F483886

General Info

Members Datasets Scaffolds Average Seq Length
862 470 1724 134

Family's Representative Sequence

Representative Sequence 3300031241|Ga0265325_10041677|Ga0265325_100416772
Length 140
Sequence MDWNDIESPTLADFEDLARRAFEVLPQEFRALTGDIVFRIEDFPGDDVIRDMKLESGFDILGLFHGPRLADEIAGHVHGHQTMIFLYRRPILDYWAEHADTLGAIVRHVLIHEIGHHFGLSDDDMHGIEDNDLPSLKGRV

Samples

Sample ID Description Type Environment
1 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
5 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
65 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
66 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
67 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
68 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
69 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
70 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
71 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
72 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
73 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
74 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
75 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
76 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
77 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
86 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
87 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
88 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
93 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
96 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
104 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
105 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
106 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
107 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
108 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
109 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
110 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
111 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
112 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
113 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
114 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
115 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
116 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
117 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
118 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
119 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
120 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
121 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
122 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
124 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
126 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
185 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
186 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
187 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
188 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
189 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
190 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
191 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
192 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
193 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
194 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
195 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
196 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
197 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
198 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
199 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
200 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
201 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
202 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
203 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
204 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
205 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
206 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
207 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
208 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
209 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
210 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
211 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
212 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
213 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
214 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
215 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
216 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
217 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
218 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
219 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
220 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
221 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
222 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
223 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
224 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
225 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
226 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
227 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
228 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
229 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
230 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
231 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
232 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
233 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
234 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
235 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
236 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
237 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
238 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
239 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
240 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
241 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
242 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
243 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
244 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
245 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
246 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
247 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
248 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
249 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
250 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
251 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
252 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
253 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
254 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
255 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
256 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
257 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
258 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
259 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
260 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
261 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
262 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
263 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
264 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
265 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
266 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
267 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
268 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
269 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
270 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
271 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
272 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
273 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
274 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
275 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
276 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
277 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
278 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
279 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
280 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
281 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
282 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
283 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
284 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
285 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
286 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
287 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
288 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
289 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
290 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
291 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
292 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
293 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
294 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
295 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
296 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
297 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
298 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
299 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
300 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
301 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
302 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
303 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
304 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
305 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
306 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
307 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
308 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
309 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
310 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
311 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
312 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
313 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
