F483974
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 864 | 307 | 863 | 113 |
Family's Representative Sequence
| Representative Sequence | 3300059421|Ga0590071_000384|Ga0590071_000384_2590_2997 |
| Length | 135 |
| Sequence | MTASSMTAVDGVPRAAVSSHQELMGLTNTPSDLLPGTLELLILKTLVTGAKHGYGIVEHLRLASDDVLRVGESALYPALQRLLLNGWVKAEWGTSENKRRARYYTLTAAGRRQLAAERIEFDRMVGAIQRVLGAT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 2 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 3 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 42 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 59 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 60 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 61 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 63 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 64 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 65 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 66 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 67 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 68 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 69 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 70 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 71 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 72 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 73 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 75 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 76 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 77 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 80 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 81 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 83 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 84 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 85 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 86 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 87 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 88 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 89 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 90 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 91 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 92 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 94 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300012485 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 | Metagenome | Rhizosphere |
| 107 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 182 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 184 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 187 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 188 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 189 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 190 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 191 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 192 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 193 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 194 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 195 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 196 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 197 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 198 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 199 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 200 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 201 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 202 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 203 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 204 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 205 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 206 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 207 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 208 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 209 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 210 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 211 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 212 | 3300042118 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 | Metagenome | Rhizosphere |
| 213 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 214 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 215 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 216 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 217 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 218 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 219 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 220 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 221 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 222 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 233 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 234 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 235 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 236 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 237 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 238 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 239 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 240 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 241 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 242 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 243 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 244 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 245 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 246 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 247 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 248 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 249 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 250 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 251 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 252 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 254 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 257 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 261 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049655 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought | Metagenome | Rhizosphere |
| 273 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 274 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 275 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 283 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 284 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 285 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 286 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 287 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 288 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 289 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 290 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 291 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 292 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 293 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 294 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 295 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 296 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 299 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 300 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 301 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 303 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 304 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 305 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 306 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.55 |
| Nodule | 0 |
| Rhizoplane | 2.2 |
| Rhizosphere | 95.25 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24751J29686_10137353 | 3300002459 | Unclassified | 517 |
| 2 | Ga0065712_10061041 | 3300005290 | Unclassified | 586 |
| 3 | Ga0065712_10117350 | 3300005290 | Bacteria | 1722 |
| 4 | Ga0065712_10138845 | 3300005290 | Unclassified | 1470 |
| 5 | Ga0065715_10001128 | 3300005293 | Bacteria | 7791 |
| 6 | Ga0065715_10123887 | 3300005293 | Unclassified | 2167 |
| 7 | Ga0065715_10302846 | 3300005293 | Unclassified | 1037 |
| 8 | Ga0065715_10524539 | 3300005293 | Unclassified | 761 |
| 9 | Ga0065715_10651255 | 3300005293 | Unclassified | 678 |
| 10 | Ga0065715_10675999 | 3300005293 | Unclassified | 636 |
| 11 | Ga0065707_10800383 | 3300005295 | Bacteria | 599 |
| 12 | Ga0070676_10085582 | 3300005328 | Bacteria | 1921 |
| 13 | Ga0070676_10968838 | 3300005328 | Unclassified | 637 |
| 14 | Ga0070683_100000832 | 3300005329 | Bacteria | 22877 |
| 15 | Ga0070683_100804181 | 3300005329 | Unclassified | 901 |
| 16 | Ga0070690_100153369 | 3300005330 | Bacteria | 1573 |
| 17 | Ga0070690_100168592 | 3300005330 | Bacteria | 1505 |
| 18 | Ga0070670_100014534 | 3300005331 | Bacteria | 6760 |
| 19 | Ga0070670_100025765 | 3300005331 | Bacteria | 5061 |
| 20 | Ga0070670_102243175 | 3300005331 | Bacteria | 503 |
| 21 | Ga0070677_10784076 | 3300005333 | Unclassified | 543 |
| 22 | Ga0068869_100136452 | 3300005334 | Bacteria | 1891 |
| 23 | Ga0068869_100156175 | 3300005334 | Bacteria | 1773 |
| 24 | Ga0070666_10038638 | 3300005335 | Unclassified | 3177 |
| 25 | Ga0070666_10353254 | 3300005335 | Unclassified | 1052 |
| 26 | Ga0070666_10821892 | 3300005335 | Bacteria | 685 |
| 27 | Ga0070680_101660081 | 3300005336 | Unclassified | 554 |
| 28 | Ga0068868_100220579 | 3300005338 | Bacteria | 1587 |
| 29 | Ga0070660_100923913 | 3300005339 | Bacteria | 736 |
| 30 | Ga0070689_100013867 | 3300005340 | Bacteria | 5841 |
| 31 | Ga0070689_100255788 | 3300005340 | Bacteria | 1446 |
| 32 | Ga0070689_100363593 | 3300005340 | Unclassified | 1216 |
| 33 | Ga0070689_100832107 | 3300005340 | Unclassified | 813 |
| 34 | Ga0070687_100316301 | 3300005343 | Unclassified | 996 |
| 35 | Ga0070661_101785628 | 3300005344 | Unclassified | 522 |
| 36 | Ga0070692_10068662 | 3300005345 | Unclassified | 1884 |
| 37 | Ga0070668_100707830 | 3300005347 | Unclassified | 889 |
| 38 | Ga0070668_101268242 | 3300005347 | Unclassified | 669 |
| 39 | Ga0070669_100015181 | 3300005353 | Bacteria | 5485 |
| 40 | Ga0070669_100074209 | 3300005353 | Bacteria | 2522 |
| 41 | Ga0070669_100470418 | 3300005353 | Bacteria | 1038 |
| 42 | Ga0070669_101053549 | 3300005353 | Unclassified | 699 |
| 43 | Ga0070675_100393893 | 3300005354 | Unclassified | 1234 |
| 44 | Ga0070675_100877263 | 3300005354 | Unclassified | 822 |
| 45 | Ga0070675_101384746 | 3300005354 | Unclassified | 648 |
| 46 | Ga0070671_100048909 | 3300005355 | Bacteria | 3518 |
| 47 | Ga0070671_100255261 | 3300005355 | Bacteria | 1490 |
| 48 | Ga0070674_100461051 | 3300005356 | Bacteria | 1051 |
| 49 | Ga0070674_100666888 | 3300005356 | Unclassified | 885 |
| 50 | Ga0070674_101500819 | 3300005356 | Bacteria | 606 |
| 51 | Ga0070673_100001105 | 3300005364 | Bacteria | 15452 |
| 52 | Ga0070673_100018616 | 3300005364 | Unclassified | 4966 |
| 53 | Ga0070673_100150629 | 3300005364 | Unclassified | 1970 |
| 54 | Ga0070688_100177557 | 3300005365 | Unclassified | 1474 |
| 55 | Ga0070688_100453550 | 3300005365 | Unclassified | 959 |
| 56 | Ga0070659_100512630 | 3300005366 | Unclassified | 1023 |
| 57 | Ga0070659_100640396 | 3300005366 | Unclassified | 916 |
| 58 | Ga0070667_100068417 | 3300005367 | Bacteria | 3021 |
| 59 | Ga0070667_100301508 | 3300005367 | Bacteria | 1443 |
| 60 | Ga0070667_100399345 | 3300005367 | Bacteria | 1251 |
| 61 | Ga0070667_101131373 | 3300005367 | Bacteria | 732 |
| 62 | Ga0070667_101509873 | 3300005367 | Bacteria | 631 |
| 63 | Ga0070709_10028947 | 3300005434 | Unclassified | 3308 |
| 64 | Ga0070709_10036144 | 3300005434 | Bacteria | 3007 |
| 65 | Ga0070714_100013094 | 3300005435 | Bacteria | 6639 |
| 66 | Ga0070714_100023917 | 3300005435 | Bacteria | 5025 |
| 67 | Ga0070713_100000276 | 3300005436 | Bacteria | 33685 |
| 68 | Ga0070713_100006548 | 3300005436 | Bacteria | 8090 |
| 69 | Ga0070713_100017861 | 3300005436 | Bacteria | 5379 |
| 70 | Ga0070713_100024802 | 3300005436 | Bacteria | 4679 |
| 71 | Ga0070713_100036881 | 3300005436 | Unclassified | 3949 |
| 72 | Ga0070710_10267658 | 3300005437 | Unclassified | 1104 |
| 73 | Ga0070701_10186771 | 3300005438 | Unclassified | 1217 |
| 74 | Ga0070701_10666419 | 3300005438 | Bacteria | 696 |
| 75 | Ga0070711_100151258 | 3300005439 | Unclassified | 1750 |
| 76 | Ga0070711_101424058 | 3300005439 | Unclassified | 603 |
| 77 | Ga0070705_101390613 | 3300005440 | Bacteria | 585 |
| 78 | Ga0070705_101882899 | 3300005440 | Bacteria | 509 |
| 79 | Ga0070700_100291943 | 3300005441 | Bacteria | 1187 |
| 80 | Ga0070700_101005758 | 3300005441 | Bacteria | 686 |
| 81 | Ga0070700_101046325 | 3300005441 | Unclassified | 674 |
| 82 | Ga0070694_100024733 | 3300005444 | Bacteria | 3878 |
| 83 | Ga0070694_100105838 | 3300005444 | Unclassified | 1997 |
| 84 | Ga0070694_100330513 | 3300005444 | Unclassified | 1176 |
| 85 | Ga0070694_100764114 | 3300005444 | Bacteria | 790 |
| 86 | Ga0070694_101525941 | 3300005444 | Unclassified | 566 |
| 87 | Ga0070694_101668819 | 3300005444 | Bacteria | 542 |
| 88 | Ga0070663_100140159 | 3300005455 | Bacteria | 1845 |
| 89 | Ga0070663_100778677 | 3300005455 | Unclassified | 819 |
| 90 | Ga0070678_100223233 | 3300005456 | Unclassified | 1567 |
| 91 | Ga0070678_100554796 | 3300005456 | Bacteria | 1020 |
| 92 | Ga0070678_100658578 | 3300005456 | Unclassified | 940 |
| 93 | Ga0070678_101000520 | 3300005456 | Unclassified | 768 |
| 94 | Ga0070662_100056066 | 3300005457 | Unclassified | 2860 |
| 95 | Ga0070681_10011895 | 3300005458 | Bacteria | 8629 |
| 96 | Ga0070681_11048105 | 3300005458 | Unclassified | 736 |
| 97 | Ga0068867_100458250 | 3300005459 | Unclassified | 1088 |
| 98 | Ga0070685_10355289 | 3300005466 | Bacteria | 1003 |
| 99 | Ga0070685_10446532 | 3300005466 | Unclassified | 905 |
| 100 | Ga0070685_11511349 | 3300005466 | Unclassified | 518 |
| 101 | Ga0070706_100620631 | 3300005467 | Bacteria | 1004 |
| 102 | Ga0070706_100668713 | 3300005467 | Bacteria | 964 |
| 103 | Ga0070707_100013913 | 3300005468 | Bacteria | 7536 |
| 104 | Ga0070707_100164488 | 3300005468 | Bacteria | 2162 |
| 105 | Ga0070707_100529847 | 3300005468 | Unclassified | 1140 |
| 106 | Ga0070698_100530657 | 3300005471 | Bacteria | 1115 |
| 107 | Ga0070699_100425906 | 3300005518 | Bacteria | 1202 |
| 108 | Ga0070699_100444953 | 3300005518 | Bacteria | 1174 |
| 109 | Ga0070699_101253786 | 3300005518 | Unclassified | 680 |
| 110 | Ga0070679_100090740 | 3300005530 | Bacteria | 3044 |
| 111 | Ga0070679_100628379 | 3300005530 | Unclassified | 1017 |
| 112 | Ga0070684_100000427 | 3300005535 | Bacteria | 28878 |
| 113 | Ga0070697_100043629 | 3300005536 | Bacteria | 3632 |
| 114 | Ga0070697_100321164 | 3300005536 | Bacteria | 1333 |
| 115 | Ga0070697_100388571 | 3300005536 | Bacteria | 1209 |
| 116 | Ga0070672_100013022 | 3300005543 | Bacteria | 5862 |
| 117 | Ga0070672_100064072 | 3300005543 | Bacteria | 2904 |
| 118 | Ga0070672_100305284 | 3300005543 | Unclassified | 1350 |
| 119 | Ga0070686_100908773 | 3300005544 | Unclassified | 717 |
| 120 | Ga0070686_101130098 | 3300005544 | Unclassified | 648 |
| 121 | Ga0070695_100074645 | 3300005545 | Bacteria | 2229 |
| 122 | Ga0070695_100284809 | 3300005545 | Bacteria | 1216 |
| 123 | Ga0070695_101328660 | 3300005545 | Unclassified | 595 |
| 124 | Ga0070696_100051203 | 3300005546 | Bacteria | 2871 |
| 125 | Ga0070693_100014197 | 3300005547 | Unclassified | 4075 |
| 126 | Ga0070693_100139831 | 3300005547 | Unclassified | 1523 |
| 127 | Ga0070665_101003037 | 3300005548 | Bacteria | 847 |
| 128 | Ga0070704_100036621 | 3300005549 | Bacteria | 3345 |
| 129 | Ga0070704_100109520 | 3300005549 | Bacteria | 2099 |
| 130 | Ga0070704_100296616 | 3300005549 | Unclassified | 1345 |
| 131 | Ga0070704_100309211 | 3300005549 | Bacteria | 1320 |
