128 Ga0495604_0063128_664_1518 275
323 3300047321 Ga0495676_0012085 Ga0495676_0012085_3857_4714 275
324 3300047322 Ga0495680_0040434 Ga0495680_0040434_1196_2053 275
325 3300047322 Ga0495680_0051429 Ga0495680_0051429_1092_1949 275
326 3300047322 Ga0495680_0056799 Ga0495680_0056799_1085_1939 275
327 3300047444 Ga0495675_0060131 Ga0495675_0060131_739_1596 275
328 3300047471 Ga0495684_0096501 Ga0495684_0096501_1323_2180 275
329 3300047673 Ga0495593_0007464 Ga0495593_0007464_594_1451 275
330 3300048088 Ga0495602_0032252 Ga0495602_0032252_3828_4685 275
331 3300048089 Ga0495614_0035816 Ga0495614_0035816_798_1655 275
332 3300048903 Ga0496100_0400995 Ga0496100_0400995_87_944 275
333 3300048903 Ga0496100_0413148 Ga0496100_0413148_142_999 275
334 3300048905 Ga0496102_0383493 Ga0496102_0383493_49_906 275
335 3300048907 Ga0496104_0029752 Ga0496104_0029752_3948_4805 275
336 3300048910 Ga0496107_0238751 Ga0496107_0238751_33_890 275
337 3300048915 Ga0496112_0319794 Ga0496112_0319794_450_1304 275
338 3300048916 Ga0496113_0160315 Ga0496113_0160315_205_1059 275
339 3300048916 Ga0496113_0168979 Ga0496113_0168979_815_1672 275
340 3300048916 Ga0496113_0391404 Ga0496113_0391404_210_1067 275
341 3300048918 Ga0496115_0259022 Ga0496115_0259022_203_1057 275
342 3300048918 Ga0496115_0346325 Ga0496115_0346325_312_1169 275
343 3300048929 Ga0496126_0015136 Ga0496126_0015136_6796_7650 275
344 3300048929 Ga0496126_0119174 Ga0496126_0119174_800_1654 275
345 3300050513 nmdc:mga0rr50_138433_c1 nmdc:mga0rr50_138433_c1_783_1640 275
346 3300053084 Ga0495595_0019342 Ga0495595_0019342_229_1086 275
347 3300053084 Ga0495595_0140202 Ga0495595_0140202_225_1079 275
348 3300053085 Ga0495619_0003141 Ga0495619_0003141_1390_2247 275
349 3300044683 Ga0466965_0284599 Ga0466965_0284599_19_849 276
350 3300049585 Ga0501069_0020740 Ga0501069_0020740_879_1724 276
351 3300049586 Ga0501070_0015755 Ga0501070_0015755_1215_2060 276
352 3300049589 Ga0501073_0285305 Ga0501073_0285305_83_928 276
353 3300049590 Ga0501074_0197163 Ga0501074_0197163_188_1033 276
354 3300049742 Ga0501080_0279676 Ga0501080_0279676_316_1161 276
355 3300049579 Ga0501043_0001755 Ga0501043_0001755_7792_8643 278
356 3300049581 Ga0501047_0001950 Ga0501047_0001950_18842_19693 278
357 3300049582 Ga0501048_0003785 Ga0501048_0003785_10393_11244 278
358 3300049590 Ga0501074_0001629 Ga0501074_0001629_4360_5211 278
359 3300037853 Ga0436364_0256774 Ga0436364_0256774_19778_20617 279
360 3300039437 Ga0436365_0792290 Ga0436365_0792290_610_1449 279
361 3300046524 Ga0495648_0001738 Ga0495648_0001738_10224_11063 279
362 3300046616 Ga0495668_0013468 Ga0495668_0013468_1051_1890 279
363 3300047320 Ga0495672_0001155 Ga0495672_0001155_8701_9540 279
364 3300047469 Ga0495673_0000708 Ga0495673_0000708_10093_10932 279
365 3300048903 Ga0496100_0057581 Ga0496100_0057581_683_1522 279
366 3300048905 Ga0496102_0000251 Ga0496102_0000251_26829_27668 279
367 3300048906 Ga0496103_0000990 Ga0496103_0000990_18577_19416 279
368 3300048909 Ga0496106_0508580 Ga0496106_0508580_69_908 279
369 3300048910 Ga0496107_0159872 Ga0496107_0159872_76_915 279
370 3300048912 Ga0496109_0540610 Ga0496109_0540610_202_1041 279
371 3300048920 Ga0496117_0002020 Ga0496117_0002020_2733_3572 279
372 3300048921 Ga0496118_0034681 Ga0496118_0034681_2749_3588 279
373 3300048922 Ga0496119_0040475 Ga0496119_0040475_1147_1986 279
374 3300048923 Ga0496120_0019927 Ga0496120_0019927_3414_4253 279
375 3300048924 Ga0496121_0019322 Ga0496121_0019322_5492_6331 279
376 3300048927 Ga0496124_0090520 Ga0496124_0090520_1343_2182 279
377 3300048928 Ga0496125_0093569 Ga0496125_0093569_1090_1929 279
378 3300048929 Ga0496126_0045618 Ga0496126_0045618_963_1802 279
379 3300053155 Ga0500620_051564 Ga0500620_051564_477_1316 279
380 iso_pu_bacteria 2643221687 2644486398 280
381 iso_pu_bacteria 2643221715 2644637323 280
382 iso_pu_bacteria 2738541274 2738706126 280
383 iso_pu_bacteria 2738543028 2739332974 280
384 iso_pu_bacteria 2842134933 2842138393 280
385 iso_pu_bacteria 2902792274 2902798491 280
386 iso_pu_bacteria 2902799365 2902801583 280
387 iso_pu_bacteria 2902810491 2902815482 280
388 iso_pu_bacteria 2902837492 2902840185 280
389 iso_pu_bacteria 2929212328 2929214979 280
390 iso_pu_bacteria 2939582691 2939587360 280
391 3300025932 Ga0207690_10229092 Ga0207690_102290922 281
392 3300003320 rootH2_10157116 rootH2_101571162 283
393 3300005434 Ga0070709_10241601 Ga0070709_102416012 283
394 3300005456 Ga0070678_100266111 Ga0070678_1002661112 283