314 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
315 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
316 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
317 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
318 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
319 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
320 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
321 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
322 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
323 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
324 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
325 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
326 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
327 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
328 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
329 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
330 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
331 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
332 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
333 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
334 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
335 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
336 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
337 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
338 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
339 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
340 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
341 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
342 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
343 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
344 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
345 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
346 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
347 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
348 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
349 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
350 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
351 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
352 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
353 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
354 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
355 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
356 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
357 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
358 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
359 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
360 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
361 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
362 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
363 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
364 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
365 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
366 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
367 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
368 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
369 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
370 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
371 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
372 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
373 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
374 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
375 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
376 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
377 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
378 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
379 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
380 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
381 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
382 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
383 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
384 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
385 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
386 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
387 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
388 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
389 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
390 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
391 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
392 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
393 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
394 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
395 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
396 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
397 3300053114 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 endosphere Metagenome Endosphere
398 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
399 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
400 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
401 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
402 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
403 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
404 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
405 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
406 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
407 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
408 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
409 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
410 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
411 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
412 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
413 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
414 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
415 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
416 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
417 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
418 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
419 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
420 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
421 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
422 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
423 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
424 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
425 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
426 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
427 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
428 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
429 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
430 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
431 2791355199
432 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
433 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
434 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
435 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
436 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
437 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
438 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
439 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
440 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
441 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
442 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
443 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
444 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
445 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
446 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
447 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
448 2906610324
449 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
450 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
451 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
452 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
453 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
454 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
455 2922425934
456 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
457 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
458 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
459 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
460 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
461 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
462 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
463 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
464 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
465 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
466 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
467 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
468 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
469 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
470 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.18
Metatranscriptomes 0.12
Isolates 5.7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.48
Nodule 3.83
Rhizoplane 7.89
Rhizosphere 68.33
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265325_10041677 3300031241 Bacteria 2405
2 LJQas_1008472 3300000549 Bacteria 1249
3 JGI25406J46586_10000267 3300003203 Bacteria 23237
4 Ga0055539_1013936 3300003752 Bacteria 983
5 JGI25405J52794_10152394 3300003911 Bacteria 527
6 Ga0065712_10322055 3300005290 Bacteria 827
7 Ga0065715_11153752 3300005293 Bacteria 508
8 Ga0070658_10268806 3300005327 Bacteria 1450
9 Ga0070658_10306974 3300005327 Bacteria 1353
10 Ga0070658_10437798 3300005327 Bacteria 1125
11 Ga0070683_100248803 3300005329 Bacteria 1690
12 Ga0070670_100043583 3300005331 Bacteria 3856
13 Ga0070670_100228412 3300005331 Bacteria 1619
14 Ga0070670_100379720 3300005331 Bacteria 1245
15 Ga0070670_101112715 3300005331 Bacteria 720
16 Ga0070670_101233727 3300005331 Bacteria 684
17 Ga0068869_100135857 3300005334 Bacteria 1895
18 Ga0068869_100422177 3300005334 Bacteria 1100
19 Ga0068869_101067167 3300005334 Bacteria 705
20 Ga0070666_10089882 3300005335 Bacteria 2108
21 Ga0070680_100505013 3300005336 Bacteria 1035