| 132 | Ga0070664_100000731 | 3300005564 | Bacteria | 25260 |
| 133 | Ga0070664_100043243 | 3300005564 | Bacteria | 3801 |
| 134 | Ga0068857_100974362 | 3300005577 | Bacteria | 815 |
| 135 | Ga0068857_102250858 | 3300005577 | Bacteria | 535 |
| 136 | Ga0068854_100222012 | 3300005578 | Bacteria | 1495 |
| 137 | Ga0068856_102677994 | 3300005614 | Bacteria | 504 |
| 138 | Ga0070702_100084248 | 3300005615 | Bacteria | 1911 |
| 139 | Ga0070702_101744119 | 3300005615 | Unclassified | 519 |
| 140 | Ga0068852_100163983 | 3300005616 | Bacteria | 2077 |
| 141 | Ga0068852_100694084 | 3300005616 | Bacteria | 1027 |
| 142 | Ga0068859_100001429 | 3300005617 | Bacteria | 24213 |
| 143 | Ga0068859_100016773 | 3300005617 | Bacteria | 7354 |
| 144 | Ga0068859_101233776 | 3300005617 | Unclassified | 824 |
| 145 | Ga0068859_101484463 | 3300005617 | Bacteria | 748 |
| 146 | Ga0068859_102513639 | 3300005617 | Bacteria | 567 |
| 147 | Ga0068864_100077964 | 3300005618 | Bacteria | 2899 |
| 148 | Ga0068864_102235240 | 3300005618 | Unclassified | 553 |
| 149 | Ga0068861_100634070 | 3300005719 | Unclassified | 985 |
| 150 | Ga0068861_100912536 | 3300005719 | Bacteria | 833 |
| 151 | Ga0068861_101047229 | 3300005719 | Bacteria | 781 |
| 152 | Ga0068851_10450310 | 3300005834 | Unclassified | 765 |
| 153 | Ga0068870_10000669 | 3300005840 | Bacteria | 13042 |
| 154 | Ga0068870_10374185 | 3300005840 | Unclassified | 920 |
| 155 | Ga0068863_100042493 | 3300005841 | Bacteria | 4319 |
| 156 | Ga0068858_100048964 | 3300005842 | Bacteria | 3914 |
| 157 | Ga0068858_100264248 | 3300005842 | Bacteria | 1636 |
| 158 | Ga0068858_100325416 | 3300005842 | Bacteria | 1470 |
| 159 | Ga0068858_102421161 | 3300005842 | Bacteria | 519 |
| 160 | Ga0068860_100141594 | 3300005843 | Bacteria | 2312 |
| 161 | Ga0068860_100830947 | 3300005843 | Bacteria | 938 |
| 162 | Ga0068860_100958117 | 3300005843 | Bacteria | 873 |
| 163 | Ga0068862_100099912 | 3300005844 | Bacteria | 2537 |
| 164 | Ga0068862_100301953 | 3300005844 | Bacteria | 1473 |
| 165 | Ga0068862_100678580 | 3300005844 | Unclassified | 996 |
| 166 | Ga0068862_100686850 | 3300005844 | Unclassified | 990 |
| 167 | Ga0068862_100996291 | 3300005844 | Unclassified | 828 |
| 168 | Ga0068862_102241212 | 3300005844 | Bacteria | 558 |
| 169 | Ga0081538_10104056 | 3300005981 | Bacteria | 1418 |
| 170 | Ga0070717_10002821 | 3300006028 | Bacteria | 12294 |
| 171 | Ga0070717_10171904 | 3300006028 | Bacteria | 1885 |
| 172 | Ga0070717_11984857 | 3300006028 | Unclassified | 524 |
| 173 | Ga0075368_10418065 | 3300006042 | Bacteria | 591 |
| 174 | Ga0075364_10006284 | 3300006051 | Bacteria | 6970 |
| 175 | Ga0075364_10011345 | 3300006051 | Bacteria | 5413 |
| 176 | Ga0075432_10183894 | 3300006058 | Bacteria | 819 |
| 177 | Ga0070716_100265779 | 3300006173 | Bacteria | 1176 |
| 178 | Ga0070712_100009439 | 3300006175 | Bacteria | 6149 |
| 179 | Ga0070712_100615416 | 3300006175 | Unclassified | 920 |
| 180 | Ga0070712_101744840 | 3300006175 | Unclassified | 545 |
| 181 | Ga0075367_10011729 | 3300006178 | Bacteria | 4650 |
| 182 | Ga0075367_10030938 | 3300006178 | Bacteria | 3072 |
| 183 | Ga0075367_10480756 | 3300006178 | Bacteria | 787 |
| 184 | Ga0075366_10172475 | 3300006195 | Bacteria | 1313 |
| 185 | Ga0097621_100401611 | 3300006237 | Bacteria | 1227 |
| 186 | Ga0097621_100485205 | 3300006237 | Unclassified | 1117 |
| 187 | Ga0075370_10144472 | 3300006353 | Bacteria | 1392 |
| 188 | Ga0068871_100492020 | 3300006358 | Unclassified | 1105 |
| 189 | Ga0068871_100596804 | 3300006358 | Unclassified | 1004 |
| 190 | Ga0068871_100875964 | 3300006358 | Unclassified | 831 |
| 191 | Ga0075428_100007041 | 3300006844 | Bacteria | 12470 |
| 192 | Ga0075428_100178199 | 3300006844 | Bacteria | 2301 |
| 193 | Ga0075428_100352484 | 3300006844 | Bacteria | 1579 |
| 194 | Ga0075428_100547472 | 3300006844 | Bacteria | 1237 |
| 195 | Ga0075428_100988703 | 3300006844 | Bacteria | 891 |
| 196 | Ga0075428_102083363 | 3300006844 | Bacteria | 587 |
| 197 | Ga0075428_102635010 | 3300006844 | Unclassified | 513 |
| 198 | Ga0075430_100029162 | 3300006846 | Bacteria | 4683 |
| 199 | Ga0075430_100031688 | 3300006846 | Bacteria | 4486 |
| 200 | Ga0075430_100165204 | 3300006846 | Bacteria | 1842 |
| 201 | Ga0075430_100173353 | 3300006846 | Bacteria | 1795 |
| 202 | Ga0075431_100031245 | 3300006847 | Bacteria | 5485 |
| 203 | Ga0075431_100033158 | 3300006847 | Bacteria | 5322 |
| 204 | Ga0075431_100036754 | 3300006847 | Bacteria | 5044 |
| 205 | Ga0075431_100038962 | 3300006847 | Bacteria | 4896 |
| 206 | Ga0075431_100105320 | 3300006847 | Bacteria | 2911 |
| 207 | Ga0075431_100244967 | 3300006847 | Unclassified | 1822 |
| 208 | Ga0075431_100535496 | 3300006847 | Bacteria | 1160 |
| 209 | Ga0075431_100596799 | 3300006847 | Bacteria | 1088 |
| 210 | Ga0075433_10000279 | 3300006852 | Bacteria | 30281 |
| 211 | Ga0075433_10040561 | 3300006852 | Bacteria | 4031 |
| 212 | Ga0075433_10052431 | 3300006852 | Bacteria | 3554 |
| 213 | Ga0075433_10059212 | 3300006852 | Bacteria | 3351 |
| 214 | Ga0075433_10063057 | 3300006852 | Bacteria | 3247 |
| 215 | Ga0075433_10409100 | 3300006852 | Bacteria | 1197 |
| 216 | Ga0075433_10646202 | 3300006852 | Unclassified | 927 |
| 217 | Ga0075433_10724630 | 3300006852 | Unclassified | 870 |
| 218 | Ga0075433_10810332 | 3300006852 | Bacteria | 818 |
| 219 | Ga0075434_100026219 | 3300006871 | Bacteria | 5708 |
| 220 | Ga0075434_100029167 | 3300006871 | Bacteria | 5426 |
| 221 | Ga0075434_100100713 | 3300006871 | Bacteria | 2895 |
| 222 | Ga0075434_100106612 | 3300006871 | Bacteria | 2812 |
| 223 | Ga0075434_100114576 | 3300006871 | Bacteria | 2709 |
| 224 | Ga0075434_100137340 | 3300006871 | Bacteria | 2464 |
| 225 | Ga0075434_100273015 | 3300006871 | Unclassified | 1710 |
| 226 | Ga0075434_100321405 | 3300006871 | Unclassified | 1568 |
| 227 | Ga0075434_100653631 | 3300006871 | Unclassified | 1070 |
| 228 | Ga0075434_101666373 | 3300006871 | Unclassified | 646 |
| 229 | Ga0075434_102439559 | 3300006871 | Unclassified | 525 |
| 230 | Ga0075429_100017403 | 3300006880 | Bacteria | 6214 |
| 231 | Ga0075429_100058872 | 3300006880 | Bacteria | 3346 |
| 232 | Ga0075429_100183005 | 3300006880 | Unclassified | 1836 |
| 233 | Ga0075429_100210068 | 3300006880 | Bacteria | 1706 |
| 234 | Ga0075429_100563635 | 3300006880 | Unclassified | 998 |
| 235 | Ga0075429_101108276 | 3300006880 | Unclassified | 691 |
| 236 | Ga0075429_101195675 | 3300006880 | Bacteria | 664 |
| 237 | Ga0075429_101885216 | 3300006880 | Bacteria | 518 |
| 238 | Ga0068865_100275308 | 3300006881 | Unclassified | 1338 |
| 239 | Ga0068865_100381594 | 3300006881 | Bacteria | 1149 |
| 240 | Ga0068865_101023268 | 3300006881 | Bacteria | 724 |
| 241 | Ga0075436_100007526 | 3300006914 | Bacteria | 7441 |
| 242 | Ga0075436_100031348 | 3300006914 | Bacteria | 3661 |
| 243 | Ga0097620_100001429 | 3300006931 | Bacteria | 24213 |
| 244 | Ga0097620_100016773 | 3300006931 | Bacteria | 7354 |
| 245 | Ga0097620_101233685 | 3300006931 | Unclassified | 824 |
| 246 | Ga0097620_101484366 | 3300006931 | Bacteria | 748 |
| 247 | Ga0097620_102514517 | 3300006931 | Bacteria | 567 |
| 248 | Ga0075435_100036693 | 3300007076 | Bacteria | 3897 |
| 249 | Ga0075435_100091898 | 3300007076 | Bacteria | 2505 |
| 250 | Ga0075435_100183876 | 3300007076 | Bacteria | 1767 |
| 251 | Ga0075435_100451952 | 3300007076 | Unclassified | 1108 |
| 252 | Ga0075435_101625679 | 3300007076 | Unclassified | 567 |
| 253 | Ga0105240_10896218 | 3300009093 | Bacteria | 954 |
| 254 | Ga0111539_10017483 | 3300009094 | Bacteria | 8878 |
| 255 | Ga0111539_10040893 | 3300009094 | Bacteria | 5578 |
| 256 | Ga0111539_10417082 | 3300009094 | Bacteria | 1564 |
| 257 | Ga0111539_10671305 | 3300009094 | Bacteria | 1207 |
| 258 | Ga0111539_10711407 | 3300009094 | Bacteria | 1169 |
| 259 | Ga0111539_10945632 | 3300009094 | Bacteria | 1002 |
| 260 | Ga0111539_10954090 | 3300009094 | Bacteria | 997 |
| 261 | Ga0111539_11262530 | 3300009094 | Unclassified | 857 |
| 262 | Ga0111539_11919620 | 3300009094 | Bacteria | 687 |
| 263 | Ga0111539_12548858 | 3300009094 | Unclassified | 593 |
| 264 | Ga0111539_12630887 | 3300009094 | Bacteria | 583 |
| 265 | Ga0105245_10158176 | 3300009098 | Unclassified | 2148 |
| 266 | Ga0105247_10033797 | 3300009101 | Bacteria | 3113 |
| 267 | Ga0114129_10039797 | 3300009147 | Bacteria | 6631 |
| 268 | Ga0114129_10471701 | 3300009147 | Bacteria | 1643 |
| 269 | Ga0114129_10490864 | 3300009147 | Bacteria | 1605 |
| 270 | Ga0114129_10531662 | 3300009147 | Bacteria | 1532 |
| 271 | Ga0114129_11039190 | 3300009147 | Bacteria | 1029 |
| 272 | Ga0114129_12417804 | 3300009147 | Bacteria | 629 |
| 273 | Ga0105243_10560969 | 3300009148 | Bacteria | 1093 |
| 274 | Ga0105241_10646842 | 3300009174 | Unclassified | 960 |
| 275 | Ga0105241_10860684 | 3300009174 | Bacteria | 839 |
| 276 | Ga0105248_10061019 | 3300009177 | Bacteria | 4233 |
| 277 | Ga0105248_10103747 | 3300009177 | Bacteria | 3205 |
| 278 | Ga0105237_11192059 | 3300009545 | Unclassified | 768 |
| 279 | Ga0105238_10353079 | 3300009551 | Bacteria | 1459 |
| 280 | Ga0105238_11034304 | 3300009551 | Unclassified | 843 |
| 281 | Ga0105249_10026632 | 3300009553 | Bacteria | 5213 |
| 282 | Ga0105249_10191348 | 3300009553 | Bacteria | 1997 |
| 283 | Ga0105249_10443888 | 3300009553 | Bacteria | 1335 |
| 284 | Ga0105249_10777768 | 3300009553 | Bacteria | 1020 |
| 285 | Ga0105249_11148179 | 3300009553 | Bacteria | 847 |
| 286 | Ga0105249_12410352 | 3300009553 | Unclassified | 599 |
| 287 | Ga0105239_13577520 | 3300010375 | Unclassified | 505 |
| 288 | Ga0157325_1020697 | 3300012485 | Unclassified | 585 |
| 289 | Ga0157373_10968953 | 3300013100 | Unclassified | 633 |
| 290 | Ga0157373_11268816 | 3300013100 | Bacteria | 557 |
| 291 | Ga0157371_11581429 | 3300013102 | Bacteria | 513 |
| 292 | Ga0157369_10580049 | 3300013105 | Bacteria | 1158 |
| 293 | Ga0157374_11162589 | 3300013296 | Unclassified | 793 |
| 294 | Ga0157378_10692872 | 3300013297 | Bacteria | 1038 |
| 295 | Ga0163162_10052692 | 3300013306 | Bacteria | 4087 |
| 296 | Ga0163162_10650907 | 3300013306 | Bacteria | 1177 |
| 297 | Ga0163162_11884987 | 3300013306 | Unclassified | 684 |
| 298 | Ga0157372_11402433 | 3300013307 | Bacteria | 805 |
| 299 | Ga0157375_10383508 | 3300013308 | Bacteria | 1572 |
| 300 | Ga0157375_11122950 | 3300013308 | Unclassified | 921 |
| 301 | Ga0157375_11135958 | 3300013308 | Bacteria | 915 |
| 302 | Ga0157375_13247229 | 3300013308 | Bacteria | 542 |
| 303 | Ga0163163_10017852 | 3300014325 | Bacteria | 6624 |
| 304 | Ga0163163_10289507 | 3300014325 | Bacteria | 1690 |
| 305 | Ga0163163_12477689 | 3300014325 | Unclassified | 577 |
| 306 | Ga0157380_10039968 | 3300014326 | Bacteria | 3651 |
| 307 | Ga0157380_10149713 | 3300014326 | Bacteria | 2016 |
| 308 | Ga0157380_10295676 | 3300014326 | Unclassified | 1489 |
| 309 | Ga0157380_10502001 | 3300014326 | Bacteria | 1179 |
| 310 | Ga0157380_10697861 | 3300014326 | Bacteria | 1019 |
| 311 | Ga0157380_10772503 | 3300014326 | Unclassified | 975 |
| 312 | Ga0157380_11111208 | 3300014326 | Unclassified | 830 |
| 313 | Ga0157380_11155313 | 3300014326 | Bacteria | 816 |
| 314 | Ga0157380_12541842 | 3300014326 | Unclassified | 578 |
| 315 | Ga0157377_10147876 | 3300014745 | Bacteria | 1450 |
| 316 | Ga0157379_12622111 | 3300014968 | Unclassified | 505 |
| 317 | Ga0157376_10201947 | 3300014969 | Bacteria | 1830 |
| 318 | Ga0157376_10452257 | 3300014969 | Unclassified | 1253 |
| 319 | Ga0163161_10463970 | 3300017792 | Unclassified | 1026 |
| 320 | Ga0163161_10506011 | 3300017792 | Unclassified | 984 |
| 321 | Ga0207697_10003386 | 3300025315 | Bacteria | 7917 |
| 322 | Ga0207697_10054729 | 3300025315 | Unclassified | 1654 |
| 323 | Ga0207653_10100958 | 3300025885 | Bacteria | 1021 |
| 324 | Ga0207682_10446706 | 3300025893 | Unclassified | 612 |
| 325 | Ga0207692_10029987 | 3300025898 | Unclassified | 2590 |
| 326 | Ga0207710_10134034 | 3300025900 | Bacteria | 1191 |
| 327 | Ga0207688_10342575 | 3300025901 | Unclassified | 920 |
| 328 | Ga0207688_10358613 | 3300025901 | Unclassified | 899 |
| 329 | Ga0207688_10827728 | 3300025901 | Unclassified | 586 |
| 330 | Ga0207680_10023481 | 3300025903 | Unclassified | 3369 |
| 331 | Ga0207680_10109105 | 3300025903 | Bacteria | 1791 |
| 332 | Ga0207680_10194102 | 3300025903 | Bacteria | 1380 |
| 333 | Ga0207680_10791396 | 3300025903 | Bacteria | 680 |
| 334 | Ga0207680_10860375 | 3300025903 | Unclassified | 650 |
| 335 | Ga0207699_10019009 | 3300025906 | Bacteria | 3653 |
| 336 | Ga0207699_10032073 | 3300025906 | Bacteria | 2957 |
| 337 | Ga0207699_10446822 | 3300025906 | Unclassified | 927 |
| 338 | Ga0207645_10411554 | 3300025907 | Bacteria | 910 |
| 339 | Ga0207643_10009182 | 3300025908 | Bacteria | 5310 |
| 340 | Ga0207643_10032482 | 3300025908 | Bacteria | 2915 |
| 341 | Ga0207684_10289581 | 3300025910 | Bacteria | 1412 |
| 342 | Ga0207684_10551107 | 3300025910 | Bacteria | 986 |
| 343 | Ga0207684_10590586 | 3300025910 | Bacteria | 949 |
| 344 | Ga0207707_10041446 | 3300025912 | Bacteria | 4021 |
| 345 | Ga0207695_11565461 | 3300025913 | Bacteria | 540 |
| 346 | Ga0207693_10009463 | 3300025915 | Bacteria | 7936 |
| 347 | Ga0207693_10472113 | 3300025915 | Unclassified | 980 |
| 348 | Ga0207663_10117773 | 3300025916 | Bacteria | 1813 |
| 349 | Ga0207660_11393893 | 3300025917 | Unclassified | 568 |
| 350 | Ga0207662_10011924 | 3300025918 | Bacteria | 4833 |
| 351 | Ga0207662_10737184 | 3300025918 | Unclassified | 692 |
| 352 | Ga0207662_11134745 | 3300025918 | Unclassified | 556 |
| 353 | Ga0207652_11470085 | 3300025921 | Unclassified | 585 |
| 354 | Ga0207646_10038261 | 3300025922 | Bacteria | 4322 |
| 355 | Ga0207646_10271320 | 3300025922 | Bacteria | 1533 |
| 356 | Ga0207646_10592546 | 3300025922 | Bacteria | 995 |
| 357 | Ga0207646_10867662 | 3300025922 | Bacteria | 802 |
| 358 | Ga0207681_10081793 | 3300025923 | Bacteria | 2281 |
| 359 | Ga0207681_10992339 | 3300025923 | Unclassified | 704 |
| 360 | Ga0207681_11735050 | 3300025923 | Unclassified | 521 |
| 361 | Ga0207694_10775530 | 3300025924 | Unclassified | 810 |
| 362 | Ga0207650_10062337 | 3300025925 | Unclassified | 2786 |
| 363 | Ga0207650_11743144 | 3300025925 | Bacteria | 527 |
| 364 | Ga0207659_10000073 | 3300025926 | Bacteria | 64021 |
| 365 | Ga0207659_10379062 | 3300025926 | Unclassified | 1179 |
| 366 | Ga0207659_10981364 | 3300025926 | Unclassified | 727 |
| 367 | Ga0207687_10169925 | 3300025927 | Unclassified | 1681 |
| 368 | Ga0207700_10004627 | 3300025928 | Bacteria | 8148 |
| 369 | Ga0207700_10040378 | 3300025928 | Unclassified | 3405 |
| 370 | Ga0207700_10132842 | 3300025928 | Bacteria | 2035 |
| 371 | Ga0207700_10161575 | 3300025928 | Bacteria | 1861 |
| 372 | Ga0207664_10016111 | 3300025929 | Bacteria | 5446 |
| 373 | Ga0207664_10634719 | 3300025929 | Bacteria | 960 |
| 374 | Ga0207644_10205669 | 3300025931 | Bacteria | 1554 |
| 375 | Ga0207644_10279790 | 3300025931 | Bacteria | 1339 |
| 376 | Ga0207706_10208048 | 3300025933 | Unclassified | 1715 |
| 377 | Ga0207706_10262137 | 3300025933 | Bacteria | 1509 |
| 378 | Ga0207706_10484078 | 3300025933 | Unclassified | 1069 |
| 379 | Ga0207706_10722697 | 3300025933 | Bacteria | 850 |
| 380 | Ga0207686_10785104 | 3300025934 | Unclassified | 762 |
| 381 | Ga0207709_10250247 | 3300025935 | Bacteria | 1294 |
| 382 | Ga0207670_10115775 | 3300025936 | Bacteria | 1940 |
| 383 | Ga0207670_10691622 | 3300025936 | Unclassified | 844 |
| 384 | Ga0207670_10700813 | 3300025936 | Unclassified | 838 |
| 385 | Ga0207670_11443206 | 3300025936 | Bacteria | 585 |
| 386 | Ga0207669_10024450 | 3300025937 | Bacteria | 3247 |
| 387 | Ga0207669_11221783 | 3300025937 | Bacteria | 637 |
| 388 | Ga0207704_10347610 | 3300025938 | Unclassified | 1153 |