395 3300009545 Ga0105237_10282367 Ga0105237_102823672 283
396 3300013105 Ga0157369_10085162 Ga0157369_100851622 283
397 3300025898 Ga0207692_10045226 Ga0207692_100452262 283
398 3300025914 Ga0207671_10417212 Ga0207671_104172121 283
399 3300049585 Ga0501069_0045295 Ga0501069_0045295_848_1699 283
400 3300000546 LJNas_1002016 LJNas_10020161 284
401 3300001977 JGI24746J21847_1005052 JGI24746J21847_10050522 284
402 3300001991 JGI24743J22301_10015602 JGI24743J22301_100156021 284
403 3300002070 JGI24750J21931_1003896 JGI24750J21931_10038962 284
404 3300002073 JGI24745J21846_1000595 JGI24745J21846_10005952 284
405 3300002074 JGI24748J21848_1004782 JGI24748J21848_10047822 284
406 3300002244 JGI24742J22300_10003385 JGI24742J22300_100033852 284
407 3300002459 JGI24751J29686_10008463 JGI24751J29686_100084632 284
408 3300003792 Ga0055540_1002004 Ga0055540_10020044 284
409 3300005328 Ga0070676_10003560 Ga0070676_100035603 284
410 3300005329 Ga0070683_100123072 Ga0070683_1001230722 284
411 3300005330 Ga0070690_100098649 Ga0070690_1000986492 284
412 3300005335 Ga0070666_10022380 Ga0070666_100223802 284
413 3300005337 Ga0070682_100043875 Ga0070682_1000438753 284
414 3300005338 Ga0068868_100001925 Ga0068868_1000019257 284
415 3300005338 Ga0068868_100214843 Ga0068868_1002148432 284
416 3300005339 Ga0070660_100360014 Ga0070660_1003600141 284
417 3300005341 Ga0070691_10019777 Ga0070691_100197772 284
418 3300005343 Ga0070687_100111861 Ga0070687_1001118611 284
419 3300005347 Ga0070668_100000140 Ga0070668_10000014042 284
420 3300005347 Ga0070668_100000721 Ga0070668_1000007213 284
421 3300005347 Ga0070668_100483453 Ga0070668_1004834531 284
422 3300005353 Ga0070669_100019162 Ga0070669_1000191626 284
423 3300005353 Ga0070669_100111779 Ga0070669_1001117792 284
424 3300005355 Ga0070671_100023362 Ga0070671_1000233623 284
425 3300005355 Ga0070671_100424353 Ga0070671_1004243531 284
426 3300005356 Ga0070674_100001316 Ga0070674_1000013164 284
427 3300005365 Ga0070688_100023636 Ga0070688_1000236362 284
428 3300005366 Ga0070659_100052771 Ga0070659_1000527712 284
429 3300005367 Ga0070667_100000408 Ga0070667_10000040851 284
430 3300005367 Ga0070667_100001695 Ga0070667_10000169516 284
431 3300005367 Ga0070667_100175346 Ga0070667_1001753462 284
432 3300005437 Ga0070710_10001921 Ga0070710_100019218 284
433 3300005437 Ga0070710_10006772 Ga0070710_100067722 284
434 3300005438 Ga0070701_10000646 Ga0070701_100006465 284
435 3300005439 Ga0070711_100006335 Ga0070711_1000063354 284
436 3300005441 Ga0070700_100000668 Ga0070700_1000006682 284
437 3300005441 Ga0070700_100138521 Ga0070700_1001385212 284
438 3300005455 Ga0070663_100119505 Ga0070663_1001195052 284
439 3300005455 Ga0070663_100119880 Ga0070663_1001198802 284
440 3300005455 Ga0070663_100132313 Ga0070663_1001323132 284
441 3300005456 Ga0070678_100000061 Ga0070678_10000006116 284
442 3300005456 Ga0070678_100461315 Ga0070678_1004613151 284
443 3300005459 Ga0068867_100008795 Ga0068867_1000087953 284
444 3300005535 Ga0070684_100108603 Ga0070684_1001086033 284
445 3300005539 Ga0068853_100000950 Ga0068853_10000095011 284
446 3300005539 Ga0068853_100032218 Ga0068853_1000322183 284
447 3300005539 Ga0068853_100168374 Ga0068853_1001683743 284
448 3300005543 Ga0070672_100260079 Ga0070672_1002600791 284
449 3300005544 Ga0070686_100098808 Ga0070686_1000988082 284
450 3300005545 Ga0070695_100118508 Ga0070695_1001185082 284
451 3300005546 Ga0070696_100004064 Ga0070696_1000040642 284
452 3300005548 Ga0070665_100003972 Ga0070665_10000397215 284
453 3300005548 Ga0070665_100008318 Ga0070665_1000083189 284
454 3300005548 Ga0070665_100047716 Ga0070665_1000477161 284
455 3300005548 Ga0070665_100066715 Ga0070665_1000667153 284
456 3300005549 Ga0070704_100008843 Ga0070704_1000088433 284
457 3300005549 Ga0070704_100156561 Ga0070704_1001565612 284
458 3300005563 Ga0068855_100125375 Ga0068855_1001253752 284
459 3300005578 Ga0068854_100003941 Ga0068854_10000394111 284
460 3300005578 Ga0068854_100103759 Ga0068854_1001037592 284
461 3300005615 Ga0070702_100001059 Ga0070702_1000010592 284
462 3300005616 Ga0068852_100078126 Ga0068852_1000781262 284
463 3300005616 Ga0068852_100120735 Ga0068852_1001207352 284
464 3300005617 Ga0068859_100000542 Ga0068859_1000005423 284
465 3300005617 Ga0068859_100006779 Ga0068859_1000067795 284
466 3300005617 Ga0068859_100614276 Ga0068859_1006142762 284
467 3300005618 Ga0068864_100124452 Ga0068864_1001244523 284
468 3300005718 Ga0068866_10001389 Ga0068866_100013897 284
