F483974

General Info

Members Datasets Scaffolds Average Seq Length
864 307 863 113

Family's Representative Sequence

Representative Sequence 3300059421|Ga0590071_000384|Ga0590071_000384_2590_2997
Length 135
Sequence MTASSMTAVDGVPRAAVSSHQELMGLTNTPSDLLPGTLELLILKTLVTGAKHGYGIVEHLRLASDDVLRVGESALYPALQRLLLNGWVKAEWGTSENKRRARYYTLTAAGRRQLAAERIEFDRMVGAIQRVLGAT

Samples

Sample ID Description Type Environment
1 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
73 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
74 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
75 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
76 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
77 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
78 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
79 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
80 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
85 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
86 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
87 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
88 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
89 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
90 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
91 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
92 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
94 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
95 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
97 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
98 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
100 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
101 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
102 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
103 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
104 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
105 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
106 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
107 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
108 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
109 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
110 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
111 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
112 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
113 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
114 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
115 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
116 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
117 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
118 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
119 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
120 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
121 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
182 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
184 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
187 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
188 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
189 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
190 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
191 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
192 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
193 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
194 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
195 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
196 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
197 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
198 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
199 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
200 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
201 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
202 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
203 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
204 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
205 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
206 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
207 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
208 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
209 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
210 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
211 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
212 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
213 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
214 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
215 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
216 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
217 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
218 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
219 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
220 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
221 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
222 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
223 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
224 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
225 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
226 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
227 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
228 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
229 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
230 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
231 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
232 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
233 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
234 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
235 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
236 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
237 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
238 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
239 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
240 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
241 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
242 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
243 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
244 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
245 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
246 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
262 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
263 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
264 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
265 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
266 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
267 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
268 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
269 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
270 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
271 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
272 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
273 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
274 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
275 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
276 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
277 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
278 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
279 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
280 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
282 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
283 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
284 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
285 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
286 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
287 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
288 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
289 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
290 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
291 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
292 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
293 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
294 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
295 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
296 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
297 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
298 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
299 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
300 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
301 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
302 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
303 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
304 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
305 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
306 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
307 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.55
Nodule 0
Rhizoplane 2.2
Rhizosphere 95.25
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10137353 3300002459 Unclassified 517
2 Ga0065712_10061041 3300005290 Unclassified 586
3 Ga0065712_10117350 3300005290 Bacteria 1722
4 Ga0065712_10138845 3300005290 Unclassified 1470
5 Ga0065715_10001128 3300005293 Bacteria 7791
6 Ga0065715_10123887 3300005293 Unclassified 2167
7 Ga0065715_10302846 3300005293 Unclassified 1037
8 Ga0065715_10524539 3300005293 Unclassified 761
9 Ga0065715_10651255 3300005293 Unclassified 678
10 Ga0065715_10675999 3300005293 Unclassified 636
11 Ga0065707_10800383 3300005295 Bacteria 599
12 Ga0070676_10085582 3300005328 Bacteria 1921
13 Ga0070676_10968838 3300005328 Unclassified 637
14 Ga0070683_100000832 3300005329 Bacteria 22877
15 Ga0070683_100804181 3300005329 Unclassified 901
16 Ga0070690_100153369 3300005330 Bacteria 1573
17 Ga0070690_100168592 3300005330 Bacteria 1505
18 Ga0070670_100014534 3300005331 Bacteria 6760
19 Ga0070670_100025765 3300005331 Bacteria 5061
20 Ga0070670_102243175 3300005331 Bacteria 503
21 Ga0070677_10784076 3300005333 Unclassified 543
22 Ga0068869_100136452 3300005334 Bacteria 1891
23 Ga0068869_100156175 3300005334 Bacteria 1773
24 Ga0070666_10038638 3300005335 Unclassified 3177
25 Ga0070666_10353254 3300005335 Unclassified 1052
26 Ga0070666_10821892 3300005335 Bacteria 685
27 Ga0070680_101660081 3300005336 Unclassified 554
28 Ga0068868_100220579 3300005338 Bacteria 1587
29 Ga0070660_100923913 3300005339 Bacteria 736
30 Ga0070689_100013867 3300005340 Bacteria 5841
31 Ga0070689_100255788 3300005340 Bacteria 1446
32 Ga0070689_100363593 3300005340 Unclassified 1216
33 Ga0070689_100832107 3300005340 Unclassified 813
34 Ga0070687_100316301 3300005343 Unclassified 996
35 Ga0070661_101785628 3300005344 Unclassified 522
36 Ga0070692_10068662 3300005345 Unclassified 1884
37 Ga0070668_100707830 3300005347 Unclassified 889
38 Ga0070668_101268242 3300005347 Unclassified 669
39 Ga0070669_100015181 3300005353 Bacteria 5485
40 Ga0070669_100074209 3300005353 Bacteria 2522
41 Ga0070669_100470418 3300005353 Bacteria 1038
42 Ga0070669_101053549 3300005353 Unclassified 699
43 Ga0070675_100393893 3300005354 Unclassified 1234
44 Ga0070675_100877263 3300005354 Unclassified 822
45 Ga0070675_101384746 3300005354 Unclassified 648
46 Ga0070671_100048909 3300005355 Bacteria 3518
47 Ga0070671_100255261 3300005355 Bacteria 1490
48 Ga0070674_100461051 3300005356 Bacteria 1051
49 Ga0070674_100666888 3300005356 Unclassified 885
50 Ga0070674_101500819 3300005356 Bacteria 606
51 Ga0070673_100001105 3300005364 Bacteria 15452
52 Ga0070673_100018616 3300005364 Unclassified 4966
53 Ga0070673_100150629 3300005364 Unclassified 1970
54 Ga0070688_100177557 3300005365 Unclassified 1474
55 Ga0070688_100453550 3300005365 Unclassified 959
56 Ga0070659_100512630 3300005366 Unclassified 1023
57 Ga0070659_100640396 3300005366 Unclassified 916
58 Ga0070667_100068417 3300005367 Bacteria 3021
59 Ga0070667_100301508 3300005367 Bacteria 1443
60 Ga0070667_100399345 3300005367 Bacteria 1251
61 Ga0070667_101131373 3300005367 Bacteria 732
62 Ga0070667_101509873 3300005367 Bacteria 631
63 Ga0070709_10028947 3300005434 Unclassified 3308
64 Ga0070709_10036144 3300005434 Bacteria 3007
65 Ga0070714_100013094 3300005435 Bacteria 6639
66 Ga0070714_100023917 3300005435 Bacteria 5025
67 Ga0070713_100000276 3300005436 Bacteria 33685
68 Ga0070713_100006548 3300005436 Bacteria 8090
69 Ga0070713_100017861 3300005436 Bacteria 5379
70 Ga0070713_100024802 3300005436 Bacteria 4679
71 Ga0070713_100036881 3300005436 Unclassified 3949
72 Ga0070710_10267658 3300005437 Unclassified 1104
73 Ga0070701_10186771 3300005438 Unclassified 1217
74 Ga0070701_10666419 3300005438 Bacteria 696
75 Ga0070711_100151258 3300005439 Unclassified 1750
76 Ga0070711_101424058 3300005439 Unclassified 603
77 Ga0070705_101390613 3300005440 Bacteria 585
78 Ga0070705_101882899 3300005440 Bacteria 509
79 Ga0070700_100291943 3300005441 Bacteria 1187
80 Ga0070700_101005758 3300005441 Bacteria 686
81 Ga0070700_101046325 3300005441 Unclassified 674
82 Ga0070694_100024733 3300005444 Bacteria 3878
83 Ga0070694_100105838 3300005444 Unclassified 1997
84 Ga0070694_100330513 3300005444 Unclassified 1176
85 Ga0070694_100764114 3300005444 Bacteria 790
86 Ga0070694_101525941 3300005444 Unclassified 566
87 Ga0070694_101668819 3300005444 Bacteria 542
88 Ga0070663_100140159 3300005455 Bacteria 1845
89 Ga0070663_100778677 3300005455 Unclassified 819
90 Ga0070678_100223233 3300005456 Unclassified 1567
91 Ga0070678_100554796 3300005456 Bacteria 1020
92 Ga0070678_100658578 3300005456 Unclassified 940
93 Ga0070678_101000520 3300005456 Unclassified 768
94 Ga0070662_100056066 3300005457 Unclassified 2860
95 Ga0070681_10011895 3300005458 Bacteria 8629
96 Ga0070681_11048105 3300005458 Unclassified 736
97 Ga0068867_100458250 3300005459 Unclassified 1088
98 Ga0070685_10355289 3300005466 Bacteria 1003
99 Ga0070685_10446532 3300005466 Unclassified 905
100 Ga0070685_11511349 3300005466 Unclassified 518
101 Ga0070706_100620631 3300005467 Bacteria 1004
102 Ga0070706_100668713 3300005467 Bacteria 964
103 Ga0070707_100013913 3300005468 Bacteria 7536
104 Ga0070707_100164488 3300005468 Bacteria 2162
105 Ga0070707_100529847 3300005468 Unclassified 1140
106 Ga0070698_100530657 3300005471 Bacteria 1115
107 Ga0070699_100425906 3300005518 Bacteria 1202
108 Ga0070699_100444953 3300005518 Bacteria 1174
109 Ga0070699_101253786 3300005518 Unclassified 680
110 Ga0070679_100090740 3300005530 Bacteria 3044
111 Ga0070679_100628379 3300005530 Unclassified 1017
112 Ga0070684_100000427 3300005535 Bacteria 28878
113 Ga0070697_100043629 3300005536 Bacteria 3632
114 Ga0070697_100321164 3300005536 Bacteria 1333
115 Ga0070697_100388571 3300005536 Bacteria 1209
116 Ga0070672_100013022 3300005543 Bacteria 5862
117 Ga0070672_100064072 3300005543 Bacteria 2904
118 Ga0070672_100305284 3300005543 Unclassified 1350
119 Ga0070686_100908773 3300005544 Unclassified 717
120 Ga0070686_101130098 3300005544 Unclassified 648
121 Ga0070695_100074645 3300005545 Bacteria 2229
122 Ga0070695_100284809 3300005545 Bacteria 1216
123 Ga0070695_101328660 3300005545 Unclassified 595
124 Ga0070696_100051203 3300005546 Bacteria 2871
125 Ga0070693_100014197 3300005547 Unclassified 4075
126 Ga0070693_100139831 3300005547 Unclassified 1523
127 Ga0070665_101003037 3300005548 Bacteria 847
128 Ga0070704_100036621 3300005549 Bacteria 3345
129 Ga0070704_100109520 3300005549 Bacteria 2099
130 Ga0070704_100296616 3300005549 Unclassified 1345
131 Ga0070704_100309211 3300005549 Bacteria 1320
132 Ga0070664_100000731 3300005564 Bacteria 25260
133 Ga0070664_100043243 3300005564 Bacteria 3801
134 Ga0068857_100974362 3300005577 Bacteria 815
135 Ga0068857_102250858 3300005577 Bacteria 535
136 Ga0068854_100222012 3300005578 Bacteria 1495
137 Ga0068856_102677994 3300005614 Bacteria 504
138 Ga0070702_100084248 3300005615 Bacteria 1911
139 Ga0070702_101744119 3300005615 Unclassified 519
140 Ga0068852_100163983 3300005616 Bacteria 2077
141 Ga0068852_100694084 3300005616 Bacteria 1027
142 Ga0068859_100001429 3300005617 Bacteria 24213
143 Ga0068859_100016773 3300005617 Bacteria 7354
144 Ga0068859_101233776 3300005617 Unclassified 824
145 Ga0068859_101484463 3300005617 Bacteria 748
146 Ga0068859_102513639 3300005617 Bacteria 567
147 Ga0068864_100077964 3300005618 Bacteria 2899
148 Ga0068864_102235240 3300005618 Unclassified 553
149 Ga0068861_100634070 3300005719 Unclassified 985
150 Ga0068861_100912536 3300005719 Bacteria 833
151 Ga0068861_101047229 3300005719 Bacteria 781
152 Ga0068851_10450310 3300005834 Unclassified 765
153 Ga0068870_10000669 3300005840 Bacteria 13042
154 Ga0068870_10374185 3300005840 Unclassified 920
155 Ga0068863_100042493 3300005841 Bacteria 4319
156 Ga0068858_100048964 3300005842 Bacteria 3914
157 Ga0068858_100264248 3300005842 Bacteria 1636
158 Ga0068858_100325416 3300005842 Bacteria 1470
159 Ga0068858_102421161 3300005842 Bacteria 519
160 Ga0068860_100141594 3300005843 Bacteria 2312
161 Ga0068860_100830947 3300005843 Bacteria 938