| 389 | Ga0207704_10815046 | 3300025938 | Unclassified | 780 |
| 390 | Ga0207704_11138490 | 3300025938 | Bacteria | 664 |
| 391 | Ga0207665_10852205 | 3300025939 | Unclassified | 721 |
| 392 | Ga0207691_10001303 | 3300025940 | Bacteria | 24901 |
| 393 | Ga0207691_10100312 | 3300025940 | Unclassified | 2584 |
| 394 | Ga0207691_10289509 | 3300025940 | Bacteria | 1409 |
| 395 | Ga0207711_10064468 | 3300025941 | Bacteria | 3165 |
| 396 | Ga0207711_10751037 | 3300025941 | Unclassified | 909 |
| 397 | Ga0207689_10018742 | 3300025942 | Bacteria | 5837 |
| 398 | Ga0207689_10023001 | 3300025942 | Bacteria | 5236 |
| 399 | Ga0207689_10035270 | 3300025942 | Bacteria | 4157 |
| 400 | Ga0207689_10199138 | 3300025942 | Unclassified | 1653 |
| 401 | Ga0207661_10001975 | 3300025944 | Bacteria | 14117 |
| 402 | Ga0207679_10001040 | 3300025945 | Bacteria | 17750 |
| 403 | Ga0207679_10061165 | 3300025945 | Bacteria | 2802 |
| 404 | Ga0207679_11941937 | 3300025945 | Unclassified | 536 |
| 405 | Ga0207651_10055108 | 3300025960 | Bacteria | 2728 |
| 406 | Ga0207651_10134666 | 3300025960 | Unclassified | 1898 |
| 407 | Ga0207651_11057940 | 3300025960 | Unclassified | 726 |
| 408 | Ga0207712_10297894 | 3300025961 | Bacteria | 1322 |
| 409 | Ga0207712_10980608 | 3300025961 | Unclassified | 749 |
| 410 | Ga0207712_11317275 | 3300025961 | Unclassified | 646 |
| 411 | Ga0207668_11657242 | 3300025972 | Unclassified | 577 |
| 412 | Ga0207640_10084497 | 3300025981 | Bacteria | 2180 |
| 413 | Ga0207658_10133653 | 3300025986 | Bacteria | 1997 |
| 414 | Ga0207658_10497249 | 3300025986 | Bacteria | 1086 |
| 415 | Ga0207677_10259759 | 3300026023 | Unclassified | 1415 |
| 416 | Ga0207677_10692450 | 3300026023 | Unclassified | 903 |
| 417 | Ga0207703_10095748 | 3300026035 | Bacteria | 2505 |
| 418 | Ga0207703_10166387 | 3300026035 | Unclassified | 1935 |
| 419 | Ga0207703_10516857 | 3300026035 | Unclassified | 1122 |
| 420 | Ga0207703_10647452 | 3300026035 | Unclassified | 1002 |
| 421 | Ga0207678_10018809 | 3300026067 | Bacteria | 6068 |
| 422 | Ga0207678_10052392 | 3300026067 | Bacteria | 3521 |
| 423 | Ga0207678_11476904 | 3300026067 | Bacteria | 600 |
| 424 | Ga0207708_10041908 | 3300026075 | Bacteria | 3490 |
| 425 | Ga0207708_10054163 | 3300026075 | Bacteria | 3058 |
| 426 | Ga0207708_10609390 | 3300026075 | Bacteria | 926 |
| 427 | Ga0207702_11280217 | 3300026078 | Unclassified | 727 |
| 428 | Ga0207641_10030781 | 3300026088 | Bacteria | 4447 |
| 429 | Ga0207648_10054198 | 3300026089 | Bacteria | 3503 |
| 430 | Ga0207648_10384508 | 3300026089 | Unclassified | 1269 |
| 431 | Ga0207676_10055314 | 3300026095 | Bacteria | 3115 |
| 432 | Ga0207676_10486214 | 3300026095 | Bacteria | 1170 |
| 433 | Ga0207676_10954914 | 3300026095 | Unclassified | 843 |
| 434 | Ga0207674_10219000 | 3300026116 | Bacteria | 1852 |
| 435 | Ga0207674_11348640 | 3300026116 | Bacteria | 683 |
| 436 | Ga0207675_100031844 | 3300026118 | Bacteria | 4912 |
| 437 | Ga0207675_100032823 | 3300026118 | Bacteria | 4837 |
| 438 | Ga0207675_100400715 | 3300026118 | Bacteria | 1352 |
| 439 | Ga0207675_101370530 | 3300026118 | Bacteria | 728 |
| 440 | Ga0207675_101524061 | 3300026118 | Unclassified | 689 |
| 441 | Ga0207675_102137051 | 3300026118 | Bacteria | 576 |
| 442 | Ga0207683_10006140 | 3300026121 | Bacteria | 10293 |
| 443 | Ga0207683_10210903 | 3300026121 | Unclassified | 1768 |
| 444 | Ga0207683_10304432 | 3300026121 | Bacteria | 1458 |
| 445 | Ga0207683_10482490 | 3300026121 | Bacteria | 1144 |
| 446 | Ga0207698_10176649 | 3300026142 | Bacteria | 1886 |
| 447 | Ga0209995_1012700 | 3300027471 | Unclassified | 1376 |
| 448 | Ga0209968_1075666 | 3300027526 | Bacteria | 603 |
| 449 | Ga0209999_1075119 | 3300027543 | Bacteria | 650 |
| 450 | Ga0209971_1066948 | 3300027682 | Bacteria | 871 |
| 451 | Ga0209813_10089102 | 3300027866 | Bacteria | 1033 |
| 452 | Ga0209974_10035953 | 3300027876 | Bacteria | 1645 |
| 453 | Ga0207428_10012852 | 3300027907 | Bacteria | 7339 |
| 454 | Ga0207428_10227018 | 3300027907 | Bacteria | 1398 |
| 455 | Ga0207428_10658216 | 3300027907 | Bacteria | 751 |
| 456 | Ga0268265_10086941 | 3300028380 | Bacteria | 2486 |
| 457 | Ga0268265_10112602 | 3300028380 | Bacteria | 2225 |
| 458 | Ga0268265_10156500 | 3300028380 | Bacteria | 1929 |
| 459 | Ga0268265_10672789 | 3300028380 | Unclassified | 997 |
| 460 | Ga0268265_10774286 | 3300028380 | Unclassified | 933 |
| 461 | Ga0268265_10785101 | 3300028380 | Bacteria | 927 |
| 462 | Ga0268265_12066193 | 3300028380 | Bacteria | 577 |
| 463 | Ga0268264_10201234 | 3300028381 | Bacteria | 1822 |
| 464 | Ga0268264_10642218 | 3300028381 | Bacteria | 1050 |
| 465 | Ga0268264_10961971 | 3300028381 | Unclassified | 859 |
| 466 | Ga0268264_11580646 | 3300028381 | Bacteria | 666 |
| 467 | Ga0268264_11604123 | 3300028381 | Bacteria | 661 |
| 468 | Ga0307408_100010704 | 3300031548 | Bacteria | 6050 |
| 469 | Ga0307408_100027722 | 3300031548 | Bacteria | 3907 |
| 470 | Ga0307408_100075965 | 3300031548 | Bacteria | 2497 |
| 471 | Ga0307408_100290526 | 3300031548 | Unclassified | 1365 |
| 472 | Ga0307405_10022749 | 3300031731 | Bacteria | 3550 |
| 473 | Ga0307405_10243839 | 3300031731 | Bacteria | 1333 |
| 474 | Ga0307413_10118450 | 3300031824 | Bacteria | 1788 |
| 475 | Ga0307413_10299204 | 3300031824 | Bacteria | 1219 |
| 476 | Ga0307413_11348066 | 3300031824 | Bacteria | 626 |
| 477 | Ga0307410_10121419 | 3300031852 | Bacteria | 1906 |
| 478 | Ga0307410_10969979 | 3300031852 | Bacteria | 732 |
| 479 | Ga0307410_11048844 | 3300031852 | Unclassified | 705 |
| 480 | Ga0307410_11119037 | 3300031852 | Unclassified | 683 |
| 481 | Ga0307410_11202630 | 3300031852 | Bacteria | 660 |
| 482 | Ga0307406_10384391 | 3300031901 | Unclassified | 1108 |
| 483 | Ga0307406_10582575 | 3300031901 | Unclassified | 920 |
| 484 | Ga0307406_10703776 | 3300031901 | Unclassified | 844 |
| 485 | Ga0307407_10220463 | 3300031903 | Bacteria | 1282 |
| 486 | Ga0307407_10277789 | 3300031903 | Unclassified | 1159 |
| 487 | Ga0307412_10134685 | 3300031911 | Bacteria | 1800 |
| 488 | Ga0307412_11572918 | 3300031911 | Bacteria | 600 |
| 489 | Ga0307409_100146913 | 3300031995 | Bacteria | 2040 |
| 490 | Ga0307409_100572295 | 3300031995 | Bacteria | 1112 |
| 491 | Ga0307409_101303514 | 3300031995 | Unclassified | 751 |
| 492 | Ga0307416_100012026 | 3300032002 | Bacteria | 5809 |
| 493 | Ga0307416_100132786 | 3300032002 | Bacteria | 2245 |
| 494 | Ga0307416_100475416 | 3300032002 | Bacteria | 1308 |
| 495 | Ga0307416_100652584 | 3300032002 | Bacteria | 1137 |
| 496 | Ga0307416_101098857 | 3300032002 | Bacteria | 900 |
| 497 | Ga0307416_103650824 | 3300032002 | Bacteria | 515 |
| 498 | Ga0307414_11258648 | 3300032004 | Unclassified | 686 |
| 499 | Ga0307411_10080548 | 3300032005 | Bacteria | 2239 |
| 500 | Ga0307411_10081660 | 3300032005 | Bacteria | 2227 |
| 501 | Ga0307411_10559034 | 3300032005 | Unclassified | 977 |
| 502 | Ga0307411_11129494 | 3300032005 | Bacteria | 708 |
| 503 | Ga0307415_100091654 | 3300032126 | Bacteria | 2202 |
| 504 | Ga0307415_100337760 | 3300032126 | Bacteria | 1263 |
| 505 | Ga0307415_101926063 | 3300032126 | Bacteria | 574 |
| 506 | Ga0373926_0162020 | 3300035083 | Unclassified | 854 |
| 507 | Ga0373952_0009107 | 3300035092 | Bacteria | 1894 |
| 508 | Ga0373939_0235472 | 3300035114 | Unclassified | 707 |
| 509 | Ga0373941_0275203 | 3300035115 | Bacteria | 664 |
| 510 | Ga0373931_0177560 | 3300035691 | Bacteria | 1259 |
| 511 | Ga0373927_0361175 | 3300035695 | Unclassified | 957 |
| 512 | Ga0373937_0479205 | 3300036401 | Bacteria | 1182 |
| 513 | Ga0373925_0127746 | 3300037068 | Bacteria | 1979 |
| 514 | Ga0439461_0024323 | 3300041410 | Unclassified | 1224 |
| 515 | Ga0451802_0382625 | 3300041460 | Bacteria | 1093 |
| 516 | Ga0439431_0112928 | 3300041997 | Bacteria | 753 |
| 517 | Ga0439432_230643 | 3300042006 | Bacteria | 533 |
| 518 | Ga0439450_040913 | 3300042008 | Bacteria | 1076 |
| 519 | Ga0439454_072667 | 3300042011 | Bacteria | 613 |
| 520 | Ga0450914_013279 | 3300042118 | Bacteria | 836 |
| 521 | Ga0450920_089620 | 3300042122 | Bacteria | 634 |
| 522 | Ga0450923_028307 | 3300042125 | Unclassified | 1131 |
| 523 | Ga0439446_0273827 | 3300042156 | Bacteria | 587 |
| 524 | Ga0439435_0110327 | 3300042436 | Bacteria | 853 |
| 525 | Ga0439435_0154504 | 3300042436 | Bacteria | 738 |
| 526 | Ga0439464_0074408 | 3300042439 | Bacteria | 1008 |
| 527 | Ga0439464_0094702 | 3300042439 | Bacteria | 903 |
| 528 | Ga0451577_1584149 | 3300042876 | Unclassified | 578 |
| 529 | Ga0439440_0137741 | 3300042993 | Bacteria | 691 |
| 530 | Ga0453683_0779470 | 3300044673 | Bacteria | 629 |
| 531 | Ga0451576_0133145 | 3300045051 | Bacteria | 2591 |
| 532 | Ga0451576_0475306 | 3300045051 | Bacteria | 1313 |
| 533 | Ga0495594_0871369 | 3300046499 | Bacteria | 506 |
| 534 | Ga0495630_1006204 | 3300046517 | Bacteria | 633 |
| 535 | Ga0495643_0005610 | 3300046522 | Bacteria | 8431 |
| 536 | Ga0495598_0305637 | 3300046537 | Archaea | 603 |
| 537 | Ga0495609_0145927 | 3300046538 | Bacteria | 1008 |
| 538 | Ga0495621_0190297 | 3300046539 | Bacteria | 822 |
| 539 | Ga0495659_0193768 | 3300046664 | Bacteria | 831 |
| 540 | Ga0495669_0121802 | 3300046684 | Bacteria | 1223 |
| 541 | Ga0495613_0272447 | 3300046689 | Bacteria | 1177 |
| 542 | Ga0495649_0372708 | 3300046694 | Bacteria | 719 |
| 543 | Ga0496102_1361815 | 3300048905 | Bacteria | 629 |
| 544 | Ga0496103_0830201 | 3300048906 | Unclassified | 582 |
| 545 | Ga0496104_0000738 | 3300048907 | Bacteria | 28056 |
| 546 | Ga0496104_1246942 | 3300048907 | Unclassified | 647 |
| 547 | Ga0496105_0004063 | 3300048908 | Bacteria | 10952 |
| 548 | Ga0496106_0213764 | 3300048909 | Bacteria | 1537 |
| 549 | Ga0496106_0565337 | 3300048909 | Unclassified | 912 |
| 550 | Ga0496107_0066038 | 3300048910 | Bacteria | 2623 |
| 551 | Ga0496108_0003353 | 3300048911 | Bacteria | 12866 |
| 552 | Ga0496109_0001592 | 3300048912 | Bacteria | 18934 |
| 553 | Ga0496109_1787255 | 3300048912 | Unclassified | 548 |
| 554 | Ga0496110_0010556 | 3300048913 | Bacteria | 7521 |
| 555 | Ga0496110_1842731 | 3300048913 | Unclassified | 515 |
| 556 | Ga0496112_0001560 | 3300048915 | Bacteria | 17707 |
| 557 | Ga0496112_1009143 | 3300048915 | Unclassified | 752 |
| 558 | Ga0496112_1600480 | 3300048915 | Bacteria | 565 |
| 559 | Ga0496112_1747813 | 3300048915 | Bacteria | 534 |
| 560 | Ga0496113_0231307 | 3300048916 | Bacteria | 1474 |
| 561 | Ga0501292_010250 | 3300049515 | Bacteria | 1401 |
| 562 | Ga0501298_093207 | 3300049521 | Bacteria | 678 |
| 563 | Ga0501299_006376 | 3300049522 | Bacteria | 1850 |
| 564 | Ga0501031_0005502 | 3300049568 | Bacteria | 8245 |
| 565 | Ga0501031_0006231 | 3300049568 | Bacteria | 7779 |
| 566 | Ga0501031_0006379 | 3300049568 | Bacteria | 7694 |
| 567 | Ga0501031_0095939 | 3300049568 | Bacteria | 1935 |
| 568 | Ga0501031_0276404 | 3300049568 | Bacteria | 1090 |
| 569 | Ga0501031_0389755 | 3300049568 | Unclassified | 901 |
| 570 | Ga0501031_0742192 | 3300049568 | Unclassified | 630 |
| 571 | Ga0501032_0000389 | 3300049569 | Bacteria | 36191 |
| 572 | Ga0501032_0004303 | 3300049569 | Bacteria | 10750 |
| 573 | Ga0501032_0028124 | 3300049569 | Bacteria | 3863 |
| 574 | Ga0501032_0086125 | 3300049569 | Bacteria | 2088 |
| 575 | Ga0501032_0306333 | 3300049569 | Bacteria | 1026 |
| 576 | Ga0501032_0625595 | 3300049569 | Bacteria | 684 |
| 577 | Ga0501033_0001379 | 3300049570 | Bacteria | 21647 |
| 578 | Ga0501033_0068677 | 3300049570 | Unclassified | 2605 |
| 579 | Ga0501033_0112387 | 3300049570 | Unclassified | 1981 |
| 580 | Ga0501034_0018144 | 3300049571 | Bacteria | 7218 |
| 581 | Ga0501034_0021049 | 3300049571 | Bacteria | 6655 |
| 582 | Ga0501034_0030824 | 3300049571 | Bacteria | 5450 |
| 583 | Ga0501034_0034104 | 3300049571 | Bacteria | 5160 |
| 584 | Ga0501034_0043322 | 3300049571 | Bacteria | 4555 |
| 585 | Ga0501034_0615309 | 3300049571 | Bacteria | 990 |
| 586 | Ga0501036_0002951 | 3300049572 | Bacteria | 13515 |
| 587 | Ga0501036_0004553 | 3300049572 | Bacteria | 11194 |
| 588 | Ga0501036_0011068 | 3300049572 | Bacteria | 7459 |
| 589 | Ga0501036_0180725 | 3300049572 | Bacteria | 1776 |
| 590 | Ga0501036_0384091 | 3300049572 | Bacteria | 1172 |
| 591 | Ga0501036_1517457 | 3300049572 | Unclassified | 542 |
| 592 | Ga0501037_0009219 | 3300049573 | Bacteria | 7234 |
| 593 | Ga0501037_0046641 | 3300049573 | Bacteria | 3178 |
| 594 | Ga0501037_0121851 | 3300049573 | Bacteria | 1875 |
| 595 | Ga0501037_0188924 | 3300049573 | Bacteria | 1459 |
| 596 | Ga0501037_0231900 | 3300049573 | Unclassified | 1296 |
| 597 | Ga0501037_0576367 | 3300049573 | Bacteria | 757 |
| 598 | Ga0501038_0002772 | 3300049574 | Bacteria | 16308 |
| 599 | Ga0501038_0002872 | 3300049574 | Bacteria | 16056 |
| 600 | Ga0501038_0003162 | 3300049574 | Bacteria | 15364 |
| 601 | Ga0501038_0028562 | 3300049574 | Bacteria | 4954 |
| 602 | Ga0501038_0049667 | 3300049574 | Bacteria | 3627 |
| 603 | Ga0501038_0201422 | 3300049574 | Bacteria | 1597 |
| 604 | Ga0501039_0002456 | 3300049575 | Bacteria | 13800 |
| 605 | Ga0501039_0032797 | 3300049575 | Bacteria | 4006 |
| 606 | Ga0501039_0130710 | 3300049575 | Bacteria | 1970 |
| 607 | Ga0501039_0232116 | 3300049575 | Unclassified | 1450 |
| 608 | Ga0501039_0446318 | 3300049575 | Bacteria | 1016 |
| 609 | Ga0501039_0917434 | 3300049575 | Bacteria | 682 |
| 610 | Ga0501040_0102671 | 3300049576 | Bacteria | 1996 |
| 611 | Ga0501040_0112720 | 3300049576 | Bacteria | 1903 |
| 612 | Ga0501040_0327325 | 3300049576 | Bacteria | 1096 |
| 613 | Ga0501040_0382616 | 3300049576 | Unclassified | 1010 |
| 614 | Ga0501040_0563567 | 3300049576 | Unclassified | 822 |
| 615 | Ga0501041_0129200 | 3300049577 | Bacteria | 1574 |
| 616 | Ga0501041_0989771 | 3300049577 | Bacteria | 541 |
| 617 | Ga0501042_0005209 | 3300049578 | Bacteria | 8356 |
| 618 | Ga0501042_0012320 | 3300049578 | Bacteria | 5789 |
| 619 | Ga0501042_0040498 | 3300049578 | Bacteria | 3313 |
| 620 | Ga0501042_0200680 | 3300049578 | Unclassified | 1438 |
| 621 | Ga0501042_0376698 | 3300049578 | Unclassified | 1027 |
| 622 | Ga0501043_0000523 | 3300049579 | Bacteria | 34476 |
| 623 | Ga0501043_0009982 | 3300049579 | Bacteria | 7448 |
| 624 | Ga0501043_0015433 | 3300049579 | Bacteria | 5982 |
| 625 | Ga0501043_0031681 | 3300049579 | Bacteria | 4156 |
| 626 | Ga0501043_0033447 | 3300049579 | Bacteria | 4045 |
| 627 | Ga0501043_0036592 | 3300049579 | Bacteria | 3862 |
| 628 | Ga0501043_0801174 | 3300049579 | Bacteria | 681 |
| 629 | Ga0501043_0932145 | 3300049579 | Bacteria | 621 |
| 630 | Ga0501043_1115757 | 3300049579 | Bacteria | 557 |
| 631 | Ga0501046_0001365 | 3300049580 | Bacteria | 23520 |
| 632 | Ga0501046_0005206 | 3300049580 | Bacteria | 11637 |
| 633 | Ga0501046_0006858 | 3300049580 | Bacteria | 10049 |
| 634 | Ga0501046_0008841 | 3300049580 | Bacteria | 8748 |
| 635 | Ga0501046_0024496 | 3300049580 | Bacteria | 4949 |
| 636 | Ga0501046_0050799 | 3300049580 | Bacteria | 3274 |
| 637 | Ga0501046_0428441 | 3300049580 | Bacteria | 953 |
| 638 | Ga0501046_0603057 | 3300049580 | Unclassified | 779 |
| 639 | Ga0501046_0859023 | 3300049580 | Bacteria | 634 |
| 640 | Ga0501047_0001059 | 3300049581 | Bacteria | 27451 |
| 641 | Ga0501047_0034798 | 3300049581 | Bacteria | 4863 |
| 642 | Ga0501047_0044932 | 3300049581 | Bacteria | 4269 |
| 643 | Ga0501047_0047430 | 3300049581 | Bacteria | 4150 |
| 644 | Ga0501047_0065872 | 3300049581 | Bacteria | 3491 |
| 645 | Ga0501047_0176527 | 3300049581 | Bacteria | 2003 |
| 646 | Ga0501047_0465561 | 3300049581 | Bacteria | 1092 |
| 647 | Ga0501048_0001458 | 3300049582 | Bacteria | 17927 |
| 648 | Ga0501048_0017437 | 3300049582 | Bacteria | 5288 |
| 649 | Ga0501048_0040044 | 3300049582 | Bacteria | 3359 |