469 3300005719 Ga0068861_100000122 Ga0068861_10000012227 284
470 3300005719 Ga0068861_100047044 Ga0068861_1000470442 284
471 3300005841 Ga0068863_100000352 Ga0068863_1000003525 284
472 3300005841 Ga0068863_100007618 Ga0068863_1000076183 284
473 3300005841 Ga0068863_100223395 Ga0068863_1002233952 284
474 3300005841 Ga0068863_100266909 Ga0068863_1002669092 284
475 3300005842 Ga0068858_100030398 Ga0068858_1000303983 284
476 3300005842 Ga0068858_100116828 Ga0068858_1001168282 284
477 3300005843 Ga0068860_100000542 Ga0068860_10000054252 284
478 3300005843 Ga0068860_100001605 Ga0068860_1000016053 284
479 3300005844 Ga0068862_100000422 Ga0068862_10000042250 284
480 3300005844 Ga0068862_100003787 Ga0068862_1000037874 284
481 3300005937 Ga0081455_10054128 Ga0081455_100541282 284
482 3300005937 Ga0081455_10330040 Ga0081455_103300402 284
483 3300005981 Ga0081538_10126763 Ga0081538_101267632 284
484 3300006038 Ga0075365_10002311 Ga0075365_100023116 284
485 3300006038 Ga0075365_10006639 Ga0075365_100066393 284
486 3300006038 Ga0075365_10034327 Ga0075365_100343273 284
487 3300006042 Ga0075368_10010682 Ga0075368_100106823 284
488 3300006048 Ga0075363_100000575 Ga0075363_1000005759 284
489 3300006048 Ga0075363_100001506 Ga0075363_1000015064 284
490 3300006048 Ga0075363_100003105 Ga0075363_1000031053 284
491 3300006048 Ga0075363_100083952 Ga0075363_1000839522 284
492 3300006048 Ga0075363_100088045 Ga0075363_1000880452 284
493 3300006048 Ga0075363_100102255 Ga0075363_1001022552 284
494 3300006048 Ga0075363_100218048 Ga0075363_1002180482 284
495 3300006051 Ga0075364_10007282 Ga0075364_100072826 284
496 3300006051 Ga0075364_10010478 Ga0075364_100104784 284
497 3300006051 Ga0075364_10018608 Ga0075364_100186083 284
498 3300006051 Ga0075364_10020437 Ga0075364_100204373 284
499 3300006051 Ga0075364_10025330 Ga0075364_100253302 284
500 3300006051 Ga0075364_10026875 Ga0075364_100268752 284
501 3300006051 Ga0075364_10056886 Ga0075364_100568861 284
502 3300006051 Ga0075364_10105487 Ga0075364_101054872 284
503 3300006051 Ga0075364_10150446 Ga0075364_101504462 284
504 3300006051 Ga0075364_10184613 Ga0075364_101846132 284
505 3300006163 Ga0070715_10070379 Ga0070715_100703792 284
506 3300006173 Ga0070716_100221822 Ga0070716_1002218222 284
507 3300006175 Ga0070712_100002266 Ga0070712_1000022664 284
508 3300006175 Ga0070712_100067471 Ga0070712_1000674712 284
509 3300006178 Ga0075367_10044122 Ga0075367_100441222 284
510 3300006178 Ga0075367_10053000 Ga0075367_100530002 284
511 3300006186 Ga0075369_10000575 Ga0075369_1000057512 284
512 3300006186 Ga0075369_10017701 Ga0075369_100177012 284
513 3300006186 Ga0075369_10028499 Ga0075369_100284993 284
514 3300006186 Ga0075369_10038689 Ga0075369_100386892 284
515 3300006186 Ga0075369_10044797 Ga0075369_100447972 284
516 3300006186 Ga0075369_10057658 Ga0075369_100576582 284
517 3300006353 Ga0075370_10000287 Ga0075370_100002873 284
518 3300006353 Ga0075370_10007884 Ga0075370_100078845 284
519 3300006353 Ga0075370_10046679 Ga0075370_100466792 284
520 3300006353 Ga0075370_10114042 Ga0075370_101140422 284
521 3300006844 Ga0075428_100025753 Ga0075428_1000257537 284
522 3300006846 Ga0075430_100079496 Ga0075430_1000794962 284
523 3300006846 Ga0075430_100152002 Ga0075430_1001520022 284
524 3300006847 Ga0075431_100044970 Ga0075431_1000449704 284
525 3300006881 Ga0068865_100134110 Ga0068865_1001341102 284
526 3300006931 Ga0097620_100000542 Ga0097620_1000005423 284
527 3300006931 Ga0097620_100006779 Ga0097620_1000067795 284
528 3300006931 Ga0097620_100614312 Ga0097620_1006143122 284
529 3300009092 Ga0105250_10063163 Ga0105250_100631632 284
530 3300009094 Ga0111539_10706926 Ga0111539_107069261 284
531 3300009098 Ga0105245_10003195 Ga0105245_100031957 284
532 3300009101 Ga0105247_10000058 Ga0105247_1000005852 284
533 3300009101 Ga0105247_10000456 Ga0105247_1000045614 284
534 3300009101 Ga0105247_10090669 Ga0105247_100906691 284
535 3300009101 Ga0105247_10202802 Ga0105247_102028022 284
536 3300009147 Ga0114129_10022769 Ga0114129_100227693 284
537 3300009174 Ga0105241_10010121 Ga0105241_100101216 284
538 3300009176 Ga0105242_10013523 Ga0105242_100135235 284
539 3300009177 Ga0105248_10000465 Ga0105248_1000046553 284
540 3300009177 Ga0105248_10007739 Ga0105248_100077397 284
541 3300009177 Ga0105248_10060085 Ga0105248_100600852 284
542 3300009545 Ga0105237_10000346 Ga0105237_1000034629 284
543 3300009553 Ga0105249_10000087 Ga0105249_1000008785 284
544 3300009553 Ga0105249_10061472 Ga0105249_100614723 284