22 Ga0070682_100352611 3300005337 Bacteria 1097
23 Ga0070682_100433303 3300005337 Bacteria 1002
24 Ga0068868_100268228 3300005338 Bacteria 1441
25 Ga0068868_100626374 3300005338 Bacteria 955
26 Ga0068868_100763226 3300005338 Bacteria 870
27 Ga0070660_100394901 3300005339 Bacteria 1143
28 Ga0070660_100433119 3300005339 Bacteria 1090
29 Ga0070691_10086259 3300005341 Bacteria 1543
30 Ga0070692_10794409 3300005345 Bacteria 646
31 Ga0070668_100115244 3300005347 Bacteria 2142
32 Ga0070668_100275202 3300005347 Bacteria 1404
33 Ga0070669_100071036 3300005353 Bacteria 2574
34 Ga0070671_100036653 3300005355 Bacteria 4067
35 Ga0070671_100262215 3300005355 Bacteria 1469
36 Ga0070671_100378503 3300005355 Bacteria 1210
37 Ga0070671_100529035 3300005355 Bacteria 1016
38 Ga0070671_101508258 3300005355 Bacteria 595
39 Ga0070674_100697466 3300005356 Bacteria 867
40 Ga0070673_100446670 3300005364 Bacteria 1163
41 Ga0070673_101796223 3300005364 Bacteria 581
42 Ga0070659_100360941 3300005366 Bacteria 1220
43 Ga0070667_100203891 3300005367 Bacteria 1755
44 Ga0070667_100357857 3300005367 Bacteria 1322
45 Ga0070709_10007973 3300005434 Bacteria 5818
46 Ga0070709_10408148 3300005434 Bacteria 1016
47 Ga0070714_100411815 3300005435 Bacteria 1279
48 Ga0070714_100453482 3300005435 Bacteria 1218
49 Ga0070713_100023368 3300005436 Bacteria 4796
50 Ga0070713_100040826 3300005436 Bacteria 3775
51 Ga0070710_10017653 3300005437 Bacteria 3657
52 Ga0070701_10114625 3300005438 Bacteria 1510
53 Ga0070705_100173809 3300005440 Bacteria 1452
54 Ga0070705_101931987 3300005440 Bacteria 503
55 Ga0070700_100260040 3300005441 Bacteria 1249
56 Ga0070700_100341740 3300005441 Bacteria 1106
57 Ga0070708_100645398 3300005445 Bacteria 997
58 Ga0070663_100025546 3300005455 Bacteria 3989
59 Ga0070663_100046917 3300005455 Bacteria 3059
60 Ga0070663_100099843 3300005455 Bacteria 2164
61 Ga0070663_100107171 3300005455 Bacteria 2094
62 Ga0070663_100145797 3300005455 Bacteria 1811
63 Ga0070663_100256895 3300005455 Bacteria 1385
64 Ga0070663_101055439 3300005455 Bacteria 709
65 Ga0070678_100045734 3300005456 Bacteria 3133
66 Ga0070678_100098529 3300005456 Bacteria 2260
67 Ga0070678_100426946 3300005456 Bacteria 1156
68 Ga0070678_101164757 3300005456 Bacteria 714
69 Ga0070662_100144539 3300005457 Bacteria 1846
70 Ga0070685_10526028 3300005466 Bacteria 841
71 Ga0070706_100599485 3300005467 Bacteria 1024
72 Ga0070698_100410736 3300005471 Bacteria 1288
73 Ga0070698_101384311 3300005471 Bacteria 654
74 Ga0070699_100186540 3300005518 Bacteria 1842
75 Ga0070684_100624178 3300005535 Bacteria 1003
76 Ga0070697_100448462 3300005536 Bacteria 1124
77 Ga0070672_100396866 3300005543 Bacteria 1182
78 Ga0070695_100161388 3300005545 Bacteria 1573
79 Ga0070693_100053548 3300005547 Bacteria 2317
80 Ga0070665_100019468 3300005548 Bacteria 6812
81 Ga0070665_100026811 3300005548 Bacteria 5804
82 Ga0070665_100228807 3300005548 Bacteria 1859
83 Ga0070665_100520263 3300005548 Bacteria 1201
84 Ga0070665_100883618 3300005548 Bacteria 907
85 Ga0070665_100980298 3300005548 Bacteria 858
86 Ga0068855_100044540 3300005563 Bacteria 5250
87 Ga0068855_100752775 3300005563 Bacteria 1039
88 Ga0070664_100041068 3300005564 Bacteria 3902
89 Ga0068857_100013150 3300005577 Bacteria 7213
90 Ga0068857_100335719 3300005577 Bacteria 1398
91 Ga0068854_100756148 3300005578 Bacteria 844
92 Ga0068856_100037942 3300005614 Bacteria 4728
93 Ga0068856_100775655 3300005614 Bacteria 979
94 Ga0070702_100042955 3300005615 Bacteria 2545
95 Ga0070702_100400654 3300005615 Bacteria 981
96 Ga0068852_100032551 3300005616 Bacteria 4318
97 Ga0068852_100096090 3300005616 Bacteria 2662
98 Ga0068852_100118263 3300005616 Bacteria 2421
99 Ga0068852_101141327 3300005616 Bacteria 800
100 Ga0068859_100356087 3300005617 Bacteria 1558
101 Ga0068859_100363476 3300005617 Bacteria 1542
102 Ga0068859_100819729 3300005617 Bacteria 1017
103 Ga0068864_100038485 3300005618 Bacteria 4085
104 Ga0068864_100063118 3300005618 Bacteria 3210
105 Ga0068861_100052851 3300005719 Bacteria 3089
106 Ga0068861_100500345 3300005719 Bacteria 1098
107 Ga0068861_100698141 3300005719 Bacteria 942
108 Ga0068851_10870625 3300005834 Bacteria 563
109 Ga0068870_10112994 3300005840 Bacteria 1554
110 Ga0068863_100121644 3300005841 Bacteria 2489
111 Ga0068858_100064112 3300005842 Bacteria 3400
112 Ga0068858_100853035 3300005842 Bacteria 890
113 Ga0068860_100226689 3300005843 Bacteria 1815
114 Ga0068860_100729761 3300005843 Bacteria 1001
115 Ga0068862_100124557 3300005844 Bacteria 2274
116 Ga0068862_100256392 3300005844 Bacteria 1595
117 Ga0068862_100312540 3300005844 Bacteria 1448
118 Ga0068862_100710312 3300005844 Bacteria 974
119 Ga0081455_10081456 3300005937 Bacteria 2651
120 Ga0081455_10130669 3300005937 Bacteria 1964
121 Ga0081455_10243560 3300005937 Bacteria 1320
122 Ga0081538_10045135 3300005981 Bacteria 2736
123 Ga0081540_1006252 3300005983 Bacteria 8720
124 Ga0081540_1023509 3300005983 Bacteria 3602
125 Ga0081540_1123921 3300005983 Bacteria 1067
126 Ga0081540_1179937 3300005983 Bacteria 793
127 Ga0081539_10000265 3300005985 Bacteria 120457
128 Ga0081539_10042243 3300005985 Bacteria 2658
129 Ga0070717_10007759 3300006028 Bacteria 7984
130 Ga0070717_10371398 3300006028 Bacteria 1281
131 Ga0070717_10552693 3300006028 Bacteria 1043
132 Ga0075365_10033153 3300006038 Bacteria 3325
133 Ga0075365_10180540 3300006038 Bacteria 1476
134 Ga0075368_10084576 3300006042 Bacteria 1293
135 Ga0075368_10207669 3300006042 Bacteria 830
136 Ga0075363_100122836 3300006048 Bacteria 1451
137 Ga0075432_10173588 3300006058 Bacteria 840
138 Ga0075432_10297558 3300006058 Bacteria 669
139 Ga0070716_100042649 3300006173 Bacteria 2533
140 Ga0070712_100016641 3300006175 Bacteria 4751
141 Ga0070712_100167285 3300006175 Bacteria 1703
142 Ga0075362_10107329 3300006177 Bacteria 1311
143 Ga0075362_10164158 3300006177 Bacteria 1070
144 Ga0075362_10315016 3300006177 Bacteria 778
145 Ga0075367_10032933 3300006178 Bacteria 2984
146 Ga0075367_10033622 3300006178 Bacteria 2957
147 Ga0075367_10215386 3300006178 Bacteria 1201
148 Ga0075369_10037635 3300006186 Bacteria 2062
149 Ga0075369_10041261 3300006186 Bacteria 1975
150 Ga0075369_10245212 3300006186 Bacteria 831
151 Ga0075369_10262174 3300006186 Bacteria 803
152 Ga0075369_10436176 3300006186 Bacteria 619
153 Ga0075366_10036815 3300006195 Bacteria 2885
154 Ga0075366_10056586 3300006195 Bacteria 2329
155 Ga0075366_10317379 3300006195 Bacteria 954
156 Ga0075366_10417301 3300006195 Bacteria 826
157 Ga0097621_100219423 3300006237 Bacteria 1656
158 Ga0097621_100407006 3300006237 Bacteria 1219
159 Ga0075370_10017420 3300006353 Bacteria 3882
160 Ga0075370_10050099 3300006353 Bacteria 2368
161 Ga0068871_100082322 3300006358 Bacteria 2668
162 Ga0068871_100225368 3300006358 Bacteria 1625
163 Ga0068871_100408230 3300006358 Bacteria 1211
164 Ga0075433_11298512 3300006852 Bacteria 631
165 Ga0075434_100813156 3300006871 Bacteria 950
166 Ga0068865_100292554 3300006881 Bacteria 1301
167 Ga0097620_100356073 3300006931 Bacteria 1558
168 Ga0097620_100363497 3300006931 Bacteria 1542
169 Ga0097620_100819739 3300006931 Bacteria 1017
170 Ga0075435_100090655 3300007076 Bacteria 2522
171 Ga0075435_100625430 3300007076 Bacteria 934
172 Ga0099794_10494659 3300007265 Bacteria 643
173 Ga0105244_10554302 3300009036 Bacteria 529
174 Ga0105250_10066224 3300009092 Bacteria 1457
175 Ga0105240_10652145 3300009093 Bacteria 1153
176 Ga0111539_10173283 3300009094 Bacteria 2521
177 Ga0111539_12770377 3300009094 Bacteria 568
178 Ga0111539_13249964 3300009094 Bacteria 524
179 Ga0105245_10070499 3300009098 Bacteria 3172
180 Ga0105245_10528981 3300009098 Bacteria 1198
181 Ga0105245_10560475 3300009098 Bacteria 1165
182 Ga0105245_10897434 3300009098 Bacteria 928
183 Ga0105247_10035861 3300009101 Bacteria 3024
184 Ga0105247_10338241 3300009101 Bacteria 1055
185 Ga0105247_10373172 3300009101 Bacteria 1009
186 Ga0114129_10196535 3300009147 Bacteria 2735
187 Ga0114129_10607383 3300009147 Bacteria 1416
188 Ga0114129_11258853 3300009147 Bacteria 919
189 Ga0105243_10099928 3300009148 Bacteria 2406
190 Ga0105243_10316106 3300009148 Bacteria 1421
191 Ga0105243_10849617 3300009148 Bacteria 904
192 Ga0105243_12397446 3300009148 Bacteria 566
193 Ga0105241_10087440 3300009174 Bacteria 2453
194 Ga0105241_10631480 3300009174 Bacteria 971
195 Ga0105241_11345393 3300009174 Bacteria 682
196 Ga0105242_10316424 3300009176 Bacteria 1430
197 Ga0105242_10887059 3300009176 Bacteria 891
198 Ga0105248_10137023 3300009177 Bacteria 2761
199 Ga0105248_10216059 3300009177 Bacteria 2159
200 Ga0105248_10259343 3300009177 Bacteria 1957
201 Ga0105248_10467212 3300009177 Bacteria 1422
202 Ga0105248_10801190 3300009177 Bacteria 1063
203 Ga0105248_11858729 3300009177 Bacteria 683
204 Ga0105237_10116992 3300009545 Bacteria 2659
205 Ga0105237_10190250 3300009545 Bacteria 2052
206 Ga0105238_10147178 3300009551 Bacteria 2331
207 Ga0105238_10445030 3300009551 Bacteria 1292
208 Ga0105238_10714830 3300009551 Bacteria 1014
209 Ga0105238_10856705 3300009551 Bacteria 926
210 Ga0105249_10536201 3300009553 Bacteria 1219
211 Ga0105249_10863827 3300009553 Bacteria 971
212 Ga0105249_12091081 3300009553 Bacteria 639
213 Ga0105249_12194574 3300009553 Bacteria 625
214 Ga0099796_10048554 3300010159 Bacteria 1464
215 Ga0105239_10150620 3300010375 Bacteria 2596
216 Ga0105239_10236077 3300010375 Bacteria 2052
217 Ga0105239_10444894 3300010375 Bacteria 1470
218 Ga0105239_12067842 3300010375 Bacteria 662
219 Ga0105246_10069159 3300011119 Bacteria 2479
220 Ga0105246_10278805 3300011119 Bacteria 1340
221 Ga0105246_10459937 3300011119 Bacteria 1072
222 Ga0157329_1011949 3300012491 Bacteria 704
223 Ga0157314_1050987 3300012500 Bacteria 529
224 Ga0157339_1013349 3300012505 Bacteria 784
225 Ga0157369_10782377 3300013105 Bacteria 981
226 Ga0157369_11066333 3300013105 Bacteria 826
227 Ga0157374_10071271 3300013296 Bacteria 3276
228 Ga0157374_11036875 3300013296 Bacteria 840
229 Ga0157378_10113937 3300013297 Bacteria 2483
230 Ga0157378_10275323 3300013297 Bacteria 1620
231 Ga0157378_10594613 3300013297 Bacteria 1117
232 Ga0157378_10710000 3300013297 Bacteria 1025
233 Ga0163162_10134527 3300013306 Bacteria 2583
234 Ga0163162_10286868 3300013306 Bacteria 1778
235 Ga0163162_11196539 3300013306 Bacteria 862