| 650 | Ga0501048_0049449 | 3300049582 | Bacteria | 2996 |
| 651 | Ga0501048_0517107 | 3300049582 | Bacteria | 856 |
| 652 | Ga0501048_0669424 | 3300049582 | Bacteria | 745 |
| 653 | Ga0501067_0002961 | 3300049583 | Bacteria | 9372 |
| 654 | Ga0501067_0003234 | 3300049583 | Bacteria | 8969 |
| 655 | Ga0501067_0024530 | 3300049583 | Bacteria | 3345 |
| 656 | Ga0501067_0049601 | 3300049583 | Bacteria | 2326 |
| 657 | Ga0501067_0134564 | 3300049583 | Unclassified | 1376 |
| 658 | Ga0501067_0649021 | 3300049583 | Unclassified | 592 |
| 659 | Ga0501068_0012341 | 3300049584 | Bacteria | 4840 |
| 660 | Ga0501068_0026918 | 3300049584 | Bacteria | 3392 |
| 661 | Ga0501068_0102632 | 3300049584 | Bacteria | 1774 |
| 662 | Ga0501068_0153908 | 3300049584 | Bacteria | 1446 |
| 663 | Ga0501068_0158200 | 3300049584 | Bacteria | 1427 |
| 664 | Ga0501068_0796874 | 3300049584 | Bacteria | 620 |
| 665 | Ga0501068_1161999 | 3300049584 | Bacteria | 511 |
| 666 | Ga0501069_0042638 | 3300049585 | Bacteria | 2511 |
| 667 | Ga0501069_0048835 | 3300049585 | Bacteria | 2351 |
| 668 | Ga0501069_0101981 | 3300049585 | Unclassified | 1629 |
| 669 | Ga0501069_0241617 | 3300049585 | Bacteria | 1052 |
| 670 | Ga0501070_0006698 | 3300049586 | Bacteria | 9812 |
| 671 | Ga0501070_0104206 | 3300049586 | Bacteria | 2346 |
| 672 | Ga0501070_0160806 | 3300049586 | Bacteria | 1851 |
| 673 | Ga0501070_1058945 | 3300049586 | Bacteria | 627 |
| 674 | Ga0501071_0004830 | 3300049587 | Bacteria | 8590 |
| 675 | Ga0501071_0021575 | 3300049587 | Bacteria | 4486 |
| 676 | Ga0501071_0092567 | 3300049587 | Bacteria | 2222 |
| 677 | Ga0501071_0464404 | 3300049587 | Bacteria | 969 |
| 678 | Ga0501071_0887610 | 3300049587 | Bacteria | 688 |
| 679 | Ga0501072_0034341 | 3300049588 | Bacteria | 3975 |
| 680 | Ga0501072_0081561 | 3300049588 | Bacteria | 2564 |
| 681 | Ga0501072_0127178 | 3300049588 | Bacteria | 2030 |
| 682 | Ga0501072_0165007 | 3300049588 | Unclassified | 1767 |
| 683 | Ga0501072_0182396 | 3300049588 | Unclassified | 1674 |
| 684 | Ga0501072_0410470 | 3300049588 | Bacteria | 1074 |
| 685 | Ga0501072_0440837 | 3300049588 | Unclassified | 1032 |
| 686 | Ga0501072_0730194 | 3300049588 | Bacteria | 778 |
| 687 | Ga0501073_0000673 | 3300049589 | Bacteria | 24026 |
| 688 | Ga0501073_0005767 | 3300049589 | Bacteria | 9255 |
| 689 | Ga0501073_0021161 | 3300049589 | Bacteria | 4690 |
| 690 | Ga0501073_0051587 | 3300049589 | Bacteria | 2881 |
| 691 | Ga0501073_0078215 | 3300049589 | Bacteria | 2301 |
| 692 | Ga0501073_0325186 | 3300049589 | Bacteria | 1061 |
| 693 | Ga0501073_0366610 | 3300049589 | Bacteria | 995 |
| 694 | Ga0501073_0386833 | 3300049589 | Bacteria | 966 |
| 695 | Ga0501074_0014220 | 3300049590 | Bacteria | 5788 |
| 696 | Ga0501074_0023908 | 3300049590 | Bacteria | 4440 |
| 697 | Ga0501074_0095952 | 3300049590 | Unclassified | 2123 |
| 698 | Ga0501074_0703615 | 3300049590 | Bacteria | 713 |
| 699 | Ga0501074_0964649 | 3300049590 | Unclassified | 600 |
| 700 | Ga0501075_0069864 | 3300049591 | Unclassified | 2654 |
| 701 | Ga0501075_0782386 | 3300049591 | Bacteria | 726 |
| 702 | Ga0501075_1195009 | 3300049591 | Bacteria | 577 |
| 703 | Ga0501075_1504680 | 3300049591 | Unclassified | 509 |
| 704 | Ga0501076_0197946 | 3300049592 | Bacteria | 1640 |
| 705 | Ga0501076_0206125 | 3300049592 | Bacteria | 1606 |
| 706 | Ga0501076_1113582 | 3300049592 | Bacteria | 650 |
| 707 | Ga0501077_0048365 | 3300049593 | Bacteria | 2702 |
| 708 | Ga0501077_0208500 | 3300049593 | Bacteria | 1242 |
| 709 | Ga0501077_0498473 | 3300049593 | Bacteria | 781 |
| 710 | Ga0501208_004275 | 3300049655 | Bacteria | 1672 |
| 711 | Ga0501243_132792 | 3300049675 | Bacteria | 521 |
| 712 | Ga0501261_039678 | 3300049690 | Unclassified | 738 |
| 713 | Ga0501079_0017757 | 3300049741 | Bacteria | 5435 |
| 714 | Ga0501079_0042490 | 3300049741 | Bacteria | 3509 |
| 715 | Ga0501079_0050619 | 3300049741 | Bacteria | 3206 |
| 716 | Ga0501079_0245842 | 3300049741 | Bacteria | 1398 |
| 717 | Ga0501079_0434128 | 3300049741 | Bacteria | 1031 |
| 718 | Ga0501079_0464813 | 3300049741 | Bacteria | 994 |
| 719 | Ga0501080_0000066 | 3300049742 | Bacteria | 68980 |
| 720 | Ga0501080_0009715 | 3300049742 | Bacteria | 8786 |
| 721 | Ga0501080_0030799 | 3300049742 | Bacteria | 4998 |
| 722 | Ga0501080_0063311 | 3300049742 | Bacteria | 3442 |
| 723 | Ga0501080_0120686 | 3300049742 | Bacteria | 2429 |
| 724 | Ga0501080_0121996 | 3300049742 | Bacteria | 2414 |
| 725 | Ga0501080_0374864 | 3300049742 | Unclassified | 1283 |
| 726 | Ga0501080_1177633 | 3300049742 | Bacteria | 660 |
| 727 | Ga0501080_1679303 | 3300049742 | Unclassified | 536 |
| 728 | Ga0501081_0206638 | 3300049743 | Bacteria | 1425 |
| 729 | Ga0501081_0222969 | 3300049743 | Bacteria | 1371 |
| 730 | Ga0501081_0288294 | 3300049743 | Bacteria | 1203 |
| 731 | Ga0501081_0649386 | 3300049743 | Bacteria | 791 |
| 732 | Ga0501081_1496574 | 3300049743 | Bacteria | 513 |
| 733 | Ga0501083_0001749 | 3300049744 | Bacteria | 14815 |
| 734 | Ga0501083_0002515 | 3300049744 | Bacteria | 12592 |
| 735 | Ga0501083_0006852 | 3300049744 | Bacteria | 8087 |
| 736 | Ga0501083_0012510 | 3300049744 | Bacteria | 5936 |
| 737 | Ga0501083_0054470 | 3300049744 | Bacteria | 2684 |
| 738 | Ga0501083_0069480 | 3300049744 | Bacteria | 2343 |
| 739 | Ga0501083_0149468 | 3300049744 | Bacteria | 1529 |
| 740 | Ga0501083_0329579 | 3300049744 | Unclassified | 993 |
| 741 | Ga0501083_0506335 | 3300049744 | Unclassified | 786 |
| 742 | Ga0501035_0031936 | 3300049822 | Bacteria | 4795 |
| 743 | Ga0501035_0061410 | 3300049822 | Bacteria | 3344 |
| 744 | Ga0501035_0159332 | 3300049822 | Unclassified | 1954 |
| 745 | Ga0501035_0342851 | 3300049822 | Bacteria | 1251 |
| 746 | Ga0501035_0563873 | 3300049822 | Unclassified | 931 |
| 747 | Ga0501044_0001594 | 3300049823 | Bacteria | 26547 |
| 748 | Ga0501044_0238192 | 3300049823 | Unclassified | 1764 |
| 749 | Ga0501044_0271441 | 3300049823 | Bacteria | 1631 |
| 750 | Ga0501044_0356773 | 3300049823 | Unclassified | 1380 |
| 751 | Ga0501044_0759088 | 3300049823 | Bacteria | 851 |
| 752 | Ga0501044_0903989 | 3300049823 | Bacteria | 757 |
| 753 | Ga0501044_1072421 | 3300049823 | Bacteria | 675 |
| 754 | Ga0501045_0022232 | 3300049824 | Bacteria | 4539 |
| 755 | Ga0501045_0063925 | 3300049824 | Bacteria | 2701 |
| 756 | Ga0501045_0142947 | 3300049824 | Bacteria | 1779 |
| 757 | Ga0501045_0239586 | 3300049824 | Bacteria | 1350 |
| 758 | Ga0501045_0347006 | 3300049824 | Bacteria | 1105 |
| 759 | nmdc:mga00v17_116254_c2 | 3300050491 | Bacteria | 778 |
| 760 | nmdc:mga00v17_96322_c1 | 3300050491 | Bacteria | 1864 |
| 761 | nmdc:mga0k408_210547_c1 | 3300050493 | Bacteria | 1161 |
| 762 | nmdc:mga0k408_408053_c1 | 3300050493 | Bacteria | 808 |
| 763 | nmdc:mga06z11_19576_c1 | 3300050494 | Bacteria | 3115 |
| 764 | nmdc:mga06z11_354356_c1 | 3300050494 | Bacteria | 879 |
| 765 | nmdc:mga06z11_438119_c1 | 3300050494 | Bacteria | 789 |
| 766 | nmdc:mga06z11_603701_c1 | 3300050494 | Bacteria | 667 |
| 767 | nmdc:mga04h51_317688_c1 | 3300050495 | Unclassified | 638 |
| 768 | nmdc:mga07m45_132337_c1 | 3300050496 | Bacteria | 1443 |
| 769 | nmdc:mga05p37_2011171_c1 | 3300050507 | Unclassified | 546 |
| 770 | nmdc:mga05p37_279912_c1 | 3300050507 | Bacteria | 1990 |
| 771 | nmdc:mga05p37_357078_c1 | 3300050507 | Bacteria | 1719 |
| 772 | nmdc:mga05p37_644084_c1 | 3300050507 | Bacteria | 1188 |
| 773 | nmdc:mga09592_10912_c1 | 3300050508 | Bacteria | 7394 |
| 774 | nmdc:mga09592_198494_c1 | 3300050508 | Unclassified | 1737 |
| 775 | nmdc:mga09592_224489_c1 | 3300050508 | Unclassified | 1627 |
| 776 | nmdc:mga09592_409290_c1 | 3300050508 | Bacteria | 1172 |
| 777 | nmdc:mga09592_55293_c1 | 3300050508 | Bacteria | 3354 |
| 778 | nmdc:mga09592_935973_c1 | 3300050508 | Unclassified | 727 |
| 779 | nmdc:mga09592_970003_c1 | 3300050508 | Unclassified | 712 |
| 780 | nmdc:mga0qj67_125077_c1 | 3300050509 | Bacteria | 2081 |
| 781 | nmdc:mga0qj67_214581_c1 | 3300050509 | Bacteria | 1563 |
| 782 | nmdc:mga0qj67_320605_c1 | 3300050509 | Bacteria | 1254 |
| 783 | nmdc:mga0qj67_325568_c1 | 3300050509 | Bacteria | 1244 |
| 784 | nmdc:mga0qj67_46370_c1 | 3300050509 | Bacteria | 3431 |
| 785 | nmdc:mga0qj67_556308_c1 | 3300050509 | Bacteria | 920 |
| 786 | nmdc:mga06r32_1099877_c1 | 3300050510 | Bacteria | 744 |
| 787 | nmdc:mga06r32_1426417_c1 | 3300050510 | Unclassified | 634 |
| 788 | nmdc:mga06r32_1562411_c1 | 3300050510 | Bacteria | 599 |
| 789 | nmdc:mga06r32_17022_c1 | 3300050510 | Bacteria | 6634 |
| 790 | nmdc:mga06r32_385144_c1 | 3300050510 | Bacteria | 1385 |
| 791 | nmdc:mga06r32_460658_c1 | 3300050510 | Bacteria | 1250 |
| 792 | nmdc:mga06r32_48917_c1 | 3300050510 | Bacteria | 4043 |
| 793 | nmdc:mga06r32_6101_c1 | 3300050510 | Bacteria | 10825 |
| 794 | nmdc:mga06r32_68801_c1 | 3300050510 | Unclassified | 3421 |
| 795 | nmdc:mga06r32_83665_c1 | 3300050510 | Unclassified | 3110 |
| 796 | nmdc:mga08y16_1105092_c1 | 3300050511 | Bacteria | 768 |
| 797 | nmdc:mga08y16_1141618_c1 | 3300050511 | Bacteria | 752 |
| 798 | nmdc:mga08y16_1593027_c1 | 3300050511 | Unclassified | 611 |
| 799 | nmdc:mga08y16_1769022_c1 | 3300050511 | Bacteria | 572 |
| 800 | nmdc:mga08y16_19145_c1 | 3300050511 | Bacteria | 7214 |
| 801 | nmdc:mga08y16_326046_c1 | 3300050511 | Bacteria | 1580 |
| 802 | nmdc:mga08y16_64524_c1 | 3300050511 | Bacteria | 3824 |
| 803 | nmdc:mga0n895_114062_c1 | 3300050512 | Unclassified | 2720 |
| 804 | nmdc:mga0n895_1146829_c1 | 3300050512 | Bacteria | 753 |
| 805 | nmdc:mga0n895_123943_c1 | 3300050512 | Bacteria | 2606 |
| 806 | nmdc:mga0n895_126543_c1 | 3300050512 | Bacteria | 2579 |
| 807 | nmdc:mga0n895_1690_c1 | 3300050512 | Bacteria | 16667 |
| 808 | nmdc:mga0n895_1800123_c1 | 3300050512 | Unclassified | 573 |
| 809 | nmdc:mga0n895_222777_c1 | 3300050512 | Unclassified | 1915 |
| 810 | nmdc:mga0n895_255012_c1 | 3300050512 | Unclassified | 1780 |
| 811 | nmdc:mga0n895_267688_c1 | 3300050512 | Bacteria | 1734 |
| 812 | nmdc:mga0n895_601_c1 | 3300050512 | Bacteria | 24893 |
| 813 | nmdc:mga0n895_899063_c1 | 3300050512 | Unclassified | 871 |
| 814 | nmdc:mga0rr50_101517_c1 | 3300050513 | Bacteria | 2262 |
| 815 | nmdc:mga0rr50_1285601_c1 | 3300050513 | Unclassified | 621 |
| 816 | nmdc:mga0rr50_29683_c1 | 3300050513 | Unclassified | 3860 |
| 817 | nmdc:mga0rr50_29688_c1 | 3300050513 | Bacteria | 3860 |
| 818 | nmdc:mga08x19_17947_c1 | 3300050514 | Bacteria | 4333 |
| 819 | nmdc:mga08x19_738185_c1 | 3300050514 | Unclassified | 699 |
| 820 | nmdc:mga08x19_86543_c1 | 3300050514 | Bacteria | 2064 |
| 821 | nmdc:mga0a205_18351_c1 | 3300050515 | Bacteria | 6575 |
| 822 | nmdc:mga0a205_21859_c1 | 3300050515 | Bacteria | 6050 |
| 823 | nmdc:mga0a205_349196_c1 | 3300050515 | Unclassified | 1347 |
| 824 | nmdc:mga0a205_43073_c1 | 3300050515 | Bacteria | 4352 |
| 825 | nmdc:mga0a205_4479_c1 | 3300050515 | Bacteria | 12539 |
| 826 | nmdc:mga0a205_656954_c1 | 3300050515 | Unclassified | 900 |
| 827 | nmdc:mga0a205_900161_c1 | 3300050515 | Bacteria | 732 |
| 828 | nmdc:mga0a205_9670_c1 | 3300050515 | Bacteria | 8829 |
| 829 | Ga0495601_0945690 | 3300053077 | Unclassified | 543 |
| 830 | Ga0495619_0103029 | 3300053085 | Unclassified | 1944 |
| 831 | Ga0500651_0215093 | 3300053093 | Unclassified | 1129 |
| 832 | Ga0500592_003315 | 3300053116 | Bacteria | 2567 |
| 833 | Ga0500658_0192469 | 3300053134 | Unclassified | 931 |
| 834 | Ga0501084_0015335 | 3300054114 | Bacteria | 6354 |
| 835 | Ga0501084_0071498 | 3300054114 | Bacteria | 2905 |
| 836 | Ga0501084_0078915 | 3300054114 | Bacteria | 2759 |
| 837 | Ga0501084_0177797 | 3300054114 | Bacteria | 1796 |
| 838 | Ga0501084_0257038 | 3300054114 | Bacteria | 1474 |
| 839 | Ga0590071_000384 | 3300059421 | Bacteria | 12975 |
| 840 | Ga0590071_061271 | 3300059421 | Bacteria | 920 |
| 841 | Ga0590074_002233 | 3300059423 | Bacteria | 3176 |
| 842 | Ga0590075_000159 | 3300059424 | Bacteria | 18375 |
| 843 | Ga0590075_024801 | 3300059424 | Unclassified | 1506 |
| 844 | Ga0590075_040702 | 3300059424 | Bacteria | 1188 |
| 845 | Ga0590077_000408 | 3300059426 | Bacteria | 12051 |
| 846 | Ga0590077_105449 | 3300059426 | Bacteria | 661 |
| 847 | Ga0590077_148215 | 3300059426 | Bacteria | 561 |
| 848 | Ga0501082_0042454 | 3300060353 | Bacteria | 3921 |
| 849 | Ga0501082_0048845 | 3300060353 | Bacteria | 3647 |
| 850 | Ga0501082_0126210 | 3300060353 | Bacteria | 2219 |
| 851 | Ga0501082_0263433 | 3300060353 | Bacteria | 1499 |
| 852 | Ga0501082_0268925 | 3300060353 | Bacteria | 1483 |
| 853 | Ga0501082_0287132 | 3300060353 | Bacteria | 1432 |
| 854 | Ga0501082_0383601 | 3300060353 | Bacteria | 1226 |
| 855 | Ga0501082_0802020 | 3300060353 | Bacteria | 824 |
| 856 | Ga0501082_1763343 | 3300060353 | Bacteria | 540 |
| 857 | Ga0530510_0126736 | 3300061734 | Bacteria | 1877 |
| 858 | Ga0530510_0214549 | 3300061734 | Unclassified | 1430 |
| 859 | Ga0530510_0684154 | 3300061734 | Unclassified | 781 |
| 860 | Ga0530510_0765871 | 3300061734 | Bacteria | 736 |
| 861 | Ga0530510_0898238 | 3300061734 | Bacteria | 677 |
| 862 | Ga0530510_0899995 | 3300061734 | Bacteria | 676 |
| 863 | Ga0530510_1447222 | 3300061734 | Bacteria | 527 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300050511 | nmdc:mga08y16_1141618_c1 | nmdc:mga08y16_1141618_c1_409_735 | 108 |
| 2 | 3300005444 | Ga0070694_101525941 | Ga0070694_1015259412 | 109 |
| 3 | 3300005518 | Ga0070699_100444953 | Ga0070699_1004449532 | 109 |
| 4 | 3300005549 | Ga0070704_100109520 | Ga0070704_1001095202 | 109 |
| 5 | 3300006852 | Ga0075433_10409100 | Ga0075433_104091001 | 109 |
| 6 | 3300006871 | Ga0075434_100653631 | Ga0075434_1006536312 | 109 |
| 7 | 3300025910 | Ga0207684_10289581 | Ga0207684_102895812 | 109 |
| 8 | 3300049584 | Ga0501068_1161999 | Ga0501068_1161999_39_368 | 109 |
| 9 | 3300050512 | nmdc:mga0n895_899063_c1 | nmdc:mga0n895_899063_c1_152_481 | 109 |
| 10 | 3300050515 | nmdc:mga0a205_9670_c1 | nmdc:mga0a205_9670_c1_4688_5017 | 109 |
| 11 | 3300053077 | Ga0495601_0945690 | Ga0495601_0945690_39_368 | 109 |
| 12 | 3300053085 | Ga0495619_0103029 | Ga0495619_0103029_362_691 | 109 |
| 13 | 3300005434 | Ga0070709_10028947 | Ga0070709_100289472 | 110 |
| 14 | 3300005434 | Ga0070709_10036144 | Ga0070709_100361441 | 110 |
| 15 | 3300005435 | Ga0070714_100013094 | Ga0070714_1000130947 | 110 |
| 16 | 3300005435 | Ga0070714_100023917 | Ga0070714_1000239174 | 110 |
| 17 | 3300005436 | Ga0070713_100000276 | Ga0070713_10000027630 | 110 |
| 18 | 3300005436 | Ga0070713_100006548 | Ga0070713_1000065484 | 110 |
| 19 | 3300005436 | Ga0070713_100024802 | Ga0070713_1000248023 | 110 |
| 20 | 3300005437 | Ga0070710_10267658 | Ga0070710_102676582 | 110 |
| 21 | 3300005439 | Ga0070711_100151258 | Ga0070711_1001512582 | 110 |
| 22 | 3300005439 | Ga0070711_101424058 | Ga0070711_1014240582 | 110 |
| 23 | 3300005458 | Ga0070681_10011895 | Ga0070681_100118954 | 110 |
| 24 | 3300005530 | Ga0070679_100090740 | Ga0070679_1000907402 | 110 |
| 25 | 3300005545 | Ga0070695_101328660 | Ga0070695_1013286601 | 110 |
| 26 | 3300005547 | Ga0070693_100014197 | Ga0070693_1000141974 | 110 |
| 27 | 3300006028 | Ga0070717_10002821 | Ga0070717_100028214 | 110 |
| 28 | 3300006028 | Ga0070717_10171904 | Ga0070717_101719044 | 110 |
| 29 | 3300006175 | Ga0070712_100009439 | Ga0070712_1000094393 | 110 |
| 30 | 3300006175 | Ga0070712_100615416 | Ga0070712_1006154162 | 110 |
| 31 | 3300006175 | Ga0070712_101744840 | Ga0070712_1017448401 | 110 |
| 32 | 3300006237 | Ga0097621_100401611 | Ga0097621_1004016112 | 110 |
| 33 | 3300006358 | Ga0068871_100875964 | Ga0068871_1008759642 | 110 |
| 34 | 3300006871 | Ga0075434_101666373 | Ga0075434_1016663732 | 110 |
| 35 | 3300013100 | Ga0157373_11268816 | Ga0157373_112688161 | 110 |