545 3300009553 Ga0105249_10362262 Ga0105249_103622622 284
546 3300010159 Ga0099796_10023707 Ga0099796_100237072 284
547 3300010375 Ga0105239_10006651 Ga0105239_100066513 284
548 3300010375 Ga0105239_10008590 Ga0105239_100085902 284
549 3300010375 Ga0105239_10203058 Ga0105239_102030582 284
550 3300011119 Ga0105246_10081852 Ga0105246_100818521 284
551 3300013296 Ga0157374_10002901 Ga0157374_1000290115 284
552 3300013297 Ga0157378_10001141 Ga0157378_1000114117 284
553 3300013306 Ga0163162_10002035 Ga0163162_1000203517 284
554 3300013306 Ga0163162_10196156 Ga0163162_101961562 284
555 3300013306 Ga0163162_10256413 Ga0163162_102564132 284
556 3300013306 Ga0163162_10318504 Ga0163162_103185041 284
557 3300013307 Ga0157372_10002481 Ga0157372_1000248114 284
558 3300013308 Ga0157375_10001315 Ga0157375_1000131519 284
559 3300014325 Ga0163163_10012227 Ga0163163_100122279 284
560 3300014325 Ga0163163_10069609 Ga0163163_100696092 284
561 3300014326 Ga0157380_10010801 Ga0157380_100108012 284
562 3300014326 Ga0157380_10078474 Ga0157380_100784742 284
563 3300014968 Ga0157379_10078582 Ga0157379_100785822 284
564 3300014968 Ga0157379_10256357 Ga0157379_102563572 284
565 3300014968 Ga0157379_10598719 Ga0157379_105987191 284
566 3300017792 Ga0163161_10008010 Ga0163161_100080103 284
567 3300021384 Ga0213876_10003290 Ga0213876_100032903 284
568 3300021384 Ga0213876_10079654 Ga0213876_100796541 284
569 3300021384 Ga0213876_10101977 Ga0213876_101019772 284
570 3300021384 Ga0213876_10162039 Ga0213876_101620391 284
571 3300025303 Ga0209051_1000374 Ga0209051_100037431 284
572 3300025303 Ga0209051_1001633 Ga0209051_100163310 284
573 3300025303 Ga0209051_1010559 Ga0209051_10105593 284
574 3300025303 Ga0209051_1014037 Ga0209051_10140372 284
575 3300025898 Ga0207692_10002728 Ga0207692_100027284 284
576 3300025899 Ga0207642_10000428 Ga0207642_100004283 284
577 3300025900 Ga0207710_10000085 Ga0207710_1000008550 284
578 3300025900 Ga0207710_10002660 Ga0207710_100026604 284
579 3300025901 Ga0207688_10000504 Ga0207688_100005047 284
580 3300025903 Ga0207680_10059263 Ga0207680_100592632 284
581 3300025904 Ga0207647_10043111 Ga0207647_100431112 284
582 3300025907 Ga0207645_10006092 Ga0207645_100060923 284
583 3300025914 Ga0207671_10010010 Ga0207671_100100105 284
584 3300025915 Ga0207693_10000189 Ga0207693_1000018957 284
585 3300025915 Ga0207693_10000743 Ga0207693_100007432 284
586 3300025916 Ga0207663_10006285 Ga0207663_100062855 284
587 3300025916 Ga0207663_10111286 Ga0207663_101112862 284
588 3300025919 Ga0207657_10072884 Ga0207657_100728842 284
589 3300025919 Ga0207657_10175928 Ga0207657_101759282 284
590 3300025923 Ga0207681_10001891 Ga0207681_1000189110 284
591 3300025923 Ga0207681_10017104 Ga0207681_100171042 284
592 3300025927 Ga0207687_10004168 Ga0207687_100041686 284
593 3300025929 Ga0207664_10272283 Ga0207664_102722831 284
594 3300025931 Ga0207644_10126237 Ga0207644_101262373 284
595 3300025932 Ga0207690_10061846 Ga0207690_100618462 284
596 3300025932 Ga0207690_10092039 Ga0207690_100920393 284
597 3300025933 Ga0207706_10001089 Ga0207706_1000108925 284
598 3300025933 Ga0207706_10031536 Ga0207706_100315364 284
599 3300025934 Ga0207686_10014685 Ga0207686_100146852 284
600 3300025936 Ga0207670_10031218 Ga0207670_100312183 284
601 3300025937 Ga0207669_10001764 Ga0207669_100017644 284
602 3300025938 Ga0207704_10002051 Ga0207704_100020514 284
603 3300025938 Ga0207704_10095565 Ga0207704_100955652 284
604 3300025939 Ga0207665_10001533 Ga0207665_100015339 284
605 3300025940 Ga0207691_10039908 Ga0207691_100399083 284
606 3300025941 Ga0207711_10000071 Ga0207711_1000007166 284
607 3300025941 Ga0207711_10084560 Ga0207711_100845602 284
608 3300025942 Ga0207689_10001274 Ga0207689_1000127421 284
609 3300025960 Ga0207651_10155507 Ga0207651_101555072 284
610 3300025961 Ga0207712_10000040 Ga0207712_10000040136 284
611 3300025972 Ga0207668_10000208 Ga0207668_1000020835 284
612 3300025972 Ga0207668_10001301 Ga0207668_100013018 284
613 3300025972 Ga0207668_10171930 Ga0207668_101719301 284
614 3300025981 Ga0207640_10002912 Ga0207640_100029126 284
615 3300025986 Ga0207658_10000121 Ga0207658_1000012136 284
616 3300025986 Ga0207658_10014319 Ga0207658_100143193 284
617 3300026023 Ga0207677_10000688 Ga0207677_1000068820 284
618 3300026023 Ga0207677_10064885 Ga0207677_100648853 284
619 3300026035 Ga0207703_10083706 Ga0207703_100837063 284
620 3300026035 Ga0207703_10265569 Ga0207703_102655692 284
621 3300026041 Ga0207639_10001989 Ga0207639_100019897 284
622 3300026041 Ga0207639_10019463 Ga0207639_100194632 284
623 3300026041 Ga0207639_10219188 Ga0207639_102191882 284
624 3300026067 Ga0207678_10022754 Ga0207678_100227545 284
625 3300026067 Ga0207678_10036534 Ga0207678_100365344 284
626 3300026067 Ga0207678_10179167 Ga0207678_101791672 284
627 3300026075 Ga0207708_10025321 Ga0207708_100253212 284
628 3300026075 Ga0207708_10096973 Ga0207708_100969733 284
629 3300026088 Ga0207641_10000485 Ga0207641_1000048547 284
630 3300026088 Ga0207641_10001669 Ga0207641_1000166921 284
631 3300026088 Ga0207641_10210463 Ga0207641_102104632 284
632 3300026088 Ga0207641_10255848 Ga0207641_102558482 284
633 3300026089 Ga0207648_10011780 Ga0207648_100117807 284
634 3300026095 Ga0207676_10097556 Ga0207676_100975562 284
635 3300026095 Ga0207676_10335546 Ga0207676_103355462 284
636 3300026118 Ga0207675_100000325 Ga0207675_10000032531 284
637 3300026118 Ga0207675_100050760 Ga0207675_1000507604 284
638 3300026118 Ga0207675_100566335 Ga0207675_1005663352 284
639 3300026118 Ga0207675_100813110 Ga0207675_1008131101 284
640 3300026121 Ga0207683_10002228 Ga0207683_100022288 284
641 3300026142 Ga0207698_10082268 Ga0207698_100822682 284
642 3300026142 Ga0207698_10179610 Ga0207698_101796102 284
643 3300026142 Ga0207698_10191376 Ga0207698_101913761 284
644 3300027866 Ga0209813_10031716 Ga0209813_100317162 284
645 3300028379 Ga0268266_10004980 Ga0268266_100049803 284
646 3300028379 Ga0268266_10005247 Ga0268266_100052472 284
647 3300028379 Ga0268266_10031978 Ga0268266_100319783 284
648 3300028380 Ga0268265_10000004 Ga0268265_10000004501 284
649 3300028380 Ga0268265_10010963 Ga0268265_100109633 284
650 3300028381 Ga0268264_10000133 Ga0268264_10000133136 284
651 3300028381 Ga0268264_10012339 Ga0268264_100123394 284
652 3300028381 Ga0268264_10472293 Ga0268264_104722931 284
653 3300031731 Ga0307405_10117105 Ga0307405_101171052 284
654 3300032002 Ga0307416_100105520 Ga0307416_1001055202 284
655 3300032126 Ga0307415_100089643 Ga0307415_1000896432 284
656 3300032126 Ga0307415_100239283 Ga0307415_1002392832 284
657 3300035691 Ga0373931_0033382 Ga0373931_0033382_599_1453 284
658 3300035691 Ga0373931_0110279 Ga0373931_0110279_194_1048 284
659 3300037853 Ga0436364_0577957 Ga0436364_0577957_1262_2116 284
660 3300039437 Ga0436365_1378611 Ga0436365_1378611_54591_55445 284
661 3300039437 Ga0436365_1417225 Ga0436365_1417225_5839_6693 284
662 3300039437 Ga0436365_1640827 Ga0436365_1640827_15168_16022 284
663 3300039447 Ga0436361_1011110 Ga0436361_1011110_174_1028 284
664 3300039450 Ga0436363_0109061 Ga0436363_0109061_532_1386 284
665 3300041411 Ga0439466_0020266 Ga0439466_0020266_1493_2347 284
666 3300041411 Ga0439466_0034855 Ga0439466_0034855_820_1674 284
667 3300041411 Ga0439466_0047681 Ga0439466_0047681_156_1010 284
668 3300041413 Ga0439465_0003626 Ga0439465_0003626_463_1317 284
669 3300041413 Ga0439465_0012682 Ga0439465_0012682_1186_2040 284
670 3300041413 Ga0439465_0017398 Ga0439465_0017398_469_1323 284
671 3300041413 Ga0439465_0018610 Ga0439465_0018610_597_1451 284
672 3300041512 Ga0451853_3968863 Ga0451853_3968863_361_1215 284
673 3300041997 Ga0439431_0000223 Ga0439431_0000223_7675_8529 284
674 3300042002 Ga0439442_031735 Ga0439442_031735_163_1017 284
675 3300042435 Ga0439434_0002239 Ga0439434_0002239_3138_3992 284
676 3300042435 Ga0439434_0008604 Ga0439434_0008604_267_1121 284
677 3300044656 Ga0466969_0015046 Ga0466969_0015046_1012_1866 284
678 3300044658 Ga0466972_0009068 Ga0466972_0009068_2223_3077 284
679 3300044658 Ga0466972_0012833 Ga0466972_0012833_1971_2825 284
680 3300044658 Ga0466972_0022560 Ga0466972_0022560_54_908 284
681 3300044683 Ga0466965_0006718 Ga0466965_0006718_3567_4421 284
682 3300044684 Ga0466966_0015855 Ga0466966_0015855_912_1766 284
683 3300044684 Ga0466966_0026947 Ga0466966_0026947_2763_3617 284
684 3300044693 Ga0466961_0007565 Ga0466961_0007565_4998_5852 284
685 3300044693 Ga0466961_0034568 Ga0466961_0034568_319_1173 284
686 3300044706 Ga0466964_0153453 Ga0466964_0153453_36_890 284
687 3300044719 Ga0466971_0009900 Ga0466971_0009900_101_955 284
688 3300044719 Ga0466971_0031204 Ga0466971_0031204_1386_2240 284
689 3300044719 Ga0466971_0059790 Ga0466971_0059790_143_997 284
690 3300044735 Ga0466968_0000170 Ga0466968_0000170_4797_5651 284
691 3300044735 Ga0466968_0009892 Ga0466968_0009892_2102_2956 284
692 3300044735 Ga0466968_0021214 Ga0466968_0021214_906_1760 284
693 3300044735 Ga0466968_0044145 Ga0466968_0044145_163_1017 284
694 3300044765 Ga0466970_0023560 Ga0466970_0023560_2257_3111 284
695 3300044765 Ga0466970_0063050 Ga0466970_0063050_215_1069 284
696 3300044765 Ga0466970_0132124 Ga0466970_0132124_502_1356 284
697 3300044842 Ga0466957_0004576 Ga0466957_0004576_919_1773 284
698 3300044842 Ga0466957_0023286 Ga0466957_0023286_14_868 284
699 3300044901 Ga0466960_0000215 Ga0466960_0000215_7830_8684 284
700 3300044901 Ga0466960_0000976 Ga0466960_0000976_4607_5461 284
701 3300044901 Ga0466960_0002924 Ga0466960_0002924_4689_5543 284
702 3300045049 Ga0466959_0011763 Ga0466959_0011763_3559_4413 284
703 3300045049 Ga0466959_0030379 Ga0466959_0030379_601_1455 284
704 3300045049 Ga0466959_0061259 Ga0466959_0061259_643_1497 284
705 3300045049 Ga0466959_0108279 Ga0466959_0108279_915_1769 284
706 3300045049 Ga0466959_0113975 Ga0466959_0113975_514_1368 284
707 3300045836 Ga0466958_0008792 Ga0466958_0008792_4462_5316 284
708 3300045836 Ga0466958_0009085 Ga0466958_0009085_3513_4367 284
709 3300045836 Ga0466958_0073046 Ga0466958_0073046_454_1308 284
710 3300045836 Ga0466958_0138118 Ga0466958_0138118_161_1015 284
711 3300045976 Ga0466967_0020224 Ga0466967_0020224_934_1788 284
712 3300045976 Ga0466967_0029940 Ga0466967_0029940_1504_2358 284
713 3300045976 Ga0466967_0053479 Ga0466967_0053479_1526_2380 284
714 3300045976 Ga0466967_0105439 Ga0466967_0105439_247_1101 284
715 3300045976 Ga0466967_0136917 Ga0466967_0136917_644_1498 284
716 3300046460 Ga0495638_0006493 Ga0495638_0006493_143_997 284
717 3300046507 Ga0495606_0119931 Ga0495606_0119931_52_906 284
718 3300046648 Ga0495611_0084262 Ga0495611_0084262_511_1365 284
719 3300046663 Ga0495635_0160770 Ga0495635_0160770_539_1393 284
720 3300046683 Ga0495658_0014104 Ga0495658_0014104_2347_3201 284
721 3300046694 Ga0495649_0142910 Ga0495649_0142910_392_1246 284
722 3300047320 Ga0495672_0030117 Ga0495672_0030117_48_902 284
723 3300047472 Ga0495686_0002058 Ga0495686_0002058_12293_13147 284
724 3300048091 Ga0495626_0024357 Ga0495626_0024357_728_1582 284
725 3300048903 Ga0496100_0010615 Ga0496100_0010615_4089_4943 284
726 3300048903 Ga0496100_0041110 Ga0496100_0041110_356_1210 284
727 3300048903 Ga0496100_0056441 Ga0496100_0056441_515_1369 284
728 3300048903 Ga0496100_0161472 Ga0496100_0161472_428_1282 284
729 3300048904 Ga0496101_0000077 Ga0496101_0000077_64597_65451 284
730 3300048904 Ga0496101_0009771 Ga0496101_0009771_4222_5076 284
731 3300048904 Ga0496101_0015917 Ga0496101_0015917_137_991 284
732 3300048904 Ga0496101_0021950 Ga0496101_0021950_899_1753 284
733 3300048904 Ga0496101_0061879 Ga0496101_0061879_1775_2629 284
734 3300048904 Ga0496101_0092140 Ga0496101_0092140_453_1307 284
735 3300048905 Ga0496102_0000037 Ga0496102_0000037_133755_134609 284
736 3300048905 Ga0496102_0003075 Ga0496102_0003075_8910_9764 284
737 3300048905 Ga0496102_0063349 Ga0496102_0063349_2287_3141 284
738 3300048905 Ga0496102_0113661 Ga0496102_0113661_1377_2231 284
739 3300048905 Ga0496102_0153245 Ga0496102_0153245_1202_2056 284
740 3300048905 Ga0496102_0442665 Ga0496102_0442665_82_936 284
741 3300048906 Ga0496103_0000004 Ga0496103_0000004_444467_445321 284
742 3300048906 Ga0496103_0004671 Ga0496103_0004671_5810_6664 284
743 3300048906 Ga0496103_0036445 Ga0496103_0036445_952_1806 284
744 3300048907 Ga0496104_0051338 Ga0496104_0051338_2584_3438 284
745 3300048907 Ga0496104_0164267 Ga0496104_0164267_371_1225 284
746 3300048907 Ga0496104_0281674 Ga0496104_0281674_694_1548 284
747 3300048907 Ga0496104_0537996 Ga0496104_0537996_160_1014 284
748 3300048908 Ga0496105_0001753 Ga0496105_0001753_12934_13788 284
749 3300048908 Ga0496105_0159289 Ga0496105_0159289_646_1500 284
750 3300048909 Ga0496106_0001893 Ga0496106_0001893_2990_3844 284
751 3300048909 Ga0496106_0003936 Ga0496106_0003936_2587_3441 284
752 3300048909 Ga0496106_0116951 Ga0496106_0116951_666_1520 284
753 3300048909 Ga0496106_0219695 Ga0496106_0219695_199_1053 284
754 3300048909 Ga0496106_0317509 Ga0496106_0317509_157_1011 284
755 3300048910 Ga0496107_0000516 Ga0496107_0000516_16009_16863 284
756 3300048910 Ga0496107_0021871 Ga0496107_0021871_2851_3705 284
757 3300048910 Ga0496107_0147240 Ga0496107_0147240_579_1433 284
758 3300048911 Ga0496108_0000985 Ga0496108_0000985_11022_11876 284
759 3300048911 Ga0496108_0055065 Ga0496108_0055065_1482_2345 284
760 3300048911 Ga0496108_0073165 Ga0496108_0073165_1060_1914 284
761 3300048911 Ga0496108_0163421 Ga0496108_0163421_610_1464 284
762 3300048912 Ga0496109_0067923 Ga0496109_0067923_1770_2624 284
763 3300048912 Ga0496109_0097485 Ga0496109_0097485_1095_1958 284
764 3300048912 Ga0496109_0112964 Ga0496109_0112964_845_1699 284
765 3300048912 Ga0496109_0129241 Ga0496109_0129241_785_1639 284
766 3300048912 Ga0496109_0319740 Ga0496109_0319740_357_1211 284
767 3300048913 Ga0496110_0044929 Ga0496110_0044929_751_1605 284
768 3300048913 Ga0496110_0057528 Ga0496110_0057528_802_1656 284
769 3300048913 Ga0496110_0458166 Ga0496110_0458166_159_1013 284
770 3300048914 Ga0496111_0167342 Ga0496111_0167342_446_1300 284
771 3300048914 Ga0496111_0323264 Ga0496111_0323264_213_1067 284
772 3300048915 Ga0496112_0041223 Ga0496112_0041223_2283_3137 284
773 3300048915 Ga0496112_0053869 Ga0496112_0053869_1326_2180 284
774 3300048915 Ga0496112_0065270 Ga0496112_0065270_763_1617 284
775 3300048915 Ga0496112_0160339 Ga0496112_0160339_359_1213 284
776 3300048915 Ga0496112_0299157 Ga0496112_0299157_426_1280 284
777 3300048915 Ga0496112_0365714 Ga0496112_0365714_175_1029 284
778 3300048916 Ga0496113_0023349 Ga0496113_0023349_2084_2938 284
779 3300048916 Ga0496113_0125046 Ga0496113_0125046_842_1696 284
780 3300048916 Ga0496113_0165649 Ga0496113_0165649_232_1086 284
781 3300048917 Ga0496114_0000849 Ga0496114_0000849_19267_20121 284
782 3300048917 Ga0496114_0005631 Ga0496114_0005631_4658_5512 284
783 3300048917 Ga0496114_0084856 Ga0496114_0084856_424_1287 284
784 3300048917 Ga0496114_0178200 Ga0496114_0178200_131_985 284
785 3300048917 Ga0496114_0540680 Ga0496114_0540680_45_899 284
786 3300048918 Ga0496115_0001951 Ga0496115_0001951_12217_13071 284
787 3300048919 Ga0496116_0000056 Ga0496116_0000056_237374_238228 284
788 3300048920 Ga0496117_0000003 Ga0496117_0000003_1642870_1643724 284
789 3300048921 Ga0496118_0000001 Ga0496118_0000001_1642873_1643727 284
790 3300048922 Ga0496119_0034519 Ga0496119_0034519_856_1710 284
791 3300048923 Ga0496120_0006402 Ga0496120_0006402_6697_7551 284
792 3300048925 Ga0496122_0007065 Ga0496122_0007065_10242_11096 284
793 3300048926 Ga0496123_0005870 Ga0496123_0005870_6205_7059 284
794 3300048929 Ga0496126_0000735 Ga0496126_0000735_43904_44758 284
795 3300048929 Ga0496126_0014618 Ga0496126_0014618_688_1542 284
796 3300049569 Ga0501032_0056083 Ga0501032_0056083_1246_2100 284
797 3300049569 Ga0501032_0182474 Ga0501032_0182474_116_976 284
798 3300049570 Ga0501033_0026959 Ga0501033_0026959_497_1351 284
799 3300049570 Ga0501033_0154317 Ga0501033_0154317_238_1092 284
800 3300049571 Ga0501034_0002114 Ga0501034_0002114_22965_23819 284
801 3300049571 Ga0501034_0055564 Ga0501034_0055564_798_1652 284
802 3300049571 Ga0501034_0084203 Ga0501034_0084203_798_1652 284
803 3300049571 Ga0501034_0187097 Ga0501034_0187097_35_889 284
804 3300049572 Ga0501036_0104904 Ga0501036_0104904_1047_1901 284
805 3300049573 Ga0501037_0001890 Ga0501037_0001890_9153_10007 284
806 3300049573 Ga0501037_0014338 Ga0501037_0014338_1462_2316 284
807 3300049574 Ga0501038_0008303 Ga0501038_0008303_6031_6885 284
808 3300049575 Ga0501039_0000951 Ga0501039_0000951_15104_15958 284
809 3300049579 Ga0501043_0004425 Ga0501043_0004425_5039_5893 284
810 3300049579 Ga0501043_0070913 Ga0501043_0070913_821_1675 284
811 3300049579 Ga0501043_0137219 Ga0501043_0137219_50_904 284
812 3300049580 Ga0501046_0008048 Ga0501046_0008048_337_1191 284
813 3300049581 Ga0501047_0117374 Ga0501047_0117374_1599_2453 284
814 3300049581 Ga0501047_0176255 Ga0501047_0176255_753_1607 284
815 3300049581 Ga0501047_0476651 Ga0501047_0476651_94_948 284
816 3300049582 Ga0501048_0236494 Ga0501048_0236494_170_1024 284
817 3300049586 Ga0501070_0005284 Ga0501070_0005284_8691_9545 284
818 3300049586 Ga0501070_0035570 Ga0501070_0035570_1947_2801 284
819 3300049589 Ga0501073_0014064 Ga0501073_0014064_2063_2917 284
820 3300049589 Ga0501073_0043339 Ga0501073_0043339_1502_2356 284
821 3300049742 Ga0501080_0257036 Ga0501080_0257036_447_1301 284
822 3300049822 Ga0501035_0001031 Ga0501035_0001031_11754_12608 284
823 3300049822 Ga0501035_0002606 Ga0501035_0002606_2726_3580 284
824 3300049823 Ga0501044_0001769 Ga0501044_0001769_359_1213 284
825 3300049823 Ga0501044_0004936 Ga0501044_0004936_1843_2697 284
826 3300049823 Ga0501044_0022732 Ga0501044_0022732_4058_4912 284
827 3300049823 Ga0501044_0034133 Ga0501044_0034133_3683_4543 284
828 3300050489 nmdc:mga03683_21801_c1 nmdc:mga03683_21801_c1_676_1530 284
829 3300050490 nmdc:mga03n38_107347_c1 nmdc:mga03n38_107347_c1_143_997 284
830 3300050490 nmdc:mga03n38_51374_c1 nmdc:mga03n38_51374_c1_572_1426 284