236 Ga0157372_10796874 3300013307 Bacteria 1098
237 Ga0157375_10217822 3300013308 Bacteria 2067
238 Ga0157375_11254422 3300013308 Bacteria 870
239 Ga0157375_12136550 3300013308 Bacteria 667
240 Ga0163163_10290379 3300014325 Bacteria 1687
241 Ga0163163_10434155 3300014325 Bacteria 1373
242 Ga0163163_10731134 3300014325 Bacteria 1053
243 Ga0157380_10168471 3300014326 Bacteria 1911
244 Ga0157380_12592011 3300014326 Bacteria 573
245 Ga0157377_10403341 3300014745 Bacteria 932
246 Ga0157377_10515258 3300014745 Bacteria 838
247 Ga0157379_10060438 3300014968 Bacteria 3388
248 Ga0157379_10187266 3300014968 Bacteria 1870
249 Ga0157379_10479099 3300014968 Bacteria 1151
250 Ga0157379_11565200 3300014968 Bacteria 643
251 Ga0157376_10227729 3300014969 Bacteria 1730
252 Ga0157376_10327052 3300014969 Bacteria 1459
253 Ga0157376_10629321 3300014969 Bacteria 1071
254 Ga0182007_10170710 3300015262 Bacteria 748
255 Ga0163161_10557869 3300017792 Bacteria 940
256 Ga0154015_1467715 3300020610 Bacteria 1098
257 Ga0213875_10236491 3300021388 Bacteria 861
258 Ga0209677_100170 3300025253 Bacteria 55896
259 Ga0209233_1009059 3300025261 Bacteria 3045
260 Ga0209455_1011291 3300025272 Bacteria 2208
261 Ga0209758_1001436 3300025297 Bacteria 28156
262 Ga0209758_1011392 3300025297 Bacteria 5158
263 Ga0207697_10149627 3300025315 Bacteria 1015
264 Ga0207697_10162136 3300025315 Bacteria 976
265 Ga0207692_10050758 3300025898 Bacteria 2099
266 Ga0207642_10045113 3300025899 Bacteria 1955
267 Ga0207710_10067396 3300025900 Bacteria 1635
268 Ga0207710_10500979 3300025900 Bacteria 630
269 Ga0207688_10207569 3300025901 Bacteria 1176
270 Ga0207680_10075528 3300025903 Bacteria 2102
271 Ga0207699_10149592 3300025906 Bacteria 1543
272 Ga0207645_10319658 3300025907 Bacteria 1035
273 Ga0207645_10945154 3300025907 Bacteria 585
274 Ga0207643_10049057 3300025908 Bacteria 2392
275 Ga0207705_10664185 3300025909 Bacteria 810
276 Ga0207684_10422950 3300025910 Bacteria 1145
277 Ga0207654_10149293 3300025911 Bacteria 1499
278 Ga0207695_10489286 3300025913 Bacteria 1112
279 Ga0207671_10108915 3300025914 Bacteria 2106
280 Ga0207693_10020364 3300025915 Bacteria 5277
281 Ga0207693_10026947 3300025915 Bacteria 4546
282 Ga0207663_10015460 3300025916 Bacteria 4211
283 Ga0207657_10504076 3300025919 Bacteria 948
284 Ga0207649_10526886 3300025920 Bacteria 901
285 Ga0207646_10565610 3300025922 Bacteria 1022
286 Ga0207694_10497096 3300025924 Bacteria 1021
287 Ga0207694_10498949 3300025924 Bacteria 1019
288 Ga0207650_10478129 3300025925 Bacteria 1039
289 Ga0207650_11064549 3300025925 Bacteria 688
290 Ga0207687_10194551 3300025927 Bacteria 1581
291 Ga0207700_10066255 3300025928 Bacteria 2760
292 Ga0207700_10100327 3300025928 Bacteria 2307
293 Ga0207664_10146070 3300025929 Bacteria 2005
294 Ga0207664_10976575 3300025929 Bacteria 759
295 Ga0207644_10123488 3300025931 Bacteria 1974
296 Ga0207644_10265438 3300025931 Bacteria 1374
297 Ga0207644_10445847 3300025931 Bacteria 1063
298 Ga0207644_11355393 3300025931 Bacteria 598
299 Ga0207706_10206403 3300025933 Bacteria 1723
300 Ga0207706_10454914 3300025933 Bacteria 1107
301 Ga0207686_10344649 3300025934 Bacteria 1120
302 Ga0207686_11330550 3300025934 Bacteria 590
303 Ga0207709_10084693 3300025935 Bacteria 2053
304 Ga0207670_10591441 3300025936 Bacteria 910
305 Ga0207665_10012221 3300025939 Bacteria 5639
306 Ga0207665_10493424 3300025939 Bacteria 945
307 Ga0207711_10074936 3300025941 Bacteria 2944
308 Ga0207711_10146482 3300025941 Bacteria 2128
309 Ga0207711_11233417 3300025941 Bacteria 689
310 Ga0207689_10029537 3300025942 Bacteria 4577
311 Ga0207689_10069376 3300025942 Bacteria 2896
312 Ga0207689_10256452 3300025942 Bacteria 1446
313 Ga0207689_10304979 3300025942 Bacteria 1320
314 Ga0207661_10371870 3300025944 Bacteria 1292
315 Ga0207661_10673779 3300025944 Bacteria 951
316 Ga0207679_11178141 3300025945 Bacteria 703
317 Ga0207679_11482815 3300025945 Bacteria 622
318 Ga0207667_10095652 3300025949 Bacteria 3066
319 Ga0207651_11353276 3300025960 Bacteria 640
320 Ga0207712_10984491 3300025961 Bacteria 748
321 Ga0207668_10529992 3300025972 Bacteria 1017
322 Ga0207668_10733449 3300025972 Bacteria 870
323 Ga0207668_10738940 3300025972 Bacteria 867
324 Ga0207640_10668173 3300025981 Bacteria 887
325 Ga0207658_10199849 3300025986 Bacteria 1668
326 Ga0207658_10598753 3300025986 Bacteria 990
327 Ga0207677_10044527 3300026023 Bacteria 2958
328 Ga0207677_10718270 3300026023 Bacteria 888
329 Ga0207677_11064044 3300026023 Bacteria 736
330 Ga0207703_10420058 3300026035 Bacteria 1244
331 Ga0207703_10444951 3300026035 Bacteria 1209
332 Ga0207703_10511532 3300026035 Bacteria 1128
333 Ga0207639_10988976 3300026041 Bacteria 788
334 Ga0207639_11414957 3300026041 Bacteria 653
335 Ga0207678_10047183 3300026067 Bacteria 3725
336 Ga0207678_10065331 3300026067 Bacteria 3124
337 Ga0207678_10092873 3300026067 Bacteria 2579
338 Ga0207678_10112340 3300026067 Bacteria 2324
339 Ga0207678_10120455 3300026067 Bacteria 2239
340 Ga0207678_10134248 3300026067 Bacteria 2112
341 Ga0207678_10383895 3300026067 Bacteria 1214
342 Ga0207678_11018387 3300026067 Bacteria 733
343 Ga0207708_10521034 3300026075 Bacteria 999
344 Ga0207702_10394624 3300026078 Bacteria 1333
345 Ga0207702_10707616 3300026078 Bacteria 993
346 Ga0207641_10523876 3300026088 Bacteria 1153
347 Ga0207648_10496367 3300026089 Bacteria 1116
348 Ga0207648_11525987 3300026089 Bacteria 628
349 Ga0207676_10118366 3300026095 Bacteria 2229
350 Ga0207676_10694145 3300026095 Bacteria 985
351 Ga0207674_10005754 3300026116 Bacteria 14710
352 Ga0207674_10518282 3300026116 Bacteria 1152
353 Ga0207675_100107503 3300026118 Bacteria 2630
354 Ga0207675_100937490 3300026118 Bacteria 883
355 Ga0207683_10049009 3300026121 Bacteria 3696
356 Ga0207683_10100369 3300026121 Bacteria 2584
357 Ga0207683_10722337 3300026121 Bacteria 924
358 Ga0207683_10744482 3300026121 Bacteria 909
359 Ga0207698_10055584 3300026142 Bacteria 3052
360 Ga0207698_10941806 3300026142 Bacteria 872
361 Ga0209179_1024243 3300027512 Bacteria 1203
362 Ga0209588_1134954 3300027671 Bacteria 786
363 Ga0268266_10001236 3300028379 Bacteria 31292
364 Ga0268266_10025196 3300028379 Bacteria 5062
365 Ga0268266_10305394 3300028379 Bacteria 1485
366 Ga0268266_10372915 3300028379 Bacteria 1344
367 Ga0268266_10855693 3300028379 Bacteria 879
368 Ga0268266_11099407 3300028379 Bacteria 769
369 Ga0268266_11485022 3300028379 Bacteria 653
370 Ga0268265_10251303 3300028380 Bacteria 1566
371 Ga0268265_10599504 3300028380 Bacteria 1052
372 Ga0268265_10666544 3300028380 Bacteria 1001
373 Ga0268264_10373654 3300028381 Bacteria 1363
374 Ga0268264_11196941 3300028381 Bacteria 769
375 Ga0307517_10000175 3300028786 Bacteria 105567
376 Ga0307515_10042883 3300028794 Bacteria 7056
377 Ga0307515_10219842 3300028794 Bacteria 1721
378 Ga0307515_10899078 3300028794 Bacteria 516
379 Ga0307512_10352246 3300030522 Bacteria 648
380 Ga0265320_10020059 3300031240 Bacteria 3634
381 Ga0265325_10003538 3300031241 Bacteria 10155
382 Ga0265340_10279235 3300031247 Bacteria 742
383 Ga0265339_10129731 3300031249 Bacteria 1290
384 Ga0307513_10169962 3300031456 Bacteria 2059
385 Ga0307513_10305950 3300031456 Bacteria 1354
386 Ga0307513_10570292 3300031456 Bacteria 843
387 Ga0307408_100125250 3300031548 Bacteria 1997
388 Ga0307508_10040818 3300031616 Bacteria 4166
389 Ga0265314_10036382 3300031711 Bacteria 3578
390 Ga0307516_10063591 3300031730 Bacteria 3572
391 Ga0307516_10154107 3300031730 Bacteria 2055
392 Ga0307516_10686875 3300031730 Bacteria 680
393 Ga0307405_10156778 3300031731 Bacteria 1608
394 Ga0307405_10543809 3300031731 Bacteria 939
395 Ga0307405_10710094 3300031731 Bacteria 833
396 Ga0307410_10692057 3300031852 Bacteria 859
397 Ga0326468_10096173 3300031889 Bacteria 538
398 Ga0307406_10261020 3300031901 Bacteria 1310
399 Ga0307406_10420233 3300031901 Bacteria 1065
400 Ga0307406_10823193 3300031901 Bacteria 785
401 Ga0307406_11503294 3300031901 Bacteria 593
402 Ga0307407_11054548 3300031903 Bacteria 630
403 Ga0307409_100212249 3300031995 Bacteria 1740
404 Ga0307416_101141486 3300032002 Bacteria 884
405 Ga0307416_101297610 3300032002 Bacteria 834
406 Ga0307416_101426070 3300032002 Bacteria 798
407 Ga0307415_100143669 3300032126 Bacteria 1826
408 Ga0307415_100551582 3300032126 Bacteria 1017
409 Ga0307415_100655650 3300032126 Bacteria 941
410 Ga0307510_10013138 3300033180 Bacteria 9823
411 Ga0307510_10102993 3300033180 Bacteria 2634
412 Ga0307510_10122359 3300033180 Bacteria 2302
413 Ga0307510_10161143 3300033180 Bacteria 1840
414 Ga0373958_0151579 3300034819 Bacteria 581
415 Ga0373938_0161339 3300034957 Bacteria 602
416 Ga0373928_0064578 3300035084 Bacteria 892
417 Ga0373940_0244580 3300035088 Bacteria 603
418 Ga0373932_0241069 3300035112 Bacteria 657
419 Ga0373932_0305138 3300035112 Bacteria 595
420 Ga0373936_0006935 3300035113 Bacteria 4264
421 Ga0373939_0269542 3300035114 Bacteria 669
422 Ga0373945_0186173 3300035116 Bacteria 857
423 Ga0373953_0193853 3300035117 Bacteria 878
424 Ga0373953_0220497 3300035117 Bacteria 822
425 Ga0373954_0014658 3300035118 Bacteria 3497
426 Ga0373956_0047354 3300035119 Bacteria 1923
427 Ga0373957_0193924 3300035120 Bacteria 845
428 Ga0373943_0030231 3300035170 Bacteria 2563
429 Ga0373955_0376677 3300035172 Bacteria 861
430 Ga0373942_0130380 3300035207 Bacteria 793
431 Ga0373962_0101455 3300035242 Bacteria 898
432 Ga0373924_0274740 3300035410 Bacteria 747
433 Ga0373931_0305610 3300035691 Bacteria 983
434 Ga0373931_0878444 3300035691 Bacteria 601
435 Ga0373935_0511586 3300035692 Bacteria 872
436 Ga0373935_1391637 3300035692 Bacteria 524
437 Ga0373927_0001972 3300035695 Bacteria 15136
438 Ga0373927_0069619 3300035695 Bacteria 2277
439 Ga0373927_0088515 3300035695 Bacteria 2010
440 Ga0373933_0008750 3300035724 Bacteria 5518
441 Ga0373933_0063756 3300035724 Bacteria 2228
442 Ga0373947_0407338 3300035725 Bacteria 918
443 Ga0373947_0815725 3300035725 Bacteria 637
444 Ga0373937_0038449 3300036401 Bacteria 4359
445 Ga0373925_1140984 3300037068 Bacteria 641
446 Ga0395898_0890894 3300037466 Bacteria 828
447 Ga0395901_0462213 3300038443 Bacteria 1297
448 Ga0436365_0653292 3300039437 Bacteria 723
449 Ga0436365_1106987 3300039437 Bacteria 2928
450 Ga0436363_1288101 3300039450 Bacteria 680