| 36 | 3300013105 | Ga0157369_10580049 | Ga0157369_105800492 | 110 |
| 37 | 3300013307 | Ga0157372_11402433 | Ga0157372_114024332 | 110 |
| 38 | 3300025898 | Ga0207692_10029987 | Ga0207692_100299872 | 110 |
| 39 | 3300025903 | Ga0207680_10109105 | Ga0207680_101091052 | 110 |
| 40 | 3300025906 | Ga0207699_10019009 | Ga0207699_100190091 | 110 |
| 41 | 3300025906 | Ga0207699_10032073 | Ga0207699_100320732 | 110 |
| 42 | 3300025906 | Ga0207699_10446822 | Ga0207699_104468222 | 110 |
| 43 | 3300025912 | Ga0207707_10041446 | Ga0207707_100414462 | 110 |
| 44 | 3300025915 | Ga0207693_10009463 | Ga0207693_100094634 | 110 |
| 45 | 3300025915 | Ga0207693_10472113 | Ga0207693_104721132 | 110 |
| 46 | 3300025916 | Ga0207663_10117773 | Ga0207663_101177732 | 110 |
| 47 | 3300025928 | Ga0207700_10004627 | Ga0207700_100046274 | 110 |
| 48 | 3300025928 | Ga0207700_10040378 | Ga0207700_100403783 | 110 |
| 49 | 3300025928 | Ga0207700_10161575 | Ga0207700_101615752 | 110 |
| 50 | 3300025929 | Ga0207664_10016111 | Ga0207664_100161117 | 110 |
| 51 | 3300025939 | Ga0207665_10852205 | Ga0207665_108522051 | 110 |
| 52 | 3300025961 | Ga0207712_10297894 | Ga0207712_102978942 | 110 |
| 53 | 3300026078 | Ga0207702_11280217 | Ga0207702_112802172 | 110 |
| 54 | 3300026118 | Ga0207675_102137051 | Ga0207675_1021370512 | 110 |
| 55 | 3300031852 | Ga0307410_10121419 | Ga0307410_101214192 | 110 |
| 56 | 3300032126 | Ga0307415_100337760 | Ga0307415_1003377602 | 110 |
| 57 | 3300036401 | Ga0373937_0479205 | Ga0373937_0479205_428_760 | 110 |
| 58 | 3300045051 | Ga0451576_0475306 | Ga0451576_0475306_62_394 | 110 |
| 59 | 3300049568 | Ga0501031_0742192 | Ga0501031_0742192_43_375 | 110 |
| 60 | 3300049575 | Ga0501039_0446318 | Ga0501039_0446318_590_922 | 110 |
| 61 | 3300049578 | Ga0501042_0200680 | Ga0501042_0200680_1048_1380 | 110 |
| 62 | 3300049588 | Ga0501072_0182396 | Ga0501072_0182396_1045_1377 | 110 |
| 63 | 3300049591 | Ga0501075_1504680 | Ga0501075_1504680_140_472 | 110 |
| 64 | 3300050512 | nmdc:mga0n895_1146829_c1 | nmdc:mga0n895_1146829_c1_227_559 | 110 |
| 65 | 3300005290 | Ga0065712_10061041 | Ga0065712_100610411 | 111 |
| 66 | 3300005293 | Ga0065715_10675999 | Ga0065715_106759992 | 111 |
| 67 | 3300005331 | Ga0070670_102243175 | Ga0070670_1022431751 | 111 |
| 68 | 3300005347 | Ga0070668_101268242 | Ga0070668_1012682421 | 111 |
| 69 | 3300005356 | Ga0070674_100666888 | Ga0070674_1006668882 | 111 |
| 70 | 3300005456 | Ga0070678_101000520 | Ga0070678_1010005201 | 111 |
| 71 | 3300005577 | Ga0068857_102250858 | Ga0068857_1022508582 | 111 |
| 72 | 3300009093 | Ga0105240_10896218 | Ga0105240_108962181 | 111 |
| 73 | 3300009094 | Ga0111539_10017483 | Ga0111539_100174832 | 111 |
| 74 | 3300009094 | Ga0111539_10417082 | Ga0111539_104170823 | 111 |
| 75 | 3300009094 | Ga0111539_12630887 | Ga0111539_126308871 | 111 |
| 76 | 3300009551 | Ga0105238_10353079 | Ga0105238_103530792 | 111 |
| 77 | 3300014326 | Ga0157380_10295676 | Ga0157380_102956762 | 111 |
| 78 | 3300014326 | Ga0157380_12541842 | Ga0157380_125418421 | 111 |
| 79 | 3300025893 | Ga0207682_10446706 | Ga0207682_104467062 | 111 |
| 80 | 3300025913 | Ga0207695_11565461 | Ga0207695_115654611 | 111 |
| 81 | 3300025925 | Ga0207650_11743144 | Ga0207650_117431441 | 111 |
| 82 | 3300025933 | Ga0207706_10208048 | Ga0207706_102080483 | 111 |
| 83 | 3300025937 | Ga0207669_10024450 | Ga0207669_100244503 | 111 |
| 84 | 3300025945 | Ga0207679_11941937 | Ga0207679_119419371 | 111 |
| 85 | 3300026116 | Ga0207674_11348640 | Ga0207674_113486402 | 111 |
| 86 | 3300026118 | Ga0207675_101370530 | Ga0207675_1013705302 | 111 |
| 87 | 3300027907 | Ga0207428_10227018 | Ga0207428_102270182 | 111 |
| 88 | 3300048906 | Ga0496103_0830201 | Ga0496103_0830201_198_533 | 111 |
| 89 | 3300048913 | Ga0496110_1842731 | Ga0496110_1842731_167_502 | 111 |
| 90 | 3300050511 | nmdc:mga08y16_1769022_c1 | nmdc:mga08y16_1769022_c1_75_410 | 111 |
| 91 | 3300002459 | JGI24751J29686_10137353 | JGI24751J29686_101373531 | 112 |
| 92 | 3300005290 | Ga0065712_10117350 | Ga0065712_101173502 | 112 |
| 93 | 3300005290 | Ga0065712_10138845 | Ga0065712_101388452 | 112 |
| 94 | 3300005293 | Ga0065715_10001128 | Ga0065715_100011283 | 112 |
| 95 | 3300005293 | Ga0065715_10123887 | Ga0065715_101238872 | 112 |
| 96 | 3300005293 | Ga0065715_10302846 | Ga0065715_103028461 | 112 |
| 97 | 3300005293 | Ga0065715_10524539 | Ga0065715_105245391 | 112 |
| 98 | 3300005293 | Ga0065715_10651255 | Ga0065715_106512552 | 112 |
| 99 | 3300005295 | Ga0065707_10800383 | Ga0065707_108003831 | 112 |
| 100 | 3300005328 | Ga0070676_10085582 | Ga0070676_100855822 | 112 |
| 101 | 3300005328 | Ga0070676_10968838 | Ga0070676_109688381 | 112 |
| 102 | 3300005329 | Ga0070683_100000832 | Ga0070683_10000083210 | 112 |
| 103 | 3300005329 | Ga0070683_100804181 | Ga0070683_1008041812 | 112 |
| 104 | 3300005330 | Ga0070690_100153369 | Ga0070690_1001533693 | 112 |
| 105 | 3300005330 | Ga0070690_100168592 | Ga0070690_1001685923 | 112 |
| 106 | 3300005331 | Ga0070670_100014534 | Ga0070670_1000145342 | 112 |
| 107 | 3300005331 | Ga0070670_100025765 | Ga0070670_1000257652 | 112 |
| 108 | 3300005333 | Ga0070677_10784076 | Ga0070677_107840761 | 112 |
| 109 | 3300005334 | Ga0068869_100136452 | Ga0068869_1001364522 | 112 |
| 110 | 3300005334 | Ga0068869_100156175 | Ga0068869_1001561752 | 112 |
| 111 | 3300005335 | Ga0070666_10038638 | Ga0070666_100386384 | 112 |
| 112 | 3300005335 | Ga0070666_10353254 | Ga0070666_103532542 | 112 |
| 113 | 3300005335 | Ga0070666_10821892 | Ga0070666_108218922 | 112 |
| 114 | 3300005336 | Ga0070680_101660081 | Ga0070680_1016600811 | 112 |
| 115 | 3300005338 | Ga0068868_100220579 | Ga0068868_1002205792 | 112 |
| 116 | 3300005339 | Ga0070660_100923913 | Ga0070660_1009239132 | 112 |
| 117 | 3300005340 | Ga0070689_100013867 | Ga0070689_1000138672 | 112 |
| 118 | 3300005340 | Ga0070689_100255788 | Ga0070689_1002557883 | 112 |
| 119 | 3300005340 | Ga0070689_100363593 | Ga0070689_1003635932 | 112 |
| 120 | 3300005340 | Ga0070689_100832107 | Ga0070689_1008321071 | 112 |
| 121 | 3300005343 | Ga0070687_100316301 | Ga0070687_1003163011 | 112 |
| 122 | 3300005344 | Ga0070661_101785628 | Ga0070661_1017856281 | 112 |
| 123 | 3300005345 | Ga0070692_10068662 | Ga0070692_100686623 | 112 |
| 124 | 3300005347 | Ga0070668_100707830 | Ga0070668_1007078302 | 112 |
| 125 | 3300005353 | Ga0070669_100015181 | Ga0070669_1000151816 | 112 |
| 126 | 3300005353 | Ga0070669_100074209 | Ga0070669_1000742092 | 112 |
| 127 | 3300005353 | Ga0070669_100470418 | Ga0070669_1004704181 | 112 |
| 128 | 3300005353 | Ga0070669_101053549 | Ga0070669_1010535492 | 112 |
| 129 | 3300005354 | Ga0070675_100393893 | Ga0070675_1003938932 | 112 |
| 130 | 3300005354 | Ga0070675_100877263 | Ga0070675_1008772631 | 112 |
| 131 | 3300005354 | Ga0070675_101384746 | Ga0070675_1013847461 | 112 |
| 132 | 3300005355 | Ga0070671_100048909 | Ga0070671_1000489094 | 112 |
| 133 | 3300005355 | Ga0070671_100255261 | Ga0070671_1002552613 | 112 |
| 134 | 3300005356 | Ga0070674_100461051 | Ga0070674_1004610512 | 112 |
| 135 | 3300005356 | Ga0070674_101500819 | Ga0070674_1015008192 | 112 |
| 136 | 3300005364 | Ga0070673_100001105 | Ga0070673_1000011059 | 112 |
| 137 | 3300005364 | Ga0070673_100018616 | Ga0070673_1000186164 | 112 |
| 138 | 3300005364 | Ga0070673_100150629 | Ga0070673_1001506292 | 112 |
| 139 | 3300005365 | Ga0070688_100177557 | Ga0070688_1001775572 | 112 |
| 140 | 3300005365 | Ga0070688_100453550 | Ga0070688_1004535501 | 112 |
| 141 | 3300005366 | Ga0070659_100512630 | Ga0070659_1005126302 | 112 |
| 142 | 3300005366 | Ga0070659_100640396 | Ga0070659_1006403962 | 112 |
| 143 | 3300005367 | Ga0070667_100068417 | Ga0070667_1000684173 | 112 |
| 144 | 3300005367 | Ga0070667_100301508 | Ga0070667_1003015081 | 112 |
| 145 | 3300005367 | Ga0070667_100399345 | Ga0070667_1003993453 | 112 |
| 146 | 3300005367 | Ga0070667_101131373 | Ga0070667_1011313731 | 112 |
| 147 | 3300005367 | Ga0070667_101509873 | Ga0070667_1015098732 | 112 |
| 148 | 3300005436 | Ga0070713_100017861 | Ga0070713_1000178613 | 112 |
| 149 | 3300005436 | Ga0070713_100036881 | Ga0070713_1000368812 | 112 |
| 150 | 3300005438 | Ga0070701_10186771 | Ga0070701_101867713 | 112 |
| 151 | 3300005438 | Ga0070701_10666419 | Ga0070701_106664192 | 112 |
| 152 | 3300005440 | Ga0070705_101390613 | Ga0070705_1013906131 | 112 |
| 153 | 3300005440 | Ga0070705_101882899 | Ga0070705_1018828991 | 112 |
| 154 | 3300005441 | Ga0070700_100291943 | Ga0070700_1002919433 | 112 |
| 155 | 3300005441 | Ga0070700_101005758 | Ga0070700_1010057582 | 112 |
| 156 | 3300005441 | Ga0070700_101046325 | Ga0070700_1010463251 | 112 |
| 157 | 3300005444 | Ga0070694_100024733 | Ga0070694_1000247332 | 112 |
| 158 | 3300005444 | Ga0070694_100105838 | Ga0070694_1001058383 | 112 |
| 159 | 3300005444 | Ga0070694_100330513 | Ga0070694_1003305133 | 112 |
| 160 | 3300005444 | Ga0070694_100764114 | Ga0070694_1007641142 | 112 |
| 161 | 3300005444 | Ga0070694_101668819 | Ga0070694_1016688191 | 112 |
| 162 | 3300005455 | Ga0070663_100140159 | Ga0070663_1001401592 | 112 |
| 163 | 3300005455 | Ga0070663_100778677 | Ga0070663_1007786772 | 112 |
| 164 | 3300005456 | Ga0070678_100223233 | Ga0070678_1002232334 | 112 |
| 165 | 3300005456 | Ga0070678_100554796 | Ga0070678_1005547962 | 112 |
| 166 | 3300005456 | Ga0070678_100658578 | Ga0070678_1006585783 | 112 |
| 167 | 3300005457 | Ga0070662_100056066 | Ga0070662_1000560661 | 112 |
| 168 | 3300005458 | Ga0070681_11048105 | Ga0070681_110481051 | 112 |
| 169 | 3300005459 | Ga0068867_100458250 | Ga0068867_1004582502 | 112 |
| 170 | 3300005466 | Ga0070685_10355289 | Ga0070685_103552891 | 112 |
| 171 | 3300005466 | Ga0070685_10446532 | Ga0070685_104465322 | 112 |
| 172 | 3300005466 | Ga0070685_11511349 | Ga0070685_115113491 | 112 |
| 173 | 3300005467 | Ga0070706_100620631 | Ga0070706_1006206312 | 112 |
| 174 | 3300005467 | Ga0070706_100668713 | Ga0070706_1006687131 | 112 |
| 175 | 3300005468 | Ga0070707_100013913 | Ga0070707_1000139132 | 112 |
| 176 | 3300005468 | Ga0070707_100164488 | Ga0070707_1001644881 | 112 |
| 177 | 3300005468 | Ga0070707_100529847 | Ga0070707_1005298472 | 112 |
| 178 | 3300005471 | Ga0070698_100530657 | Ga0070698_1005306571 | 112 |
| 179 | 3300005518 | Ga0070699_100425906 | Ga0070699_1004259061 | 112 |
| 180 | 3300005518 | Ga0070699_101253786 | Ga0070699_1012537861 | 112 |
| 181 | 3300005530 | Ga0070679_100628379 | Ga0070679_1006283792 | 112 |
| 182 | 3300005535 | Ga0070684_100000427 | Ga0070684_10000042710 | 112 |
| 183 | 3300005536 | Ga0070697_100043629 | Ga0070697_1000436291 | 112 |
| 184 | 3300005536 | Ga0070697_100321164 | Ga0070697_1003211642 | 112 |
| 185 | 3300005536 | Ga0070697_100388571 | Ga0070697_1003885712 | 112 |
| 186 | 3300005543 | Ga0070672_100013022 | Ga0070672_1000130223 | 112 |
| 187 | 3300005543 | Ga0070672_100064072 | Ga0070672_1000640724 | 112 |
| 188 | 3300005543 | Ga0070672_100305284 | Ga0070672_1003052842 | 112 |
| 189 | 3300005544 | Ga0070686_100908773 | Ga0070686_1009087732 | 112 |
| 190 | 3300005544 | Ga0070686_101130098 | Ga0070686_1011300982 | 112 |
| 191 | 3300005545 | Ga0070695_100074645 | Ga0070695_1000746452 | 112 |
| 192 | 3300005545 | Ga0070695_100284809 | Ga0070695_1002848091 | 112 |
| 193 | 3300005546 | Ga0070696_100051203 | Ga0070696_1000512032 | 112 |
| 194 | 3300005547 | Ga0070693_100139831 | Ga0070693_1001398312 | 112 |
| 195 | 3300005548 | Ga0070665_101003037 | Ga0070665_1010030372 | 112 |
| 196 | 3300005549 | Ga0070704_100036621 | Ga0070704_1000366212 | 112 |
| 197 | 3300005549 | Ga0070704_100296616 | Ga0070704_1002966162 | 112 |
| 198 | 3300005549 | Ga0070704_100309211 | Ga0070704_1003092112 | 112 |
| 199 | 3300005564 | Ga0070664_100000731 | Ga0070664_1000007318 | 112 |
| 200 | 3300005564 | Ga0070664_100043243 | Ga0070664_1000432432 | 112 |
| 201 | 3300005577 | Ga0068857_100974362 | Ga0068857_1009743622 | 112 |
| 202 | 3300005578 | Ga0068854_100222012 | Ga0068854_1002220123 | 112 |
| 203 | 3300005614 | Ga0068856_102677994 | Ga0068856_1026779941 | 112 |
| 204 | 3300005615 | Ga0070702_100084248 | Ga0070702_1000842483 | 112 |
| 205 | 3300005615 | Ga0070702_101744119 | Ga0070702_1017441191 | 112 |
| 206 | 3300005616 | Ga0068852_100163983 | Ga0068852_1001639832 | 112 |
| 207 | 3300005616 | Ga0068852_100694084 | Ga0068852_1006940841 | 112 |
| 208 | 3300005617 | Ga0068859_100001429 | Ga0068859_1000014298 | 112 |
| 209 | 3300005617 | Ga0068859_100016773 | Ga0068859_1000167732 | 112 |
| 210 | 3300005617 | Ga0068859_101233776 | Ga0068859_1012337762 | 112 |
| 211 | 3300005617 | Ga0068859_101484463 | Ga0068859_1014844631 | 112 |
| 212 | 3300005617 | Ga0068859_102513639 | Ga0068859_1025136392 | 112 |
| 213 | 3300005618 | Ga0068864_100077964 | Ga0068864_1000779644 | 112 |
| 214 | 3300005618 | Ga0068864_102235240 | Ga0068864_1022352401 | 112 |
| 215 | 3300005719 | Ga0068861_100634070 | Ga0068861_1006340702 | 112 |
| 216 | 3300005719 | Ga0068861_100912536 | Ga0068861_1009125362 | 112 |
| 217 | 3300005719 | Ga0068861_101047229 | Ga0068861_1010472293 | 112 |
| 218 | 3300005834 | Ga0068851_10450310 | Ga0068851_104503102 | 112 |
| 219 | 3300005840 | Ga0068870_10000669 | Ga0068870_100006692 | 112 |
| 220 | 3300005840 | Ga0068870_10374185 | Ga0068870_103741852 | 112 |
| 221 | 3300005841 | Ga0068863_100042493 | Ga0068863_1000424932 | 112 |
| 222 | 3300005842 | Ga0068858_100048964 | Ga0068858_1000489644 | 112 |
| 223 | 3300005842 | Ga0068858_100264248 | Ga0068858_1002642482 | 112 |
| 224 | 3300005842 | Ga0068858_100325416 | Ga0068858_1003254162 | 112 |
| 225 | 3300005842 | Ga0068858_102421161 | Ga0068858_1024211611 | 112 |
| 226 | 3300005843 | Ga0068860_100141594 | Ga0068860_1001415944 | 112 |
| 227 | 3300005843 | Ga0068860_100830947 | Ga0068860_1008309472 | 112 |
| 228 | 3300005843 | Ga0068860_100958117 | Ga0068860_1009581172 | 112 |
| 229 | 3300005844 | Ga0068862_100099912 | Ga0068862_1000999123 | 112 |
| 230 | 3300005844 | Ga0068862_100301953 | Ga0068862_1003019532 | 112 |
| 231 | 3300005844 | Ga0068862_100678580 | Ga0068862_1006785802 | 112 |
| 232 | 3300005844 | Ga0068862_100686850 | Ga0068862_1006868502 | 112 |
| 233 | 3300005844 | Ga0068862_100996291 | Ga0068862_1009962912 | 112 |
| 234 | 3300005844 | Ga0068862_102241212 | Ga0068862_1022412122 | 112 |
| 235 | 3300005981 | Ga0081538_10104056 | Ga0081538_101040562 | 112 |
| 236 | 3300006028 | Ga0070717_11984857 | Ga0070717_119848571 | 112 |
| 237 | 3300006042 | Ga0075368_10418065 | Ga0075368_104180652 | 112 |
| 238 | 3300006051 | Ga0075364_10006284 | Ga0075364_100062841 | 112 |
| 239 | 3300006051 | Ga0075364_10011345 | Ga0075364_100113452 | 112 |
| 240 | 3300006058 | Ga0075432_10183894 | Ga0075432_101838941 | 112 |
| 241 | 3300006173 | Ga0070716_100265779 | Ga0070716_1002657791 | 112 |
| 242 | 3300006178 | Ga0075367_10011729 | Ga0075367_100117292 | 112 |
| 243 | 3300006178 | Ga0075367_10030938 | Ga0075367_100309382 | 112 |
| 244 | 3300006178 | Ga0075367_10480756 | Ga0075367_104807562 | 112 |
| 245 | 3300006195 | Ga0075366_10172475 | Ga0075366_101724752 | 112 |
| 246 | 3300006237 | Ga0097621_100485205 | Ga0097621_1004852052 | 112 |
| 247 | 3300006353 | Ga0075370_10144472 | Ga0075370_101444721 | 112 |
| 248 | 3300006358 | Ga0068871_100492020 | Ga0068871_1004920202 | 112 |
| 249 | 3300006358 | Ga0068871_100596804 | Ga0068871_1005968042 | 112 |
| 250 | 3300006844 | Ga0075428_100007041 | Ga0075428_1000070418 | 112 |
| 251 | 3300006844 | Ga0075428_100178199 | Ga0075428_1001781992 | 112 |
| 252 | 3300006844 | Ga0075428_100352484 | Ga0075428_1003524842 | 112 |
| 253 | 3300006844 | Ga0075428_100547472 | Ga0075428_1005474722 | 112 |
| 254 | 3300006844 | Ga0075428_100988703 | Ga0075428_1009887032 | 112 |
| 255 | 3300006844 | Ga0075428_102083363 | Ga0075428_1020833632 | 112 |