831 3300050490 nmdc:mga03n38_80418_c1 nmdc:mga03n38_80418_c1_482_1336 284
832 3300050491 nmdc:mga00v17_13203_c1 nmdc:mga00v17_13203_c1_3042_3896 284
833 3300050491 nmdc:mga00v17_15026_c1 nmdc:mga00v17_15026_c1_1067_1921 284
834 3300050491 nmdc:mga00v17_163178_c1 nmdc:mga00v17_163178_c1_314_1168 284
835 3300050491 nmdc:mga00v17_17192_c1 nmdc:mga00v17_17192_c1_2815_3669 284
836 3300050491 nmdc:mga00v17_19115_c1 nmdc:mga00v17_19115_c1_1731_2585 284
837 3300050491 nmdc:mga00v17_4361_c1 nmdc:mga00v17_4361_c1_6319_7173 284
838 3300050491 nmdc:mga00v17_8290_c1 nmdc:mga00v17_8290_c1_4433_5287 284
839 3300050492 nmdc:mga0yw44_20059_c1 nmdc:mga0yw44_20059_c1_2373_3227 284
840 3300050492 nmdc:mga0yw44_44143_c1 nmdc:mga0yw44_44143_c1_1048_1902 284
841 3300050494 nmdc:mga06z11_11103_c1 nmdc:mga06z11_11103_c1_615_1469 284
842 3300050495 nmdc:mga04h51_36647_c1 nmdc:mga04h51_36647_c1_511_1365 284
843 3300050496 nmdc:mga07m45_3242_c1 nmdc:mga07m45_3242_c1_3104_3958 284
844 3300050496 nmdc:mga07m45_60598_c2 nmdc:mga07m45_60598_c2_39_893 284
845 3300050507 nmdc:mga05p37_38534_c1 nmdc:mga05p37_38534_c1_3371_4225 284
846 3300050509 nmdc:mga0qj67_7034_c1 nmdc:mga0qj67_7034_c1_6822_7676 284
847 3300050509 nmdc:mga0qj67_72643_c1 nmdc:mga0qj67_72643_c1_1094_1948 284
848 3300050510 nmdc:mga06r32_51989_c1 nmdc:mga06r32_51989_c1_2620_3474 284
849 3300050511 nmdc:mga08y16_522175_c1 nmdc:mga08y16_522175_c1_244_1098 284
850 3300050516 nmdc:mga0sz30_14784_c1 nmdc:mga0sz30_14784_c1_419_1273 284
851 3300050516 nmdc:mga0sz30_1985_c1 nmdc:mga0sz30_1985_c1_2507_3361 284
852 3300050516 nmdc:mga0sz30_4443_c1 nmdc:mga0sz30_4443_c1_3488_4342 284
853 3300050516 nmdc:mga0sz30_90242_c1 nmdc:mga0sz30_90242_c1_210_1103 284
854 3300053080 Ga0500635_0005140 Ga0500635_0005140_1336_2190 284
855 3300053087 Ga0500643_002707 Ga0500643_002707_5000_5854 284
856 3300053087 Ga0500643_005848 Ga0500643_005848_658_1512 284
857 3300053096 Ga0500641_0047176 Ga0500641_0047176_377_1231 284
858 3300053104 Ga0500556_0003029 Ga0500556_0003029_831_1685 284
859 3300053108 Ga0500562_006252 Ga0500562_006252_1153_2007 284
860 3300053131 Ga0500652_001797 Ga0500652_001797_4539_5393 284
861 3300053131 Ga0500652_017942 Ga0500652_017942_208_1062 284
862 3300053134 Ga0500658_0074833 Ga0500658_0074833_207_1061 284
863 3300053146 Ga0500588_0013486 Ga0500588_0013486_244_1098 284
864 3300053153 Ga0500616_0025979 Ga0500616_0025979_1108_1962 284
865 3300053158 Ga0500627_0005307 Ga0500627_0005307_2994_3848 284
866 3300061719 Ga0466962_0007816 Ga0466962_0007816_3744_4598 284
867 3300061719 Ga0466962_0083994 Ga0466962_0083994_74_928 284

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13312

DUF4081

Domain of unknown function (DUF4081)

80

190

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
5i0c-assembly1.cif.gz_A crystal structure of predicted acyltransferase yjdj with acyl-coa n-acyltransferase domain from escherichia coli str. k-12 0.8931 193 250
5isv-assembly2.cif.gz_B crystal structure of the ribosomal-protein-s18-alanine n-acetyltransferase from escherichia coli 0.8338 194 283
3d2p-assembly1.cif.gz_A crystal structure of n-acetylglutamate synthase from neisseria gonorrhoeae complexed with coenzyme a and l-arginine 0.8261 185 248
2cnt-assembly4.cif.gz_D rimi - ribosomal s18 n-alpha-protein acetyltransferase in complex with coenzymea. 0.8113 194 283
7ypu-assembly2.cif.gz_D orfe-coa-glycylthricin complex 0.8075 193 280
ID Description Score Start End Superfamily
af_I6XFI7_58_284_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9967 58 284 3.40.630.30
af_I6XFI7_58_284_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9923 58 284 3.40.630.30
5i0cA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8752 193 250 3.40.630.30
af_D4A230_16_108_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8548 193 254 3.40.630.30
af_E7EZI9_69_205_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8511 194 275 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A842GSR9-F1-model_v4 deleted 0.9925 15 284
AF-A0A0U0SN66-F1-model_v4 Gcn5-related N-acetyltransferase (EC 2.3.1.-) 0.9915 131 284 GO:0016747
AF-K5B8N6-F1-model_v4 Acetyltransferase family protein 0.9909 146 284 GO:0016747
AF-C0ZY28-F1-model_v4 N-acetyltransferase domain-containing protein 0.9879 15 284 GO:0016747
AF-A0A840F0N9-F1-model_v4 N-acetyltransferase domain-containing protein 0.9861 25 284 GO:0016747

Feature Viewer

pLDDT pTM Quality
93.57 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map