451 Ga0451787_812520 3300041441 Bacteria 510
452 Ga0451789_1152664 3300041443 Bacteria 678
453 Ga0451793_0424926 3300041452 Bacteria 974
454 Ga0451793_1522198 3300041452 Bacteria 761
455 Ga0451795_0719483 3300041456 Bacteria 803
456 Ga0451798_0642453 3300041458 Bacteria 669
457 Ga0451802_0616298 3300041460 Bacteria 618
458 Ga0451839_0289012 3300041496 Bacteria 686
459 Ga0451845_0938506 3300041501 Bacteria 696
460 Ga0451847_0631731 3300041503 Bacteria 639
461 Ga0451843_1467111 3300041509 Bacteria 989
462 Ga0451853_2484189 3300041512 Bacteria 1134
463 Ga0451853_3334213 3300041512 Bacteria 732
464 Ga0439458_0109390 3300042157 Bacteria 722
465 Ga0439459_0071388 3300042438 Bacteria 804
466 Ga0439440_0095890 3300042993 Bacteria 802
467 Ga0466969_0210708 3300044656 Bacteria 885
468 Ga0466963_0396653 3300044694 Bacteria 973
469 Ga0466957_0362987 3300044842 Bacteria 985
470 Ga0466960_0517177 3300044901 Bacteria 701
471 Ga0466967_1315650 3300045976 Bacteria 720
472 Ga0495592_0059830 3300046454 Bacteria 2803
473 Ga0495592_0267180 3300046454 Bacteria 1124
474 Ga0495603_0028072 3300046455 Bacteria 3394
475 Ga0495603_0031664 3300046455 Bacteria 3184
476 Ga0495603_0051650 3300046455 Bacteria 2442
477 Ga0495603_0468312 3300046455 Bacteria 721
478 Ga0495603_0571334 3300046455 Bacteria 647
479 Ga0495590_0318447 3300046457 Bacteria 587
480 Ga0495629_0004556 3300046459 Bacteria 10367
481 Ga0495629_0173842 3300046459 Bacteria 1494
482 Ga0495629_0278574 3300046459 Bacteria 1148
483 Ga0495638_0043028 3300046460 Bacteria 2850
484 Ga0495638_0199422 3300046460 Bacteria 1131
485 Ga0495638_0204171 3300046460 Bacteria 1114
486 Ga0495641_0084827 3300046461 Bacteria 1418
487 Ga0495651_0008073 3300046462 Bacteria 8071
488 Ga0495653_0028022 3300046463 Bacteria 4508
489 Ga0495650_0155875 3300046471 Bacteria 817
490 Ga0495650_0193452 3300046471 Bacteria 710
491 Ga0495580_0088594 3300046472 Bacteria 2155
492 Ga0495580_0309490 3300046472 Bacteria 1075
493 Ga0495580_0390809 3300046472 Bacteria 939
494 Ga0495580_0598370 3300046472 Bacteria 729
495 Ga0495582_0214765 3300046473 Bacteria 1100
496 Ga0495639_0211535 3300046475 Bacteria 951
497 Ga0495639_0245059 3300046475 Bacteria 885
498 Ga0495639_0247284 3300046475 Bacteria 881
499 Ga0495662_0298511 3300046476 Bacteria 793
500 Ga0495662_0487907 3300046476 Bacteria 604
501 Ga0495664_0011415 3300046477 Bacteria 5008
502 Ga0495664_0030878 3300046477 Bacteria 3140
503 Ga0495664_0246079 3300046477 Bacteria 1081
504 Ga0495664_0255921 3300046477 Bacteria 1059
505 Ga0495584_0180980 3300046491 Bacteria 1071
506 Ga0495584_0480703 3300046491 Bacteria 632
507 Ga0495584_0511579 3300046491 Bacteria 612
508 Ga0495584_0617530 3300046491 Bacteria 553
509 Ga0495584_0697729 3300046491 Bacteria 517
510 Ga0495585_0388396 3300046492 Bacteria 673
511 Ga0495594_0118997 3300046499 Bacteria 1492
512 Ga0495596_0243144 3300046500 Bacteria 699
513 Ga0495606_0000831 3300046507 Bacteria 46699
514 Ga0495616_0112684 3300046513 Bacteria 1262
515 Ga0495618_0029859 3300046514 Bacteria 3402
516 Ga0495628_0086962 3300046516 Bacteria 2423
517 Ga0495630_0330416 3300046517 Bacteria 1166
518 Ga0495630_0438789 3300046517 Bacteria 1000
519 Ga0495630_0699386 3300046517 Bacteria 776
520 Ga0495631_0144431 3300046518 Bacteria 1021
521 Ga0495631_0192085 3300046518 Bacteria 874
522 Ga0495637_0115719 3300046520 Bacteria 1036
523 Ga0495643_0227371 3300046522 Bacteria 881
524 Ga0495644_0037619 3300046523 Bacteria 1826
525 Ga0495663_0033772 3300046525 Bacteria 1529
526 Ga0495663_0334947 3300046525 Bacteria 549
527 Ga0495666_0357232 3300046526 Bacteria 658
528 Ga0495642_0158481 3300046528 Bacteria 981
529 Ga0495652_0006237 3300046529 Bacteria 11118
530 Ga0495654_0130271 3300046530 Bacteria 1130
531 Ga0495665_0158049 3300046531 Bacteria 1182
532 Ga0495640_0025782 3300046533 Bacteria 4258
533 Ga0495640_0118923 3300046533 Bacteria 1719
534 Ga0495586_0240317 3300046535 Bacteria 1032
535 Ga0495586_0420559 3300046535 Bacteria 770
536 Ga0495587_0220454 3300046536 Bacteria 1070
537 Ga0495598_0020197 3300046537 Bacteria 1756
538 Ga0495621_0112441 3300046539 Bacteria 1045
539 Ga0495621_0225087 3300046539 Bacteria 760
540 Ga0495622_0026867 3300046557 Bacteria 2686
541 Ga0495633_0078834 3300046558 Bacteria 1533
542 Ga0495633_0106593 3300046558 Bacteria 1300
543 Ga0495656_0023665 3300046615 Bacteria 2419
544 Ga0495656_0179397 3300046615 Bacteria 1040
545 Ga0495656_0209092 3300046615 Bacteria 971
546 Ga0495656_0312708 3300046615 Bacteria 807
547 Ga0495668_0101817 3300046616 Bacteria 1571
548 Ga0495668_0180847 3300046616 Bacteria 1155
549 Ga0495668_0230431 3300046616 Bacteria 1014
550 Ga0495668_0432009 3300046616 Bacteria 724
551 Ga0495634_0002973 3300046642 Bacteria 13828
552 Ga0495634_0091048 3300046642 Bacteria 1980
553 Ga0495634_0111538 3300046642 Bacteria 1758
554 Ga0495634_0493641 3300046642 Bacteria 718
555 Ga0495611_0240590 3300046648 Bacteria 840
556 Ga0495611_0253606 3300046648 Bacteria 815
557 Ga0495611_0301629 3300046648 Bacteria 738
558 Ga0495625_0351792 3300046660 Bacteria 931
559 Ga0495625_0467659 3300046660 Bacteria 776
560 Ga0495625_0474978 3300046660 Bacteria 768
561 Ga0495635_0009194 3300046663 Bacteria 6901
562 Ga0495659_0027069 3300046664 Bacteria 1975
563 Ga0495661_0147555 3300046665 Bacteria 1273
564 Ga0495588_0016078 3300046674 Bacteria 3611
565 Ga0495588_0450574 3300046674 Bacteria 675
566 Ga0495657_0013089 3300046675 Bacteria 6132
567 Ga0495599_0019404 3300046678 Bacteria 4238
568 Ga0495599_0817466 3300046678 Bacteria 532
569 Ga0495623_0001696 3300046679 Bacteria 14806
570 Ga0495623_0269539 3300046679 Bacteria 951
571 Ga0495623_0443063 3300046679 Bacteria 693
572 Ga0495623_0645072 3300046679 Bacteria 546
573 Ga0495646_0017448 3300046680 Bacteria 4553
574 Ga0495647_0028480 3300046681 Bacteria 2060
575 Ga0495647_0037683 3300046681 Bacteria 1826
576 Ga0495647_0111357 3300046681 Bacteria 1143
577 Ga0495647_0194708 3300046681 Bacteria 887
578 Ga0495658_0587986 3300046683 Bacteria 713
579 Ga0495669_0357652 3300046684 Bacteria 706
580 Ga0495669_0369147 3300046684 Bacteria 694
581 Ga0495613_0332590 3300046689 Bacteria 1047
582 Ga0495624_0331548 3300046690 Bacteria 916
583 Ga0495671_0346496 3300046692 Bacteria 712
584 Ga0495660_0402619 3300046810 Bacteria 599
585 Ga0495581_0052805 3300047315 Bacteria 2348
586 Ga0495581_0092788 3300047315 Bacteria 1752
587 Ga0495581_0115919 3300047315 Bacteria 1558
588 Ga0495581_0687753 3300047315 Bacteria 590
589 Ga0495604_0002530 3300047317 Bacteria 14585
590 Ga0495636_0389522 3300047318 Bacteria 662
591 Ga0495674_0172268 3300047319 Bacteria 1805
592 Ga0495674_0347712 3300047319 Bacteria 1204
593 Ga0495672_0047426 3300047320 Bacteria 2555
594 Ga0495672_0102007 3300047320 Bacteria 1554
595 Ga0495676_0094051 3300047321 Bacteria 2234
596 Ga0495676_0298823 3300047321 Bacteria 1086
597 Ga0495676_0419059 3300047321 Bacteria 886
598 Ga0495680_0000483 3300047322 Bacteria 44818
599 Ga0495683_0099561 3300047323 Bacteria 1399
600 Ga0495683_0273397 3300047323 Bacteria 734
601 Ga0495679_050853 3300047446 Bacteria 1245
602 Ga0495685_039477 3300047447 Bacteria 1616
603 Ga0495681_0130751 3300047470 Bacteria 1069
604 Ga0495684_0027128 3300047471 Bacteria 4397
605 Ga0495686_0093058 3300047472 Bacteria 1828
606 Ga0495686_0129236 3300047472 Bacteria 1499
607 Ga0495593_0016387 3300047673 Bacteria 4181
608 Ga0495593_0249304 3300047673 Bacteria 889
609 Ga0495602_0111256 3300048088 Bacteria 2224
610 Ga0495602_0676905 3300048088 Bacteria 702
611 Ga0495615_0043313 3300048090 Bacteria 1132
612 Ga0495626_0161233 3300048091 Bacteria 940
613 Ga0496100_0091454 3300048903 Bacteria 2077
614 Ga0496100_0188290 3300048903 Bacteria 1497
615 Ga0496101_0008819 3300048904 Bacteria 6598
616 Ga0496101_0077845 3300048904 Bacteria 2445
617 Ga0496101_0659971 3300048904 Bacteria 826
618 Ga0496102_0099110 3300048905 Bacteria 2704
619 Ga0496102_0542658 3300048905 Bacteria 1085
620 Ga0496102_0922994 3300048905 Bacteria 794
621 Ga0496103_0145272 3300048906 Bacteria 1518
622 Ga0496103_0189792 3300048906 Bacteria 1321
623 Ga0496103_0220829 3300048906 Bacteria 1219
624 Ga0496103_0792696 3300048906 Bacteria 598
625 Ga0496104_0195025 3300048907 Bacteria 1937
626 Ga0496105_0056309 3300048908 Bacteria 3245
627 Ga0496105_0410729 3300048908 Bacteria 1073
628 Ga0496105_0471721 3300048908 Bacteria 988
629 Ga0496106_0006134 3300048909 Bacteria 8889
630 Ga0496106_0190468 3300048909 Bacteria 1631
631 Ga0496106_0262339 3300048909 Bacteria 1382
632 Ga0496106_0455328 3300048909 Bacteria 1028
633 Ga0496106_1047571 3300048909 Bacteria 640
634 Ga0496106_1395528 3300048909 Bacteria 541
635 Ga0496107_0002790 3300048910 Bacteria 11524
636 Ga0496107_0017396 3300048910 Bacteria 5057
637 Ga0496107_0018608 3300048910 Bacteria 4892
638 Ga0496107_0373171 3300048910 Bacteria 1061
639 Ga0496108_0000309 3300048911 Bacteria 41957
640 Ga0496108_0067396 3300048911 Bacteria 3019
641 Ga0496108_0351844 3300048911 Bacteria 1285
642 Ga0496109_0000229 3300048912 Bacteria 54733
643 Ga0496109_0253179 3300048912 Bacteria 1658
644 Ga0496109_0334006 3300048912 Bacteria 1431
645 Ga0496110_0011598 3300048913 Bacteria 7224
646 Ga0496110_0038304 3300048913 Bacteria 4171
647 Ga0496110_0038809 3300048913 Bacteria 4145
648 Ga0496110_0179946 3300048913 Bacteria 1920
649 Ga0496110_0183814 3300048913 Bacteria 1898
650 Ga0496111_0179407 3300048914 Bacteria 1574
651 Ga0496111_0593602 3300048914 Bacteria 811
652 Ga0496111_0775263 3300048914 Bacteria 695
653 Ga0496111_0886103 3300048914 Bacteria 643
654 Ga0496112_0000018 3300048915 Bacteria 188820
655 Ga0496112_0074725 3300048915 Bacteria 3351
656 Ga0496112_0077238 3300048915 Bacteria 3293
657 Ga0496112_0146879 3300048915 Bacteria 2326
658 Ga0496112_0157177 3300048915 Bacteria 2240
659 Ga0496112_1568698 3300048915 Bacteria 572
660 Ga0496113_0024174 3300048916 Bacteria 4315
661 Ga0496113_0114048 3300048916 Bacteria 2107
662 Ga0496113_0288757 3300048916 Bacteria 1312
663 Ga0496113_0304449 3300048916 Bacteria 1276
664 Ga0496113_0533818 3300048916 Bacteria 941
665 Ga0496114_0085739 3300048917 Bacteria 2668
666 Ga0496114_0370878 3300048917 Bacteria 1267
667 Ga0496114_0766975 3300048917 Bacteria 842
668 Ga0496114_1514812 3300048917 Bacteria 559
669 Ga0496115_0050026 3300048918 Bacteria 3347