| 256 | 3300006844 | Ga0075428_102635010 | Ga0075428_1026350101 | 112 |
| 257 | 3300006846 | Ga0075430_100029162 | Ga0075430_1000291624 | 112 |
| 258 | 3300006846 | Ga0075430_100031688 | Ga0075430_1000316884 | 112 |
| 259 | 3300006846 | Ga0075430_100165204 | Ga0075430_1001652042 | 112 |
| 260 | 3300006846 | Ga0075430_100173353 | Ga0075430_1001733533 | 112 |
| 261 | 3300006847 | Ga0075431_100031245 | Ga0075431_1000312452 | 112 |
| 262 | 3300006847 | Ga0075431_100033158 | Ga0075431_1000331582 | 112 |
| 263 | 3300006847 | Ga0075431_100036754 | Ga0075431_1000367544 | 112 |
| 264 | 3300006847 | Ga0075431_100038962 | Ga0075431_1000389622 | 112 |
| 265 | 3300006847 | Ga0075431_100105320 | Ga0075431_1001053203 | 112 |
| 266 | 3300006847 | Ga0075431_100244967 | Ga0075431_1002449672 | 112 |
| 267 | 3300006847 | Ga0075431_100535496 | Ga0075431_1005354962 | 112 |
| 268 | 3300006847 | Ga0075431_100596799 | Ga0075431_1005967991 | 112 |
| 269 | 3300006852 | Ga0075433_10000279 | Ga0075433_100002797 | 112 |
| 270 | 3300006852 | Ga0075433_10040561 | Ga0075433_100405612 | 112 |
| 271 | 3300006852 | Ga0075433_10052431 | Ga0075433_100524312 | 112 |
| 272 | 3300006852 | Ga0075433_10059212 | Ga0075433_100592122 | 112 |
| 273 | 3300006852 | Ga0075433_10063057 | Ga0075433_100630572 | 112 |
| 274 | 3300006852 | Ga0075433_10646202 | Ga0075433_106462022 | 112 |
| 275 | 3300006852 | Ga0075433_10724630 | Ga0075433_107246302 | 112 |
| 276 | 3300006852 | Ga0075433_10810332 | Ga0075433_108103322 | 112 |
| 277 | 3300006871 | Ga0075434_100026219 | Ga0075434_1000262193 | 112 |
| 278 | 3300006871 | Ga0075434_100029167 | Ga0075434_1000291674 | 112 |
| 279 | 3300006871 | Ga0075434_100100713 | Ga0075434_1001007132 | 112 |
| 280 | 3300006871 | Ga0075434_100106612 | Ga0075434_1001066121 | 112 |
| 281 | 3300006871 | Ga0075434_100114576 | Ga0075434_1001145762 | 112 |
| 282 | 3300006871 | Ga0075434_100137340 | Ga0075434_1001373402 | 112 |
| 283 | 3300006871 | Ga0075434_100273015 | Ga0075434_1002730152 | 112 |
| 284 | 3300006871 | Ga0075434_100321405 | Ga0075434_1003214053 | 112 |
| 285 | 3300006871 | Ga0075434_102439559 | Ga0075434_1024395591 | 112 |
| 286 | 3300006880 | Ga0075429_100017403 | Ga0075429_1000174032 | 112 |
| 287 | 3300006880 | Ga0075429_100058872 | Ga0075429_1000588722 | 112 |
| 288 | 3300006880 | Ga0075429_100183005 | Ga0075429_1001830052 | 112 |
| 289 | 3300006880 | Ga0075429_100210068 | Ga0075429_1002100682 | 112 |
| 290 | 3300006880 | Ga0075429_100563635 | Ga0075429_1005636352 | 112 |
| 291 | 3300006880 | Ga0075429_101108276 | Ga0075429_1011082761 | 112 |
| 292 | 3300006880 | Ga0075429_101195675 | Ga0075429_1011956751 | 112 |
| 293 | 3300006880 | Ga0075429_101885216 | Ga0075429_1018852162 | 112 |
| 294 | 3300006881 | Ga0068865_100275308 | Ga0068865_1002753082 | 112 |
| 295 | 3300006881 | Ga0068865_100381594 | Ga0068865_1003815941 | 112 |
| 296 | 3300006881 | Ga0068865_101023268 | Ga0068865_1010232681 | 112 |
| 297 | 3300006914 | Ga0075436_100007526 | Ga0075436_1000075262 | 112 |
| 298 | 3300006914 | Ga0075436_100031348 | Ga0075436_1000313482 | 112 |
| 299 | 3300006931 | Ga0097620_100001429 | Ga0097620_1000014298 | 112 |
| 300 | 3300006931 | Ga0097620_100016773 | Ga0097620_1000167736 | 112 |
| 301 | 3300006931 | Ga0097620_101233685 | Ga0097620_1012336852 | 112 |
| 302 | 3300006931 | Ga0097620_101484366 | Ga0097620_1014843661 | 112 |
| 303 | 3300006931 | Ga0097620_102514517 | Ga0097620_1025145171 | 112 |
| 304 | 3300007076 | Ga0075435_100036693 | Ga0075435_1000366934 | 112 |
| 305 | 3300007076 | Ga0075435_100091898 | Ga0075435_1000918981 | 112 |
| 306 | 3300007076 | Ga0075435_100183876 | Ga0075435_1001838762 | 112 |
| 307 | 3300007076 | Ga0075435_100451952 | Ga0075435_1004519521 | 112 |
| 308 | 3300007076 | Ga0075435_101625679 | Ga0075435_1016256791 | 112 |
| 309 | 3300009094 | Ga0111539_10040893 | Ga0111539_100408932 | 112 |
| 310 | 3300009094 | Ga0111539_10671305 | Ga0111539_106713052 | 112 |
| 311 | 3300009094 | Ga0111539_10711407 | Ga0111539_107114072 | 112 |
| 312 | 3300009094 | Ga0111539_10945632 | Ga0111539_109456322 | 112 |
| 313 | 3300009094 | Ga0111539_10954090 | Ga0111539_109540902 | 112 |
| 314 | 3300009094 | Ga0111539_11262530 | Ga0111539_112625302 | 112 |
| 315 | 3300009094 | Ga0111539_11919620 | Ga0111539_119196201 | 112 |
| 316 | 3300009094 | Ga0111539_12548858 | Ga0111539_125488582 | 112 |
| 317 | 3300009098 | Ga0105245_10158176 | Ga0105245_101581762 | 112 |
| 318 | 3300009101 | Ga0105247_10033797 | Ga0105247_100337972 | 112 |
| 319 | 3300009147 | Ga0114129_10039797 | Ga0114129_100397972 | 112 |
| 320 | 3300009147 | Ga0114129_10471701 | Ga0114129_104717012 | 112 |
| 321 | 3300009147 | Ga0114129_10490864 | Ga0114129_104908642 | 112 |
| 322 | 3300009147 | Ga0114129_10531662 | Ga0114129_105316624 | 112 |
| 323 | 3300009147 | Ga0114129_11039190 | Ga0114129_110391901 | 112 |
| 324 | 3300009147 | Ga0114129_12417804 | Ga0114129_124178042 | 112 |
| 325 | 3300009148 | Ga0105243_10560969 | Ga0105243_105609692 | 112 |
| 326 | 3300009174 | Ga0105241_10646842 | Ga0105241_106468422 | 112 |
| 327 | 3300009174 | Ga0105241_10860684 | Ga0105241_108606842 | 112 |
| 328 | 3300009177 | Ga0105248_10061019 | Ga0105248_100610195 | 112 |
| 329 | 3300009177 | Ga0105248_10103747 | Ga0105248_101037472 | 112 |
| 330 | 3300009545 | Ga0105237_11192059 | Ga0105237_111920592 | 112 |
| 331 | 3300009551 | Ga0105238_11034304 | Ga0105238_110343041 | 112 |
| 332 | 3300009553 | Ga0105249_10026632 | Ga0105249_100266326 | 112 |
| 333 | 3300009553 | Ga0105249_10191348 | Ga0105249_101913482 | 112 |
| 334 | 3300009553 | Ga0105249_10443888 | Ga0105249_104438882 | 112 |
| 335 | 3300009553 | Ga0105249_10777768 | Ga0105249_107777681 | 112 |
| 336 | 3300009553 | Ga0105249_11148179 | Ga0105249_111481792 | 112 |
| 337 | 3300009553 | Ga0105249_12410352 | Ga0105249_124103521 | 112 |
| 338 | 3300010375 | Ga0105239_13577520 | Ga0105239_135775201 | 112 |
| 339 | 3300012485 | Ga0157325_1020697 | Ga0157325_10206971 | 112 |
| 340 | 3300013100 | Ga0157373_10968953 | Ga0157373_109689532 | 112 |
| 341 | 3300013102 | Ga0157371_11581429 | Ga0157371_115814291 | 112 |
| 342 | 3300013296 | Ga0157374_11162589 | Ga0157374_111625891 | 112 |
| 343 | 3300013297 | Ga0157378_10692872 | Ga0157378_106928722 | 112 |
| 344 | 3300013306 | Ga0163162_10052692 | Ga0163162_100526921 | 112 |
| 345 | 3300013306 | Ga0163162_10650907 | Ga0163162_106509072 | 112 |
| 346 | 3300013306 | Ga0163162_11884987 | Ga0163162_118849871 | 112 |
| 347 | 3300013308 | Ga0157375_10383508 | Ga0157375_103835082 | 112 |
| 348 | 3300013308 | Ga0157375_11122950 | Ga0157375_111229502 | 112 |
| 349 | 3300013308 | Ga0157375_11135958 | Ga0157375_111359582 | 112 |
| 350 | 3300013308 | Ga0157375_13247229 | Ga0157375_132472291 | 112 |
| 351 | 3300014325 | Ga0163163_10017852 | Ga0163163_100178525 | 112 |
| 352 | 3300014325 | Ga0163163_10289507 | Ga0163163_102895072 | 112 |
| 353 | 3300014325 | Ga0163163_12477689 | Ga0163163_124776892 | 112 |
| 354 | 3300014326 | Ga0157380_10039968 | Ga0157380_100399684 | 112 |
| 355 | 3300014326 | Ga0157380_10149713 | Ga0157380_101497132 | 112 |
| 356 | 3300014326 | Ga0157380_10502001 | Ga0157380_105020012 | 112 |
| 357 | 3300014326 | Ga0157380_10697861 | Ga0157380_106978612 | 112 |
| 358 | 3300014326 | Ga0157380_10772503 | Ga0157380_107725032 | 112 |
| 359 | 3300014326 | Ga0157380_11111208 | Ga0157380_111112081 | 112 |
| 360 | 3300014326 | Ga0157380_11155313 | Ga0157380_111553132 | 112 |
| 361 | 3300014745 | Ga0157377_10147876 | Ga0157377_101478762 | 112 |
| 362 | 3300014968 | Ga0157379_12622111 | Ga0157379_126221111 | 112 |
| 363 | 3300014969 | Ga0157376_10201947 | Ga0157376_102019472 | 112 |
| 364 | 3300014969 | Ga0157376_10452257 | Ga0157376_104522572 | 112 |
| 365 | 3300017792 | Ga0163161_10463970 | Ga0163161_104639703 | 112 |
| 366 | 3300017792 | Ga0163161_10506011 | Ga0163161_105060111 | 112 |
| 367 | 3300025315 | Ga0207697_10003386 | Ga0207697_100033862 | 112 |
| 368 | 3300025315 | Ga0207697_10054729 | Ga0207697_100547291 | 112 |
| 369 | 3300025885 | Ga0207653_10100958 | Ga0207653_101009583 | 112 |
| 370 | 3300025900 | Ga0207710_10134034 | Ga0207710_101340342 | 112 |
| 371 | 3300025901 | Ga0207688_10342575 | Ga0207688_103425752 | 112 |
| 372 | 3300025901 | Ga0207688_10358613 | Ga0207688_103586131 | 112 |
| 373 | 3300025901 | Ga0207688_10827728 | Ga0207688_108277282 | 112 |
| 374 | 3300025903 | Ga0207680_10023481 | Ga0207680_100234814 | 112 |
| 375 | 3300025903 | Ga0207680_10194102 | Ga0207680_101941022 | 112 |
| 376 | 3300025903 | Ga0207680_10791396 | Ga0207680_107913961 | 112 |
| 377 | 3300025903 | Ga0207680_10860375 | Ga0207680_108603752 | 112 |
| 378 | 3300025907 | Ga0207645_10411554 | Ga0207645_104115542 | 112 |
| 379 | 3300025908 | Ga0207643_10009182 | Ga0207643_100091822 | 112 |
| 380 | 3300025908 | Ga0207643_10032482 | Ga0207643_100324823 | 112 |
| 381 | 3300025910 | Ga0207684_10551107 | Ga0207684_105511072 | 112 |
| 382 | 3300025910 | Ga0207684_10590586 | Ga0207684_105905862 | 112 |
| 383 | 3300025917 | Ga0207660_11393893 | Ga0207660_113938932 | 112 |
| 384 | 3300025918 | Ga0207662_10011924 | Ga0207662_100119243 | 112 |
| 385 | 3300025918 | Ga0207662_10737184 | Ga0207662_107371841 | 112 |
| 386 | 3300025918 | Ga0207662_11134745 | Ga0207662_111347452 | 112 |
| 387 | 3300025921 | Ga0207652_11470085 | Ga0207652_114700852 | 112 |
| 388 | 3300025922 | Ga0207646_10038261 | Ga0207646_100382612 | 112 |
| 389 | 3300025922 | Ga0207646_10271320 | Ga0207646_102713202 | 112 |
| 390 | 3300025922 | Ga0207646_10592546 | Ga0207646_105925461 | 112 |
| 391 | 3300025922 | Ga0207646_10867662 | Ga0207646_108676621 | 112 |
| 392 | 3300025923 | Ga0207681_10081793 | Ga0207681_100817931 | 112 |
| 393 | 3300025923 | Ga0207681_10992339 | Ga0207681_109923391 | 112 |
| 394 | 3300025923 | Ga0207681_11735050 | Ga0207681_117350501 | 112 |
| 395 | 3300025924 | Ga0207694_10775530 | Ga0207694_107755302 | 112 |
| 396 | 3300025925 | Ga0207650_10062337 | Ga0207650_100623371 | 112 |
| 397 | 3300025926 | Ga0207659_10000073 | Ga0207659_1000007324 | 112 |
| 398 | 3300025926 | Ga0207659_10379062 | Ga0207659_103790622 | 112 |
| 399 | 3300025926 | Ga0207659_10981364 | Ga0207659_109813642 | 112 |
| 400 | 3300025927 | Ga0207687_10169925 | Ga0207687_101699253 | 112 |
| 401 | 3300025928 | Ga0207700_10132842 | Ga0207700_101328422 | 112 |
| 402 | 3300025929 | Ga0207664_10634719 | Ga0207664_106347192 | 112 |
| 403 | 3300025931 | Ga0207644_10205669 | Ga0207644_102056692 | 112 |
| 404 | 3300025931 | Ga0207644_10279790 | Ga0207644_102797902 | 112 |
| 405 | 3300025933 | Ga0207706_10262137 | Ga0207706_102621371 | 112 |
| 406 | 3300025933 | Ga0207706_10484078 | Ga0207706_104840782 | 112 |
| 407 | 3300025933 | Ga0207706_10722697 | Ga0207706_107226971 | 112 |
| 408 | 3300025934 | Ga0207686_10785104 | Ga0207686_107851042 | 112 |
| 409 | 3300025935 | Ga0207709_10250247 | Ga0207709_102502472 | 112 |
| 410 | 3300025936 | Ga0207670_10115775 | Ga0207670_101157753 | 112 |
| 411 | 3300025936 | Ga0207670_10691622 | Ga0207670_106916221 | 112 |
| 412 | 3300025936 | Ga0207670_10700813 | Ga0207670_107008131 | 112 |
| 413 | 3300025936 | Ga0207670_11443206 | Ga0207670_114432061 | 112 |
| 414 | 3300025937 | Ga0207669_11221783 | Ga0207669_112217831 | 112 |
| 415 | 3300025938 | Ga0207704_10347610 | Ga0207704_103476101 | 112 |
| 416 | 3300025938 | Ga0207704_10815046 | Ga0207704_108150461 | 112 |
| 417 | 3300025938 | Ga0207704_11138490 | Ga0207704_111384902 | 112 |
| 418 | 3300025940 | Ga0207691_10001303 | Ga0207691_100013039 | 112 |
| 419 | 3300025940 | Ga0207691_10100312 | Ga0207691_101003123 | 112 |
| 420 | 3300025940 | Ga0207691_10289509 | Ga0207691_102895092 | 112 |
| 421 | 3300025941 | Ga0207711_10064468 | Ga0207711_100644683 | 112 |
| 422 | 3300025941 | Ga0207711_10751037 | Ga0207711_107510372 | 112 |
| 423 | 3300025942 | Ga0207689_10018742 | Ga0207689_100187425 | 112 |
| 424 | 3300025942 | Ga0207689_10023001 | Ga0207689_100230016 | 112 |
| 425 | 3300025942 | Ga0207689_10035270 | Ga0207689_100352705 | 112 |
| 426 | 3300025942 | Ga0207689_10199138 | Ga0207689_101991383 | 112 |
| 427 | 3300025944 | Ga0207661_10001975 | Ga0207661_100019755 | 112 |
| 428 | 3300025945 | Ga0207679_10001040 | Ga0207679_100010409 | 112 |
| 429 | 3300025945 | Ga0207679_10061165 | Ga0207679_100611652 | 112 |
| 430 | 3300025960 | Ga0207651_10055108 | Ga0207651_100551082 | 112 |
| 431 | 3300025960 | Ga0207651_10134666 | Ga0207651_101346662 | 112 |
| 432 | 3300025960 | Ga0207651_11057940 | Ga0207651_110579401 | 112 |
| 433 | 3300025961 | Ga0207712_10980608 | Ga0207712_109806082 | 112 |
| 434 | 3300025961 | Ga0207712_11317275 | Ga0207712_113172752 | 112 |
| 435 | 3300025972 | Ga0207668_11657242 | Ga0207668_116572421 | 112 |
| 436 | 3300025981 | Ga0207640_10084497 | Ga0207640_100844972 | 112 |
| 437 | 3300025986 | Ga0207658_10133653 | Ga0207658_101336532 | 112 |
| 438 | 3300025986 | Ga0207658_10497249 | Ga0207658_104972492 | 112 |
| 439 | 3300026023 | Ga0207677_10259759 | Ga0207677_102597591 | 112 |
| 440 | 3300026023 | Ga0207677_10692450 | Ga0207677_106924503 | 112 |
| 441 | 3300026035 | Ga0207703_10095748 | Ga0207703_100957482 | 112 |
| 442 | 3300026035 | Ga0207703_10166387 | Ga0207703_101663873 | 112 |
| 443 | 3300026035 | Ga0207703_10516857 | Ga0207703_105168572 | 112 |
| 444 | 3300026035 | Ga0207703_10647452 | Ga0207703_106474521 | 112 |
| 445 | 3300026067 | Ga0207678_10018809 | Ga0207678_100188094 | 112 |
| 446 | 3300026067 | Ga0207678_10052392 | Ga0207678_100523924 | 112 |
| 447 | 3300026067 | Ga0207678_11476904 | Ga0207678_114769041 | 112 |
| 448 | 3300026075 | Ga0207708_10041908 | Ga0207708_100419082 | 112 |
| 449 | 3300026075 | Ga0207708_10054163 | Ga0207708_100541634 | 112 |
| 450 | 3300026075 | Ga0207708_10609390 | Ga0207708_106093902 | 112 |
| 451 | 3300026088 | Ga0207641_10030781 | Ga0207641_100307814 | 112 |
| 452 | 3300026089 | Ga0207648_10054198 | Ga0207648_100541981 | 112 |
| 453 | 3300026089 | Ga0207648_10384508 | Ga0207648_103845082 | 112 |
| 454 | 3300026095 | Ga0207676_10055314 | Ga0207676_100553142 | 112 |
| 455 | 3300026095 | Ga0207676_10486214 | Ga0207676_104862141 | 112 |
| 456 | 3300026095 | Ga0207676_10954914 | Ga0207676_109549141 | 112 |
| 457 | 3300026116 | Ga0207674_10219000 | Ga0207674_102190002 | 112 |
| 458 | 3300026118 | Ga0207675_100031844 | Ga0207675_1000318446 | 112 |
| 459 | 3300026118 | Ga0207675_100032823 | Ga0207675_1000328232 | 112 |
| 460 | 3300026118 | Ga0207675_100400715 | Ga0207675_1004007152 | 112 |
| 461 | 3300026118 | Ga0207675_101524061 | Ga0207675_1015240611 | 112 |
| 462 | 3300026121 | Ga0207683_10006140 | Ga0207683_100061401 | 112 |
| 463 | 3300026121 | Ga0207683_10210903 | Ga0207683_102109032 | 112 |
| 464 | 3300026121 | Ga0207683_10304432 | Ga0207683_103044322 | 112 |
| 465 | 3300026121 | Ga0207683_10482490 | Ga0207683_104824902 | 112 |
| 466 | 3300026142 | Ga0207698_10176649 | Ga0207698_101766492 | 112 |
| 467 | 3300027471 | Ga0209995_1012700 | Ga0209995_10127002 | 112 |
| 468 | 3300027526 | Ga0209968_1075666 | Ga0209968_10756661 | 112 |
| 469 | 3300027543 | Ga0209999_1075119 | Ga0209999_10751191 | 112 |
| 470 | 3300027682 | Ga0209971_1066948 | Ga0209971_10669481 | 112 |
| 471 | 3300027682 | Ga0209971_1066948 | Ga0209971_10669482 | 112 |
| 472 | 3300027866 | Ga0209813_10089102 | Ga0209813_100891021 | 112 |
| 473 | 3300027876 | Ga0209974_10035953 | Ga0209974_100359532 | 112 |
| 474 | 3300027907 | Ga0207428_10012852 | Ga0207428_100128521 | 112 |
| 475 | 3300027907 | Ga0207428_10658216 | Ga0207428_106582161 | 112 |
| 476 | 3300028380 | Ga0268265_10086941 | Ga0268265_100869412 | 112 |
| 477 | 3300028380 | Ga0268265_10112602 | Ga0268265_101126022 | 112 |
| 478 | 3300028380 | Ga0268265_10156500 | Ga0268265_101565001 | 112 |