162 Ga0068860_100958117 3300005843 Bacteria 873
163 Ga0068862_100099912 3300005844 Bacteria 2537
164 Ga0068862_100301953 3300005844 Bacteria 1473
165 Ga0068862_100678580 3300005844 Unclassified 996
166 Ga0068862_100686850 3300005844 Unclassified 990
167 Ga0068862_100996291 3300005844 Unclassified 828
168 Ga0068862_102241212 3300005844 Bacteria 558
169 Ga0081538_10104056 3300005981 Bacteria 1418
170 Ga0070717_10002821 3300006028 Bacteria 12294
171 Ga0070717_10171904 3300006028 Bacteria 1885
172 Ga0070717_11984857 3300006028 Unclassified 524
173 Ga0075368_10418065 3300006042 Bacteria 591
174 Ga0075364_10006284 3300006051 Bacteria 6970
175 Ga0075364_10011345 3300006051 Bacteria 5413
176 Ga0075432_10183894 3300006058 Bacteria 819
177 Ga0070716_100265779 3300006173 Bacteria 1176
178 Ga0070712_100009439 3300006175 Bacteria 6149
179 Ga0070712_100615416 3300006175 Unclassified 920
180 Ga0070712_101744840 3300006175 Unclassified 545
181 Ga0075367_10011729 3300006178 Bacteria 4650
182 Ga0075367_10030938 3300006178 Bacteria 3072
183 Ga0075367_10480756 3300006178 Bacteria 787
184 Ga0075366_10172475 3300006195 Bacteria 1313
185 Ga0097621_100401611 3300006237 Bacteria 1227
186 Ga0097621_100485205 3300006237 Unclassified 1117
187 Ga0075370_10144472 3300006353 Bacteria 1392
188 Ga0068871_100492020 3300006358 Unclassified 1105
189 Ga0068871_100596804 3300006358 Unclassified 1004
190 Ga0068871_100875964 3300006358 Unclassified 831
191 Ga0075428_100007041 3300006844 Bacteria 12470
192 Ga0075428_100178199 3300006844 Bacteria 2301
193 Ga0075428_100352484 3300006844 Bacteria 1579
194 Ga0075428_100547472 3300006844 Bacteria 1237
195 Ga0075428_100988703 3300006844 Bacteria 891
196 Ga0075428_102083363 3300006844 Bacteria 587
197 Ga0075428_102635010 3300006844 Unclassified 513
198 Ga0075430_100029162 3300006846 Bacteria 4683
199 Ga0075430_100031688 3300006846 Bacteria 4486
200 Ga0075430_100165204 3300006846 Bacteria 1842
201 Ga0075430_100173353 3300006846 Bacteria 1795
202 Ga0075431_100031245 3300006847 Bacteria 5485
203 Ga0075431_100033158 3300006847 Bacteria 5322
204 Ga0075431_100036754 3300006847 Bacteria 5044
205 Ga0075431_100038962 3300006847 Bacteria 4896
206 Ga0075431_100105320 3300006847 Bacteria 2911
207 Ga0075431_100244967 3300006847 Unclassified 1822
208 Ga0075431_100535496 3300006847 Bacteria 1160
209 Ga0075431_100596799 3300006847 Bacteria 1088
210 Ga0075433_10000279 3300006852 Bacteria 30281
211 Ga0075433_10040561 3300006852 Bacteria 4031
212 Ga0075433_10052431 3300006852 Bacteria 3554
213 Ga0075433_10059212 3300006852 Bacteria 3351
214 Ga0075433_10063057 3300006852 Bacteria 3247
215 Ga0075433_10409100 3300006852 Bacteria 1197
216 Ga0075433_10646202 3300006852 Unclassified 927
217 Ga0075433_10724630 3300006852 Unclassified 870
218 Ga0075433_10810332 3300006852 Bacteria 818
219 Ga0075434_100026219 3300006871 Bacteria 5708
220 Ga0075434_100029167 3300006871 Bacteria 5426
221 Ga0075434_100100713 3300006871 Bacteria 2895
222 Ga0075434_100106612 3300006871 Bacteria 2812
223 Ga0075434_100114576 3300006871 Bacteria 2709
224 Ga0075434_100137340 3300006871 Bacteria 2464
225 Ga0075434_100273015 3300006871 Unclassified 1710
226 Ga0075434_100321405 3300006871 Unclassified 1568
227 Ga0075434_100653631 3300006871 Unclassified 1070
228 Ga0075434_101666373 3300006871 Unclassified 646
229 Ga0075434_102439559 3300006871 Unclassified 525
230 Ga0075429_100017403 3300006880 Bacteria 6214
231 Ga0075429_100058872 3300006880 Bacteria 3346
232 Ga0075429_100183005 3300006880 Unclassified 1836
233 Ga0075429_100210068 3300006880 Bacteria 1706
234 Ga0075429_100563635 3300006880 Unclassified 998
235 Ga0075429_101108276 3300006880 Unclassified 691
236 Ga0075429_101195675 3300006880 Bacteria 664
237 Ga0075429_101885216 3300006880 Bacteria 518
238 Ga0068865_100275308 3300006881 Unclassified 1338
239 Ga0068865_100381594 3300006881 Bacteria 1149
240 Ga0068865_101023268 3300006881 Bacteria 724
241 Ga0075436_100007526 3300006914 Bacteria 7441
242 Ga0075436_100031348 3300006914 Bacteria 3661
243 Ga0097620_100001429 3300006931 Bacteria 24213
244 Ga0097620_100016773 3300006931 Bacteria 7354
245 Ga0097620_101233685 3300006931 Unclassified 824
246 Ga0097620_101484366 3300006931 Bacteria 748
247 Ga0097620_102514517 3300006931 Bacteria 567
248 Ga0075435_100036693 3300007076 Bacteria 3897
249 Ga0075435_100091898 3300007076 Bacteria 2505
250 Ga0075435_100183876 3300007076 Bacteria 1767
251 Ga0075435_100451952 3300007076 Unclassified 1108
252 Ga0075435_101625679 3300007076 Unclassified 567
253 Ga0105240_10896218 3300009093 Bacteria 954
254 Ga0111539_10017483 3300009094 Bacteria 8878
255 Ga0111539_10040893 3300009094 Bacteria 5578
256 Ga0111539_10417082 3300009094 Bacteria 1564
257 Ga0111539_10671305 3300009094 Bacteria 1207
258 Ga0111539_10711407 3300009094 Bacteria 1169
259 Ga0111539_10945632 3300009094 Bacteria 1002
260 Ga0111539_10954090 3300009094 Bacteria 997
261 Ga0111539_11262530 3300009094 Unclassified 857
262 Ga0111539_11919620 3300009094 Bacteria 687
263 Ga0111539_12548858 3300009094 Unclassified 593
264 Ga0111539_12630887 3300009094 Bacteria 583
265 Ga0105245_10158176 3300009098 Unclassified 2148
266 Ga0105247_10033797 3300009101 Bacteria 3113
267 Ga0114129_10039797 3300009147 Bacteria 6631
268 Ga0114129_10471701 3300009147 Bacteria 1643
269 Ga0114129_10490864 3300009147 Bacteria 1605
270 Ga0114129_10531662 3300009147 Bacteria 1532
271 Ga0114129_11039190 3300009147 Bacteria 1029
272 Ga0114129_12417804 3300009147 Bacteria 629
273 Ga0105243_10560969 3300009148 Bacteria 1093
274 Ga0105241_10646842 3300009174 Unclassified 960
275 Ga0105241_10860684 3300009174 Bacteria 839
276 Ga0105248_10061019 3300009177 Bacteria 4233
277 Ga0105248_10103747 3300009177 Bacteria 3205
278 Ga0105237_11192059 3300009545 Unclassified 768
279 Ga0105238_10353079 3300009551 Bacteria 1459
280 Ga0105238_11034304 3300009551 Unclassified 843
281 Ga0105249_10026632 3300009553 Bacteria 5213
282 Ga0105249_10191348 3300009553 Bacteria 1997
283 Ga0105249_10443888 3300009553 Bacteria 1335
284 Ga0105249_10777768 3300009553 Bacteria 1020
285 Ga0105249_11148179 3300009553 Bacteria 847
286 Ga0105249_12410352 3300009553 Unclassified 599
287 Ga0105239_13577520 3300010375 Unclassified 505
288 Ga0157325_1020697 3300012485 Unclassified 585
289 Ga0157373_10968953 3300013100 Unclassified 633
290 Ga0157373_11268816 3300013100 Bacteria 557
291 Ga0157371_11581429 3300013102 Bacteria 513
292 Ga0157369_10580049 3300013105 Bacteria 1158
293 Ga0157374_11162589 3300013296 Unclassified 793
294 Ga0157378_10692872 3300013297 Bacteria 1038
295 Ga0163162_10052692 3300013306 Bacteria 4087
296 Ga0163162_10650907 3300013306 Bacteria 1177
297 Ga0163162_11884987 3300013306 Unclassified 684
298 Ga0157372_11402433 3300013307 Bacteria 805
299 Ga0157375_10383508 3300013308 Bacteria 1572
300 Ga0157375_11122950 3300013308 Unclassified 921
301 Ga0157375_11135958 3300013308 Bacteria 915
302 Ga0157375_13247229 3300013308 Bacteria 542
303 Ga0163163_10017852 3300014325 Bacteria 6624
304 Ga0163163_10289507 3300014325 Bacteria 1690
305 Ga0163163_12477689 3300014325 Unclassified 577
306 Ga0157380_10039968 3300014326 Bacteria 3651
307 Ga0157380_10149713 3300014326 Bacteria 2016
308 Ga0157380_10295676 3300014326 Unclassified 1489
309 Ga0157380_10502001 3300014326 Bacteria 1179
310 Ga0157380_10697861 3300014326 Bacteria 1019
311 Ga0157380_10772503 3300014326 Unclassified 975
312 Ga0157380_11111208 3300014326 Unclassified 830
313 Ga0157380_11155313 3300014326 Bacteria 816
314 Ga0157380_12541842 3300014326 Unclassified 578
315 Ga0157377_10147876 3300014745 Bacteria 1450
316 Ga0157379_12622111 3300014968 Unclassified 505
317 Ga0157376_10201947 3300014969 Bacteria 1830
318 Ga0157376_10452257 3300014969 Unclassified 1253
319 Ga0163161_10463970 3300017792 Unclassified 1026
320 Ga0163161_10506011 3300017792 Unclassified 984
321 Ga0207697_10003386 3300025315 Bacteria 7917
322 Ga0207697_10054729 3300025315 Unclassified 1654
323 Ga0207653_10100958 3300025885 Bacteria 1021
324 Ga0207682_10446706 3300025893 Unclassified 612
325 Ga0207692_10029987 3300025898 Unclassified 2590
326 Ga0207710_10134034 3300025900 Bacteria 1191
327 Ga0207688_10342575 3300025901 Unclassified 920
328 Ga0207688_10358613 3300025901 Unclassified 899
329 Ga0207688_10827728 3300025901 Unclassified 586
330 Ga0207680_10023481 3300025903 Unclassified 3369
331 Ga0207680_10109105 3300025903 Bacteria 1791
332 Ga0207680_10194102 3300025903 Bacteria 1380
333 Ga0207680_10791396 3300025903 Bacteria 680
334 Ga0207680_10860375 3300025903 Unclassified 650
335 Ga0207699_10019009 3300025906 Bacteria 3653
336 Ga0207699_10032073 3300025906 Bacteria 2957
337 Ga0207699_10446822 3300025906 Unclassified 927
338 Ga0207645_10411554 3300025907 Bacteria 910
339 Ga0207643_10009182 3300025908 Bacteria 5310
340 Ga0207643_10032482 3300025908 Bacteria 2915
341 Ga0207684_10289581 3300025910 Bacteria 1412
342 Ga0207684_10551107 3300025910 Bacteria 986
343 Ga0207684_10590586 3300025910 Bacteria 949
344 Ga0207707_10041446 3300025912 Bacteria 4021
345 Ga0207695_11565461 3300025913 Bacteria 540
346 Ga0207693_10009463 3300025915 Bacteria 7936
347 Ga0207693_10472113 3300025915 Unclassified 980
348 Ga0207663_10117773 3300025916 Bacteria 1813
349 Ga0207660_11393893 3300025917 Unclassified 568
350 Ga0207662_10011924 3300025918 Bacteria 4833
351 Ga0207662_10737184 3300025918 Unclassified 692
352 Ga0207662_11134745 3300025918 Unclassified 556
353 Ga0207652_11470085 3300025921 Unclassified 585
354 Ga0207646_10038261 3300025922 Bacteria 4322
355 Ga0207646_10271320 3300025922 Bacteria 1533
356 Ga0207646_10592546 3300025922 Bacteria 995
357 Ga0207646_10867662 3300025922 Bacteria 802
358 Ga0207681_10081793 3300025923 Bacteria 2281
359 Ga0207681_10992339 3300025923 Unclassified 704
360 Ga0207681_11735050 3300025923 Unclassified 521
361 Ga0207694_10775530 3300025924 Unclassified 810
362 Ga0207650_10062337 3300025925 Unclassified 2786
363 Ga0207650_11743144 3300025925 Bacteria 527
364 Ga0207659_10000073 3300025926 Bacteria 64021
365 Ga0207659_10379062 3300025926 Unclassified 1179
366 Ga0207659_10981364 3300025926 Unclassified 727
367 Ga0207687_10169925 3300025927 Unclassified 1681
368 Ga0207700_10004627 3300025928 Bacteria 8148
369 Ga0207700_10040378 3300025928 Unclassified 3405
370 Ga0207700_10132842 3300025928 Bacteria 2035
371 Ga0207700_10161575 3300025928 Bacteria 1861
372 Ga0207664_10016111 3300025929 Bacteria 5446
373 Ga0207664_10634719 3300025929 Bacteria 960
374 Ga0207644_10205669 3300025931 Bacteria 1554
375 Ga0207644_10279790 3300025931 Bacteria 1339
376 Ga0207706_10208048 3300025933 Unclassified 1715
377 Ga0207706_10262137 3300025933 Bacteria 1509
378 Ga0207706_10484078 3300025933 Unclassified 1069
379 Ga0207706_10722697 3300025933 Bacteria 850
380 Ga0207686_10785104 3300025934 Unclassified 762
381 Ga0207709_10250247 3300025935 Bacteria 1294
382 Ga0207670_10115775 3300025936 Bacteria 1940
383 Ga0207670_10691622 3300025936 Unclassified 844
384 Ga0207670_10700813 3300025936 Unclassified 838
385 Ga0207670_11443206 3300025936 Bacteria 585
386 Ga0207669_10024450 3300025937 Bacteria 3247
387 Ga0207669_11221783 3300025937 Bacteria 637
388 Ga0207704_10347610 3300025938 Unclassified 1153
389 Ga0207704_10815046 3300025938 Unclassified 780
390 Ga0207704_11138490 3300025938 Bacteria 664
391 Ga0207665_10852205 3300025939 Unclassified 721
392 Ga0207691_10001303 3300025940 Bacteria 24901
393 Ga0207691_10100312 3300025940 Unclassified 2584
394 Ga0207691_10289509 3300025940 Bacteria 1409
395 Ga0207711_10064468 3300025941 Bacteria 3165
396 Ga0207711_10751037 3300025941 Unclassified 909
397 Ga0207689_10018742 3300025942 Bacteria 5837
398 Ga0207689_10023001 3300025942 Bacteria 5236
399 Ga0207689_10035270 3300025942 Bacteria 4157
400 Ga0207689_10199138 3300025942 Unclassified 1653
401 Ga0207661_10001975 3300025944 Bacteria 14117
402 Ga0207679_10001040 3300025945 Bacteria 17750
403 Ga0207679_10061165 3300025945 Bacteria 2802
404 Ga0207679_11941937 3300025945 Unclassified 536
405 Ga0207651_10055108 3300025960 Bacteria 2728
406 Ga0207651_10134666 3300025960 Unclassified 1898
407 Ga0207651_11057940 3300025960 Unclassified 726
408 Ga0207712_10297894 3300025961 Bacteria 1322
409 Ga0207712_10980608 3300025961 Unclassified 749
410 Ga0207712_11317275 3300025961 Unclassified 646
411 Ga0207668_11657242 3300025972 Unclassified 577
412 Ga0207640_10084497 3300025981 Bacteria 2180
413 Ga0207658_10133653 3300025986 Bacteria 1997
414 Ga0207658_10497249 3300025986 Bacteria 1086
415 Ga0207677_10259759 3300026023 Unclassified 1415
416 Ga0207677_10692450 3300026023 Unclassified 903
417 Ga0207703_10095748 3300026035 Bacteria 2505
418 Ga0207703_10166387 3300026035 Unclassified 1935
419 Ga0207703_10516857 3300026035 Unclassified 1122
420 Ga0207703_10647452 3300026035 Unclassified 1002
421 Ga0207678_10018809 3300026067 Bacteria 6068
422 Ga0207678_10052392 3300026067 Bacteria 3521
423 Ga0207678_11476904 3300026067 Bacteria 600
424 Ga0207708_10041908 3300026075 Bacteria 3490
425 Ga0207708_10054163 3300026075 Bacteria 3058
426 Ga0207708_10609390 3300026075 Bacteria 926
427 Ga0207702_11280217 3300026078 Unclassified 727
428 Ga0207641_10030781 3300026088 Bacteria 4447
429 Ga0207648_10054198 3300026089 Bacteria 3503
430 Ga0207648_10384508 3300026089 Unclassified 1269
431 Ga0207676_10055314 3300026095 Bacteria 3115
432 Ga0207676_10486214 3300026095 Bacteria 1170
433 Ga0207676_10954914 3300026095 Unclassified 843
434 Ga0207674_10219000 3300026116 Bacteria 1852
435 Ga0207674_11348640 3300026116 Bacteria 683
436 Ga0207675_100031844 3300026118 Bacteria 4912
437 Ga0207675_100032823 3300026118 Bacteria 4837
438 Ga0207675_100400715 3300026118 Bacteria 1352
439 Ga0207675_101370530 3300026118 Bacteria 728
440 Ga0207675_101524061 3300026118 Unclassified 689
441 Ga0207675_102137051 3300026118 Bacteria 576
442 Ga0207683_10006140 3300026121 Bacteria 10293
443 Ga0207683_10210903 3300026121 Unclassified 1768
444 Ga0207683_10304432 3300026121 Bacteria 1458
445 Ga0207683_10482490 3300026121 Bacteria 1144
446 Ga0207698_10176649 3300026142 Bacteria 1886
447 Ga0209995_1012700 3300027471 Unclassified 1376
448 Ga0209968_1075666 3300027526 Bacteria 603
449 Ga0209999_1075119 3300027543 Bacteria 650
450 Ga0209971_1066948 3300027682 Bacteria 871
451 Ga0209813_10089102 3300027866 Bacteria 1033
452 Ga0209974_10035953 3300027876 Bacteria 1645
453 Ga0207428_10012852 3300027907 Bacteria 7339
454 Ga0207428_10227018 3300027907 Bacteria 1398
455 Ga0207428_10658216 3300027907 Bacteria 751
456 Ga0268265_10086941 3300028380 Bacteria 2486
457 Ga0268265_10112602 3300028380 Bacteria 2225
458 Ga0268265_10156500 3300028380 Bacteria 1929
459 Ga0268265_10672789 3300028380 Unclassified 997
460 Ga0268265_10774286 3300028380 Unclassified 933
461 Ga0268265_10785101 3300028380 Bacteria 927
462 Ga0268265_12066193 3300028380 Bacteria 577
463 Ga0268264_10201234 3300028381 Bacteria 1822
464 Ga0268264_10642218 3300028381 Bacteria 1050
465 Ga0268264_10961971 3300028381 Unclassified 859
466 Ga0268264_11580646 3300028381 Bacteria 666
467 Ga0268264_11604123 3300028381 Bacteria 661
468 Ga0307408_100010704 3300031548 Bacteria 6050
469 Ga0307408_100027722 3300031548 Bacteria 3907
470 Ga0307408_100075965 3300031548 Bacteria 2497
471 Ga0307408_100290526 3300031548 Unclassified 1365
472 Ga0307405_10022749 3300031731 Bacteria 3550
473 Ga0307405_10243839 3300031731 Bacteria 1333
474 Ga0307413_10118450 3300031824 Bacteria 1788
475 Ga0307413_10299204 3300031824 Bacteria 1219
476 Ga0307413_11348066 3300031824 Bacteria 626
477 Ga0307410_10121419 3300031852 Bacteria 1906
478 Ga0307410_10969979 3300031852 Bacteria 732
479 Ga0307410_11048844 3300031852 Unclassified 705
480 Ga0307410_11119037 3300031852 Unclassified 683
481 Ga0307410_11202630 3300031852 Bacteria 660
482 Ga0307406_10384391 3300031901 Unclassified 1108
483 Ga0307406_10582575 3300031901 Unclassified 920
484 Ga0307406_10703776 3300031901 Unclassified 844
485 Ga0307407_10220463 3300031903 Bacteria 1282
486 Ga0307407_10277789 3300031903 Unclassified 1159
487 Ga0307412_10134685 3300031911 Bacteria 1800
488 Ga0307412_11572918 3300031911 Bacteria 600
489 Ga0307409_100146913 3300031995 Bacteria 2040
490 Ga0307409_100572295 3300031995 Bacteria 1112
491 Ga0307409_101303514 3300031995 Unclassified 751
492 Ga0307416_100012026 3300032002 Bacteria 5809
493 Ga0307416_100132786 3300032002 Bacteria 2245
494 Ga0307416_100475416 3300032002 Bacteria 1308
495 Ga0307416_100652584 3300032002 Bacteria 1137
496 Ga0307416_101098857 3300032002 Bacteria 900
497 Ga0307416_103650824 3300032002 Bacteria 515
498 Ga0307414_11258648 3300032004 Unclassified 686
499 Ga0307411_10080548 3300032005 Bacteria 2239
500 Ga0307411_10081660 3300032005 Bacteria 2227
501 Ga0307411_10559034 3300032005 Unclassified 977
502 Ga0307411_11129494 3300032005 Bacteria 708
503 Ga0307415_100091654 3300032126 Bacteria 2202
504 Ga0307415_100337760 3300032126 Bacteria 1263
505 Ga0307415_101926063 3300032126 Bacteria 574
506 Ga0373926_0162020 3300035083 Unclassified 854
507 Ga0373952_0009107 3300035092 Bacteria 1894
508 Ga0373939_0235472 3300035114 Unclassified 707
509 Ga0373941_0275203 3300035115 Bacteria 664
510 Ga0373931_0177560 3300035691 Bacteria 1259
511 Ga0373927_0361175 3300035695 Unclassified 957
512 Ga0373937_0479205 3300036401 Bacteria 1182
513 Ga0373925_0127746 3300037068 Bacteria 1979
514 Ga0439461_0024323 3300041410 Unclassified 1224
515 Ga0451802_0382625 3300041460 Bacteria 1093
516 Ga0439431_0112928 3300041997 Bacteria 753
517 Ga0439432_230643 3300042006 Bacteria 533
518 Ga0439450_040913 3300042008 Bacteria 1076
519 Ga0439454_072667 3300042011 Bacteria 613
520 Ga0450914_013279 3300042118 Bacteria 836
521 Ga0450920_089620 3300042122 Bacteria 634
522 Ga0450923_028307 3300042125 Unclassified 1131
523 Ga0439446_0273827 3300042156 Bacteria 587
524 Ga0439435_0110327 3300042436 Bacteria 853
525 Ga0439435_0154504 3300042436 Bacteria 738
526 Ga0439464_0074408 3300042439 Bacteria 1008
527 Ga0439464_0094702 3300042439 Bacteria 903
528 Ga0451577_1584149 3300042876 Unclassified 578
529 Ga0439440_0137741 3300042993 Bacteria 691
530 Ga0453683_0779470 3300044673 Bacteria 629
531 Ga0451576_0133145 3300045051 Bacteria 2591
532 Ga0451576_0475306 3300045051 Bacteria 1313
533 Ga0495594_0871369 3300046499 Bacteria 506
534 Ga0495630_1006204 3300046517 Bacteria 633
535 Ga0495643_0005610 3300046522 Bacteria 8431
536 Ga0495598_0305637 3300046537 Archaea 603
537 Ga0495609_0145927 3300046538 Bacteria 1008
538 Ga0495621_0190297 3300046539 Bacteria 822
539 Ga0495659_0193768 3300046664 Bacteria 831
540 Ga0495669_0121802 3300046684 Bacteria 1223
541 Ga0495613_0272447 3300046689 Bacteria 1177
542 Ga0495649_0372708 3300046694 Bacteria 719
543 Ga0496102_1361815 3300048905 Bacteria 629
544 Ga0496103_0830201 3300048906 Unclassified 582
545 Ga0496104_0000738 3300048907 Bacteria 28056
546 Ga0496104_1246942 3300048907 Unclassified 647
547 Ga0496105_0004063 3300048908 Bacteria 10952
548 Ga0496106_0213764 3300048909 Bacteria 1537
549 Ga0496106_0565337 3300048909 Unclassified 912
550 Ga0496107_0066038 3300048910 Bacteria 2623
551 Ga0496108_0003353 3300048911 Bacteria 12866
552 Ga0496109_0001592 3300048912 Bacteria 18934
553 Ga0496109_1787255 3300048912 Unclassified 548
554 Ga0496110_0010556 3300048913 Bacteria 7521
555 Ga0496110_1842731 3300048913 Unclassified 515
556 Ga0496112_0001560 3300048915 Bacteria 17707
557 Ga0496112_1009143 3300048915 Unclassified 752
558 Ga0496112_1600480 3300048915 Bacteria 565
559 Ga0496112_1747813 3300048915 Bacteria 534
560 Ga0496113_0231307 3300048916 Bacteria 1474
561 Ga0501292_010250 3300049515 Bacteria 1401
562 Ga0501298_093207 3300049521 Bacteria 678
563 Ga0501299_006376 3300049522 Bacteria 1850
564 Ga0501031_0005502 3300049568 Bacteria 8245
565 Ga0501031_0006231 3300049568 Bacteria 7779
566 Ga0501031_0006379 3300049568 Bacteria 7694
567 Ga0501031_0095939 3300049568 Bacteria 1935
568 Ga0501031_0276404 3300049568 Bacteria 1090
569 Ga0501031_0389755 3300049568 Unclassified 901
570 Ga0501031_0742192 3300049568 Unclassified 630
571 Ga0501032_0000389 3300049569 Bacteria 36191
572 Ga0501032_0004303 3300049569 Bacteria 10750
573 Ga0501032_0028124 3300049569 Bacteria 3863
574 Ga0501032_0086125 3300049569 Bacteria 2088
575 Ga0501032_0306333 3300049569 Bacteria 1026
576 Ga0501032_0625595 3300049569 Bacteria 684
577 Ga0501033_0001379 3300049570 Bacteria 21647
578 Ga0501033_0068677 3300049570 Unclassified 2605
579 Ga0501033_0112387 3300049570 Unclassified 1981
580 Ga0501034_0018144 3300049571 Bacteria 7218
581 Ga0501034_0021049 3300049571 Bacteria 6655
582 Ga0501034_0030824 3300049571 Bacteria 5450
583 Ga0501034_0034104 3300049571 Bacteria 5160
584 Ga0501034_0043322 3300049571 Bacteria 4555
585 Ga0501034_0615309 3300049571 Bacteria 990
586 Ga0501036_0002951 3300049572 Bacteria 13515
587 Ga0501036_0004553 3300049572 Bacteria 11194
588 Ga0501036_0011068 3300049572 Bacteria 7459
589 Ga0501036_0180725 3300049572 Bacteria 1776
590 Ga0501036_0384091 3300049572 Bacteria 1172
591 Ga0501036_1517457 3300049572 Unclassified 542
592 Ga0501037_0009219 3300049573 Bacteria 7234
593 Ga0501037_0046641 3300049573 Bacteria 3178
594 Ga0501037_0121851 3300049573 Bacteria 1875
595 Ga0501037_0188924 3300049573 Bacteria 1459
596 Ga0501037_0231900 3300049573 Unclassified 1296
597 Ga0501037_0576367 3300049573 Bacteria 757
598 Ga0501038_0002772 3300049574 Bacteria 16308
599 Ga0501038_0002872 3300049574 Bacteria 16056
600 Ga0501038_0003162 3300049574 Bacteria 15364
601 Ga0501038_0028562 3300049574 Bacteria 4954
602 Ga0501038_0049667 3300049574 Bacteria 3627
603 Ga0501038_0201422 3300049574 Bacteria 1597
604 Ga0501039_0002456 3300049575 Bacteria 13800
605 Ga0501039_0032797 3300049575 Bacteria 4006
606 Ga0501039_0130710 3300049575 Bacteria 1970
607 Ga0501039_0232116 3300049575 Unclassified 1450
608 Ga0501039_0446318 3300049575 Bacteria 1016
609 Ga0501039_0917434 3300049575 Bacteria 682
610 Ga0501040_0102671 3300049576 Bacteria 1996
611 Ga0501040_0112720 3300049576 Bacteria 1903
612 Ga0501040_0327325 3300049576 Bacteria 1096
613 Ga0501040_0382616 3300049576 Unclassified 1010
614 Ga0501040_0563567 3300049576 Unclassified 822
615 Ga0501041_0129200 3300049577 Bacteria 1574
616 Ga0501041_0989771 3300049577 Bacteria 541
617 Ga0501042_0005209 3300049578 Bacteria 8356
618 Ga0501042_0012320 3300049578 Bacteria 5789
619 Ga0501042_0040498 3300049578 Bacteria 3313
620 Ga0501042_0200680 3300049578 Unclassified 1438
621 Ga0501042_0376698 3300049578 Unclassified 1027
622 Ga0501043_0000523 3300049579 Bacteria 34476
623 Ga0501043_0009982 3300049579 Bacteria 7448
624 Ga0501043_0015433 3300049579 Bacteria 5982
625 Ga0501043_0031681 3300049579 Bacteria 4156
626 Ga0501043_0033447 3300049579 Bacteria 4045
627 Ga0501043_0036592 3300049579 Bacteria 3862
628 Ga0501043_0801174 3300049579 Bacteria 681
629 Ga0501043_0932145 3300049579 Bacteria 621
630 Ga0501043_1115757 3300049579 Bacteria 557
631 Ga0501046_0001365 3300049580 Bacteria 23520
632 Ga0501046_0005206 3300049580 Bacteria 11637
633 Ga0501046_0006858 3300049580 Bacteria 10049
634 Ga0501046_0008841 3300049580 Bacteria 8748
635 Ga0501046_0024496 3300049580 Bacteria 4949
636 Ga0501046_0050799 3300049580 Bacteria 3274
637 Ga0501046_0428441 3300049580 Bacteria 953
638 Ga0501046_0603057 3300049580 Unclassified 779
639 Ga0501046_0859023 3300049580 Bacteria 634
640 Ga0501047_0001059 3300049581 Bacteria 27451
641 Ga0501047_0034798 3300049581 Bacteria 4863
642 Ga0501047_0044932 3300049581 Bacteria 4269
643 Ga0501047_0047430 3300049581 Bacteria 4150
644 Ga0501047_0065872 3300049581 Bacteria 3491
645 Ga0501047_0176527 3300049581 Bacteria 2003
646 Ga0501047_0465561 3300049581 Bacteria 1092
647 Ga0501048_0001458 3300049582 Bacteria 17927
648 Ga0501048_0017437 3300049582 Bacteria 5288
649 Ga0501048_0040044 3300049582 Bacteria 3359
650 Ga0501048_0049449 3300049582 Bacteria 2996
651 Ga0501048_0517107 3300049582 Bacteria 856
652 Ga0501048_0669424 3300049582 Bacteria 745
653 Ga0501067_0002961 3300049583 Bacteria 9372
654 Ga0501067_0003234 3300049583 Bacteria 8969
655 Ga0501067_0024530 3300049583 Bacteria 3345
656 Ga0501067_0049601 3300049583 Bacteria 2326
657 Ga0501067_0134564 3300049583 Unclassified 1376
658 Ga0501067_0649021 3300049583 Unclassified 592
659 Ga0501068_0012341 3300049584 Bacteria 4840
660 Ga0501068_0026918 3300049584 Bacteria 3392
661 Ga0501068_0102632 3300049584 Bacteria 1774
662 Ga0501068_0153908 3300049584 Bacteria 1446
663 Ga0501068_0158200 3300049584 Bacteria 1427
664 Ga0501068_0796874 3300049584 Bacteria 620
665 Ga0501068_1161999 3300049584 Bacteria 511
666 Ga0501069_0042638 3300049585 Bacteria 2511
667 Ga0501069_0048835 3300049585 Bacteria 2351
668 Ga0501069_0101981 3300049585 Unclassified 1629
669 Ga0501069_0241617 3300049585 Bacteria 1052
670 Ga0501070_0006698 3300049586 Bacteria 9812
671 Ga0501070_0104206 3300049586 Bacteria 2346
672 Ga0501070_0160806 3300049586 Bacteria 1851
673 Ga0501070_1058945 3300049586 Bacteria 627
674 Ga0501071_0004830 3300049587 Bacteria 8590
675 Ga0501071_0021575 3300049587 Bacteria 4486
676 Ga0501071_0092567 3300049587 Bacteria 2222
677 Ga0501071_0464404 3300049587 Bacteria 969
678 Ga0501071_0887610 3300049587 Bacteria 688
679 Ga0501072_0034341 3300049588 Bacteria 3975
680 Ga0501072_0081561 3300049588 Bacteria 2564
681 Ga0501072_0127178 3300049588 Bacteria 2030
682 Ga0501072_0165007 3300049588 Unclassified 1767
683 Ga0501072_0182396 3300049588 Unclassified 1674
684 Ga0501072_0410470 3300049588 Bacteria 1074
685 Ga0501072_0440837 3300049588 Unclassified 1032
686 Ga0501072_0730194 3300049588 Bacteria 778
687 Ga0501073_0000673 3300049589 Bacteria 24026
688 Ga0501073_0005767 3300049589 Bacteria 9255
689 Ga0501073_0021161 3300049589 Bacteria 4690
690 Ga0501073_0051587 3300049589 Bacteria 2881
691 Ga0501073_0078215 3300049589 Bacteria 2301
692 Ga0501073_0325186 3300049589 Bacteria 1061
693 Ga0501073_0366610 3300049589 Bacteria 995
694 Ga0501073_0386833 3300049589 Bacteria 966
695 Ga0501074_0014220 3300049590 Bacteria 5788
696 Ga0501074_0023908 3300049590 Bacteria 4440
697 Ga0501074_0095952 3300049590 Unclassified 2123
698 Ga0501074_0703615 3300049590 Bacteria 713
699 Ga0501074_0964649 3300049590 Unclassified 600
700 Ga0501075_0069864 3300049591 Unclassified 2654
701 Ga0501075_0782386 3300049591 Bacteria 726
702 Ga0501075_1195009 3300049591 Bacteria 577
703 Ga0501075_1504680 3300049591 Unclassified 509
704 Ga0501076_0197946 3300049592 Bacteria 1640
705 Ga0501076_0206125 3300049592 Bacteria 1606
706 Ga0501076_1113582 3300049592 Bacteria 650
707 Ga0501077_0048365 3300049593 Bacteria 2702
708 Ga0501077_0208500 3300049593 Bacteria 1242
709 Ga0501077_0498473 3300049593 Bacteria 781
710 Ga0501208_004275 3300049655 Bacteria 1672
711 Ga0501243_132792 3300049675 Bacteria 521
712 Ga0501261_039678 3300049690 Unclassified 738
713 Ga0501079_0017757 3300049741 Bacteria 5435
714 Ga0501079_0042490 3300049741 Bacteria 3509
715 Ga0501079_0050619 3300049741 Bacteria 3206
716 Ga0501079_0245842 3300049741 Bacteria 1398
717 Ga0501079_0434128 3300049741 Bacteria 1031
718 Ga0501079_0464813 3300049741 Bacteria 994
719 Ga0501080_0000066 3300049742 Bacteria 68980
720 Ga0501080_0009715 3300049742 Bacteria 8786
721 Ga0501080_0030799 3300049742 Bacteria 4998
722 Ga0501080_0063311 3300049742 Bacteria 3442
723 Ga0501080_0120686 3300049742 Bacteria 2429
724 Ga0501080_0121996 3300049742 Bacteria 2414
725 Ga0501080_0374864 3300049742 Unclassified 1283
726 Ga0501080_1177633 3300049742 Bacteria 660
727 Ga0501080_1679303 3300049742 Unclassified 536
728 Ga0501081_0206638 3300049743 Bacteria 1425
729 Ga0501081_0222969 3300049743 Bacteria 1371
730 Ga0501081_0288294 3300049743 Bacteria 1203
731 Ga0501081_0649386 3300049743 Bacteria 791
732 Ga0501081_1496574 3300049743 Bacteria 513
733 Ga0501083_0001749 3300049744 Bacteria 14815
734 Ga0501083_0002515 3300049744 Bacteria 12592
735 Ga0501083_0006852 3300049744 Bacteria 8087
736 Ga0501083_0012510 3300049744 Bacteria 5936
737 Ga0501083_0054470 3300049744 Bacteria 2684
738 Ga0501083_0069480 3300049744 Bacteria 2343
739 Ga0501083_0149468 3300049744 Bacteria 1529
740 Ga0501083_0329579 3300049744 Unclassified 993
741 Ga0501083_0506335 3300049744 Unclassified 786
742 Ga0501035_0031936 3300049822 Bacteria 4795
743 Ga0501035_0061410 3300049822 Bacteria 3344
744 Ga0501035_0159332 3300049822 Unclassified 1954
745 Ga0501035_0342851 3300049822 Bacteria 1251
746 Ga0501035_0563873 3300049822 Unclassified 931
747 Ga0501044_0001594 3300049823 Bacteria 26547
748 Ga0501044_0238192 3300049823 Unclassified 1764
749 Ga0501044_0271441 3300049823 Bacteria 1631
750 Ga0501044_0356773 3300049823 Unclassified 1380
751 Ga0501044_0759088 3300049823 Bacteria 851
752 Ga0501044_0903989 3300049823 Bacteria 757
753 Ga0501044_1072421 3300049823 Bacteria 675
754 Ga0501045_0022232 3300049824 Bacteria 4539
755 Ga0501045_0063925 3300049824 Bacteria 2701
756 Ga0501045_0142947 3300049824 Bacteria 1779
757 Ga0501045_0239586 3300049824 Bacteria 1350
758 Ga0501045_0347006 3300049824 Bacteria 1105
759 nmdc:mga00v17_116254_c2 3300050491 Bacteria 778
760 nmdc:mga00v17_96322_c1 3300050491 Bacteria 1864
761 nmdc:mga0k408_210547_c1 3300050493 Bacteria 1161
762 nmdc:mga0k408_408053_c1 3300050493 Bacteria 808
763 nmdc:mga06z11_19576_c1 3300050494 Bacteria 3115
764 nmdc:mga06z11_354356_c1 3300050494 Bacteria 879
765 nmdc:mga06z11_438119_c1 3300050494 Bacteria 789
766 nmdc:mga06z11_603701_c1 3300050494 Bacteria 667
767 nmdc:mga04h51_317688_c1 3300050495 Unclassified 638
768 nmdc:mga07m45_132337_c1 3300050496 Bacteria 1443
769 nmdc:mga05p37_2011171_c1 3300050507 Unclassified 546
770 nmdc:mga05p37_279912_c1 3300050507 Bacteria 1990
771 nmdc:mga05p37_357078_c1 3300050507 Bacteria 1719
772 nmdc:mga05p37_644084_c1 3300050507 Bacteria 1188
773 nmdc:mga09592_10912_c1 3300050508 Bacteria 7394
774 nmdc:mga09592_198494_c1 3300050508 Unclassified 1737
775 nmdc:mga09592_224489_c1 3300050508 Unclassified 1627
776 nmdc:mga09592_409290_c1 3300050508 Bacteria 1172
777 nmdc:mga09592_55293_c1 3300050508 Bacteria 3354
778 nmdc:mga09592_935973_c1 3300050508 Unclassified 727
779 nmdc:mga09592_970003_c1 3300050508 Unclassified 712
780 nmdc:mga0qj67_125077_c1 3300050509 Bacteria 2081
781 nmdc:mga0qj67_214581_c1 3300050509 Bacteria 1563
782 nmdc:mga0qj67_320605_c1 3300050509 Bacteria 1254
783 nmdc:mga0qj67_325568_c1 3300050509 Bacteria 1244
784 nmdc:mga0qj67_46370_c1 3300050509 Bacteria 3431
785 nmdc:mga0qj67_556308_c1 3300050509 Bacteria 920
786 nmdc:mga06r32_1099877_c1 3300050510 Bacteria 744
787 nmdc:mga06r32_1426417_c1 3300050510 Unclassified 634
788 nmdc:mga06r32_1562411_c1 3300050510 Bacteria 599
789 nmdc:mga06r32_17022_c1 3300050510 Bacteria 6634
790 nmdc:mga06r32_385144_c1 3300050510 Bacteria 1385
791 nmdc:mga06r32_460658_c1 3300050510 Bacteria 1250
792 nmdc:mga06r32_48917_c1 3300050510 Bacteria 4043
793 nmdc:mga06r32_6101_c1 3300050510 Bacteria 10825
794 nmdc:mga06r32_68801_c1 3300050510 Unclassified 3421
795 nmdc:mga06r32_83665_c1 3300050510 Unclassified 3110
796 nmdc:mga08y16_1105092_c1 3300050511 Bacteria 768
797 nmdc:mga08y16_1141618_c1 3300050511 Bacteria 752
798 nmdc:mga08y16_1593027_c1 3300050511 Unclassified 611
799 nmdc:mga08y16_1769022_c1 3300050511 Bacteria 572
800 nmdc:mga08y16_19145_c1 3300050511 Bacteria 7214
801 nmdc:mga08y16_326046_c1 3300050511 Bacteria 1580
802 nmdc:mga08y16_64524_c1 3300050511 Bacteria 3824
803 nmdc:mga0n895_114062_c1 3300050512 Unclassified 2720
804 nmdc:mga0n895_1146829_c1 3300050512 Bacteria 753
805 nmdc:mga0n895_123943_c1 3300050512 Bacteria 2606
806 nmdc:mga0n895_126543_c1 3300050512 Bacteria 2579
807 nmdc:mga0n895_1690_c1 3300050512 Bacteria 16667
808 nmdc:mga0n895_1800123_c1 3300050512 Unclassified 573
809 nmdc:mga0n895_222777_c1 3300050512 Unclassified 1915
810 nmdc:mga0n895_255012_c1 3300050512 Unclassified 1780
811 nmdc:mga0n895_267688_c1 3300050512 Bacteria 1734
812 nmdc:mga0n895_601_c1 3300050512 Bacteria 24893
813 nmdc:mga0n895_899063_c1 3300050512 Unclassified 871
814 nmdc:mga0rr50_101517_c1 3300050513 Bacteria 2262
815 nmdc:mga0rr50_1285601_c1 3300050513 Unclassified 621
816 nmdc:mga0rr50_29683_c1 3300050513 Unclassified 3860
817 nmdc:mga0rr50_29688_c1 3300050513 Bacteria 3860
818 nmdc:mga08x19_17947_c1 3300050514 Bacteria 4333
819 nmdc:mga08x19_738185_c1 3300050514 Unclassified 699
820 nmdc:mga08x19_86543_c1 3300050514 Bacteria 2064
821 nmdc:mga0a205_18351_c1 3300050515 Bacteria 6575
822 nmdc:mga0a205_21859_c1 3300050515 Bacteria 6050
823 nmdc:mga0a205_349196_c1 3300050515 Unclassified 1347
824 nmdc:mga0a205_43073_c1 3300050515 Bacteria 4352
825 nmdc:mga0a205_4479_c1 3300050515 Bacteria 12539
826 nmdc:mga0a205_656954_c1 3300050515 Unclassified 900
827 nmdc:mga0a205_900161_c1 3300050515 Bacteria 732
828 nmdc:mga0a205_9670_c1 3300050515 Bacteria 8829
829 Ga0495601_0945690 3300053077 Unclassified 543
830 Ga0495619_0103029 3300053085 Unclassified 1944
831 Ga0500651_0215093 3300053093 Unclassified 1129
832 Ga0500592_003315 3300053116 Bacteria 2567
833 Ga0500658_0192469 3300053134 Unclassified 931
834 Ga0501084_0015335 3300054114 Bacteria 6354
835 Ga0501084_0071498 3300054114 Bacteria 2905
836 Ga0501084_0078915 3300054114 Bacteria 2759
837 Ga0501084_0177797 3300054114 Bacteria 1796
838 Ga0501084_0257038 3300054114 Bacteria 1474
839 Ga0590071_000384 3300059421 Bacteria 12975
840 Ga0590071_061271 3300059421 Bacteria 920
841 Ga0590074_002233 3300059423 Bacteria 3176
842 Ga0590075_000159 3300059424 Bacteria 18375
843 Ga0590075_024801 3300059424 Unclassified 1506
844 Ga0590075_040702 3300059424 Bacteria 1188
845 Ga0590077_000408 3300059426 Bacteria 12051
846 Ga0590077_105449 3300059426 Bacteria 661
847 Ga0590077_148215 3300059426 Bacteria 561
848 Ga0501082_0042454 3300060353 Bacteria 3921
849 Ga0501082_0048845 3300060353 Bacteria 3647
850 Ga0501082_0126210 3300060353 Bacteria 2219
851 Ga0501082_0263433 3300060353 Bacteria 1499
852 Ga0501082_0268925 3300060353 Bacteria 1483
853 Ga0501082_0287132 3300060353 Bacteria 1432
854 Ga0501082_0383601 3300060353 Bacteria 1226
855 Ga0501082_0802020 3300060353 Bacteria 824
856 Ga0501082_1763343 3300060353 Bacteria 540
857 Ga0530510_0126736 3300061734 Bacteria 1877
858 Ga0530510_0214549 3300061734 Unclassified 1430
859 Ga0530510_0684154 3300061734 Unclassified 781
860 Ga0530510_0765871 3300061734 Bacteria 736
861 Ga0530510_0898238 3300061734 Bacteria 677
862 Ga0530510_0899995 3300061734 Bacteria 676
863 Ga0530510_1447222 3300061734 Bacteria 527

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050511 nmdc:mga08y16_1141618_c1 nmdc:mga08y16_1141618_c1_409_735 108
2 3300005444 Ga0070694_101525941 Ga0070694_1015259412 109
3 3300005518 Ga0070699_100444953 Ga0070699_1004449532 109
4 3300005549 Ga0070704_100109520 Ga0070704_1001095202 109
5 3300006852 Ga0075433_10409100 Ga0075433_104091001 109
6 3300006871 Ga0075434_100653631 Ga0075434_1006536312 109
7 3300025910 Ga0207684_10289581 Ga0207684_102895812 109
8 3300049584 Ga0501068_1161999 Ga0501068_1161999_39_368 109
9 3300050512 nmdc:mga0n895_899063_c1 nmdc:mga0n895_899063_c1_152_481 109
10 3300050515 nmdc:mga0a205_9670_c1 nmdc:mga0a205_9670_c1_4688_5017 109
11 3300053077 Ga0495601_0945690 Ga0495601_0945690_39_368 109
12 3300053085 Ga0495619_0103029 Ga0495619_0103029_362_691 109
13 3300005434 Ga0070709_10028947 Ga0070709_100289472 110
14 3300005434 Ga0070709_10036144 Ga0070709_100361441 110
15 3300005435 Ga0070714_100013094 Ga0070714_1000130947 110
16 3300005435 Ga0070714_100023917 Ga0070714_1000239174 110
17 3300005436 Ga0070713_100000276 Ga0070713_10000027630 110
18 3300005436 Ga0070713_100006548 Ga0070713_1000065484 110
19 3300005436 Ga0070713_100024802 Ga0070713_1000248023 110
20 3300005437 Ga0070710_10267658 Ga0070710_102676582 110
21 3300005439 Ga0070711_100151258 Ga0070711_1001512582 110
22 3300005439 Ga0070711_101424058 Ga0070711_1014240582 110
23 3300005458 Ga0070681_10011895 Ga0070681_100118954 110
24 3300005530 Ga0070679_100090740 Ga0070679_1000907402 110
25 3300005545 Ga0070695_101328660 Ga0070695_1013286601 110
26 3300005547 Ga0070693_100014197 Ga0070693_1000141974 110
27 3300006028 Ga0070717_10002821 Ga0070717_100028214 110
28 3300006028 Ga0070717_10171904 Ga0070717_101719044 110
29 3300006175 Ga0070712_100009439 Ga0070712_1000094393 110
30 3300006175 Ga0070712_100615416 Ga0070712_1006154162 110
31 3300006175 Ga0070712_101744840 Ga0070712_1017448401 110
32 3300006237 Ga0097621_100401611 Ga0097621_1004016112 110
33 3300006358 Ga0068871_100875964 Ga0068871_1008759642 110
34 3300006871 Ga0075434_101666373 Ga0075434_1016663732 110
35 3300013100 Ga0157373_11268816 Ga0157373_112688161 110
36 3300013105 Ga0157369_10580049 Ga0157369_105800492 110
37 3300013307 Ga0157372_11402433 Ga0157372_114024332 110
38 3300025898 Ga0207692_10029987 Ga0207692_100299872 110
39 3300025903 Ga0207680_10109105 Ga0207680_101091052 110
40 3300025906 Ga0207699_10019009 Ga0207699_100190091 110
41 3300025906 Ga0207699_10032073 Ga0207699_100320732 110
42 3300025906 Ga0207699_10446822 Ga0207699_104468222 110
43 3300025912 Ga0207707_10041446 Ga0207707_100414462 110
44 3300025915 Ga0207693_10009463 Ga0207693_100094634 110
45 3300025915 Ga0207693_10472113 Ga0207693_104721132 110
46 3300025916 Ga0207663_10117773 Ga0207663_101177732 110
47 3300025928 Ga0207700_10004627 Ga0207700_100046274 110
48 3300025928 Ga0207700_10040378 Ga0207700_100403783 110
49 3300025928 Ga0207700_10161575 Ga0207700_101615752 110
50 3300025929 Ga0207664_10016111 Ga0207664_100161117 110
51 3300025939 Ga0207665_10852205 Ga0207665_108522051 110
52 3300025961 Ga0207712_10297894 Ga0207712_102978942 110
53 3300026078 Ga0207702_11280217 Ga0207702_112802172 110
54 3300026118 Ga0207675_102137051 Ga0207675_1021370512 110
55 3300031852 Ga0307410_10121419 Ga0307410_101214192 110
56 3300032126 Ga0307415_100337760 Ga0307415_1003377602 110
57 3300036401 Ga0373937_0479205 Ga0373937_0479205_428_760 110
58 3300045051 Ga0451576_0475306 Ga0451576_0475306_62_394 110
59 3300049568 Ga0501031_0742192 Ga0501031_0742192_43_375 110
60 3300049575 Ga0501039_0446318 Ga0501039_0446318_590_922 110
61 3300049578 Ga0501042_0200680 Ga0501042_0200680_1048_1380 110
62 3300049588 Ga0501072_0182396 Ga0501072_0182396_1045_1377 110
63 3300049591 Ga0501075_1504680 Ga0501075_1504680_140_472 110
64 3300050512 nmdc:mga0n895_1146829_c1 nmdc:mga0n895_1146829_c1_227_559 110
65 3300005290 Ga0065712_10061041 Ga0065712_100610411 111
66 3300005293 Ga0065715_10675999 Ga0065715_106759992 111
67 3300005331 Ga0070670_102243175 Ga0070670_1022431751 111
68 3300005347 Ga0070668_101268242 Ga0070668_1012682421 111
69 3300005356 Ga0070674_100666888 Ga0070674_1006668882 111
70 3300005456 Ga0070678_101000520 Ga0070678_1010005201 111
71 3300005577 Ga0068857_102250858 Ga0068857_1022508582 111
72 3300009093 Ga0105240_10896218 Ga0105240_108962181 111
73 3300009094 Ga0111539_10017483 Ga0111539_100174832 111
74 3300009094 Ga0111539_10417082 Ga0111539_104170823 111
75 3300009094 Ga0111539_12630887 Ga0111539_126308871 111
76 3300009551 Ga0105238_10353079 Ga0105238_103530792 111
77 3300014326 Ga0157380_10295676 Ga0157380_102956762 111
78 3300014326 Ga0157380_12541842 Ga0157380_125418421 111
79 3300025893 Ga0207682_10446706 Ga0207682_104467062 111
80 3300025913 Ga0207695_11565461 Ga0207695_115654611 111
81 3300025925 Ga0207650_11743144 Ga0207650_117431441 111
82 3300025933 Ga0207706_10208048 Ga0207706_102080483 111
83 3300025937 Ga0207669_10024450 Ga0207669_100244503 111
84 3300025945 Ga0207679_11941937 Ga0207679_119419371 111
85 3300026116 Ga0207674_11348640 Ga0207674_113486402 111
86 3300026118 Ga0207675_101370530 Ga0207675_1013705302 111
87 3300027907 Ga0207428_10227018 Ga0207428_102270182 111
88 3300048906 Ga0496103_0830201 Ga0496103_0830201_198_533 111
89 3300048913 Ga0496110_1842731 Ga0496110_1842731_167_502 111
90 3300050511 nmdc:mga08y16_1769022_c1 nmdc:mga08y16_1769022_c1_75_410 111
91 3300002459 JGI24751J29686_10137353 JGI24751J29686_101373531 112
92 3300005290 Ga0065712_10117350 Ga0065712_101173502 112
93 3300005290 Ga0065712_10138845 Ga0065712_101388452 112
94 3300005293 Ga0065715_10001128 Ga0065715_100011283 112
95 3300005293 Ga0065715_10123887 Ga0065715_101238872 112
96 3300005293 Ga0065715_10302846 Ga0065715_103028461 112
97 3300005293 Ga0065715_10524539 Ga0065715_105245391 112
98 3300005293 Ga0065715_10651255 Ga0065715_106512552 112
99 3300005295 Ga0065707_10800383 Ga0065707_108003831 112
100 3300005328 Ga0070676_10085582 Ga0070676_100855822 112
101 3300005328 Ga0070676_10968838 Ga0070676_109688381 112
102 3300005329 Ga0070683_100000832 Ga0070683_10000083210 112
103 3300005329 Ga0070683_100804181 Ga0070683_1008041812 112
104 3300005330 Ga0070690_100153369 Ga0070690_1001533693 112
105 3300005330 Ga0070690_100168592 Ga0070690_1001685923 112
106 3300005331 Ga0070670_100014534 Ga0070670_1000145342 112
107 3300005331 Ga0070670_100025765 Ga0070670_1000257652 112
108 3300005333 Ga0070677_10784076 Ga0070677_107840761 112
109 3300005334 Ga0068869_100136452 Ga0068869_1001364522 112
110 3300005334 Ga0068869_100156175 Ga0068869_1001561752 112
111 3300005335 Ga0070666_10038638 Ga0070666_100386384 112
112 3300005335 Ga0070666_10353254 Ga0070666_103532542 112
113 3300005335 Ga0070666_10821892 Ga0070666_108218922 112
114 3300005336 Ga0070680_101660081 Ga0070680_1016600811 112
115 3300005338 Ga0068868_100220579 Ga0068868_1002205792 112
116 3300005339 Ga0070660_100923913 Ga0070660_1009239132 112
117 3300005340 Ga0070689_100013867 Ga0070689_1000138672 112
118 3300005340 Ga0070689_100255788 Ga0070689_1002557883 112
119 3300005340 Ga0070689_100363593 Ga0070689_1003635932 112
120 3300005340 Ga0070689_100832107 Ga0070689_1008321071 112
121 3300005343 Ga0070687_100316301 Ga0070687_1003163011 112
122 3300005344 Ga0070661_101785628 Ga0070661_1017856281 112
123 3300005345 Ga0070692_10068662 Ga0070692_100686623 112
124 3300005347 Ga0070668_100707830 Ga0070668_1007078302 112
125 3300005353 Ga0070669_100015181 Ga0070669_1000151816 112
126 3300005353 Ga0070669_100074209 Ga0070669_1000742092 112
127 3300005353 Ga0070669_100470418 Ga0070669_1004704181 112
128 3300005353 Ga0070669_101053549 Ga0070669_1010535492 112
129 3300005354 Ga0070675_100393893 Ga0070675_1003938932 112
130 3300005354 Ga0070675_100877263 Ga0070675_1008772631 112
131 3300005354 Ga0070675_101384746 Ga0070675_1013847461 112
132 3300005355 Ga0070671_100048909 Ga0070671_1000489094 112
133 3300005355 Ga0070671_100255261 Ga0070671_1002552613 112
134 3300005356 Ga0070674_100461051 Ga0070674_1004610512 112
135 3300005356 Ga0070674_101500819 Ga0070674_1015008192 112
136 3300005364 Ga0070673_100001105 Ga0070673_1000011059 112
137 3300005364 Ga0070673_100018616 Ga0070673_1000186164 112
138 3300005364 Ga0070673_100150629 Ga0070673_1001506292 112
139 3300005365 Ga0070688_100177557 Ga0070688_1001775572 112
140 3300005365 Ga0070688_100453550 Ga0070688_1004535501 112
141 3300005366 Ga0070659_100512630 Ga0070659_1005126302 112
142 3300005366 Ga0070659_100640396 Ga0070659_1006403962 112
143 3300005367 Ga0070667_100068417 Ga0070667_1000684173 112
144 3300005367 Ga0070667_100301508 Ga0070667_1003015081 112
145 3300005367 Ga0070667_100399345 Ga0070667_1003993453 112
146 3300005367 Ga0070667_101131373 Ga0070667_1011313731 112
147 3300005367 Ga0070667_101509873 Ga0070667_1015098732 112
148 3300005436 Ga0070713_100017861 Ga0070713_1000178613 112
149 3300005436 Ga0070713_100036881 Ga0070713_1000368812 112
150 3300005438 Ga0070701_10186771 Ga0070701_101867713 112
151 3300005438 Ga0070701_10666419 Ga0070701_106664192 112
152 3300005440 Ga0070705_101390613 Ga0070705_1013906131 112
153 3300005440 Ga0070705_101882899 Ga0070705_1018828991 112
154 3300005441 Ga0070700_100291943 Ga0070700_1002919433 112
155 3300005441 Ga0070700_101005758 Ga0070700_1010057582 112
156 3300005441 Ga0070700_101046325 Ga0070700_1010463251 112
157 3300005444 Ga0070694_100024733 Ga0070694_1000247332 112
158 3300005444 Ga0070694_100105838 Ga0070694_1001058383 112
159 3300005444 Ga0070694_100330513 Ga0070694_1003305133 112
160 3300005444 Ga0070694_100764114 Ga0070694_1007641142 112
161 3300005444 Ga0070694_101668819 Ga0070694_1016688191 112
162 3300005455 Ga0070663_100140159 Ga0070663_1001401592 112
163 3300005455 Ga0070663_100778677 Ga0070663_1007786772 112
164 3300005456 Ga0070678_100223233 Ga0070678_1002232334 112
165 3300005456 Ga0070678_100554796 Ga0070678_1005547962 112
166 3300005456 Ga0070678_100658578 Ga0070678_1006585783 112
167 3300005457 Ga0070662_100056066 Ga0070662_1000560661 112
168 3300005458 Ga0070681_11048105 Ga0070681_110481051 112
169 3300005459 Ga0068867_100458250 Ga0068867_1004582502 112
170 3300005466 Ga0070685_10355289 Ga0070685_103552891 112
171 3300005466 Ga0070685_10446532 Ga0070685_104465322 112
172 3300005466 Ga0070685_11511349 Ga0070685_115113491 112
173 3300005467 Ga0070706_100620631 Ga0070706_1006206312 112
174 3300005467 Ga0070706_100668713 Ga0070706_1006687131 112
175 3300005468 Ga0070707_100013913 Ga0070707_1000139132 112
176 3300005468 Ga0070707_100164488 Ga0070707_1001644881 112
177 3300005468 Ga0070707_100529847 Ga0070707_1005298472 112
178 3300005471 Ga0070698_100530657 Ga0070698_1005306571 112
179 3300005518 Ga0070699_100425906 Ga0070699_1004259061 112
180 3300005518 Ga0070699_101253786 Ga0070699_1012537861 112
181 3300005530 Ga0070679_100628379 Ga0070679_1006283792 112
182 3300005535 Ga0070684_100000427 Ga0070684_10000042710 112
183 3300005536 Ga0070697_100043629 Ga0070697_1000436291 112
184 3300005536 Ga0070697_100321164 Ga0070697_1003211642 112
185 3300005536 Ga0070697_100388571 Ga0070697_1003885712 112
186 3300005543 Ga0070672_100013022 Ga0070672_1000130223 112
187 3300005543 Ga0070672_100064072 Ga0070672_1000640724 112
188 3300005543 Ga0070672_100305284 Ga0070672_1003052842 112
189 3300005544 Ga0070686_100908773 Ga0070686_1009087732 112
190 3300005544 Ga0070686_101130098 Ga0070686_1011300982 112
191 3300005545 Ga0070695_100074645 Ga0070695_1000746452 112
192 3300005545 Ga0070695_100284809 Ga0070695_1002848091 112
193 3300005546 Ga0070696_100051203 Ga0070696_1000512032 112
194 3300005547 Ga0070693_100139831 Ga0070693_1001398312 112
195 3300005548 Ga0070665_101003037 Ga0070665_1010030372 112
196 3300005549 Ga0070704_100036621 Ga0070704_1000366212 112
197 3300005549 Ga0070704_100296616 Ga0070704_1002966162 112
198 3300005549 Ga0070704_100309211 Ga0070704_1003092112 112
199 3300005564 Ga0070664_100000731 Ga0070664_1000007318 112
200 3300005564 Ga0070664_100043243 Ga0070664_1000432432 112
201 3300005577 Ga0068857_100974362 Ga0068857_1009743622 112
202 3300005578 Ga0068854_100222012 Ga0068854_1002220123 112
203 3300005614 Ga0068856_102677994 Ga0068856_1026779941 112
204 3300005615 Ga0070702_100084248 Ga0070702_1000842483 112
205 3300005615 Ga0070702_101744119 Ga0070702_1017441191 112
206 3300005616 Ga0068852_100163983 Ga0068852_1001639832 112
207 3300005616 Ga0068852_100694084 Ga0068852_1006940841 112
208 3300005617 Ga0068859_100001429 Ga0068859_1000014298 112
209 3300005617 Ga0068859_100016773 Ga0068859_1000167732 112
210 3300005617 Ga0068859_101233776 Ga0068859_1012337762 112
211 3300005617 Ga0068859_101484463 Ga0068859_1014844631 112
212 3300005617 Ga0068859_102513639 Ga0068859_1025136392 112
213 3300005618 Ga0068864_100077964 Ga0068864_1000779644 112
214 3300005618 Ga0068864_102235240 Ga0068864_1022352401 112
215 3300005719 Ga0068861_100634070 Ga0068861_1006340702 112
216 3300005719 Ga0068861_100912536 Ga0068861_1009125362 112
217 3300005719 Ga0068861_101047229 Ga0068861_1010472293 112
218 3300005834 Ga0068851_10450310 Ga0068851_104503102 112
219 3300005840 Ga0068870_10000669 Ga0068870_100006692 112
220 3300005840 Ga0068870_10374185 Ga0068870_103741852 112
221 3300005841 Ga0068863_100042493 Ga0068863_1000424932 112
222 3300005842 Ga0068858_100048964 Ga0068858_1000489644 112
223 3300005842 Ga0068858_100264248 Ga0068858_1002642482 112
224 3300005842 Ga0068858_100325416 Ga0068858_1003254162 112
225 3300005842 Ga0068858_102421161 Ga0068858_1024211611 112
226 3300005843 Ga0068860_100141594 Ga0068860_1001415944 112
227 3300005843 Ga0068860_100830947 Ga0068860_1008309472 112
228 3300005843 Ga0068860_100958117 Ga0068860_1009581172 112
229 3300005844 Ga0068862_100099912 Ga0068862_1000999123 112
230 3300005844 Ga0068862_100301953 Ga0068862_1003019532 112
231 3300005844 Ga0068862_100678580 Ga0068862_1006785802 112
232 3300005844 Ga0068862_100686850 Ga0068862_1006868502 112
233 3300005844 Ga0068862_100996291 Ga0068862_1009962912 112
234 3300005844 Ga0068862_102241212 Ga0068862_1022412122 112
235 3300005981 Ga0081538_10104056 Ga0081538_101040562 112
236 3300006028 Ga0070717_11984857 Ga0070717_119848571 112
237 3300006042 Ga0075368_10418065 Ga0075368_104180652 112
238 3300006051 Ga0075364_10006284 Ga0075364_100062841 112
239 3300006051 Ga0075364_10011345 Ga0075364_100113452 112
240 3300006058 Ga0075432_10183894 Ga0075432_101838941 112
241 3300006173 Ga0070716_100265779 Ga0070716_1002657791 112
242 3300006178 Ga0075367_10011729 Ga0075367_100117292 112
243 3300006178 Ga0075367_10030938 Ga0075367_100309382 112
244 3300006178 Ga0075367_10480756 Ga0075367_104807562 112
245 3300006195 Ga0075366_10172475 Ga0075366_101724752 112
246 3300006237 Ga0097621_100485205 Ga0097621_1004852052 112
247 3300006353 Ga0075370_10144472 Ga0075370_101444721 112
248 3300006358 Ga0068871_100492020 Ga0068871_1004920202 112
249 3300006358 Ga0068871_100596804 Ga0068871_1005968042 112
250 3300006844 Ga0075428_100007041 Ga0075428_1000070418 112
251 3300006844 Ga0075428_100178199 Ga0075428_1001781992 112
252 3300006844 Ga0075428_100352484 Ga0075428_1003524842 112
253 3300006844 Ga0075428_100547472 Ga0075428_1005474722 112
254 3300006844 Ga0075428_100988703 Ga0075428_1009887032 112
255 3300006844 Ga0075428_102083363 Ga0075428_1020833632 112
256 3300006844 Ga0075428_102635010 Ga0075428_1026350101 112
257 3300006846 Ga0075430_100029162 Ga0075430_1000291624 112
258 3300006846 Ga0075430_100031688 Ga0075430_1000316884 112
259 3300006846 Ga0075430_100165204 Ga0075430_1001652042 112
260 3300006846 Ga0075430_100173353 Ga0075430_1001733533 112
261 3300006847 Ga0075431_100031245 Ga0075431_1000312452 112
262 3300006847 Ga0075431_100033158 Ga0075431_1000331582 112
263 3300006847 Ga0075431_100036754 Ga0075431_1000367544 112
264 3300006847 Ga0075431_100038962 Ga0075431_1000389622 112
265 3300006847 Ga0075431_100105320 Ga0075431_1001053203 112
266 3300006847 Ga0075431_100244967 Ga0075431_1002449672 112
267 3300006847 Ga0075431_100535496 Ga0075431_1005354962 112
268 3300006847 Ga0075431_100596799 Ga0075431_1005967991 112
269 3300006852 Ga0075433_10000279 Ga0075433_100002797 112
270 3300006852 Ga0075433_10040561 Ga0075433_100405612 112
271 3300006852 Ga0075433_10052431 Ga0075433_100524312 112
272 3300006852 Ga0075433_10059212 Ga0075433_100592122 112
273 3300006852 Ga0075433_10063057 Ga0075433_100630572 112
274 3300006852 Ga0075433_10646202 Ga0075433_106462022 112
275 3300006852 Ga0075433_10724630 Ga0075433_107246302 112
276 3300006852 Ga0075433_10810332 Ga0075433_108103322 112
277 3300006871 Ga0075434_100026219 Ga0075434_1000262193 112
278 3300006871 Ga0075434_100029167 Ga0075434_1000291674 112
279 3300006871 Ga0075434_100100713 Ga0075434_1001007132 112
280 3300006871 Ga0075434_100106612 Ga0075434_1001066121 112
281 3300006871 Ga0075434_100114576 Ga0075434_1001145762 112
282 3300006871 Ga0075434_100137340 Ga0075434_1001373402 112
283 3300006871 Ga0075434_100273015 Ga0075434_1002730152 112
284 3300006871 Ga0075434_100321405 Ga0075434_1003214053 112
285 3300006871 Ga0075434_102439559 Ga0075434_1024395591 112
286 3300006880 Ga0075429_100017403 Ga0075429_1000174032 112
287 3300006880 Ga0075429_100058872 Ga0075429_1000588722 112
288 3300006880 Ga0075429_100183005 Ga0075429_1001830052 112
289 3300006880 Ga0075429_100210068 Ga0075429_1002100682 112
290 3300006880 Ga0075429_100563635 Ga0075429_1005636352 112
291 3300006880 Ga0075429_101108276 Ga0075429_1011082761 112
292 3300006880 Ga0075429_101195675 Ga0075429_1011956751 112
293 3300006880 Ga0075429_101885216 Ga0075429_1018852162 112
294 3300006881 Ga0068865_100275308 Ga0068865_1002753082 112
295 3300006881 Ga0068865_100381594 Ga0068865_1003815941 112
296 3300006881 Ga0068865_101023268 Ga0068865_1010232681 112
297 3300006914 Ga0075436_100007526 Ga0075436_1000075262 112
298 3300006914 Ga0075436_100031348 Ga0075436_1000313482 112
299 3300006931 Ga0097620_100001429 Ga0097620_1000014298 112
300 3300006931 Ga0097620_100016773 Ga0097620_1000167736 112
301 3300006931 Ga0097620_101233685 Ga0097620_1012336852 112
302 3300006931 Ga0097620_101484366 Ga0097620_1014843661 112
303 3300006931 Ga0097620_102514517 Ga0097620_1025145171 112
304 3300007076 Ga0075435_100036693 Ga0075435_1000366934 112
305 3300007076 Ga0075435_100091898 Ga0075435_1000918981 112
306 3300007076 Ga0075435_100183876 Ga0075435_1001838762 112
307 3300007076 Ga0075435_100451952 Ga0075435_1004519521 112
308 3300007076 Ga0075435_101625679 Ga0075435_1016256791 112
309 3300009094 Ga0111539_10040893 Ga0111539_100408932 112
310 3300009094 Ga0111539_10671305 Ga0111539_106713052 112
311 3300009094 Ga0111539_10711407 Ga0111539_107114072 112
312 3300009094 Ga0111539_10945632 Ga0111539_109456322 112
313 3300009094 Ga0111539_10954090 Ga0111539_109540902 112
314 3300009094 Ga0111539_11262530 Ga0111539_112625302 112
315 3300009094 Ga0111539_11919620 Ga0111539_119196201 112
316 3300009094 Ga0111539_12548858 Ga0111539_125488582 112
317 3300009098 Ga0105245_10158176 Ga0105245_101581762 112
318 3300009101 Ga0105247_10033797 Ga0105247_100337972 112
319 3300009147 Ga0114129_10039797 Ga0114129_100397972 112
320 3300009147 Ga0114129_10471701 Ga0114129_104717012 112
321 3300009147 Ga0114129_10490864 Ga0114129_104908642 112
322 3300009147 Ga0114129_10531662 Ga0114129_105316624 112
323 3300009147 Ga0114129_11039190 Ga0114129_110391901 112
324 3300009147 Ga0114129_12417804 Ga0114129_124178042 112
325 3300009148 Ga0105243_10560969 Ga0105243_105609692 112
326 3300009174 Ga0105241_10646842 Ga0105241_106468422 112
327 3300009174 Ga0105241_10860684 Ga0105241_108606842 112
328 3300009177 Ga0105248_10061019 Ga0105248_100610195 112
329 3300009177 Ga0105248_10103747 Ga0105248_101037472 112
330 3300009545 Ga0105237_11192059 Ga0105237_111920592 112
331 3300009551 Ga0105238_11034304 Ga0105238_110343041 112
332 3300009553 Ga0105249_10026632 Ga0105249_100266326 112
333 3300009553 Ga0105249_10191348 Ga0105249_101913482 112
334 3300009553 Ga0105249_10443888 Ga0105249_104438882 112
335 3300009553 Ga0105249_10777768 Ga0105249_107777681 112
336 3300009553 Ga0105249_11148179 Ga0105249_111481792 112
337 3300009553 Ga0105249_12410352 Ga0105249_124103521 112
338 3300010375 Ga0105239_13577520 Ga0105239_135775201 112
339 3300012485 Ga0157325_1020697 Ga0157325_10206971 112
340 3300013100 Ga0157373_10968953 Ga0157373_109689532 112
341 3300013102 Ga0157371_11581429 Ga0157371_115814291 112
342 3300013296 Ga0157374_11162589 Ga0157374_111625891 112
343 3300013297 Ga0157378_10692872 Ga0157378_106928722 112
344 3300013306 Ga0163162_10052692 Ga0163162_100526921 112
345 3300013306 Ga0163162_10650907 Ga0163162_106509072 112
346 3300013306 Ga0163162_11884987 Ga0163162_118849871 112
347 3300013308 Ga0157375_10383508 Ga0157375_103835082 112
348 3300013308 Ga0157375_11122950 Ga0157375_111229502 112
349 3300013308 Ga0157375_11135958 Ga0157375_111359582 112
350 3300013308 Ga0157375_13247229 Ga0157375_132472291 112
351 3300014325 Ga0163163_10017852 Ga0163163_100178525 112
352 3300014325 Ga0163163_10289507 Ga0163163_102895072 112
353 3300014325 Ga0163163_12477689 Ga0163163_124776892 112
354 3300014326 Ga0157380_10039968 Ga0157380_100399684 112
355 3300014326 Ga0157380_10149713 Ga0157380_101497132 112
356 3300014326 Ga0157380_10502001 Ga0157380_105020012 112
357 3300014326 Ga0157380_10697861 Ga0157380_106978612 112
358 3300014326 Ga0157380_10772503 Ga0157380_107725032 112
359 3300014326 Ga0157380_11111208 Ga0157380_111112081 112
360 3300014326 Ga0157380_11155313 Ga0157380_111553132 112
361 3300014745 Ga0157377_10147876 Ga0157377_101478762 112
362 3300014968 Ga0157379_12622111 Ga0157379_126221111 112
363 3300014969 Ga0157376_10201947 Ga0157376_102019472 112
364 3300014969 Ga0157376_10452257 Ga0157376_104522572 112
365 3300017792 Ga0163161_10463970 Ga0163161_104639703 112
366 3300017792 Ga0163161_10506011 Ga0163161_105060111 112
367 3300025315 Ga0207697_10003386 Ga0207697_100033862 112
368 3300025315 Ga0207697_10054729 Ga0207697_100547291 112
369 3300025885 Ga0207653_10100958 Ga0207653_101009583 112
370 3300025900 Ga0207710_10134034 Ga0207710_101340342 112
371 3300025901 Ga0207688_10342575 Ga0207688_103425752 112
372 3300025901 Ga0207688_10358613 Ga0207688_103586131 112
373 3300025901 Ga0207688_10827728 Ga0207688_108277282 112
374 3300025903 Ga0207680_10023481 Ga0207680_100234814 112
375 3300025903 Ga0207680_10194102 Ga0207680_101941022 112
376 3300025903 Ga0207680_10791396 Ga0207680_107913961 112
377 3300025903 Ga0207680_10860375 Ga0207680_108603752 112
378 3300025907 Ga0207645_10411554 Ga0207645_104115542 112
379 3300025908 Ga0207643_10009182 Ga0207643_100091822 112
380 3300025908 Ga0207643_10032482 Ga0207643_100324823 112
381 3300025910 Ga0207684_10551107 Ga0207684_105511072 112
382 3300025910 Ga0207684_10590586 Ga0207684_105905862 112
383 3300025917 Ga0207660_11393893 Ga0207660_113938932 112
384 3300025918 Ga0207662_10011924 Ga0207662_100119243 112
385 3300025918 Ga0207662_10737184 Ga0207662_107371841 112
386 3300025918 Ga0207662_11134745 Ga0207662_111347452 112
387 3300025921 Ga0207652_11470085 Ga0207652_114700852 112
388 3300025922 Ga0207646_10038261 Ga0207646_100382612 112
389 3300025922 Ga0207646_10271320 Ga0207646_102713202 112
390 3300025922 Ga0207646_10592546 Ga0207646_105925461 112
391 3300025922 Ga0207646_10867662 Ga0207646_108676621 112
392 3300025923 Ga0207681_10081793 Ga0207681_100817931 112
393 3300025923 Ga0207681_10992339 Ga0207681_109923391 112
394 3300025923 Ga0207681_11735050 Ga0207681_117350501 112
395 3300025924 Ga0207694_10775530 Ga0207694_107755302 112
396 3300025925 Ga0207650_10062337 Ga0207650_100623371 112
397 3300025926 Ga0207659_10000073 Ga0207659_1000007324 112
398 3300025926 Ga0207659_10379062 Ga0207659_103790622 112
399 3300025926 Ga0207659_10981364 Ga0207659_109813642 112
400 3300025927 Ga0207687_10169925 Ga0207687_101699253 112
401 3300025928 Ga0207700_10132842 Ga0207700_101328422 112
402 3300025929 Ga0207664_10634719 Ga0207664_106347192 112
403 3300025931 Ga0207644_10205669 Ga0207644_102056692 112
404 3300025931 Ga0207644_10279790 Ga0207644_102797902 112
405 3300025933 Ga0207706_10262137 Ga0207706_102621371 112
406 3300025933 Ga0207706_10484078 Ga0207706_104840782 112
407 3300025933 Ga0207706_10722697 Ga0207706_107226971 112
408 3300025934 Ga0207686_10785104 Ga0207686_107851042 112
409 3300025935 Ga0207709_10250247 Ga0207709_102502472 112
410 3300025936 Ga0207670_10115775 Ga0207670_101157753 112
411 3300025936 Ga0207670_10691622 Ga0207670_106916221 112
412 3300025936 Ga0207670_10700813 Ga0207670_107008131 112
413 3300025936 Ga0207670_11443206 Ga0207670_114432061 112
414 3300025937 Ga0207669_11221783 Ga0207669_112217831 112
415 3300025938 Ga0207704_10347610 Ga0207704_103476101 112
416 3300025938 Ga0207704_10815046 Ga0207704_108150461 112
417 3300025938 Ga0207704_11138490 Ga0207704_111384902 112
418 3300025940 Ga0207691_10001303 Ga0207691_100013039 112
419 3300025940 Ga0207691_10100312 Ga0207691_101003123 112
420 3300025940 Ga0207691_10289509 Ga0207691_102895092 112
421 3300025941 Ga0207711_10064468 Ga0207711_100644683 112
422 3300025941 Ga0207711_10751037 Ga0207711_107510372 112
423 3300025942 Ga0207689_10018742 Ga0207689_100187425 112
424 3300025942 Ga0207689_10023001 Ga0207689_100230016 112
425 3300025942 Ga0207689_10035270 Ga0207689_100352705 112
426 3300025942 Ga0207689_10199138 Ga0207689_101991383 112
427 3300025944 Ga0207661_10001975 Ga0207661_100019755 112
428 3300025945 Ga0207679_10001040 Ga0207679_100010409 112
429 3300025945 Ga0207679_10061165 Ga0207679_100611652 112
430 3300025960 Ga0207651_10055108 Ga0207651_100551082 112
431 3300025960 Ga0207651_10134666 Ga0207651_101346662 112
432 3300025960 Ga0207651_11057940 Ga0207651_110579401 112
433 3300025961 Ga0207712_10980608 Ga0207712_109806082 112
434 3300025961 Ga0207712_11317275 Ga0207712_113172752 112
435 3300025972 Ga0207668_11657242 Ga0207668_116572421 112
436 3300025981 Ga0207640_10084497 Ga0207640_100844972 112
437 3300025986 Ga0207658_10133653 Ga0207658_101336532 112
438 3300025986 Ga0207658_10497249 Ga0207658_104972492 112
439 3300026023 Ga0207677_10259759 Ga0207677_102597591 112
440 3300026023 Ga0207677_10692450 Ga0207677_106924503 112
441 3300026035 Ga0207703_10095748 Ga0207703_100957482 112
442 3300026035 Ga0207703_10166387 Ga0207703_101663873 112
443 3300026035 Ga0207703_10516857 Ga0207703_105168572 112
444 3300026035 Ga0207703_10647452 Ga0207703_106474521 112
445 3300026067 Ga0207678_10018809 Ga0207678_100188094 112
446 3300026067 Ga0207678_10052392 Ga0207678_100523924 112
447 3300026067 Ga0207678_11476904 Ga0207678_114769041 112
448 3300026075 Ga0207708_10041908 Ga0207708_100419082 112
449 3300026075 Ga0207708_10054163 Ga0207708_100541634 112
450 3300026075 Ga0207708_10609390 Ga0207708_106093902 112
451 3300026088 Ga0207641_10030781 Ga0207641_100307814 112
452 3300026089 Ga0207648_10054198 Ga0207648_100541981 112
453 3300026089 Ga0207648_10384508 Ga0207648_103845082 112
454 3300026095 Ga0207676_10055314 Ga0207676_100553142 112
455 3300026095 Ga0207676_10486214 Ga0207676_104862141 112
456 3300026095 Ga0207676_10954914 Ga0207676_109549141 112
457 3300026116 Ga0207674_10219000 Ga0207674_102190002 112
458 3300026118 Ga0207675_100031844 Ga0207675_1000318446 112
459 3300026118 Ga0207675_100032823 Ga0207675_1000328232 112
460 3300026118 Ga0207675_100400715 Ga0207675_1004007152 112
461 3300026118 Ga0207675_101524061 Ga0207675_1015240611 112
462 3300026121 Ga0207683_10006140 Ga0207683_100061401 112
463 3300026121 Ga0207683_10210903 Ga0207683_102109032 112
464 3300026121 Ga0207683_10304432 Ga0207683_103044322 112
465 3300026121 Ga0207683_10482490 Ga0207683_104824902 112
466 3300026142 Ga0207698_10176649 Ga0207698_101766492 112
467 3300027471 Ga0209995_1012700 Ga0209995_10127002 112
468 3300027526 Ga0209968_1075666 Ga0209968_10756661 112
469 3300027543 Ga0209999_1075119 Ga0209999_10751191 112
470 3300027682 Ga0209971_1066948 Ga0209971_10669481 112
471 3300027682 Ga0209971_1066948 Ga0209971_10669482 112
472 3300027866 Ga0209813_10089102 Ga0209813_100891021 112
473 3300027876 Ga0209974_10035953 Ga0209974_100359532 112
474 3300027907 Ga0207428_10012852 Ga0207428_100128521 112
475 3300027907 Ga0207428_10658216 Ga0207428_106582161 112
476 3300028380 Ga0268265_10086941 Ga0268265_100869412 112
477 3300028380 Ga0268265_10112602 Ga0268265_101126022 112
478 3300028380 Ga0268265_10156500 Ga0268265_101565001 112
479 3300028380 Ga0268265_10672789 Ga0268265_106727891 112
480 3300028380 Ga0268265_10774286 Ga0268265_107742862 112
481 3300028380 Ga0268265_10785101 Ga0268265_107851011 112
482 3300028380 Ga0268265_12066193 Ga0268265_120661932 112
483 3300028381 Ga0268264_10201234 Ga0268264_102012342 112
484 3300028381 Ga0268264_10642218 Ga0268264_106422182 112
485 3300028381 Ga0268264_10961971 Ga0268264_109619711 112
486 3300028381 Ga0268264_11580646 Ga0268264_115806461 112
487 3300028381 Ga0268264_11604123 Ga0268264_116041232 112
488 3300031548 Ga0307408_100010704 Ga0307408_1000107044 112
489 3300031548 Ga0307408_100027722 Ga0307408_1000277226 112
490 3300031548 Ga0307408_100075965 Ga0307408_1000759652 112
491 3300031548 Ga0307408_100290526 Ga0307408_1002905262 112
492 3300031731 Ga0307405_10022749 Ga0307405_100227491 112
493 3300031731 Ga0307405_10243839 Ga0307405_102438393 112
494 3300031824 Ga0307413_10118450 Ga0307413_101184502 112
495 3300031824 Ga0307413_10299204 Ga0307413_102992042 112
496 3300031824 Ga0307413_11348066 Ga0307413_113480661 112
497 3300031852 Ga0307410_10969979 Ga0307410_109699792 112
498 3300031852 Ga0307410_11048844 Ga0307410_110488442 112
499 3300031852 Ga0307410_11119037 Ga0307410_111190372 112
500 3300031852 Ga0307410_11202630 Ga0307410_112026302 112
501 3300031901 Ga0307406_10384391 Ga0307406_103843912 112
502 3300031901 Ga0307406_10582575 Ga0307406_105825752 112
503 3300031901 Ga0307406_10703776 Ga0307406_107037762 112
504 3300031903 Ga0307407_10220463 Ga0307407_102204631 112
505 3300031903 Ga0307407_10277789 Ga0307407_102777892 112
506 3300031911 Ga0307412_10134685 Ga0307412_101346852 112
507 3300031911 Ga0307412_11572918 Ga0307412_115729181 112
508 3300031995 Ga0307409_100146913 Ga0307409_1001469132 112
509 3300031995 Ga0307409_100572295 Ga0307409_1005722952 112
510 3300031995 Ga0307409_101303514 Ga0307409_1013035142 112
511 3300032002 Ga0307416_100012026 Ga0307416_1000120262 112
512 3300032002 Ga0307416_100132786 Ga0307416_1001327862 112
513 3300032002 Ga0307416_100475416 Ga0307416_1004754162 112
514 3300032002 Ga0307416_100652584 Ga0307416_1006525842 112
515 3300032002 Ga0307416_101098857 Ga0307416_1010988572 112
516 3300032002 Ga0307416_103650824 Ga0307416_1036508241 112
517 3300032004 Ga0307414_11258648 Ga0307414_112586482 112
518 3300032005 Ga0307411_10080548 Ga0307411_100805482 112
519 3300032005 Ga0307411_10081660 Ga0307411_100816602 112
520 3300032005 Ga0307411_10559034 Ga0307411_105590342 112
521 3300032005 Ga0307411_11129494 Ga0307411_111294941 112
522 3300032126 Ga0307415_100091654 Ga0307415_1000916542 112
523 3300032126 Ga0307415_101926063 Ga0307415_1019260631 112
524 3300035083 Ga0373926_0162020 Ga0373926_0162020_441_779 112
525 3300035092 Ga0373952_0009107 Ga0373952_0009107_591_929 112
526 3300035114 Ga0373939_0235472 Ga0373939_0235472_136_474 112
527 3300035115 Ga0373941_0275203 Ga0373941_0275203_235_573 112
528 3300035691 Ga0373931_0177560 Ga0373931_0177560_735_1073 112
529 3300035695 Ga0373927_0361175 Ga0373927_0361175_554_892 112
530 3300037068 Ga0373925_0127746 Ga0373925_0127746_271_609 112
531 3300041410 Ga0439461_0024323 Ga0439461_0024323_768_1106 112
532 3300041460 Ga0451802_0382625 Ga0451802_0382625_552_890 112
533 3300041997 Ga0439431_0112928 Ga0439431_0112928_96_434 112
534 3300042006 Ga0439432_230643 Ga0439432_230643_132_470 112
535 3300042008 Ga0439450_040913 Ga0439450_040913_348_686 112
536 3300042011 Ga0439454_072667 Ga0439454_072667_50_412 112
537 3300042118 Ga0450914_013279 Ga0450914_013279_113_451 112
538 3300042122 Ga0450920_089620 Ga0450920_089620_232_570 112
539 3300042125 Ga0450923_028307 Ga0450923_028307_199_537 112
540 3300042156 Ga0439446_0273827 Ga0439446_0273827_219_557 112
541 3300042436 Ga0439435_0110327 Ga0439435_0110327_72_410 112
542 3300042436 Ga0439435_0154504 Ga0439435_0154504_390_728 112
543 3300042439 Ga0439464_0074408 Ga0439464_0074408_551_889 112
544 3300042439 Ga0439464_0094702 Ga0439464_0094702_74_412 112
545 3300042876 Ga0451577_1584149 Ga0451577_1584149_177_524 112
546 3300042993 Ga0439440_0137741 Ga0439440_0137741_246_584 112
547 3300044673 Ga0453683_0779470 Ga0453683_0779470_106_444 112
548 3300045051 Ga0451576_0133145 Ga0451576_0133145_553_891 112
549 3300046499 Ga0495594_0871369 Ga0495594_0871369_35_373 112
550 3300046517 Ga0495630_1006204 Ga0495630_1006204_197_535 112
551 3300046522 Ga0495643_0005610 Ga0495643_0005610_5792_6130 112
552 3300046537 Ga0495598_0305637 Ga0495598_0305637_173_511 112
553 3300046538 Ga0495609_0145927 Ga0495609_0145927_47_385 112
554 3300046539 Ga0495621_0190297 Ga0495621_0190297_110_448 112
555 3300046664 Ga0495659_0193768 Ga0495659_0193768_258_596 112
556 3300046684 Ga0495669_0121802 Ga0495669_0121802_19_357 112
557 3300046689 Ga0495613_0272447 Ga0495613_0272447_766_1104 112
558 3300046694 Ga0495649_0372708 Ga0495649_0372708_149_487 112
559 3300048905 Ga0496102_1361815 Ga0496102_1361815_203_541 112
560 3300048907 Ga0496104_0000738 Ga0496104_0000738_5740_6078 112
561 3300048907 Ga0496104_1246942 Ga0496104_1246942_172_510 112
562 3300048908 Ga0496105_0004063 Ga0496105_0004063_183_521 112
563 3300048909 Ga0496106_0213764 Ga0496106_0213764_240_578 112
564 3300048909 Ga0496106_0565337 Ga0496106_0565337_233_574 112
565 3300048910 Ga0496107_0066038 Ga0496107_0066038_22_360 112
566 3300048911 Ga0496108_0003353 Ga0496108_0003353_10202_10540 112
567 3300048912 Ga0496109_0001592 Ga0496109_0001592_16471_16809 112
568 3300048912 Ga0496109_1787255 Ga0496109_1787255_191_529 112
569 3300048913 Ga0496110_0010556 Ga0496110_0010556_1564_1902 112
570 3300048915 Ga0496112_0001560 Ga0496112_0001560_2567_2905 112
571 3300048915 Ga0496112_1009143 Ga0496112_1009143_374_712 112
572 3300048915 Ga0496112_1600480 Ga0496112_1600480_12_350 112
573 3300048915 Ga0496112_1747813 Ga0496112_1747813_20_358 112
574 3300048916 Ga0496113_0231307 Ga0496113_0231307_210_548 112
575 3300049515 Ga0501292_010250 Ga0501292_010250_649_987 112
576 3300049521 Ga0501298_093207 Ga0501298_093207_192_530 112
577 3300049522 Ga0501299_006376 Ga0501299_006376_743_1081 112
578 3300049568 Ga0501031_0005502 Ga0501031_0005502_6063_6401 112
579 3300049568 Ga0501031_0006231 Ga0501031_0006231_980_1321 112
580 3300049568 Ga0501031_0006379 Ga0501031_0006379_5489_5827 112
581 3300049568 Ga0501031_0095939 Ga0501031_0095939_1445_1783 112
582 3300049568 Ga0501031_0276404 Ga0501031_0276404_402_740 112
583 3300049568 Ga0501031_0389755 Ga0501031_0389755_357_695 112
584 3300049569 Ga0501032_0000389 Ga0501032_0000389_9141_9479 112
585 3300049569 Ga0501032_0004303 Ga0501032_0004303_4098_4439 112
586 3300049569 Ga0501032_0028124 Ga0501032_0028124_533_871 112
587 3300049569 Ga0501032_0086125 Ga0501032_0086125_65_403 112
588 3300049569 Ga0501032_0306333 Ga0501032_0306333_88_429 112
589 3300049569 Ga0501032_0625595 Ga0501032_0625595_53_391 112
590 3300049570 Ga0501033_0001379 Ga0501033_0001379_15946_16287 112
591 3300049570 Ga0501033_0068677 Ga0501033_0068677_679_1017 112
592 3300049570 Ga0501033_0112387 Ga0501033_0112387_821_1162 112
593 3300049571 Ga0501034_0018144 Ga0501034_0018144_4852_5190 112
594 3300049571 Ga0501034_0021049 Ga0501034_0021049_3963_4304 112
595 3300049571 Ga0501034_0030824 Ga0501034_0030824_4353_4691 112
596 3300049571 Ga0501034_0034104 Ga0501034_0034104_949_1287 112
597 3300049571 Ga0501034_0043322 Ga0501034_0043322_3949_4290 112
598 3300049571 Ga0501034_0615309 Ga0501034_0615309_204_542 112
599 3300049572 Ga0501036_0002951 Ga0501036_0002951_8242_8580 112
600 3300049572 Ga0501036_0004553 Ga0501036_0004553_3269_3610 112
601 3300049572 Ga0501036_0011068 Ga0501036_0011068_1432_1770 112
602 3300049572 Ga0501036_0180725 Ga0501036_0180725_68_406 112
603 3300049572 Ga0501036_0384091 Ga0501036_0384091_742_1080 112
604 3300049572 Ga0501036_1517457 Ga0501036_1517457_59_397 112
605 3300049573 Ga0501037_0009219 Ga0501037_0009219_6375_6716 112
606 3300049573 Ga0501037_0046641 Ga0501037_0046641_421_759 112
607 3300049573 Ga0501037_0121851 Ga0501037_0121851_1240_1578 112
608 3300049573 Ga0501037_0188924 Ga0501037_0188924_745_1083 112
609 3300049573 Ga0501037_0231900 Ga0501037_0231900_250_588 112
610 3300049573 Ga0501037_0576367 Ga0501037_0576367_237_578 112
611 3300049574 Ga0501038_0002772 Ga0501038_0002772_8695_9033 112
612 3300049574 Ga0501038_0002872 Ga0501038_0002872_5927_6268 112
613 3300049574 Ga0501038_0003162 Ga0501038_0003162_13456_13794 112
614 3300049574 Ga0501038_0028562 Ga0501038_0028562_16_354 112
615 3300049574 Ga0501038_0049667 Ga0501038_0049667_169_510 112
616 3300049574 Ga0501038_0201422 Ga0501038_0201422_1054_1392 112
617 3300049575 Ga0501039_0002456 Ga0501039_0002456_4845_5183 112
618 3300049575 Ga0501039_0032797 Ga0501039_0032797_1185_1523 112
619 3300049575 Ga0501039_0130710 Ga0501039_0130710_52_390 112
620 3300049575 Ga0501039_0232116 Ga0501039_0232116_610_951 112
621 3300049575 Ga0501039_0917434 Ga0501039_0917434_70_408 112
622 3300049576 Ga0501040_0102671 Ga0501040_0102671_991_1332 112
623 3300049576 Ga0501040_0112720 Ga0501040_0112720_176_514 112
624 3300049576 Ga0501040_0327325 Ga0501040_0327325_350_688 112
625 3300049576 Ga0501040_0382616 Ga0501040_0382616_424_762 112
626 3300049576 Ga0501040_0563567 Ga0501040_0563567_213_551 112
627 3300049577 Ga0501041_0129200 Ga0501041_0129200_1159_1548 112
628 3300049577 Ga0501041_0989771 Ga0501041_0989771_120_458 112
629 3300049578 Ga0501042_0005209 Ga0501042_0005209_532_921 112
630 3300049578 Ga0501042_0012320 Ga0501042_0012320_4055_4393 112
631 3300049578 Ga0501042_0040498 Ga0501042_0040498_1860_2198 112
632 3300049578 Ga0501042_0376698 Ga0501042_0376698_335_676 112
633 3300049579 Ga0501043_0000523 Ga0501043_0000523_12744_13082 112
634 3300049579 Ga0501043_0009982 Ga0501043_0009982_5498_5839 112
635 3300049579 Ga0501043_0015433 Ga0501043_0015433_4337_4675 112
636 3300049579 Ga0501043_0031681 Ga0501043_0031681_1053_1391 112
637 3300049579 Ga0501043_0033447 Ga0501043_0033447_3526_3864 112
638 3300049579 Ga0501043_0036592 Ga0501043_0036592_809_1147 112
639 3300049579 Ga0501043_0801174 Ga0501043_0801174_52_390 112
640 3300049579 Ga0501043_0932145 Ga0501043_0932145_129_467 112
641 3300049579 Ga0501043_1115757 Ga0501043_1115757_102_440 112
642 3300049580 Ga0501046_0001365 Ga0501046_0001365_16876_17214 112
643 3300049580 Ga0501046_0005206 Ga0501046_0005206_10363_10701 112
644 3300049580 Ga0501046_0006858 Ga0501046_0006858_2629_2970 112
645 3300049580 Ga0501046_0008841 Ga0501046_0008841_3356_3694 112
646 3300049580 Ga0501046_0024496 Ga0501046_0024496_3194_3532 112
647 3300049580 Ga0501046_0050799 Ga0501046_0050799_1902_2240 112
648 3300049580 Ga0501046_0428441 Ga0501046_0428441_563_901 112
649 3300049580 Ga0501046_0603057 Ga0501046_0603057_368_706 112
650 3300049580 Ga0501046_0859023 Ga0501046_0859023_36_374 112
651 3300049581 Ga0501047_0001059 Ga0501047_0001059_25061_25399 112
652 3300049581 Ga0501047_0034798 Ga0501047_0034798_3874_4212 112
653 3300049581 Ga0501047_0044932 Ga0501047_0044932_2839_3177 112
654 3300049581 Ga0501047_0047430 Ga0501047_0047430_335_676 112
655 3300049581 Ga0501047_0065872 Ga0501047_0065872_625_963 112
656 3300049581 Ga0501047_0176527 Ga0501047_0176527_1210_1548 112
657 3300049581 Ga0501047_0465561 Ga0501047_0465561_376_717 112
658 3300049582 Ga0501048_0001458 Ga0501048_0001458_184_522 112
659 3300049582 Ga0501048_0017437 Ga0501048_0017437_4153_4491 112
660 3300049582 Ga0501048_0040044 Ga0501048_0040044_2518_2856 112
661 3300049582 Ga0501048_0049449 Ga0501048_0049449_240_581 112
662 3300049582 Ga0501048_0517107 Ga0501048_0517107_53_391 112
663 3300049582 Ga0501048_0669424 Ga0501048_0669424_384_722 112
664 3300049583 Ga0501067_0002961 Ga0501067_0002961_7335_7673 112
665 3300049583 Ga0501067_0003234 Ga0501067_0003234_5420_5761 112
666 3300049583 Ga0501067_0024530 Ga0501067_0024530_2932_3270 112
667 3300049583 Ga0501067_0049601 Ga0501067_0049601_1420_1758 112
668 3300049583 Ga0501067_0134564 Ga0501067_0134564_561_899 112
669 3300049583 Ga0501067_0649021 Ga0501067_0649021_54_392 112
670 3300049584 Ga0501068_0012341 Ga0501068_0012341_3616_3957 112
671 3300049584 Ga0501068_0026918 Ga0501068_0026918_1451_1789 112
672 3300049584 Ga0501068_0102632 Ga0501068_0102632_65_403 112
673 3300049584 Ga0501068_0153908 Ga0501068_0153908_575_913 112
674 3300049584 Ga0501068_0158200 Ga0501068_0158200_187_525 112
675 3300049584 Ga0501068_0796874 Ga0501068_0796874_159_497 112
676 3300049585 Ga0501069_0042638 Ga0501069_0042638_1260_1598 112
677 3300049585 Ga0501069_0048835 Ga0501069_0048835_1983_2324 112
678 3300049585 Ga0501069_0101981 Ga0501069_0101981_405_743 112
679 3300049585 Ga0501069_0241617 Ga0501069_0241617_496_834 112
680 3300049586 Ga0501070_0006698 Ga0501070_0006698_4196_4537 112
681 3300049586 Ga0501070_0104206 Ga0501070_0104206_1882_2220 112
682 3300049586 Ga0501070_0160806 Ga0501070_0160806_1340_1678 112
683 3300049586 Ga0501070_1058945 Ga0501070_1058945_169_507 112
684 3300049587 Ga0501071_0004830 Ga0501071_0004830_4283_4621 112
685 3300049587 Ga0501071_0021575 Ga0501071_0021575_1480_1818 112
686 3300049587 Ga0501071_0092567 Ga0501071_0092567_320_658 112
687 3300049587 Ga0501071_0464404 Ga0501071_0464404_606_944 112
688 3300049587 Ga0501071_0887610 Ga0501071_0887610_285_623 112
689 3300049588 Ga0501072_0034341 Ga0501072_0034341_603_941 112
690 3300049588 Ga0501072_0081561 Ga0501072_0081561_555_893 112
691 3300049588 Ga0501072_0127178 Ga0501072_0127178_1382_1720 112
692 3300049588 Ga0501072_0165007 Ga0501072_0165007_991_1329 112
693 3300049588 Ga0501072_0410470 Ga0501072_0410470_307_645 112
694 3300049588 Ga0501072_0440837 Ga0501072_0440837_166_504 112
695 3300049588 Ga0501072_0730194 Ga0501072_0730194_353_691 112
696 3300049589 Ga0501073_0000673 Ga0501073_0000673_12098_12439 112
697 3300049589 Ga0501073_0005767 Ga0501073_0005767_3987_4325 112
698 3300049589 Ga0501073_0021161 Ga0501073_0021161_3058_3396 112
699 3300049589 Ga0501073_0051587 Ga0501073_0051587_2303_2644 112
700 3300049589 Ga0501073_0078215 Ga0501073_0078215_1764_2102 112
701 3300049589 Ga0501073_0325186 Ga0501073_0325186_570_908 112
702 3300049589 Ga0501073_0366610 Ga0501073_0366610_458_847 112
703 3300049589 Ga0501073_0386833 Ga0501073_0386833_553_891 112
704 3300049590 Ga0501074_0014220 Ga0501074_0014220_4580_4918 112
705 3300049590 Ga0501074_0023908 Ga0501074_0023908_3594_3935 112
706 3300049590 Ga0501074_0095952 Ga0501074_0095952_182_520 112
707 3300049590 Ga0501074_0703615 Ga0501074_0703615_260_598 112
708 3300049590 Ga0501074_0964649 Ga0501074_0964649_144_482 112
709 3300049591 Ga0501075_0069864 Ga0501075_0069864_1101_1490 112
710 3300049591 Ga0501075_0782386 Ga0501075_0782386_160_498 112
711 3300049591 Ga0501075_1195009 Ga0501075_1195009_153_491 112
712 3300049592 Ga0501076_0197946 Ga0501076_0197946_1039_1377 112
713 3300049592 Ga0501076_0206125 Ga0501076_0206125_867_1256 112
714 3300049592 Ga0501076_1113582 Ga0501076_1113582_173_514 112
715 3300049593 Ga0501077_0048365 Ga0501077_0048365_1570_1908 112
716 3300049593 Ga0501077_0208500 Ga0501077_0208500_27_419 112
717 3300049593 Ga0501077_0498473 Ga0501077_0498473_197_586 112
718 3300049655 Ga0501208_004275 Ga0501208_004275_459_797 112
719 3300049675 Ga0501243_132792 Ga0501243_132792_25_363 112
720 3300049690 Ga0501261_039678 Ga0501261_039678_36_374 112
721 3300049741 Ga0501079_0017757 Ga0501079_0017757_4772_5113 112
722 3300049741 Ga0501079_0042490 Ga0501079_0042490_3127_3465 112
723 3300049741 Ga0501079_0050619 Ga0501079_0050619_1254_1592 112
724 3300049741 Ga0501079_0245842 Ga0501079_0245842_378_716 112
725 3300049741 Ga0501079_0434128 Ga0501079_0434128_566_904 112
726 3300049741 Ga0501079_0464813 Ga0501079_0464813_173_511 112
727 3300049742 Ga0501080_0000066 Ga0501080_0000066_63801_64139 112
728 3300049742 Ga0501080_0009715 Ga0501080_0009715_4342_4683 112
729 3300049742 Ga0501080_0030799 Ga0501080_0030799_4055_4393 112
730 3300049742 Ga0501080_0063311 Ga0501080_0063311_2690_3028 112
731 3300049742 Ga0501080_0120686 Ga0501080_0120686_1128_1466 112
732 3300049742 Ga0501080_0121996 Ga0501080_0121996_1093_1431 112
733 3300049742 Ga0501080_0374864 Ga0501080_0374864_772_1110 112
734 3300049742 Ga0501080_1177633 Ga0501080_1177633_161_499 112
735 3300049742 Ga0501080_1679303 Ga0501080_1679303_97_486 112
736 3300049743 Ga0501081_0206638 Ga0501081_0206638_652_990 112
737 3300049743 Ga0501081_0222969 Ga0501081_0222969_745_1083 112
738 3300049743 Ga0501081_0288294 Ga0501081_0288294_465_806 112
739 3300049743 Ga0501081_0649386 Ga0501081_0649386_336_674 112
740 3300049743 Ga0501081_1496574 Ga0501081_1496574_69_407 112
741 3300049744 Ga0501083_0001749 Ga0501083_0001749_12465_12821 112
742 3300049744 Ga0501083_0002515 Ga0501083_0002515_11195_11533 112
743 3300049744 Ga0501083_0006852 Ga0501083_0006852_3287_3628 112
744 3300049744 Ga0501083_0012510 Ga0501083_0012510_5371_5709 112
745 3300049744 Ga0501083_0054470 Ga0501083_0054470_665_1003 112
746 3300049744 Ga0501083_0069480 Ga0501083_0069480_1332_1670 112
747 3300049744 Ga0501083_0149468 Ga0501083_0149468_861_1199 112
748 3300049744 Ga0501083_0329579 Ga0501083_0329579_457_846 112
749 3300049744 Ga0501083_0506335 Ga0501083_0506335_319_657 112
750 3300049822 Ga0501035_0031936 Ga0501035_0031936_4410_4748 112
751 3300049822 Ga0501035_0061410 Ga0501035_0061410_1093_1431 112
752 3300049822 Ga0501035_0159332 Ga0501035_0159332_873_1214 112
753 3300049822 Ga0501035_0342851 Ga0501035_0342851_77_418 112
754 3300049822 Ga0501035_0563873 Ga0501035_0563873_258_599 112
755 3300049823 Ga0501044_0001594 Ga0501044_0001594_21375_21713 112
756 3300049823 Ga0501044_0238192 Ga0501044_0238192_586_924 112
757 3300049823 Ga0501044_0271441 Ga0501044_0271441_281_622 112
758 3300049823 Ga0501044_0356773 Ga0501044_0356773_861_1199 112
759 3300049823 Ga0501044_0759088 Ga0501044_0759088_497_835 112
760 3300049823 Ga0501044_0903989 Ga0501044_0903989_224_562 112
761 3300049823 Ga0501044_1072421 Ga0501044_1072421_90_431 112
762 3300049824 Ga0501045_0022232 Ga0501045_0022232_1848_2186 112
763 3300049824 Ga0501045_0063925 Ga0501045_0063925_1543_1881 112
764 3300049824 Ga0501045_0142947 Ga0501045_0142947_311_652 112
765 3300049824 Ga0501045_0239586 Ga0501045_0239586_80_418 112
766 3300049824 Ga0501045_0347006 Ga0501045_0347006_128_466 112
767 3300050491 nmdc:mga00v17_116254_c2 nmdc:mga00v17_116254_c2_100_438 112
768 3300050491 nmdc:mga00v17_96322_c1 nmdc:mga00v17_96322_c1_1509_1847 112
769 3300050493 nmdc:mga0k408_210547_c1 nmdc:mga0k408_210547_c1_656_994 112
770 3300050493 nmdc:mga0k408_408053_c1 nmdc:mga0k408_408053_c1_33_371 112
771 3300050494 nmdc:mga06z11_19576_c1 nmdc:mga06z11_19576_c1_298_636 112
772 3300050494 nmdc:mga06z11_354356_c1 nmdc:mga06z11_354356_c1_333_671 112
773 3300050494 nmdc:mga06z11_438119_c1 nmdc:mga06z11_438119_c1_440_778 112
774 3300050494 nmdc:mga06z11_603701_c1 nmdc:mga06z11_603701_c1_23_412 112
775 3300050495 nmdc:mga04h51_317688_c1 nmdc:mga04h51_317688_c1_207_545 112
776 3300050496 nmdc:mga07m45_132337_c1 nmdc:mga07m45_132337_c1_182_520 112
777 3300050507 nmdc:mga05p37_2011171_c1 nmdc:mga05p37_2011171_c1_112_450 112
778 3300050507 nmdc:mga05p37_279912_c1 nmdc:mga05p37_279912_c1_561_899 112
779 3300050507 nmdc:mga05p37_357078_c1 nmdc:mga05p37_357078_c1_262_603 112
780 3300050507 nmdc:mga05p37_644084_c1 nmdc:mga05p37_644084_c1_447_785 112
781 3300050508 nmdc:mga09592_10912_c1 nmdc:mga09592_10912_c1_2943_3284 112
782 3300050508 nmdc:mga09592_198494_c1 nmdc:mga09592_198494_c1_727_1065 112
783 3300050508 nmdc:mga09592_224489_c1 nmdc:mga09592_224489_c1_948_1286 112
784 3300050508 nmdc:mga09592_409290_c1 nmdc:mga09592_409290_c1_303_641 112
785 3300050508 nmdc:mga09592_55293_c1 nmdc:mga09592_55293_c1_2328_2666 112
786 3300050508 nmdc:mga09592_935973_c1 nmdc:mga09592_935973_c1_226_564 112
787 3300050508 nmdc:mga09592_970003_c1 nmdc:mga09592_970003_c1_274_612 112
788 3300050509 nmdc:mga0qj67_125077_c1 nmdc:mga0qj67_125077_c1_1227_1565 112
789 3300050509 nmdc:mga0qj67_214581_c1 nmdc:mga0qj67_214581_c1_1083_1421 112
790 3300050509 nmdc:mga0qj67_320605_c1 nmdc:mga0qj67_320605_c1_33_371 112
791 3300050509 nmdc:mga0qj67_325568_c1 nmdc:mga0qj67_325568_c1_615_956 112
792 3300050509 nmdc:mga0qj67_46370_c1 nmdc:mga0qj67_46370_c1_787_1128 112
793 3300050509 nmdc:mga0qj67_556308_c1 nmdc:mga0qj67_556308_c1_373_711 112
794 3300050510 nmdc:mga06r32_1099877_c1 nmdc:mga06r32_1099877_c1_34_372 112
795 3300050510 nmdc:mga06r32_1426417_c1 nmdc:mga06r32_1426417_c1_251_589 112
796 3300050510 nmdc:mga06r32_1562411_c1 nmdc:mga06r32_1562411_c1_79_417 112
797 3300050510 nmdc:mga06r32_17022_c1 nmdc:mga06r32_17022_c1_2607_2948 112
798 3300050510 nmdc:mga06r32_385144_c1 nmdc:mga06r32_385144_c1_433_771 112
799 3300050510 nmdc:mga06r32_460658_c1 nmdc:mga06r32_460658_c1_871_1209 112
800 3300050510 nmdc:mga06r32_48917_c1 nmdc:mga06r32_48917_c1_3317_3655 112
801 3300050510 nmdc:mga06r32_6101_c1 nmdc:mga06r32_6101_c1_5169_5507 112
802 3300050510 nmdc:mga06r32_68801_c1 nmdc:mga06r32_68801_c1_354_692 112
803 3300050510 nmdc:mga06r32_83665_c1 nmdc:mga06r32_83665_c1_1296_1637 112
804 3300050511 nmdc:mga08y16_1105092_c1 nmdc:mga08y16_1105092_c1_61_399 112
805 3300050511 nmdc:mga08y16_1593027_c1 nmdc:mga08y16_1593027_c1_124_462 112
806 3300050511 nmdc:mga08y16_19145_c1 nmdc:mga08y16_19145_c1_5126_5464 112
807 3300050511 nmdc:mga08y16_326046_c1 nmdc:mga08y16_326046_c1_1077_1415 112
808 3300050511 nmdc:mga08y16_64524_c1 nmdc:mga08y16_64524_c1_2345_2683 112
809 3300050512 nmdc:mga0n895_114062_c1 nmdc:mga0n895_114062_c1_1404_1745 112
810 3300050512 nmdc:mga0n895_123943_c1 nmdc:mga0n895_123943_c1_898_1287 112
811 3300050512 nmdc:mga0n895_126543_c1 nmdc:mga0n895_126543_c1_1607_1945 112
812 3300050512 nmdc:mga0n895_1690_c1 nmdc:mga0n895_1690_c1_10840_11178 112
813 3300050512 nmdc:mga0n895_1800123_c1 nmdc:mga0n895_1800123_c1_44_382 112
814 3300050512 nmdc:mga0n895_222777_c1 nmdc:mga0n895_222777_c1_513_851 112
815 3300050512 nmdc:mga0n895_255012_c1 nmdc:mga0n895_255012_c1_630_971 112
816 3300050512 nmdc:mga0n895_267688_c1 nmdc:mga0n895_267688_c1_953_1291 112
817 3300050512 nmdc:mga0n895_601_c1 nmdc:mga0n895_601_c1_18059_18397 112
818 3300050513 nmdc:mga0rr50_101517_c1 nmdc:mga0rr50_101517_c1_403_741 112
819 3300050513 nmdc:mga0rr50_1285601_c1 nmdc:mga0rr50_1285601_c1_34_372 112
820 3300050513 nmdc:mga0rr50_29683_c1 nmdc:mga0rr50_29683_c1_1300_1638 112
821 3300050513 nmdc:mga0rr50_29688_c1 nmdc:mga0rr50_29688_c1_2157_2495 112
822 3300050514 nmdc:mga08x19_17947_c1 nmdc:mga08x19_17947_c1_3053_3391 112
823 3300050514 nmdc:mga08x19_738185_c1 nmdc:mga08x19_738185_c1_248_589 112
824 3300050514 nmdc:mga08x19_86543_c1 nmdc:mga08x19_86543_c1_495_833 112
825 3300050515 nmdc:mga0a205_18351_c1 nmdc:mga0a205_18351_c1_5812_6150 112
826 3300050515 nmdc:mga0a205_21859_c1 nmdc:mga0a205_21859_c1_3483_3824 112
827 3300050515 nmdc:mga0a205_349196_c1 nmdc:mga0a205_349196_c1_89_427 112
828 3300050515 nmdc:mga0a205_43073_c1 nmdc:mga0a205_43073_c1_2334_2672 112
829 3300050515 nmdc:mga0a205_4479_c1 nmdc:mga0a205_4479_c1_6460_6798 112
830 3300050515 nmdc:mga0a205_656954_c1 nmdc:mga0a205_656954_c1_331_669 112
831 3300050515 nmdc:mga0a205_900161_c1 nmdc:mga0a205_900161_c1_142_531 112
832 3300053093 Ga0500651_0215093 Ga0500651_0215093_443_781 112
833 3300053116 Ga0500592_003315 Ga0500592_003315_1042_1380 112
834 3300053134 Ga0500658_0192469 Ga0500658_0192469_336_674 112
835 3300054114 Ga0501084_0015335 Ga0501084_0015335_5451_5840 112
836 3300054114 Ga0501084_0071498 Ga0501084_0071498_870_1211 112
837 3300054114 Ga0501084_0078915 Ga0501084_0078915_456_794 112
838 3300054114 Ga0501084_0177797 Ga0501084_0177797_1344_1682 112
839 3300054114 Ga0501084_0257038 Ga0501084_0257038_1021_1359 112
840 3300059421 Ga0590071_000384 Ga0590071_000384_2590_2997 112
841 3300059421 Ga0590071_061271 Ga0590071_061271_142_531 112
842 3300059423 Ga0590074_002233 Ga0590074_002233_380_787 112
843 3300059424 Ga0590075_000159 Ga0590075_000159_8919_9326 112
844 3300059424 Ga0590075_024801 Ga0590075_024801_598_936 112
845 3300059424 Ga0590075_040702 Ga0590075_040702_688_1077 112
846 3300059426 Ga0590077_000408 Ga0590077_000408_9064_9471 112
847 3300059426 Ga0590077_105449 Ga0590077_105449_159_497 112
848 3300059426 Ga0590077_148215 Ga0590077_148215_159_497 112
849 3300060353 Ga0501082_0042454 Ga0501082_0042454_447_785 112
850 3300060353 Ga0501082_0048845 Ga0501082_0048845_2740_3078 112
851 3300060353 Ga0501082_0126210 Ga0501082_0126210_1367_1705 112
852 3300060353 Ga0501082_0263433 Ga0501082_0263433_646_987 112
853 3300060353 Ga0501082_0268925 Ga0501082_0268925_64_402 112
854 3300060353 Ga0501082_0287132 Ga0501082_0287132_142_480 112
855 3300060353 Ga0501082_0383601 Ga0501082_0383601_642_980 112
856 3300060353 Ga0501082_0802020 Ga0501082_0802020_194_532 112
857 3300060353 Ga0501082_1763343 Ga0501082_1763343_90_428 112
858 3300061734 Ga0530510_0126736 Ga0530510_0126736_634_972 112
859 3300061734 Ga0530510_0214549 Ga0530510_0214549_875_1213 112
860 3300061734 Ga0530510_0684154 Ga0530510_0684154_178_567 112
861 3300061734 Ga0530510_0765871 Ga0530510_0765871_316_654 112
862 3300061734 Ga0530510_0898238 Ga0530510_0898238_163_522 112
863 3300061734 Ga0530510_0899995 Ga0530510_0899995_317_655 112
864 3300061734 Ga0530510_1447222 Ga0530510_1447222_22_360 112

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03551

PadR

Transcriptional regulator PadR-like family

42

116

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hhh-assembly1.cif.gz_B crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.9288 11 108
3hhh-assembly1.cif.gz_A crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.9276 11 110
1xma-assembly1.cif.gz_B-2 structure of a transcriptional regulator from clostridium thermocellum cth-833 0.9246 8 107
1xma-assembly1.cif.gz_A structure of a transcriptional regulator from clostridium thermocellum cth-833 0.9223 8 107
6abq-assembly1.cif.gz_A crystal structure of transcription factor from listeria monocytogenes 0.9188 11 108
ID Description Score Start End Superfamily
1xmaA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9223 8 107 1.10.10.10
af_Q2FUS4_1_110_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9002 13 110 1.10.10.10
af_I6X7F9_1_101_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8992 13 112 1.10.10.10
1xmaA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8885 8 107 1.10.10.10
af_P71704_1_89_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8846 15 96 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A4R1L5U4-F1-model_v4 PadR family transcriptional regulator 0.9951 13 112
AF-A0A3E0P3D5-F1-model_v4 PadR family transcriptional regulator 0.9914 13 109
AF-A0A3N5H0U7-F1-model_v4 PadR family transcriptional regulator 0.9896 10 109
AF-A0A7S7SQC6-F1-model_v4 PadR family transcriptional regulator 0.9881 10 110
AF-A0A7S7SJ63-F1-model_v4 PadR family transcriptional regulator 0.9874 9 108

Feature Viewer

pLDDT pTM Quality
87.33 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map