670 Ga0496115_0088641 3300048918 Bacteria 2526
671 Ga0496115_0345380 3300048918 Bacteria 1214
672 Ga0496115_0866587 3300048918 Bacteria 698
673 Ga0496117_0007148 3300048920 Bacteria 11029
674 Ga0496118_0052392 3300048921 Bacteria 3113
675 Ga0496118_0086890 3300048921 Bacteria 2171
676 Ga0496118_0260839 3300048921 Bacteria 978
677 Ga0496119_0060865 3300048922 Bacteria 2258
678 Ga0496119_0104030 3300048922 Bacteria 1589
679 Ga0496119_0250298 3300048922 Bacteria 894
680 Ga0496120_0335461 3300048923 Bacteria 683
681 Ga0496121_0000278 3300048924 Bacteria 106838
682 Ga0496121_0001616 3300048924 Bacteria 37413
683 Ga0496121_0087003 3300048924 Bacteria 2454
684 Ga0496121_0124411 3300048924 Bacteria 1941
685 Ga0496121_0202566 3300048924 Bacteria 1413
686 Ga0496121_0390699 3300048924 Bacteria 914
687 Ga0496121_0813576 3300048924 Bacteria 548
688 Ga0496124_0095447 3300048927 Bacteria 2417
689 Ga0496124_0259085 3300048927 Bacteria 1281
690 Ga0496125_0067622 3300048928 Bacteria 2814
691 Ga0496125_0597994 3300048928 Bacteria 603
692 Ga0496126_0013009 3300048929 Bacteria 8491
693 Ga0496126_0021155 3300048929 Bacteria 6360
694 Ga0496126_0103763 3300048929 Bacteria 2484
695 Ga0496126_0109310 3300048929 Bacteria 2410
696 Ga0496126_0120068 3300048929 Bacteria 2281
697 Ga0496126_0236659 3300048929 Bacteria 1527
698 Ga0496126_0244003 3300048929 Bacteria 1499
699 Ga0496126_0356491 3300048929 Bacteria 1195
700 Ga0496126_0646980 3300048929 Bacteria 828
701 Ga0496126_1153658 3300048929 Bacteria 572
702 Ga0495678_125201 3300049459 Bacteria 858
703 Ga0495682_0099073 3300049460 Bacteria 1045
704 Ga0495682_0112229 3300049460 Bacteria 977
705 Ga0495682_0138435 3300049460 Bacteria 870
706 Ga0501033_0820463 3300049570 Bacteria 628
707 Ga0501036_0966157 3300049572 Bacteria 698
708 Ga0501040_1343308 3300049576 Bacteria 519
709 Ga0501041_0352144 3300049577 Bacteria 931
710 Ga0501067_0026967 3300049583 Bacteria 3182
711 Ga0501068_0242784 3300049584 Bacteria 1147
712 Ga0501070_0004413 3300049586 Bacteria 12077
713 Ga0501074_0264562 3300049590 Bacteria 1222
714 Ga0501202_238843 3300049652 Bacteria 508
715 Ga0501216_114654 3300049660 Bacteria 609
716 Ga0501238_047445 3300049671 Bacteria 640
717 Ga0501257_122111 3300049686 Bacteria 698
718 Ga0501080_0044907 3300049742 Bacteria 4112
719 Ga0501035_1436038 3300049822 Bacteria 528
720 nmdc:mga03683_144959_c1 3300050489 Bacteria 1069
721 nmdc:mga03683_166220_c1 3300050489 Bacteria 1001
722 nmdc:mga03683_22815_c1 3300050489 Bacteria 2430
723 nmdc:mga03683_98443_c1 3300050489 Bacteria 1283
724 nmdc:mga03n38_58585_c1 3300050490 Bacteria 1746
725 nmdc:mga03n38_660935_c1 3300050490 Bacteria 600
726 nmdc:mga03n38_800184_c1 3300050490 Bacteria 549
727 nmdc:mga00v17_299923_c1 3300050491 Bacteria 1044
728 nmdc:mga00v17_58873_c1 3300050491 Bacteria 2355
729 nmdc:mga0yw44_147751_c1 3300050492 Bacteria 1531
730 nmdc:mga0yw44_30333_c1 3300050492 Bacteria 3132
731 nmdc:mga0yw44_425795_c1 3300050492 Bacteria 899
732 nmdc:mga0yw44_49619_c1 3300050492 Bacteria 2044
733 nmdc:mga0yw44_91202_c1 3300050492 Bacteria 1471
734 nmdc:mga0k408_102781_c1 3300050493 Bacteria 1686
735 nmdc:mga0k408_28562_c1 3300050493 Bacteria 2840
736 nmdc:mga0k408_393338_c1 3300050493 Bacteria 825
737 nmdc:mga0k408_565366_c1 3300050493 Bacteria 672
738 nmdc:mga06z11_111939_c1 3300050494 Bacteria 1513
739 nmdc:mga06z11_592270_c1 3300050494 Bacteria 674
740 nmdc:mga06z11_73963_c1 3300050494 Bacteria 1811
741 nmdc:mga07m45_19410_c1 3300050496 Bacteria 3683
742 nmdc:mga07m45_264169_c1 3300050496 Bacteria 1001
743 nmdc:mga07m45_48711_c1 3300050496 Bacteria 2384
744 nmdc:mga07m45_72754_c1 3300050496 Bacteria 1957
745 nmdc:mga05p37_815434_c1 3300050507 Bacteria 1019
746 nmdc:mga05p37_900566_c1 3300050507 Bacteria 954
747 nmdc:mga09592_242277_c1 3300050508 Bacteria 1562
748 nmdc:mga0qj67_946757_c1 3300050509 Bacteria 677
749 nmdc:mga08y16_1316538_c1 3300050511 Bacteria 688
750 nmdc:mga08y16_473431_c1 3300050511 Bacteria 1275
751 nmdc:mga08y16_964681_c1 3300050511 Bacteria 835
752 nmdc:mga0n895_669954_c1 3300050512 Bacteria 1035
753 nmdc:mga0n895_87550_c1 3300050512 Bacteria 3112
754 nmdc:mga0rr50_1262501_c1 3300050513 Bacteria 627
755 nmdc:mga0rr50_233945_c1 3300050513 Bacteria 1521
756 nmdc:mga0rr50_548421_c1 3300050513 Bacteria 984
757 nmdc:mga08x19_570193_c1 3300050514 Bacteria 801
758 nmdc:mga0sz30_133720_c1 3300050516 Bacteria 1094
759 Ga0495601_0039160 3300053077 Bacteria 2968
760 Ga0495612_0006314 3300053078 Bacteria 4885
761 Ga0495655_0059479 3300053083 Bacteria 1038
762 Ga0495655_0257011 3300053083 Bacteria 589
763 Ga0495595_0003274 3300053084 Bacteria 6432
764 Ga0495619_0018347 3300053085 Bacteria 4439
765 Ga0495619_0078677 3300053085 Bacteria 2217
766 Ga0500643_045999 3300053087 Bacteria 1262
767 Ga0500583_0141993 3300053092 Bacteria 1193
768 Ga0500651_0013653 3300053093 Bacteria 4957
769 Ga0500566_0020304 3300053094 Bacteria 3904
770 Ga0500641_0025456 3300053096 Bacteria 2289
771 Ga0500650_0214885 3300053098 Bacteria 872
772 Ga0500554_001768 3300053102 Bacteria 4170
773 Ga0500554_093811 3300053102 Bacteria 999
774 Ga0500555_108306 3300053103 Bacteria 701
775 Ga0500562_093123 3300053108 Bacteria 818
776 Ga0500582_084827 3300053114 Bacteria 1091
777 Ga0500594_0111559 3300053118 Bacteria 851
778 Ga0500594_0316059 3300053118 Bacteria 524
779 Ga0500595_001181 3300053119 Bacteria 14424
780 Ga0500595_005078 3300053119 Bacteria 5783
781 Ga0500595_008629 3300053119 Bacteria 4158
782 Ga0500595_010638 3300053119 Bacteria 3647
783 Ga0500595_129902 3300053119 Bacteria 709
784 Ga0500617_038097 3300053124 Bacteria 2153
785 Ga0500642_0047441 3300053130 Bacteria 1882
786 Ga0500642_0152787 3300053130 Bacteria 1083
787 Ga0500658_0437400 3300053134 Bacteria 596
788 Ga0500561_0314113 3300053137 Bacteria 500
789 Ga0500568_0039328 3300053139 Bacteria 1910
790 Ga0500568_0057862 3300053139 Bacteria 1507
791 Ga0500568_0092731 3300053139 Bacteria 1138
792 Ga0500577_0323699 3300053142 Bacteria 673
793 Ga0500577_0433941 3300053142 Bacteria 574
794 Ga0500589_048426 3300053147 Bacteria 1976
795 Ga0500590_271047 3300053148 Bacteria 659
796 Ga0500603_005971 3300053150 Bacteria 2637
797 Ga0500603_065725 3300053150 Bacteria 1023
798 Ga0500604_0078149 3300053151 Bacteria 1065
799 Ga0500620_091669 3300053155 Bacteria 1060
800 Ga0500622_0316811 3300053156 Bacteria 658
801 Ga0500622_0356460 3300053156 Bacteria 605
802 Ga0500627_0238070 3300053158 Bacteria 808
803 Ga0500627_0302613 3300053158 Bacteria 698
804 Ga0500638_000149 3300053162 Bacteria 13453
805 Ga0500637_0001223 3300053178 Bacteria 10739
806 Ga0500637_0140551 3300053178 Bacteria 1397
807 Ga0500611_013593 3300053727 Bacteria 1401
808 Ga0500645_188347 3300053730 Bacteria 559
809 Ga0500609_010365 3300053731 Bacteria 1255
810 Ga0500661_005251 3300055283 Bacteria 2424
811 2513659468 2513237096 Bacteria 8722461
812 2513695249 2513237101 Bacteria 7952346
813 2513859426 2513237137 Bacteria 9558895
814 2513921599 2513237145 Bacteria 8979722
815 2517889008 2517572143 Bacteria 9484767
816 2524441398 2524023205 Bacteria 8918781
817 2524467027 2524023210 Bacteria 9029266
818 2524537434 2524023228 Bacteria 10118060
819 2671122603 2667528175 Bacteria 7532676
820 2723841776 2721755755 Bacteria 8322773
821 2745077532 2744054633 Bacteria 8678936
822 2793073686 2791355197 Bacteria 8420563
823 2793078349
824 2824711446 2824704595 Bacteria 9667483
825 2824762552 2824753945 Bacteria 9787441
826 2824771886 2824763712 Bacteria 9792355
827 2841965455 2841957949 Bacteria 8652217
828 2874607928 2874604998 Bacteria 7834745
829 2874619099 2874612657 Bacteria 8252029
830 2876769598 2876761206 Bacteria 10111113
831 2876812459 2876808645 Bacteria 8824342
832 2879113355 2879110137 Bacteria 8907982
833 2885382796 2885374607 Bacteria 8927485
834 2885411838 2885409591 Bacteria 9235467
835 2889035344 2889033259 Bacteria 9099371
836 2903758968 2903748898 Bacteria 9972761
837 2903775482 2903768456 Bacteria 9749579
838 2904691049 2904690495 Bacteria 9412302
839 2904716370 2904711408 Bacteria 9771557
840 2906613622
841 2906641624 2906635258 Bacteria 8601019
842 2906668152 2906660503 Bacteria 8595048
843 2908747606 2908739725 Bacteria 8628932
844 2908757107 2908756301 Bacteria 8864324
845 2922363166 2922361189 Bacteria 7436256
846 2922388530 2922386360 Bacteria 7017218
847 2922434057
848 2935636088 2935630451 Bacteria 8169952
849 2941512608 2941507105 Bacteria 8166816
850 2941520554 2941515067 Bacteria 8166720
851 2941528568 2941523033 Bacteria 8169134
852 3005475228 3005474847 Bacteria 9259049
853 8006928165 8006926726 Bacteria 6749210
854 8006936051 8006933436 Bacteria 10410654
855 8006967595 8006964411 Bacteria 8966052
856 8006975825 8006973647 Bacteria 10679141
857 8006991064 8006984368 Bacteria 9651211
858 8019562606 8019555841 Bacteria 9642137
859 8019572684 8019565922 Bacteria 9639779
860 8056676099 8056673599 Bacteria 7871253
861 8056682900 8056681323 Bacteria 8472857
862 8056691103 8056689827 Bacteria 6712655
863 Ga0265325_10041677
864 LJQas_1008472
865 JGI25406J46586_10000267
866 Ga0055539_1013936
867 JGI25405J52794_10152394
868 Ga0065712_10322055
869 Ga0065715_11153752
870 Ga0070658_10268806
871 Ga0070658_10306974
872 Ga0070658_10437798
873 Ga0070683_100248803
874 Ga0070670_100043583
875 Ga0070670_100228412
876 Ga0070670_100379720
877 Ga0070670_101112715
878 Ga0070670_101233727
879 Ga0068869_100135857
880 Ga0068869_100422177
881 Ga0068869_101067167
882 Ga0070666_10089882
883 Ga0070680_100505013
884 Ga0070682_100352611
885 Ga0070682_100433303
886 Ga0068868_100268228
887 Ga0068868_100626374
888 Ga0068868_100763226
889 Ga0070660_100394901
890 Ga0070660_100433119
891 Ga0070691_10086259
892 Ga0070692_10794409
893 Ga0070668_100115244
894 Ga0070668_100275202
895 Ga0070669_100071036
896 Ga0070671_100036653
897 Ga0070671_100262215
898 Ga0070671_100378503
899 Ga0070671_100529035
900 Ga0070671_101508258
901 Ga0070674_100697466
902 Ga0070673_100446670
903 Ga0070673_101796223
904 Ga0070659_100360941
905 Ga0070667_100203891
906 Ga0070667_100357857
907 Ga0070709_10007973
908 Ga0070709_10408148
909 Ga0070714_100411815
910 Ga0070714_100453482
911 Ga0070713_100023368
912 Ga0070713_100040826
913 Ga0070710_10017653
914 Ga0070701_10114625
915 Ga0070705_100173809
916 Ga0070705_101931987
917 Ga0070700_100260040
918 Ga0070700_100341740
919 Ga0070708_100645398
920 Ga0070663_100025546
921 Ga0070663_100046917
922 Ga0070663_100099843
923 Ga0070663_100107171
924 Ga0070663_100145797
925 Ga0070663_100256895
926 Ga0070663_101055439
927 Ga0070678_100045734
928 Ga0070678_100098529
929 Ga0070678_100426946
930 Ga0070678_101164757
931 Ga0070662_100144539
932 Ga0070685_10526028
933 Ga0070706_100599485
934 Ga0070698_100410736
935 Ga0070698_101384311
936 Ga0070699_100186540
937 Ga0070684_100624178
938 Ga0070697_100448462
939 Ga0070672_100396866
940 Ga0070695_100161388
941 Ga0070693_100053548
942 Ga0070665_100019468
943 Ga0070665_100026811
944 Ga0070665_100228807
945 Ga0070665_100520263
946 Ga0070665_100883618
947 Ga0070665_100980298
948 Ga0068855_100044540
949 Ga0068855_100752775
950 Ga0070664_100041068
951 Ga0068857_100013150
952 Ga0068857_100335719
953 Ga0068854_100756148
954 Ga0068856_100037942
955 Ga0068856_100775655
956 Ga0070702_100042955
957 Ga0070702_100400654
958 Ga0068852_100032551
959 Ga0068852_100096090
960 Ga0068852_100118263
961 Ga0068852_101141327
962 Ga0068859_100356087
963 Ga0068859_100363476
964 Ga0068859_100819729
965 Ga0068864_100038485
966 Ga0068864_100063118
967 Ga0068861_100052851
968 Ga0068861_100500345
969 Ga0068861_100698141
970 Ga0068851_10870625
971 Ga0068870_10112994
972 Ga0068863_100121644
973 Ga0068858_100064112
974 Ga0068858_100853035
975 Ga0068860_100226689
976 Ga0068860_100729761
977 Ga0068862_100124557
978 Ga0068862_100256392
979 Ga0068862_100312540
980 Ga0068862_100710312
981 Ga0081455_10081456
982 Ga0081455_10130669
983 Ga0081455_10243560
984 Ga0081538_10045135
985 Ga0081540_1006252
986 Ga0081540_1023509
987 Ga0081540_1123921
988 Ga0081540_1179937
989 Ga0081539_10000265
990 Ga0081539_10042243
991 Ga0070717_10007759
992 Ga0070717_10371398
993 Ga0070717_10552693
994 Ga0075365_10033153
995 Ga0075365_10180540
996 Ga0075368_10084576
997 Ga0075368_10207669
998 Ga0075363_100122836
999 Ga0075432_10173588
1000 Ga0075432_10297558
1001 Ga0070716_100042649
1002 Ga0070712_100016641
1003 Ga0070712_100167285
1004 Ga0075362_10107329
1005 Ga0075362_10164158
1006 Ga0075362_10315016
1007 Ga0075367_10032933
1008 Ga0075367_10033622
1009 Ga0075367_10215386
1010 Ga0075369_10037635
1011 Ga0075369_10041261
1012 Ga0075369_10245212
1013 Ga0075369_10262174
1014 Ga0075369_10436176
1015 Ga0075366_10036815
1016 Ga0075366_10056586
1017 Ga0075366_10317379
1018 Ga0075366_10417301
1019 Ga0097621_100219423
1020 Ga0097621_100407006
1021 Ga0075370_10017420
1022 Ga0075370_10050099
1023 Ga0068871_100082322
1024 Ga0068871_100225368
1025 Ga0068871_100408230
1026 Ga0075433_11298512
1027 Ga0075434_100813156
1028 Ga0068865_100292554
1029 Ga0097620_100356073
1030 Ga0097620_100363497
1031 Ga0097620_100819739
1032 Ga0075435_100090655
1033 Ga0075435_100625430
1034 Ga0099794_10494659
1035 Ga0105244_10554302
1036 Ga0105250_10066224
1037 Ga0105240_10652145
1038 Ga0111539_10173283
1039 Ga0111539_12770377
1040 Ga0111539_13249964
1041 Ga0105245_10070499
1042 Ga0105245_10528981
1043 Ga0105245_10560475
1044 Ga0105245_10897434
1045 Ga0105247_10035861
1046 Ga0105247_10338241
1047 Ga0105247_10373172
1048 Ga0114129_10196535
1049 Ga0114129_10607383
1050 Ga0114129_11258853
1051 Ga0105243_10099928
1052 Ga0105243_10316106
1053 Ga0105243_10849617
1054 Ga0105243_12397446
1055 Ga0105241_10087440
1056 Ga0105241_10631480
1057 Ga0105241_11345393
1058 Ga0105242_10316424
1059 Ga0105242_10887059
1060 Ga0105248_10137023
1061 Ga0105248_10216059
1062 Ga0105248_10259343
1063 Ga0105248_10467212
1064 Ga0105248_10801190
1065 Ga0105248_11858729
1066 Ga0105237_10116992
1067 Ga0105237_10190250
1068 Ga0105238_10147178
1069 Ga0105238_10445030
1070 Ga0105238_10714830
1071 Ga0105238_10856705
1072 Ga0105249_10536201
1073 Ga0105249_10863827
1074 Ga0105249_12091081
1075 Ga0105249_12194574
1076 Ga0099796_10048554
1077 Ga0105239_10150620
1078 Ga0105239_10236077
1079 Ga0105239_10444894
1080 Ga0105239_12067842
1081 Ga0105246_10069159
1082 Ga0105246_10278805
1083 Ga0105246_10459937
1084 Ga0157329_1011949
1085 Ga0157314_1050987
1086 Ga0157339_1013349
1087 Ga0157369_10782377
1088 Ga0157369_11066333
1089 Ga0157374_10071271
1090 Ga0157374_11036875
1091 Ga0157378_10113937
1092 Ga0157378_10275323
1093 Ga0157378_10594613
1094 Ga0157378_10710000
1095 Ga0163162_10134527
1096 Ga0163162_10286868
1097 Ga0163162_11196539
1098 Ga0157372_10796874
1099 Ga0157375_10217822
1100 Ga0157375_11254422
1101 Ga0157375_12136550
1102 Ga0163163_10290379
1103 Ga0163163_10434155
1104 Ga0163163_10731134
1105 Ga0157380_10168471
1106 Ga0157380_12592011
1107 Ga0157377_10403341
1108 Ga0157377_10515258
1109 Ga0157379_10060438
1110 Ga0157379_10187266
1111 Ga0157379_10479099
1112 Ga0157379_11565200
1113 Ga0157376_10227729
1114 Ga0157376_10327052
1115 Ga0157376_10629321
1116 Ga0182007_10170710
1117 Ga0163161_10557869
1118 Ga0154015_1467715
1119 Ga0213875_10236491
1120 Ga0209677_100170
1121 Ga0209233_1009059
1122 Ga0209455_1011291
1123 Ga0209758_1001436
1124 Ga0209758_1011392
1125 Ga0207697_10149627
1126 Ga0207697_10162136
1127 Ga0207692_10050758
1128 Ga0207642_10045113
1129 Ga0207710_10067396
1130 Ga0207710_10500979
1131 Ga0207688_10207569
1132 Ga0207680_10075528
1133 Ga0207699_10149592
1134 Ga0207645_10319658
1135 Ga0207645_10945154
1136 Ga0207643_10049057
1137 Ga0207705_10664185
1138 Ga0207684_10422950
1139 Ga0207654_10149293
1140 Ga0207695_10489286
1141 Ga0207671_10108915
1142 Ga0207693_10020364
1143 Ga0207693_10026947
1144 Ga0207663_10015460
1145 Ga0207657_10504076
1146 Ga0207649_10526886
1147 Ga0207646_10565610
1148 Ga0207694_10497096
1149 Ga0207694_10498949
1150 Ga0207650_10478129
1151 Ga0207650_11064549
1152 Ga0207687_10194551
1153 Ga0207700_10066255
1154 Ga0207700_10100327
1155 Ga0207664_10146070
1156 Ga0207664_10976575
1157 Ga0207644_10123488
1158 Ga0207644_10265438
1159 Ga0207644_10445847
1160 Ga0207644_11355393
1161 Ga0207706_10206403
1162 Ga0207706_10454914
1163 Ga0207686_10344649
1164 Ga0207686_11330550
1165 Ga0207709_10084693
1166 Ga0207670_10591441
1167 Ga0207665_10012221
1168 Ga0207665_10493424
1169 Ga0207711_10074936
1170 Ga0207711_10146482
1171 Ga0207711_11233417
1172 Ga0207689_10029537
1173 Ga0207689_10069376
1174 Ga0207689_10256452
1175 Ga0207689_10304979
1176 Ga0207661_10371870
1177 Ga0207661_10673779
1178 Ga0207679_11178141
1179 Ga0207679_11482815
1180 Ga0207667_10095652
1181 Ga0207651_11353276
1182 Ga0207712_10984491
1183 Ga0207668_10529992
1184 Ga0207668_10733449
1185 Ga0207668_10738940
1186 Ga0207640_10668173
1187 Ga0207658_10199849
1188 Ga0207658_10598753
1189 Ga0207677_10044527
1190 Ga0207677_10718270
1191 Ga0207677_11064044
1192 Ga0207703_10420058
1193 Ga0207703_10444951
1194 Ga0207703_10511532
1195 Ga0207639_10988976
1196 Ga0207639_11414957
1197 Ga0207678_10047183
1198 Ga0207678_10065331
1199 Ga0207678_10092873
1200 Ga0207678_10112340
1201 Ga0207678_10120455
1202 Ga0207678_10134248
1203 Ga0207678_10383895
1204 Ga0207678_11018387
1205 Ga0207708_10521034
1206 Ga0207702_10394624
1207 Ga0207702_10707616
1208 Ga0207641_10523876
1209 Ga0207648_10496367
1210 Ga0207648_11525987
1211 Ga0207676_10118366
1212 Ga0207676_10694145
1213 Ga0207674_10005754
1214 Ga0207674_10518282
1215 Ga0207675_100107503
1216 Ga0207675_100937490
1217 Ga0207683_10049009
1218 Ga0207683_10100369
1219 Ga0207683_10722337
1220 Ga0207683_10744482
1221 Ga0207698_10055584
1222 Ga0207698_10941806
1223 Ga0209179_1024243
1224 Ga0209588_1134954
1225 Ga0268266_10001236
1226 Ga0268266_10025196
1227 Ga0268266_10305394
1228 Ga0268266_10372915
1229 Ga0268266_10855693
1230 Ga0268266_11099407
1231 Ga0268266_11485022
1232 Ga0268265_10251303
1233 Ga0268265_10599504
1234 Ga0268265_10666544
1235 Ga0268264_10373654
1236 Ga0268264_11196941
1237 Ga0307517_10000175
1238 Ga0307515_10042883
1239 Ga0307515_10219842
1240 Ga0307515_10899078
1241 Ga0307512_10352246
1242 Ga0265320_10020059
1243 Ga0265325_10003538
1244 Ga0265340_10279235
1245 Ga0265339_10129731
1246 Ga0307513_10169962
1247 Ga0307513_10305950
1248 Ga0307513_10570292
1249 Ga0307408_100125250
1250 Ga0307508_10040818
1251 Ga0265314_10036382
1252 Ga0307516_10063591
1253 Ga0307516_10154107
1254 Ga0307516_10686875
1255 Ga0307405_10156778
1256 Ga0307405_10543809
1257 Ga0307405_10710094
1258 Ga0307410_10692057
1259 Ga0326468_10096173
1260 Ga0307406_10261020
1261 Ga0307406_10420233
1262 Ga0307406_10823193
1263 Ga0307406_11503294
1264 Ga0307407_11054548
1265 Ga0307409_100212249
1266 Ga0307416_101141486
1267 Ga0307416_101297610
1268 Ga0307416_101426070
1269 Ga0307415_100143669
1270 Ga0307415_100551582
1271 Ga0307415_100655650
1272 Ga0307510_10013138
1273 Ga0307510_10102993
1274 Ga0307510_10122359
1275 Ga0307510_10161143
1276 Ga0373958_0151579
1277 Ga0373938_0161339
1278 Ga0373928_0064578
1279 Ga0373940_0244580
1280 Ga0373932_0241069
1281 Ga0373932_0305138
1282 Ga0373936_0006935
1283 Ga0373939_0269542
1284 Ga0373945_0186173
1285 Ga0373953_0193853
1286 Ga0373953_0220497
1287 Ga0373954_0014658
1288 Ga0373956_0047354
1289 Ga0373957_0193924
1290 Ga0373943_0030231
1291 Ga0373955_0376677
1292 Ga0373942_0130380
1293 Ga0373962_0101455
1294 Ga0373924_0274740
1295 Ga0373931_0305610
1296 Ga0373931_0878444
1297 Ga0373935_0511586
1298 Ga0373935_1391637
1299 Ga0373927_0001972
1300 Ga0373927_0069619
1301 Ga0373927_0088515
1302 Ga0373933_0008750
1303 Ga0373933_0063756
1304 Ga0373947_0407338
1305 Ga0373947_0815725
1306 Ga0373937_0038449
1307 Ga0373925_1140984
1308 Ga0395898_0890894
1309 Ga0395901_0462213
1310 Ga0436365_0653292
1311 Ga0436365_1106987
1312 Ga0436363_1288101
1313 Ga0451787_812520
1314 Ga0451789_1152664
1315 Ga0451793_0424926
1316 Ga0451793_1522198
1317 Ga0451795_0719483
1318 Ga0451798_0642453
1319 Ga0451802_0616298
1320 Ga0451839_0289012
1321 Ga0451845_0938506
1322 Ga0451847_0631731
1323 Ga0451843_1467111
1324 Ga0451853_2484189
1325 Ga0451853_3334213
1326 Ga0439458_0109390
1327 Ga0439459_0071388
1328 Ga0439440_0095890
1329 Ga0466969_0210708
1330 Ga0466963_0396653
1331 Ga0466957_0362987
1332 Ga0466960_0517177
1333 Ga0466967_1315650
1334 Ga0495592_0059830
1335 Ga0495592_0267180
1336 Ga0495603_0028072
1337 Ga0495603_0031664
1338 Ga0495603_0051650
1339 Ga0495603_0468312
1340 Ga0495603_0571334
1341 Ga0495590_0318447
1342 Ga0495629_0004556
1343 Ga0495629_0173842
1344 Ga0495629_0278574
1345 Ga0495638_0043028
1346 Ga0495638_0199422
1347 Ga0495638_0204171
1348 Ga0495641_0084827
1349 Ga0495651_0008073
1350 Ga0495653_0028022
1351 Ga0495650_0155875
1352 Ga0495650_0193452
1353 Ga0495580_0088594
1354 Ga0495580_0309490
1355 Ga0495580_0390809
1356 Ga0495580_0598370
1357 Ga0495582_0214765
1358 Ga0495639_0211535
1359 Ga0495639_0245059
1360 Ga0495639_0247284
1361 Ga0495662_0298511
1362 Ga0495662_0487907
1363 Ga0495664_0011415
1364 Ga0495664_0030878
1365 Ga0495664_0246079
1366 Ga0495664_0255921
1367 Ga0495584_0180980
1368 Ga0495584_0480703
1369 Ga0495584_0511579
1370 Ga0495584_0617530
1371 Ga0495584_0697729
1372 Ga0495585_0388396
1373 Ga0495594_0118997
1374 Ga0495596_0243144
1375 Ga0495606_0000831
1376 Ga0495616_0112684
1377 Ga0495618_0029859
1378 Ga0495628_0086962
1379 Ga0495630_0330416
1380 Ga0495630_0438789
1381 Ga0495630_0699386
1382 Ga0495631_0144431
1383 Ga0495631_0192085
1384 Ga0495637_0115719
1385 Ga0495643_0227371
1386 Ga0495644_0037619
1387 Ga0495663_0033772
1388 Ga0495663_0334947
1389 Ga0495666_0357232
1390 Ga0495642_0158481
1391 Ga0495652_0006237
1392 Ga0495654_0130271
1393 Ga0495665_0158049
1394 Ga0495640_0025782
1395 Ga0495640_0118923
1396 Ga0495586_0240317
1397 Ga0495586_0420559
1398 Ga0495587_0220454
1399 Ga0495598_0020197
1400 Ga0495621_0112441
1401 Ga0495621_0225087
1402 Ga0495622_0026867
1403 Ga0495633_0078834
1404 Ga0495633_0106593
1405 Ga0495656_0023665
1406 Ga0495656_0179397
1407 Ga0495656_0209092
1408 Ga0495656_0312708
1409 Ga0495668_0101817
1410 Ga0495668_0180847
1411 Ga0495668_0230431
1412 Ga0495668_0432009
1413 Ga0495634_0002973
1414 Ga0495634_0091048
1415 Ga0495634_0111538
1416 Ga0495634_0493641
1417 Ga0495611_0240590
1418 Ga0495611_0253606
1419 Ga0495611_0301629
1420 Ga0495625_0351792
1421 Ga0495625_0467659
1422 Ga0495625_0474978
1423 Ga0495635_0009194
1424 Ga0495659_0027069
1425 Ga0495661_0147555
1426 Ga0495588_0016078
1427 Ga0495588_0450574
1428 Ga0495657_0013089
1429 Ga0495599_0019404
1430 Ga0495599_0817466
1431 Ga0495623_0001696
1432 Ga0495623_0269539
1433 Ga0495623_0443063
1434 Ga0495623_0645072
1435 Ga0495646_0017448
1436 Ga0495647_0028480
1437 Ga0495647_0037683
1438 Ga0495647_0111357
1439 Ga0495647_0194708
1440 Ga0495658_0587986
1441 Ga0495669_0357652
1442 Ga0495669_0369147
1443 Ga0495613_0332590
1444 Ga0495624_0331548
1445 Ga0495671_0346496
1446 Ga0495660_0402619
1447 Ga0495581_0052805
1448 Ga0495581_0092788
1449 Ga0495581_0115919
1450 Ga0495581_0687753
1451 Ga0495604_0002530
1452 Ga0495636_0389522
1453 Ga0495674_0172268
1454 Ga0495674_0347712
1455 Ga0495672_0047426
1456 Ga0495672_0102007
1457 Ga0495676_0094051
1458 Ga0495676_0298823
1459 Ga0495676_0419059
1460 Ga0495680_0000483
1461 Ga0495683_0099561
1462 Ga0495683_0273397
1463 Ga0495679_050853
1464 Ga0495685_039477
1465 Ga0495681_0130751
1466 Ga0495684_0027128
1467 Ga0495686_0093058
1468 Ga0495686_0129236
1469 Ga0495593_0016387
1470 Ga0495593_0249304
1471 Ga0495602_0111256
1472 Ga0495602_0676905
1473 Ga0495615_0043313
1474 Ga0495626_0161233
1475 Ga0496100_0091454
1476 Ga0496100_0188290
1477 Ga0496101_0008819
1478 Ga0496101_0077845
1479 Ga0496101_0659971
1480 Ga0496102_0099110
1481 Ga0496102_0542658
1482 Ga0496102_0922994
1483 Ga0496103_0145272
1484 Ga0496103_0189792
1485 Ga0496103_0220829
1486 Ga0496103_0792696
1487 Ga0496104_0195025
1488 Ga0496105_0056309
1489 Ga0496105_0410729
1490 Ga0496105_0471721
1491 Ga0496106_0006134
1492 Ga0496106_0190468
1493 Ga0496106_0262339
1494 Ga0496106_0455328
1495 Ga0496106_1047571
1496 Ga0496106_1395528
1497 Ga0496107_0002790
1498 Ga0496107_0017396
1499 Ga0496107_0018608
1500 Ga0496107_0373171
1501 Ga0496108_0000309
1502 Ga0496108_0067396
1503 Ga0496108_0351844
1504 Ga0496109_0000229
1505 Ga0496109_0253179
1506 Ga0496109_0334006
1507 Ga0496110_0011598
1508 Ga0496110_0038304
1509 Ga0496110_0038809
1510 Ga0496110_0179946
1511 Ga0496110_0183814
1512 Ga0496111_0179407
1513 Ga0496111_0593602
1514 Ga0496111_0775263
1515 Ga0496111_0886103
1516 Ga0496112_0000018
1517 Ga0496112_0074725
1518 Ga0496112_0077238
1519 Ga0496112_0146879
1520 Ga0496112_0157177
1521 Ga0496112_1568698
1522 Ga0496113_0024174
1523 Ga0496113_0114048
1524 Ga0496113_0288757
1525 Ga0496113_0304449
1526 Ga0496113_0533818
1527 Ga0496114_0085739
1528 Ga0496114_0370878
1529 Ga0496114_0766975
1530 Ga0496114_1514812
1531 Ga0496115_0050026
1532 Ga0496115_0088641
1533 Ga0496115_0345380
1534 Ga0496115_0866587
1535 Ga0496117_0007148
1536 Ga0496118_0052392
1537 Ga0496118_0086890
1538 Ga0496118_0260839
1539 Ga0496119_0060865
1540 Ga0496119_0104030
1541 Ga0496119_0250298
1542 Ga0496120_0335461
1543 Ga0496121_0000278
1544 Ga0496121_0001616
1545 Ga0496121_0087003
1546 Ga0496121_0124411
1547 Ga0496121_0202566
1548 Ga0496121_0390699
1549 Ga0496121_0813576
1550 Ga0496124_0095447
1551 Ga0496124_0259085
1552 Ga0496125_0067622
1553 Ga0496125_0597994
1554 Ga0496126_0013009
1555 Ga0496126_0021155
1556 Ga0496126_0103763
1557 Ga0496126_0109310
1558 Ga0496126_0120068
1559 Ga0496126_0236659
1560 Ga0496126_0244003
1561 Ga0496126_0356491
1562 Ga0496126_0646980
1563 Ga0496126_1153658
1564 Ga0495678_125201
1565 Ga0495682_0099073
1566 Ga0495682_0112229
1567 Ga0495682_0138435
1568 Ga0501033_0820463
1569 Ga0501036_0966157
1570 Ga0501040_1343308
1571 Ga0501041_0352144
1572 Ga0501067_0026967
1573 Ga0501068_0242784
1574 Ga0501070_0004413
1575 Ga0501074_0264562
1576 Ga0501202_238843
1577 Ga0501216_114654
1578 Ga0501238_047445
1579 Ga0501257_122111
1580 Ga0501080_0044907
1581 Ga0501035_1436038
1582 nmdc:mga03683_144959_c1
1583 nmdc:mga03683_166220_c1
1584 nmdc:mga03683_22815_c1
1585 nmdc:mga03683_98443_c1
1586 nmdc:mga03n38_58585_c1
1587 nmdc:mga03n38_660935_c1
1588 nmdc:mga03n38_800184_c1
1589 nmdc:mga00v17_299923_c1
1590 nmdc:mga00v17_58873_c1
1591 nmdc:mga0yw44_147751_c1
1592 nmdc:mga0yw44_30333_c1
1593 nmdc:mga0yw44_425795_c1
1594 nmdc:mga0yw44_49619_c1
1595 nmdc:mga0yw44_91202_c1
1596 nmdc:mga0k408_102781_c1
1597 nmdc:mga0k408_28562_c1
1598 nmdc:mga0k408_393338_c1
1599 nmdc:mga0k408_565366_c1
1600 nmdc:mga06z11_111939_c1
1601 nmdc:mga06z11_592270_c1
1602 nmdc:mga06z11_73963_c1
1603 nmdc:mga07m45_19410_c1
1604 nmdc:mga07m45_264169_c1
1605 nmdc:mga07m45_48711_c1
1606 nmdc:mga07m45_72754_c1
1607 nmdc:mga05p37_815434_c1
1608 nmdc:mga05p37_900566_c1
1609 nmdc:mga09592_242277_c1
1610 nmdc:mga0qj67_946757_c1
1611 nmdc:mga08y16_1316538_c1
1612 nmdc:mga08y16_473431_c1
1613 nmdc:mga08y16_964681_c1
1614 nmdc:mga0n895_669954_c1
1615 nmdc:mga0n895_87550_c1
1616 nmdc:mga0rr50_1262501_c1
1617 nmdc:mga0rr50_233945_c1
1618 nmdc:mga0rr50_548421_c1
1619 nmdc:mga08x19_570193_c1
1620 nmdc:mga0sz30_133720_c1
1621 Ga0495601_0039160
1622 Ga0495612_0006314
1623 Ga0495655_0059479
1624 Ga0495655_0257011
1625 Ga0495595_0003274
1626 Ga0495619_0018347
1627 Ga0495619_0078677
1628 Ga0500643_045999
1629 Ga0500583_0141993
1630 Ga0500651_0013653
1631 Ga0500566_0020304
1632 Ga0500641_0025456
1633 Ga0500650_0214885
1634 Ga0500554_001768
1635 Ga0500554_093811
1636 Ga0500555_108306
1637 Ga0500562_093123
1638 Ga0500582_084827
1639 Ga0500594_0111559
1640 Ga0500594_0316059
1641 Ga0500595_001181
1642 Ga0500595_005078
1643 Ga0500595_008629
1644 Ga0500595_010638
1645 Ga0500595_129902
1646 Ga0500617_038097
1647 Ga0500642_0047441
1648 Ga0500642_0152787
1649 Ga0500658_0437400
1650 Ga0500561_0314113
1651 Ga0500568_0039328
1652 Ga0500568_0057862
1653 Ga0500568_0092731
1654 Ga0500577_0323699
1655 Ga0500577_0433941
1656 Ga0500589_048426
1657 Ga0500590_271047
1658 Ga0500603_005971
1659 Ga0500603_065725
1660 Ga0500604_0078149
1661 Ga0500620_091669
1662 Ga0500622_0316811
1663 Ga0500622_0356460
1664 Ga0500627_0238070
1665 Ga0500627_0302613
1666 Ga0500638_000149
1667 Ga0500637_0001223
1668 Ga0500637_0140551
1669 Ga0500611_013593
1670 Ga0500645_188347
1671 Ga0500609_010365
1672 Ga0500661_005251
1673 2513659468
1674 2513695249
1675 2513859426
1676 2513921599
1677 2517889008
1678 2524441398
1679 2524467027
1680 2524537434
1681 2671122603
1682 2723841776
1683 2745077532
1684 2793073686
1685 2793078349
1686 2824711446
1687 2824762552
1688 2824771886
1689 2841965455
1690 2874607928
1691 2874619099
1692 2876769598
1693 2876812459
1694 2879113355
1695 2885382796
1696 2885411838
1697 2889035344
1698 2903758968
1699 2903775482
1700 2904691049
1701 2904716370
1702 2906613622
1703 2906641624
1704 2906668152
1705 2908747606
1706 2908757107
1707 2922363166
1708 2922388530
1709 2922434057
1710 2935636088
1711 2941512608
1712 2941520554
1713 2941528568
1714 3005475228
1715 8006928165
1716 8006936051
1717 8006967595
1718 8006975825
1719 8006991064
1720 8019562606
1721 8019572684
1722 8056676099
1723 8056682900
1724 8056691103

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06262

Zincin_1

Zincin-like metallopeptidase

33

131

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3e11-assembly2.cif.gz_B crystal structure of a predicted zincin-like metalloprotease (acel_2062) from acidothermus cellulolyticus 11b at 1.80 a resolution 0.7556 9 126
2ejq-assembly1.cif.gz_A conserved hypothetical protein (ttha0227) from thermo thermophilus hb8 0.7042 15 117
3e11-assembly2.cif.gz_B crystal structure of a predicted zincin-like metalloprotease (acel_2062) from acidothermus cellulolyticus 11b at 1.80 a resolution 0.704 9 126
3cqd-assembly1.cif.gz_A-2 structure of the tetrameric inhibited form of phosphofructokinase-2 from escherichia coli 0.6668 90 131
2ejq-assembly1.cif.gz_A conserved hypothetical protein (ttha0227) from thermo thermophilus hb8 0.6308 15 117
ID Description Score Start End Superfamily
af_K7TWM1_16_363_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.77 101 131 1.20.1530.20
3e11B00 Alpha Beta;2-Layer Sandwich;Zincin-like; 0.7538 9 126 3.30.2010.20
3e11B00 Alpha Beta;2-Layer Sandwich;Zincin-like; 0.7073 9 126 3.30.2010.20
2ejqA00 Alpha Beta;2-Layer Sandwich;Zincin-like; 0.7042 15 117 3.30.2010.20
af_P9WJX9_6_194_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.7032 101 131 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A0A1PCH7-F1-model_v4 Possibl zinc metallo-peptidase 0.9348 4 132
AF-A0A2S5MBN3-F1-model_v4 Metallopeptidase family protein 0.9307 1 131
AF-A0A7W9RCC8-F1-model_v4 deleted 0.9305 5 131
AF-A0A2G4ISL3-F1-model_v4 Acetylglutamate kinase 0.9303 1 131 GO:0016301
AF-A0A522CLA4-F1-model_v4 Acetylglutamate kinase 0.9273 5 131 GO:0016301

Map