| 479 | 3300028380 | Ga0268265_10672789 | Ga0268265_106727891 | 112 |
| 480 | 3300028380 | Ga0268265_10774286 | Ga0268265_107742862 | 112 |
| 481 | 3300028380 | Ga0268265_10785101 | Ga0268265_107851011 | 112 |
| 482 | 3300028380 | Ga0268265_12066193 | Ga0268265_120661932 | 112 |
| 483 | 3300028381 | Ga0268264_10201234 | Ga0268264_102012342 | 112 |
| 484 | 3300028381 | Ga0268264_10642218 | Ga0268264_106422182 | 112 |
| 485 | 3300028381 | Ga0268264_10961971 | Ga0268264_109619711 | 112 |
| 486 | 3300028381 | Ga0268264_11580646 | Ga0268264_115806461 | 112 |
| 487 | 3300028381 | Ga0268264_11604123 | Ga0268264_116041232 | 112 |
| 488 | 3300031548 | Ga0307408_100010704 | Ga0307408_1000107044 | 112 |
| 489 | 3300031548 | Ga0307408_100027722 | Ga0307408_1000277226 | 112 |
| 490 | 3300031548 | Ga0307408_100075965 | Ga0307408_1000759652 | 112 |
| 491 | 3300031548 | Ga0307408_100290526 | Ga0307408_1002905262 | 112 |
| 492 | 3300031731 | Ga0307405_10022749 | Ga0307405_100227491 | 112 |
| 493 | 3300031731 | Ga0307405_10243839 | Ga0307405_102438393 | 112 |
| 494 | 3300031824 | Ga0307413_10118450 | Ga0307413_101184502 | 112 |
| 495 | 3300031824 | Ga0307413_10299204 | Ga0307413_102992042 | 112 |
| 496 | 3300031824 | Ga0307413_11348066 | Ga0307413_113480661 | 112 |
| 497 | 3300031852 | Ga0307410_10969979 | Ga0307410_109699792 | 112 |
| 498 | 3300031852 | Ga0307410_11048844 | Ga0307410_110488442 | 112 |
| 499 | 3300031852 | Ga0307410_11119037 | Ga0307410_111190372 | 112 |
| 500 | 3300031852 | Ga0307410_11202630 | Ga0307410_112026302 | 112 |
| 501 | 3300031901 | Ga0307406_10384391 | Ga0307406_103843912 | 112 |
| 502 | 3300031901 | Ga0307406_10582575 | Ga0307406_105825752 | 112 |
| 503 | 3300031901 | Ga0307406_10703776 | Ga0307406_107037762 | 112 |
| 504 | 3300031903 | Ga0307407_10220463 | Ga0307407_102204631 | 112 |
| 505 | 3300031903 | Ga0307407_10277789 | Ga0307407_102777892 | 112 |
| 506 | 3300031911 | Ga0307412_10134685 | Ga0307412_101346852 | 112 |
| 507 | 3300031911 | Ga0307412_11572918 | Ga0307412_115729181 | 112 |
| 508 | 3300031995 | Ga0307409_100146913 | Ga0307409_1001469132 | 112 |
| 509 | 3300031995 | Ga0307409_100572295 | Ga0307409_1005722952 | 112 |
| 510 | 3300031995 | Ga0307409_101303514 | Ga0307409_1013035142 | 112 |
| 511 | 3300032002 | Ga0307416_100012026 | Ga0307416_1000120262 | 112 |
| 512 | 3300032002 | Ga0307416_100132786 | Ga0307416_1001327862 | 112 |
| 513 | 3300032002 | Ga0307416_100475416 | Ga0307416_1004754162 | 112 |
| 514 | 3300032002 | Ga0307416_100652584 | Ga0307416_1006525842 | 112 |
| 515 | 3300032002 | Ga0307416_101098857 | Ga0307416_1010988572 | 112 |
| 516 | 3300032002 | Ga0307416_103650824 | Ga0307416_1036508241 | 112 |
| 517 | 3300032004 | Ga0307414_11258648 | Ga0307414_112586482 | 112 |
| 518 | 3300032005 | Ga0307411_10080548 | Ga0307411_100805482 | 112 |
| 519 | 3300032005 | Ga0307411_10081660 | Ga0307411_100816602 | 112 |
| 520 | 3300032005 | Ga0307411_10559034 | Ga0307411_105590342 | 112 |
| 521 | 3300032005 | Ga0307411_11129494 | Ga0307411_111294941 | 112 |
| 522 | 3300032126 | Ga0307415_100091654 | Ga0307415_1000916542 | 112 |
| 523 | 3300032126 | Ga0307415_101926063 | Ga0307415_1019260631 | 112 |
| 524 | 3300035083 | Ga0373926_0162020 | Ga0373926_0162020_441_779 | 112 |
| 525 | 3300035092 | Ga0373952_0009107 | Ga0373952_0009107_591_929 | 112 |
| 526 | 3300035114 | Ga0373939_0235472 | Ga0373939_0235472_136_474 | 112 |
| 527 | 3300035115 | Ga0373941_0275203 | Ga0373941_0275203_235_573 | 112 |
| 528 | 3300035691 | Ga0373931_0177560 | Ga0373931_0177560_735_1073 | 112 |
| 529 | 3300035695 | Ga0373927_0361175 | Ga0373927_0361175_554_892 | 112 |
| 530 | 3300037068 | Ga0373925_0127746 | Ga0373925_0127746_271_609 | 112 |
| 531 | 3300041410 | Ga0439461_0024323 | Ga0439461_0024323_768_1106 | 112 |
| 532 | 3300041460 | Ga0451802_0382625 | Ga0451802_0382625_552_890 | 112 |
| 533 | 3300041997 | Ga0439431_0112928 | Ga0439431_0112928_96_434 | 112 |
| 534 | 3300042006 | Ga0439432_230643 | Ga0439432_230643_132_470 | 112 |
| 535 | 3300042008 | Ga0439450_040913 | Ga0439450_040913_348_686 | 112 |
| 536 | 3300042011 | Ga0439454_072667 | Ga0439454_072667_50_412 | 112 |
| 537 | 3300042118 | Ga0450914_013279 | Ga0450914_013279_113_451 | 112 |
| 538 | 3300042122 | Ga0450920_089620 | Ga0450920_089620_232_570 | 112 |
| 539 | 3300042125 | Ga0450923_028307 | Ga0450923_028307_199_537 | 112 |
| 540 | 3300042156 | Ga0439446_0273827 | Ga0439446_0273827_219_557 | 112 |
| 541 | 3300042436 | Ga0439435_0110327 | Ga0439435_0110327_72_410 | 112 |
| 542 | 3300042436 | Ga0439435_0154504 | Ga0439435_0154504_390_728 | 112 |
| 543 | 3300042439 | Ga0439464_0074408 | Ga0439464_0074408_551_889 | 112 |
| 544 | 3300042439 | Ga0439464_0094702 | Ga0439464_0094702_74_412 | 112 |
| 545 | 3300042876 | Ga0451577_1584149 | Ga0451577_1584149_177_524 | 112 |
| 546 | 3300042993 | Ga0439440_0137741 | Ga0439440_0137741_246_584 | 112 |
| 547 | 3300044673 | Ga0453683_0779470 | Ga0453683_0779470_106_444 | 112 |
| 548 | 3300045051 | Ga0451576_0133145 | Ga0451576_0133145_553_891 | 112 |
| 549 | 3300046499 | Ga0495594_0871369 | Ga0495594_0871369_35_373 | 112 |
| 550 | 3300046517 | Ga0495630_1006204 | Ga0495630_1006204_197_535 | 112 |
| 551 | 3300046522 | Ga0495643_0005610 | Ga0495643_0005610_5792_6130 | 112 |
| 552 | 3300046537 | Ga0495598_0305637 | Ga0495598_0305637_173_511 | 112 |
| 553 | 3300046538 | Ga0495609_0145927 | Ga0495609_0145927_47_385 | 112 |
| 554 | 3300046539 | Ga0495621_0190297 | Ga0495621_0190297_110_448 | 112 |
| 555 | 3300046664 | Ga0495659_0193768 | Ga0495659_0193768_258_596 | 112 |
| 556 | 3300046684 | Ga0495669_0121802 | Ga0495669_0121802_19_357 | 112 |
| 557 | 3300046689 | Ga0495613_0272447 | Ga0495613_0272447_766_1104 | 112 |
| 558 | 3300046694 | Ga0495649_0372708 | Ga0495649_0372708_149_487 | 112 |
| 559 | 3300048905 | Ga0496102_1361815 | Ga0496102_1361815_203_541 | 112 |
| 560 | 3300048907 | Ga0496104_0000738 | Ga0496104_0000738_5740_6078 | 112 |
| 561 | 3300048907 | Ga0496104_1246942 | Ga0496104_1246942_172_510 | 112 |
| 562 | 3300048908 | Ga0496105_0004063 | Ga0496105_0004063_183_521 | 112 |
| 563 | 3300048909 | Ga0496106_0213764 | Ga0496106_0213764_240_578 | 112 |
| 564 | 3300048909 | Ga0496106_0565337 | Ga0496106_0565337_233_574 | 112 |
| 565 | 3300048910 | Ga0496107_0066038 | Ga0496107_0066038_22_360 | 112 |
| 566 | 3300048911 | Ga0496108_0003353 | Ga0496108_0003353_10202_10540 | 112 |
| 567 | 3300048912 | Ga0496109_0001592 | Ga0496109_0001592_16471_16809 | 112 |
| 568 | 3300048912 | Ga0496109_1787255 | Ga0496109_1787255_191_529 | 112 |
| 569 | 3300048913 | Ga0496110_0010556 | Ga0496110_0010556_1564_1902 | 112 |
| 570 | 3300048915 | Ga0496112_0001560 | Ga0496112_0001560_2567_2905 | 112 |
| 571 | 3300048915 | Ga0496112_1009143 | Ga0496112_1009143_374_712 | 112 |
| 572 | 3300048915 | Ga0496112_1600480 | Ga0496112_1600480_12_350 | 112 |
| 573 | 3300048915 | Ga0496112_1747813 | Ga0496112_1747813_20_358 | 112 |
| 574 | 3300048916 | Ga0496113_0231307 | Ga0496113_0231307_210_548 | 112 |
| 575 | 3300049515 | Ga0501292_010250 | Ga0501292_010250_649_987 | 112 |
| 576 | 3300049521 | Ga0501298_093207 | Ga0501298_093207_192_530 | 112 |
| 577 | 3300049522 | Ga0501299_006376 | Ga0501299_006376_743_1081 | 112 |
| 578 | 3300049568 | Ga0501031_0005502 | Ga0501031_0005502_6063_6401 | 112 |
| 579 | 3300049568 | Ga0501031_0006231 | Ga0501031_0006231_980_1321 | 112 |
| 580 | 3300049568 | Ga0501031_0006379 | Ga0501031_0006379_5489_5827 | 112 |
| 581 | 3300049568 | Ga0501031_0095939 | Ga0501031_0095939_1445_1783 | 112 |
| 582 | 3300049568 | Ga0501031_0276404 | Ga0501031_0276404_402_740 | 112 |
| 583 | 3300049568 | Ga0501031_0389755 | Ga0501031_0389755_357_695 | 112 |
| 584 | 3300049569 | Ga0501032_0000389 | Ga0501032_0000389_9141_9479 | 112 |
| 585 | 3300049569 | Ga0501032_0004303 | Ga0501032_0004303_4098_4439 | 112 |
| 586 | 3300049569 | Ga0501032_0028124 | Ga0501032_0028124_533_871 | 112 |
| 587 | 3300049569 | Ga0501032_0086125 | Ga0501032_0086125_65_403 | 112 |
| 588 | 3300049569 | Ga0501032_0306333 | Ga0501032_0306333_88_429 | 112 |
| 589 | 3300049569 | Ga0501032_0625595 | Ga0501032_0625595_53_391 | 112 |
| 590 | 3300049570 | Ga0501033_0001379 | Ga0501033_0001379_15946_16287 | 112 |
| 591 | 3300049570 | Ga0501033_0068677 | Ga0501033_0068677_679_1017 | 112 |
| 592 | 3300049570 | Ga0501033_0112387 | Ga0501033_0112387_821_1162 | 112 |
| 593 | 3300049571 | Ga0501034_0018144 | Ga0501034_0018144_4852_5190 | 112 |
| 594 | 3300049571 | Ga0501034_0021049 | Ga0501034_0021049_3963_4304 | 112 |
| 595 | 3300049571 | Ga0501034_0030824 | Ga0501034_0030824_4353_4691 | 112 |
| 596 | 3300049571 | Ga0501034_0034104 | Ga0501034_0034104_949_1287 | 112 |
| 597 | 3300049571 | Ga0501034_0043322 | Ga0501034_0043322_3949_4290 | 112 |
| 598 | 3300049571 | Ga0501034_0615309 | Ga0501034_0615309_204_542 | 112 |
| 599 | 3300049572 | Ga0501036_0002951 | Ga0501036_0002951_8242_8580 | 112 |
| 600 | 3300049572 | Ga0501036_0004553 | Ga0501036_0004553_3269_3610 | 112 |
| 601 | 3300049572 | Ga0501036_0011068 | Ga0501036_0011068_1432_1770 | 112 |
| 602 | 3300049572 | Ga0501036_0180725 | Ga0501036_0180725_68_406 | 112 |
| 603 | 3300049572 | Ga0501036_0384091 | Ga0501036_0384091_742_1080 | 112 |
| 604 | 3300049572 | Ga0501036_1517457 | Ga0501036_1517457_59_397 | 112 |
| 605 | 3300049573 | Ga0501037_0009219 | Ga0501037_0009219_6375_6716 | 112 |
| 606 | 3300049573 | Ga0501037_0046641 | Ga0501037_0046641_421_759 | 112 |
| 607 | 3300049573 | Ga0501037_0121851 | Ga0501037_0121851_1240_1578 | 112 |
| 608 | 3300049573 | Ga0501037_0188924 | Ga0501037_0188924_745_1083 | 112 |
| 609 | 3300049573 | Ga0501037_0231900 | Ga0501037_0231900_250_588 | 112 |
| 610 | 3300049573 | Ga0501037_0576367 | Ga0501037_0576367_237_578 | 112 |
| 611 | 3300049574 | Ga0501038_0002772 | Ga0501038_0002772_8695_9033 | 112 |
| 612 | 3300049574 | Ga0501038_0002872 | Ga0501038_0002872_5927_6268 | 112 |
| 613 | 3300049574 | Ga0501038_0003162 | Ga0501038_0003162_13456_13794 | 112 |
| 614 | 3300049574 | Ga0501038_0028562 | Ga0501038_0028562_16_354 | 112 |
| 615 | 3300049574 | Ga0501038_0049667 | Ga0501038_0049667_169_510 | 112 |
| 616 | 3300049574 | Ga0501038_0201422 | Ga0501038_0201422_1054_1392 | 112 |
| 617 | 3300049575 | Ga0501039_0002456 | Ga0501039_0002456_4845_5183 | 112 |
| 618 | 3300049575 | Ga0501039_0032797 | Ga0501039_0032797_1185_1523 | 112 |
| 619 | 3300049575 | Ga0501039_0130710 | Ga0501039_0130710_52_390 | 112 |
| 620 | 3300049575 | Ga0501039_0232116 | Ga0501039_0232116_610_951 | 112 |
| 621 | 3300049575 | Ga0501039_0917434 | Ga0501039_0917434_70_408 | 112 |
| 622 | 3300049576 | Ga0501040_0102671 | Ga0501040_0102671_991_1332 | 112 |
| 623 | 3300049576 | Ga0501040_0112720 | Ga0501040_0112720_176_514 | 112 |
| 624 | 3300049576 | Ga0501040_0327325 | Ga0501040_0327325_350_688 | 112 |
| 625 | 3300049576 | Ga0501040_0382616 | Ga0501040_0382616_424_762 | 112 |
| 626 | 3300049576 | Ga0501040_0563567 | Ga0501040_0563567_213_551 | 112 |
| 627 | 3300049577 | Ga0501041_0129200 | Ga0501041_0129200_1159_1548 | 112 |
| 628 | 3300049577 | Ga0501041_0989771 | Ga0501041_0989771_120_458 | 112 |
| 629 | 3300049578 | Ga0501042_0005209 | Ga0501042_0005209_532_921 | 112 |
| 630 | 3300049578 | Ga0501042_0012320 | Ga0501042_0012320_4055_4393 | 112 |
| 631 | 3300049578 | Ga0501042_0040498 | Ga0501042_0040498_1860_2198 | 112 |
| 632 | 3300049578 | Ga0501042_0376698 | Ga0501042_0376698_335_676 | 112 |
| 633 | 3300049579 | Ga0501043_0000523 | Ga0501043_0000523_12744_13082 | 112 |
| 634 | 3300049579 | Ga0501043_0009982 | Ga0501043_0009982_5498_5839 | 112 |
| 635 | 3300049579 | Ga0501043_0015433 | Ga0501043_0015433_4337_4675 | 112 |
| 636 | 3300049579 | Ga0501043_0031681 | Ga0501043_0031681_1053_1391 | 112 |
| 637 | 3300049579 | Ga0501043_0033447 | Ga0501043_0033447_3526_3864 | 112 |
| 638 | 3300049579 | Ga0501043_0036592 | Ga0501043_0036592_809_1147 | 112 |
| 639 | 3300049579 | Ga0501043_0801174 | Ga0501043_0801174_52_390 | 112 |
| 640 | 3300049579 | Ga0501043_0932145 | Ga0501043_0932145_129_467 | 112 |
| 641 | 3300049579 | Ga0501043_1115757 | Ga0501043_1115757_102_440 | 112 |
| 642 | 3300049580 | Ga0501046_0001365 | Ga0501046_0001365_16876_17214 | 112 |
| 643 | 3300049580 | Ga0501046_0005206 | Ga0501046_0005206_10363_10701 | 112 |
| 644 | 3300049580 | Ga0501046_0006858 | Ga0501046_0006858_2629_2970 | 112 |
| 645 | 3300049580 | Ga0501046_0008841 | Ga0501046_0008841_3356_3694 | 112 |
| 646 | 3300049580 | Ga0501046_0024496 | Ga0501046_0024496_3194_3532 | 112 |
| 647 | 3300049580 | Ga0501046_0050799 | Ga0501046_0050799_1902_2240 | 112 |
| 648 | 3300049580 | Ga0501046_0428441 | Ga0501046_0428441_563_901 | 112 |
| 649 | 3300049580 | Ga0501046_0603057 | Ga0501046_0603057_368_706 | 112 |
| 650 | 3300049580 | Ga0501046_0859023 | Ga0501046_0859023_36_374 | 112 |
| 651 | 3300049581 | Ga0501047_0001059 | Ga0501047_0001059_25061_25399 | 112 |
| 652 | 3300049581 | Ga0501047_0034798 | Ga0501047_0034798_3874_4212 | 112 |
| 653 | 3300049581 | Ga0501047_0044932 | Ga0501047_0044932_2839_3177 | 112 |
| 654 | 3300049581 | Ga0501047_0047430 | Ga0501047_0047430_335_676 | 112 |
| 655 | 3300049581 | Ga0501047_0065872 | Ga0501047_0065872_625_963 | 112 |
| 656 | 3300049581 | Ga0501047_0176527 | Ga0501047_0176527_1210_1548 | 112 |
| 657 | 3300049581 | Ga0501047_0465561 | Ga0501047_0465561_376_717 | 112 |
| 658 | 3300049582 | Ga0501048_0001458 | Ga0501048_0001458_184_522 | 112 |
| 659 | 3300049582 | Ga0501048_0017437 | Ga0501048_0017437_4153_4491 | 112 |
| 660 | 3300049582 | Ga0501048_0040044 | Ga0501048_0040044_2518_2856 | 112 |
| 661 | 3300049582 | Ga0501048_0049449 | Ga0501048_0049449_240_581 | 112 |
| 662 | 3300049582 | Ga0501048_0517107 | Ga0501048_0517107_53_391 | 112 |
| 663 | 3300049582 | Ga0501048_0669424 | Ga0501048_0669424_384_722 | 112 |
| 664 | 3300049583 | Ga0501067_0002961 | Ga0501067_0002961_7335_7673 | 112 |
| 665 | 3300049583 | Ga0501067_0003234 | Ga0501067_0003234_5420_5761 | 112 |
| 666 | 3300049583 | Ga0501067_0024530 | Ga0501067_0024530_2932_3270 | 112 |
| 667 | 3300049583 | Ga0501067_0049601 | Ga0501067_0049601_1420_1758 | 112 |
| 668 | 3300049583 | Ga0501067_0134564 | Ga0501067_0134564_561_899 | 112 |
| 669 | 3300049583 | Ga0501067_0649021 | Ga0501067_0649021_54_392 | 112 |
| 670 | 3300049584 | Ga0501068_0012341 | Ga0501068_0012341_3616_3957 | 112 |
| 671 | 3300049584 | Ga0501068_0026918 | Ga0501068_0026918_1451_1789 | 112 |
| 672 | 3300049584 | Ga0501068_0102632 | Ga0501068_0102632_65_403 | 112 |
| 673 | 3300049584 | Ga0501068_0153908 | Ga0501068_0153908_575_913 | 112 |
| 674 | 3300049584 | Ga0501068_0158200 | Ga0501068_0158200_187_525 | 112 |
| 675 | 3300049584 | Ga0501068_0796874 | Ga0501068_0796874_159_497 | 112 |
| 676 | 3300049585 | Ga0501069_0042638 | Ga0501069_0042638_1260_1598 | 112 |
| 677 | 3300049585 | Ga0501069_0048835 | Ga0501069_0048835_1983_2324 | 112 |
| 678 | 3300049585 | Ga0501069_0101981 | Ga0501069_0101981_405_743 | 112 |
| 679 | 3300049585 | Ga0501069_0241617 | Ga0501069_0241617_496_834 | 112 |
| 680 | 3300049586 | Ga0501070_0006698 | Ga0501070_0006698_4196_4537 | 112 |
| 681 | 3300049586 | Ga0501070_0104206 | Ga0501070_0104206_1882_2220 | 112 |
| 682 | 3300049586 | Ga0501070_0160806 | Ga0501070_0160806_1340_1678 | 112 |
| 683 | 3300049586 | Ga0501070_1058945 | Ga0501070_1058945_169_507 | 112 |
| 684 | 3300049587 | Ga0501071_0004830 | Ga0501071_0004830_4283_4621 | 112 |
| 685 | 3300049587 | Ga0501071_0021575 | Ga0501071_0021575_1480_1818 | 112 |
| 686 | 3300049587 | Ga0501071_0092567 | Ga0501071_0092567_320_658 | 112 |
| 687 | 3300049587 | Ga0501071_0464404 | Ga0501071_0464404_606_944 | 112 |
| 688 | 3300049587 | Ga0501071_0887610 | Ga0501071_0887610_285_623 | 112 |
| 689 | 3300049588 | Ga0501072_0034341 | Ga0501072_0034341_603_941 | 112 |
| 690 | 3300049588 | Ga0501072_0081561 | Ga0501072_0081561_555_893 | 112 |
| 691 | 3300049588 | Ga0501072_0127178 | Ga0501072_0127178_1382_1720 | 112 |
| 692 | 3300049588 | Ga0501072_0165007 | Ga0501072_0165007_991_1329 | 112 |
| 693 | 3300049588 | Ga0501072_0410470 | Ga0501072_0410470_307_645 | 112 |
| 694 | 3300049588 | Ga0501072_0440837 | Ga0501072_0440837_166_504 | 112 |
| 695 | 3300049588 | Ga0501072_0730194 | Ga0501072_0730194_353_691 | 112 |
| 696 | 3300049589 | Ga0501073_0000673 | Ga0501073_0000673_12098_12439 | 112 |
| 697 | 3300049589 | Ga0501073_0005767 | Ga0501073_0005767_3987_4325 | 112 |
| 698 | 3300049589 | Ga0501073_0021161 | Ga0501073_0021161_3058_3396 | 112 |
| 699 | 3300049589 | Ga0501073_0051587 | Ga0501073_0051587_2303_2644 | 112 |
| 700 | 3300049589 | Ga0501073_0078215 | Ga0501073_0078215_1764_2102 | 112 |
| 701 | 3300049589 | Ga0501073_0325186 | Ga0501073_0325186_570_908 | 112 |
| 702 | 3300049589 | Ga0501073_0366610 | Ga0501073_0366610_458_847 | 112 |
| 703 | 3300049589 | Ga0501073_0386833 | Ga0501073_0386833_553_891 | 112 |
| 704 | 3300049590 | Ga0501074_0014220 | Ga0501074_0014220_4580_4918 | 112 |
| 705 | 3300049590 | Ga0501074_0023908 | Ga0501074_0023908_3594_3935 | 112 |
| 706 | 3300049590 | Ga0501074_0095952 | Ga0501074_0095952_182_520 | 112 |
| 707 | 3300049590 | Ga0501074_0703615 | Ga0501074_0703615_260_598 | 112 |
| 708 | 3300049590 | Ga0501074_0964649 | Ga0501074_0964649_144_482 | 112 |
| 709 | 3300049591 | Ga0501075_0069864 | Ga0501075_0069864_1101_1490 | 112 |
| 710 | 3300049591 | Ga0501075_0782386 | Ga0501075_0782386_160_498 | 112 |
| 711 | 3300049591 | Ga0501075_1195009 | Ga0501075_1195009_153_491 | 112 |
| 712 | 3300049592 | Ga0501076_0197946 | Ga0501076_0197946_1039_1377 | 112 |
| 713 | 3300049592 | Ga0501076_0206125 | Ga0501076_0206125_867_1256 | 112 |
| 714 | 3300049592 | Ga0501076_1113582 | Ga0501076_1113582_173_514 | 112 |
| 715 | 3300049593 | Ga0501077_0048365 | Ga0501077_0048365_1570_1908 | 112 |
| 716 | 3300049593 | Ga0501077_0208500 | Ga0501077_0208500_27_419 | 112 |
| 717 | 3300049593 | Ga0501077_0498473 | Ga0501077_0498473_197_586 | 112 |
| 718 | 3300049655 | Ga0501208_004275 | Ga0501208_004275_459_797 | 112 |
| 719 | 3300049675 | Ga0501243_132792 | Ga0501243_132792_25_363 | 112 |
| 720 | 3300049690 | Ga0501261_039678 | Ga0501261_039678_36_374 | 112 |
| 721 | 3300049741 | Ga0501079_0017757 | Ga0501079_0017757_4772_5113 | 112 |
| 722 | 3300049741 | Ga0501079_0042490 | Ga0501079_0042490_3127_3465 | 112 |
| 723 | 3300049741 | Ga0501079_0050619 | Ga0501079_0050619_1254_1592 | 112 |
| 724 | 3300049741 | Ga0501079_0245842 | Ga0501079_0245842_378_716 | 112 |
| 725 | 3300049741 | Ga0501079_0434128 | Ga0501079_0434128_566_904 | 112 |
| 726 | 3300049741 | Ga0501079_0464813 | Ga0501079_0464813_173_511 | 112 |
| 727 | 3300049742 | Ga0501080_0000066 | Ga0501080_0000066_63801_64139 | 112 |
| 728 | 3300049742 | Ga0501080_0009715 | Ga0501080_0009715_4342_4683 | 112 |
| 729 | 3300049742 | Ga0501080_0030799 | Ga0501080_0030799_4055_4393 | 112 |
| 730 | 3300049742 | Ga0501080_0063311 | Ga0501080_0063311_2690_3028 | 112 |
| 731 | 3300049742 | Ga0501080_0120686 | Ga0501080_0120686_1128_1466 | 112 |
| 732 | 3300049742 | Ga0501080_0121996 | Ga0501080_0121996_1093_1431 | 112 |
| 733 | 3300049742 | Ga0501080_0374864 | Ga0501080_0374864_772_1110 | 112 |
| 734 | 3300049742 | Ga0501080_1177633 | Ga0501080_1177633_161_499 | 112 |
| 735 | 3300049742 | Ga0501080_1679303 | Ga0501080_1679303_97_486 | 112 |
| 736 | 3300049743 | Ga0501081_0206638 | Ga0501081_0206638_652_990 | 112 |
| 737 | 3300049743 | Ga0501081_0222969 | Ga0501081_0222969_745_1083 | 112 |
| 738 | 3300049743 | Ga0501081_0288294 | Ga0501081_0288294_465_806 | 112 |
| 739 | 3300049743 | Ga0501081_0649386 | Ga0501081_0649386_336_674 | 112 |
| 740 | 3300049743 | Ga0501081_1496574 | Ga0501081_1496574_69_407 | 112 |
| 741 | 3300049744 | Ga0501083_0001749 | Ga0501083_0001749_12465_12821 | 112 |
| 742 | 3300049744 | Ga0501083_0002515 | Ga0501083_0002515_11195_11533 | 112 |
| 743 | 3300049744 | Ga0501083_0006852 | Ga0501083_0006852_3287_3628 | 112 |
| 744 | 3300049744 | Ga0501083_0012510 | Ga0501083_0012510_5371_5709 | 112 |
| 745 | 3300049744 | Ga0501083_0054470 | Ga0501083_0054470_665_1003 | 112 |
| 746 | 3300049744 | Ga0501083_0069480 | Ga0501083_0069480_1332_1670 | 112 |
| 747 | 3300049744 | Ga0501083_0149468 | Ga0501083_0149468_861_1199 | 112 |
| 748 | 3300049744 | Ga0501083_0329579 | Ga0501083_0329579_457_846 | 112 |
| 749 | 3300049744 | Ga0501083_0506335 | Ga0501083_0506335_319_657 | 112 |
| 750 | 3300049822 | Ga0501035_0031936 | Ga0501035_0031936_4410_4748 | 112 |
| 751 | 3300049822 | Ga0501035_0061410 | Ga0501035_0061410_1093_1431 | 112 |
| 752 | 3300049822 | Ga0501035_0159332 | Ga0501035_0159332_873_1214 | 112 |
| 753 | 3300049822 | Ga0501035_0342851 | Ga0501035_0342851_77_418 | 112 |
| 754 | 3300049822 | Ga0501035_0563873 | Ga0501035_0563873_258_599 | 112 |
| 755 | 3300049823 | Ga0501044_0001594 | Ga0501044_0001594_21375_21713 | 112 |
| 756 | 3300049823 | Ga0501044_0238192 | Ga0501044_0238192_586_924 | 112 |
| 757 | 3300049823 | Ga0501044_0271441 | Ga0501044_0271441_281_622 | 112 |
| 758 | 3300049823 | Ga0501044_0356773 | Ga0501044_0356773_861_1199 | 112 |
| 759 | 3300049823 | Ga0501044_0759088 | Ga0501044_0759088_497_835 | 112 |
| 760 | 3300049823 | Ga0501044_0903989 | Ga0501044_0903989_224_562 | 112 |
| 761 | 3300049823 | Ga0501044_1072421 | Ga0501044_1072421_90_431 | 112 |
| 762 | 3300049824 | Ga0501045_0022232 | Ga0501045_0022232_1848_2186 | 112 |
| 763 | 3300049824 | Ga0501045_0063925 | Ga0501045_0063925_1543_1881 | 112 |
| 764 | 3300049824 | Ga0501045_0142947 | Ga0501045_0142947_311_652 | 112 |
| 765 | 3300049824 | Ga0501045_0239586 | Ga0501045_0239586_80_418 | 112 |
| 766 | 3300049824 | Ga0501045_0347006 | Ga0501045_0347006_128_466 | 112 |
| 767 | 3300050491 | nmdc:mga00v17_116254_c2 | nmdc:mga00v17_116254_c2_100_438 | 112 |
| 768 | 3300050491 | nmdc:mga00v17_96322_c1 | nmdc:mga00v17_96322_c1_1509_1847 | 112 |
| 769 | 3300050493 | nmdc:mga0k408_210547_c1 | nmdc:mga0k408_210547_c1_656_994 | 112 |
| 770 | 3300050493 | nmdc:mga0k408_408053_c1 | nmdc:mga0k408_408053_c1_33_371 | 112 |
| 771 | 3300050494 | nmdc:mga06z11_19576_c1 | nmdc:mga06z11_19576_c1_298_636 | 112 |
| 772 | 3300050494 | nmdc:mga06z11_354356_c1 | nmdc:mga06z11_354356_c1_333_671 | 112 |
| 773 | 3300050494 | nmdc:mga06z11_438119_c1 | nmdc:mga06z11_438119_c1_440_778 | 112 |
| 774 | 3300050494 | nmdc:mga06z11_603701_c1 | nmdc:mga06z11_603701_c1_23_412 | 112 |
| 775 | 3300050495 | nmdc:mga04h51_317688_c1 | nmdc:mga04h51_317688_c1_207_545 | 112 |
| 776 | 3300050496 | nmdc:mga07m45_132337_c1 | nmdc:mga07m45_132337_c1_182_520 | 112 |
| 777 | 3300050507 | nmdc:mga05p37_2011171_c1 | nmdc:mga05p37_2011171_c1_112_450 | 112 |
| 778 | 3300050507 | nmdc:mga05p37_279912_c1 | nmdc:mga05p37_279912_c1_561_899 | 112 |
| 779 | 3300050507 | nmdc:mga05p37_357078_c1 | nmdc:mga05p37_357078_c1_262_603 | 112 |
| 780 | 3300050507 | nmdc:mga05p37_644084_c1 | nmdc:mga05p37_644084_c1_447_785 | 112 |
| 781 | 3300050508 | nmdc:mga09592_10912_c1 | nmdc:mga09592_10912_c1_2943_3284 | 112 |
| 782 | 3300050508 | nmdc:mga09592_198494_c1 | nmdc:mga09592_198494_c1_727_1065 | 112 |
| 783 | 3300050508 | nmdc:mga09592_224489_c1 | nmdc:mga09592_224489_c1_948_1286 | 112 |
| 784 | 3300050508 | nmdc:mga09592_409290_c1 | nmdc:mga09592_409290_c1_303_641 | 112 |
| 785 | 3300050508 | nmdc:mga09592_55293_c1 | nmdc:mga09592_55293_c1_2328_2666 | 112 |
| 786 | 3300050508 | nmdc:mga09592_935973_c1 | nmdc:mga09592_935973_c1_226_564 | 112 |
| 787 | 3300050508 | nmdc:mga09592_970003_c1 | nmdc:mga09592_970003_c1_274_612 | 112 |
| 788 | 3300050509 | nmdc:mga0qj67_125077_c1 | nmdc:mga0qj67_125077_c1_1227_1565 | 112 |
| 789 | 3300050509 | nmdc:mga0qj67_214581_c1 | nmdc:mga0qj67_214581_c1_1083_1421 | 112 |
| 790 | 3300050509 | nmdc:mga0qj67_320605_c1 | nmdc:mga0qj67_320605_c1_33_371 | 112 |
| 791 | 3300050509 | nmdc:mga0qj67_325568_c1 | nmdc:mga0qj67_325568_c1_615_956 | 112 |
| 792 | 3300050509 | nmdc:mga0qj67_46370_c1 | nmdc:mga0qj67_46370_c1_787_1128 | 112 |
| 793 | 3300050509 | nmdc:mga0qj67_556308_c1 | nmdc:mga0qj67_556308_c1_373_711 | 112 |
| 794 | 3300050510 | nmdc:mga06r32_1099877_c1 | nmdc:mga06r32_1099877_c1_34_372 | 112 |
| 795 | 3300050510 | nmdc:mga06r32_1426417_c1 | nmdc:mga06r32_1426417_c1_251_589 | 112 |
| 796 | 3300050510 | nmdc:mga06r32_1562411_c1 | nmdc:mga06r32_1562411_c1_79_417 | 112 |
| 797 | 3300050510 | nmdc:mga06r32_17022_c1 | nmdc:mga06r32_17022_c1_2607_2948 | 112 |
| 798 | 3300050510 | nmdc:mga06r32_385144_c1 | nmdc:mga06r32_385144_c1_433_771 | 112 |
| 799 | 3300050510 | nmdc:mga06r32_460658_c1 | nmdc:mga06r32_460658_c1_871_1209 | 112 |
| 800 | 3300050510 | nmdc:mga06r32_48917_c1 | nmdc:mga06r32_48917_c1_3317_3655 | 112 |
| 801 | 3300050510 | nmdc:mga06r32_6101_c1 | nmdc:mga06r32_6101_c1_5169_5507 | 112 |
| 802 | 3300050510 | nmdc:mga06r32_68801_c1 | nmdc:mga06r32_68801_c1_354_692 | 112 |
| 803 | 3300050510 | nmdc:mga06r32_83665_c1 | nmdc:mga06r32_83665_c1_1296_1637 | 112 |
| 804 | 3300050511 | nmdc:mga08y16_1105092_c1 | nmdc:mga08y16_1105092_c1_61_399 | 112 |
| 805 | 3300050511 | nmdc:mga08y16_1593027_c1 | nmdc:mga08y16_1593027_c1_124_462 | 112 |
| 806 | 3300050511 | nmdc:mga08y16_19145_c1 | nmdc:mga08y16_19145_c1_5126_5464 | 112 |
| 807 | 3300050511 | nmdc:mga08y16_326046_c1 | nmdc:mga08y16_326046_c1_1077_1415 | 112 |
| 808 | 3300050511 | nmdc:mga08y16_64524_c1 | nmdc:mga08y16_64524_c1_2345_2683 | 112 |
| 809 | 3300050512 | nmdc:mga0n895_114062_c1 | nmdc:mga0n895_114062_c1_1404_1745 | 112 |
| 810 | 3300050512 | nmdc:mga0n895_123943_c1 | nmdc:mga0n895_123943_c1_898_1287 | 112 |
| 811 | 3300050512 | nmdc:mga0n895_126543_c1 | nmdc:mga0n895_126543_c1_1607_1945 | 112 |
| 812 | 3300050512 | nmdc:mga0n895_1690_c1 | nmdc:mga0n895_1690_c1_10840_11178 | 112 |
| 813 | 3300050512 | nmdc:mga0n895_1800123_c1 | nmdc:mga0n895_1800123_c1_44_382 | 112 |
| 814 | 3300050512 | nmdc:mga0n895_222777_c1 | nmdc:mga0n895_222777_c1_513_851 | 112 |
| 815 | 3300050512 | nmdc:mga0n895_255012_c1 | nmdc:mga0n895_255012_c1_630_971 | 112 |
| 816 | 3300050512 | nmdc:mga0n895_267688_c1 | nmdc:mga0n895_267688_c1_953_1291 | 112 |
| 817 | 3300050512 | nmdc:mga0n895_601_c1 | nmdc:mga0n895_601_c1_18059_18397 | 112 |
| 818 | 3300050513 | nmdc:mga0rr50_101517_c1 | nmdc:mga0rr50_101517_c1_403_741 | 112 |
| 819 | 3300050513 | nmdc:mga0rr50_1285601_c1 | nmdc:mga0rr50_1285601_c1_34_372 | 112 |
| 820 | 3300050513 | nmdc:mga0rr50_29683_c1 | nmdc:mga0rr50_29683_c1_1300_1638 | 112 |
| 821 | 3300050513 | nmdc:mga0rr50_29688_c1 | nmdc:mga0rr50_29688_c1_2157_2495 | 112 |
| 822 | 3300050514 | nmdc:mga08x19_17947_c1 | nmdc:mga08x19_17947_c1_3053_3391 | 112 |
| 823 | 3300050514 | nmdc:mga08x19_738185_c1 | nmdc:mga08x19_738185_c1_248_589 | 112 |
| 824 | 3300050514 | nmdc:mga08x19_86543_c1 | nmdc:mga08x19_86543_c1_495_833 | 112 |
| 825 | 3300050515 | nmdc:mga0a205_18351_c1 | nmdc:mga0a205_18351_c1_5812_6150 | 112 |
| 826 | 3300050515 | nmdc:mga0a205_21859_c1 | nmdc:mga0a205_21859_c1_3483_3824 | 112 |
| 827 | 3300050515 | nmdc:mga0a205_349196_c1 | nmdc:mga0a205_349196_c1_89_427 | 112 |
| 828 | 3300050515 | nmdc:mga0a205_43073_c1 | nmdc:mga0a205_43073_c1_2334_2672 | 112 |
| 829 | 3300050515 | nmdc:mga0a205_4479_c1 | nmdc:mga0a205_4479_c1_6460_6798 | 112 |
| 830 | 3300050515 | nmdc:mga0a205_656954_c1 | nmdc:mga0a205_656954_c1_331_669 | 112 |
| 831 | 3300050515 | nmdc:mga0a205_900161_c1 | nmdc:mga0a205_900161_c1_142_531 | 112 |
| 832 | 3300053093 | Ga0500651_0215093 | Ga0500651_0215093_443_781 | 112 |
| 833 | 3300053116 | Ga0500592_003315 | Ga0500592_003315_1042_1380 | 112 |
| 834 | 3300053134 | Ga0500658_0192469 | Ga0500658_0192469_336_674 | 112 |
| 835 | 3300054114 | Ga0501084_0015335 | Ga0501084_0015335_5451_5840 | 112 |
| 836 | 3300054114 | Ga0501084_0071498 | Ga0501084_0071498_870_1211 | 112 |
| 837 | 3300054114 | Ga0501084_0078915 | Ga0501084_0078915_456_794 | 112 |
| 838 | 3300054114 | Ga0501084_0177797 | Ga0501084_0177797_1344_1682 | 112 |
| 839 | 3300054114 | Ga0501084_0257038 | Ga0501084_0257038_1021_1359 | 112 |
| 840 | 3300059421 | Ga0590071_000384 | Ga0590071_000384_2590_2997 | 112 |
| 841 | 3300059421 | Ga0590071_061271 | Ga0590071_061271_142_531 | 112 |
| 842 | 3300059423 | Ga0590074_002233 | Ga0590074_002233_380_787 | 112 |
| 843 | 3300059424 | Ga0590075_000159 | Ga0590075_000159_8919_9326 | 112 |
| 844 | 3300059424 | Ga0590075_024801 | Ga0590075_024801_598_936 | 112 |
| 845 | 3300059424 | Ga0590075_040702 | Ga0590075_040702_688_1077 | 112 |
| 846 | 3300059426 | Ga0590077_000408 | Ga0590077_000408_9064_9471 | 112 |
| 847 | 3300059426 | Ga0590077_105449 | Ga0590077_105449_159_497 | 112 |
| 848 | 3300059426 | Ga0590077_148215 | Ga0590077_148215_159_497 | 112 |
| 849 | 3300060353 | Ga0501082_0042454 | Ga0501082_0042454_447_785 | 112 |
| 850 | 3300060353 | Ga0501082_0048845 | Ga0501082_0048845_2740_3078 | 112 |
| 851 | 3300060353 | Ga0501082_0126210 | Ga0501082_0126210_1367_1705 | 112 |
| 852 | 3300060353 | Ga0501082_0263433 | Ga0501082_0263433_646_987 | 112 |
| 853 | 3300060353 | Ga0501082_0268925 | Ga0501082_0268925_64_402 | 112 |
| 854 | 3300060353 | Ga0501082_0287132 | Ga0501082_0287132_142_480 | 112 |
| 855 | 3300060353 | Ga0501082_0383601 | Ga0501082_0383601_642_980 | 112 |
| 856 | 3300060353 | Ga0501082_0802020 | Ga0501082_0802020_194_532 | 112 |
| 857 | 3300060353 | Ga0501082_1763343 | Ga0501082_1763343_90_428 | 112 |
| 858 | 3300061734 | Ga0530510_0126736 | Ga0530510_0126736_634_972 | 112 |
| 859 | 3300061734 | Ga0530510_0214549 | Ga0530510_0214549_875_1213 | 112 |
| 860 | 3300061734 | Ga0530510_0684154 | Ga0530510_0684154_178_567 | 112 |
| 861 | 3300061734 | Ga0530510_0765871 | Ga0530510_0765871_316_654 | 112 |
| 862 | 3300061734 | Ga0530510_0898238 | Ga0530510_0898238_163_522 | 112 |
| 863 | 3300061734 | Ga0530510_0899995 | Ga0530510_0899995_317_655 | 112 |
| 864 | 3300061734 | Ga0530510_1447222 | Ga0530510_1447222_22_360 | 112 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3hhh-assembly1.cif.gz_B | crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 | 0.9288 | 11 | 108 |
| 3hhh-assembly1.cif.gz_A | crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 | 0.9276 | 11 | 110 |
| 1xma-assembly1.cif.gz_B-2 | structure of a transcriptional regulator from clostridium thermocellum cth-833 | 0.9246 | 8 | 107 |
| 1xma-assembly1.cif.gz_A | structure of a transcriptional regulator from clostridium thermocellum cth-833 | 0.9223 | 8 | 107 |
| 6abq-assembly1.cif.gz_A | crystal structure of transcription factor from listeria monocytogenes | 0.9188 | 11 | 108 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1xmaA00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9223 | 8 | 107 | 1.10.10.10 |
| af_Q2FUS4_1_110_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9002 | 13 | 110 | 1.10.10.10 |
| af_I6X7F9_1_101_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8992 | 13 | 112 | 1.10.10.10 |
| 1xmaA00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8885 | 8 | 107 | 1.10.10.10 |
| af_P71704_1_89_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8846 | 15 | 96 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4R1L5U4-F1-model_v4 | PadR family transcriptional regulator | 0.9951 | 13 | 112 |
|
| AF-A0A3E0P3D5-F1-model_v4 | PadR family transcriptional regulator | 0.9914 | 13 | 109 |
|
| AF-A0A3N5H0U7-F1-model_v4 | PadR family transcriptional regulator | 0.9896 | 10 | 109 |
|
| AF-A0A7S7SQC6-F1-model_v4 | PadR family transcriptional regulator | 0.9881 | 10 | 110 |
|
| AF-A0A7S7SJ63-F1-model_v4 | PadR family transcriptional regulator | 0.9874 | 9 | 108 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar