F483875

General Info

Members Datasets Scaffolds Average Seq Length
862 287 857 457

Family's Representative Sequence

Representative Sequence 3300005337|Ga0070682_100000094|Ga0070682_10000009464
Length 508
Sequence MNTGGVRAHSRWLSAPRDTTGTYANPVAPRMGRGTSGIPSGMHVRRAPALRWLHASRWPPAIGRYAAGVLLLLATSAFAQDADRLVTAALGNTRAYETLSYLTDEIGPRPSGSANAARAVKWTSEQFRAWGIDVRTEKVTVPHWVRGEEHASLVSHNDQKIVLTALGGSVATPAAGITAEVIEVSSFDELKQLGTKVKGKIVYYNNPMDLELVKARHGFEAYSRAVIYRGSGASRAAEYGAVAALIRSVGSASLRTPHTGAMRYDPKQPKIPSAAMTTEDAELVHRLIARGDRVRMHVTLTPKTLPDVESANVIAEIRGSEHPEEIVLIGGHLDSWDLGTGAIDDGSGVAMVMETLRLIKESGLRPKRTIRAVLFMNEENGLNGGRAYFAGHKNEKHVAAIETDAGAAAPTGFNTTLKGEALEAMTARTKVLDRVGAHRFEFAAETGADTSFLIDSGVTGFGLIPDPLHYFDYHHTPADTLDKIDPKELAQDTAAVAALAWTISNNER

Samples

Sample ID Description Type Environment
1 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
2 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
3 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
4 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
5 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
6 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
7 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
8 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
9 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
10 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
11 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
12 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
13 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
14 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
15 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
16 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
17 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
18 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
19 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
20 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
21 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
22 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
25 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
26 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
27 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
28 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
29 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
30 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
31 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
32 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
33 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
34 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
35 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
36 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
37 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
38 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
39 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
40 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
41 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
42 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
43 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
44 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
45 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
46 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
47 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
48 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
49 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
50 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
51 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
52 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
53 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
54 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
55 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
56 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
57 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
58 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
59 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
60 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
61 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
62 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
63 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
64 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
65 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
66 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
67 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
68 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
69 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
70 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
71 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
72 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
73 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
74 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
75 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
76 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
77 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
78 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
79 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
80 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
84 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
100 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
101 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
102 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
103 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
115 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
116 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
117 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
118 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
120 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
121 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
122 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
124 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
126 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
183 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
187 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
188 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
189 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
190 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
191 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
192 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
193 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
194 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
195 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
196 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
197 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
198 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
199 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
200 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
201 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
202 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
203 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
204 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
205 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
206 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
207 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
208 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
209 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
210 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
211 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
212 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
213 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
214 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
215 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
216 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
217 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
218 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
219 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
220 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
221 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
222 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
223 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
224 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
225 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
226 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
227 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
228 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
229 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
230 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
231 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
232 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
233 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
234 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
235 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
236 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
237 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
238 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
239 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
240 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
241 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
242 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
243 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
244 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
245 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
246 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
247 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
248 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
249 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
250 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
251 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
252 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
253 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
254 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
255 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
256 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
257 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
258 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
259 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
260 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
261 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
262 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
263 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
264 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
265 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
266 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
267 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
268 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
269 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
270 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
271 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
272 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
273 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
274 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
276 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
277 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
278 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
279 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
280 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
281 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
282 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
283 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
284 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
285 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
286 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
287 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.42
Metatranscriptomes 0
Isolates 0.58

Biome Distribution

Category Percentage (%)
Aerial Root 0.35
Bulb 0
Endosphere 3.02
Nodule 0
Rhizoplane 4.52
Rhizosphere 88.05
Stem 0
Stem Tuber 0
Unclassified 4.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1000462 3300001904 Bacteria 7637
2 JGI24736J21556_1000548 3300001904 Bacteria 6981
3 JGI24741J21665_1001717 3300001915 Bacteria 6041
4 JGI24752J21851_1000063 3300001976 Bacteria 13680
5 JGI24740J21852_10000610 3300001979 Bacteria 15461
6 JGI24740J21852_10006244 3300001979 Bacteria 4957
7 JGI24740J21852_10013329 3300001979 Bacteria 3069
8 JGI24739J22299_10000438 3300001989 Bacteria 14466
9 JGI24739J22299_10002661 3300001989 Bacteria 6875
10 JGI24739J22299_10006758 3300001989 Bacteria 4320
11 JGI24739J22299_10032172 3300001989 Bacteria 1807
12 JGI24737J22298_10000016 3300001990 Bacteria 49280
13 JGI24737J22298_10000754 3300001990 Bacteria 11436
14 JGI24737J22298_10001348 3300001990 Bacteria 8690
15 JGI24737J22298_10004346 3300001990 Bacteria 4949
16 JGI24737J22298_10004813 3300001990 Bacteria 4689
17 JGI24737J22298_10012522 3300001990 Bacteria 2766
18 JGI24735J21928_10001176 3300002067 Bacteria 9351
19 JGI24748J21848_1000101 3300002074 Bacteria 19763
20 JGI24738J21930_10000106 3300002075 Bacteria 19367
21 JGI24738J21930_10001777 3300002075 Bacteria 5871
22 JGI24738J21930_10001908 3300002075 Bacteria 5627
23 JGI24749J21850_1002872 3300002076 Bacteria 2413
24 JGI24744J21845_10002156 3300002077 Bacteria 3997
25 JGI24034J26672_10000034 3300002239 Bacteria 85929
26 JGI25165J46597_1000032 3300003214 Bacteria 294371
27 JGI25165J46597_1001377 3300003214 Bacteria 13380
28 JGI25153J46596_10000006 3300003215 Bacteria 447760
29 Ga0055525_1000040 3300003759 Bacteria 286933
30 Ga0055542_1000046 3300003762 Bacteria 201922
31 Ga0055529_1000007 3300003763 Bacteria 403604
32 Ga0070658_10004220 3300005327 Bacteria 11756
33 Ga0070658_10007750 3300005327 Bacteria 8653
34 Ga0070658_10012050 3300005327 Bacteria 6944
35 Ga0070658_10012348 3300005327 Bacteria 6860
36 Ga0070658_10037304 3300005327 Bacteria 3917
37 Ga0070658_10039282 3300005327 Bacteria 3817
38 Ga0070658_10041821 3300005327 Bacteria 3697
39 Ga0070658_10044376 3300005327 Bacteria 3593
40 Ga0070658_10140303 3300005327 Bacteria 2018
41 Ga0070676_10005331 3300005328 Bacteria 6845
42 Ga0070683_100000109 3300005329 Bacteria 54186
43 Ga0070690_100000068 3300005330 Bacteria 51626
44 Ga0070690_100009353 3300005330 Bacteria 5676
45 Ga0070670_100000051 3300005331 Bacteria 131351
46 Ga0070670_100002017 3300005331 Bacteria 16606
47 Ga0070670_100024824 3300005331 Bacteria 5156
48 Ga0070670_100027828 3300005331 Bacteria 4863
49 Ga0070670_100050975 3300005331 Bacteria 3556
50 Ga0070670_100054032 3300005331 Bacteria 3448
51 Ga0070670_100171692 3300005331 Bacteria 1881
52 Ga0068869_100000516 3300005334 Bacteria 21591
53 Ga0068869_100002134 3300005334 Bacteria 11887
54 Ga0068869_100013879 3300005334 Bacteria 5371
55 Ga0070666_10000002 3300005335 Bacteria 478684
56 Ga0070666_10000717 3300005335 Bacteria 20096
57 Ga0070680_100039350 3300005336 Bacteria 3827
58 Ga0070682_100000094 3300005337 Bacteria 81230
59 Ga0068868_100000038 3300005338 Bacteria 71746
60 Ga0068868_100001094 3300005338 Bacteria 18562
61 Ga0068868_100003632 3300005338 Bacteria 10767
62 Ga0068868_100014837 3300005338 Bacteria 5751
63 Ga0068868_100024491 3300005338 Bacteria 4581
64 Ga0068868_100144729 3300005338 Bacteria 1953
65 Ga0070660_100000436 3300005339 Bacteria 27606
66 Ga0070660_100003726 3300005339 Bacteria 10530
67 Ga0070660_100005239 3300005339 Bacteria 8966
68 Ga0070689_100004818 3300005340 Bacteria 9156
69 Ga0070689_100019280 3300005340 Bacteria 5041
70 Ga0070687_100002359 3300005343 Bacteria 7040
71 Ga0070661_100024728 3300005344 Bacteria 4309
72 Ga0070661_100052604 3300005344 Bacteria 2981
73 Ga0070661_100055938 3300005344 Bacteria 2889
74 Ga0070661_100070617 3300005344 Bacteria 2568
75 Ga0070661_100113825 3300005344 Bacteria 2022
76 Ga0070692_10011298 3300005345 Bacteria 4094
77 Ga0070668_100002981 3300005347 Bacteria 12519
78 Ga0070668_100016412 3300005347 Bacteria 5536
79 Ga0070669_100000229 3300005353 Bacteria 46742
80 Ga0070669_100000811 3300005353 Bacteria 22744
81 Ga0070675_100000060 3300005354 Bacteria 66785
82 Ga0070675_100007442 3300005354 Bacteria 8456
83 Ga0070675_100025145 3300005354 Bacteria 4772
84 Ga0070675_100049263 3300005354 Bacteria 3457
85 Ga0070675_100063772 3300005354 Bacteria 3046
86 Ga0070671_100001075 3300005355 Bacteria 20195
87 Ga0070671_100002434 3300005355 Bacteria 14391
88 Ga0070671_100010584 3300005355 Bacteria 7408
89 Ga0070671_100027863 3300005355 Bacteria 4651
90 Ga0070671_100037728 3300005355 Bacteria 4008
91 Ga0070671_100084037 3300005355 Bacteria 2662
92 Ga0070671_100094013 3300005355 Bacteria 2512
93 Ga0070671_100097573 3300005355 Bacteria 2464
94 Ga0070671_100129121 3300005355 Bacteria 2128
95 Ga0070671_100148149 3300005355 Bacteria 1982
96 Ga0070671_100176849 3300005355 Bacteria 1806
97 Ga0070674_100001467 3300005356 Bacteria 12583
98 Ga0070674_100041488 3300005356 Bacteria 3119
99 Ga0070674_100048818 3300005356 Bacteria 2907
100 Ga0070674_100066915 3300005356 Bacteria 2526
101 Ga0070673_100000003 3300005364 Bacteria 216759
102 Ga0070673_100000661 3300005364 Bacteria 18949
103 Ga0070673_100003749 3300005364 Bacteria 9531
104 Ga0070673_100005252 3300005364 Bacteria 8268
105 Ga0070673_100011740 3300005364 Bacteria 5990
106 Ga0070673_100035307 3300005364 Bacteria 3790
107 Ga0070673_100073319 3300005364 Bacteria 2755
108 Ga0070659_100001213 3300005366 Bacteria 18709
109 Ga0070659_100017252 3300005366 Bacteria 5428
110 Ga0070659_100029989 3300005366 Bacteria 4207
111 Ga0070659_100078208 3300005366 Bacteria 2638
112 Ga0070659_100079665 3300005366 Bacteria 2614
113 Ga0070667_100000418 3300005367 Bacteria 45252
114 Ga0070667_100001262 3300005367 Bacteria 22964
115 Ga0070667_100001721 3300005367 Bacteria 19565
116 Ga0070667_100006338 3300005367 Bacteria 9833
117 Ga0070667_100009153 3300005367 Bacteria 8198
118 Ga0070667_100009740 3300005367 Bacteria 7966
119 Ga0070667_100021197 3300005367 Bacteria 5399
120 Ga0070667_100028675 3300005367 Bacteria 4635
121 Ga0070667_100032476 3300005367 Bacteria 4354
122 Ga0070667_100097370 3300005367 Bacteria 2538
123 Ga0070667_100127771 3300005367 Bacteria 2216
124 Ga0070713_100010249 3300005436 Bacteria 6765
125 Ga0070713_100025207 3300005436 Bacteria 4646
126 Ga0070705_100012263 3300005440 Bacteria 4352
127 Ga0070700_100000002 3300005441 Bacteria 261904
128 Ga0070694_100006532 3300005444 Bacteria 7081
129 Ga0070663_100002208 3300005455 Bacteria 10893
130 Ga0070663_100059657 3300005455 Bacteria 2742
131 Ga0070678_100006037 3300005456 Bacteria 7066
132 Ga0070678_100059147 3300005456 Bacteria 2816
133 Ga0070678_100083340 3300005456 Bacteria 2430
134 Ga0070662_100001359 3300005457 Bacteria 15030
135 Ga0070662_100004688 3300005457 Bacteria 8667
136 Ga0070662_100011778 3300005457 Bacteria 5776
137 Ga0070662_100019584 3300005457 Bacteria 4596
138 Ga0070662_100031271 3300005457 Bacteria 3735
139 Ga0070662_100040079 3300005457 Bacteria 3333
140 Ga0070662_100052030 3300005457 Bacteria 2959
141 Ga0070662_100065191 3300005457 Bacteria 2669
142 Ga0070662_100108027 3300005457 Bacteria 2115
143 Ga0070662_100122079 3300005457 Bacteria 1998
144 Ga0070662_100157654 3300005457 Bacteria 1773
145 Ga0068867_100000001 3300005459 Bacteria 427563
146 Ga0068867_100003553 3300005459 Bacteria 10963
147 Ga0068867_100037589 3300005459 Bacteria 3519
148 Ga0068867_100040177 3300005459 Bacteria 3412
149 Ga0068867_100185083 3300005459 Bacteria 1658
150 Ga0070685_10000337 3300005466 Bacteria 28829
151 Ga0070685_10102351 3300005466 Bacteria 1751
152 Ga0070707_100002311 3300005468 Bacteria 18215
153 Ga0070707_100046695 3300005468 Bacteria 4145
154 Ga0070699_100021683 3300005518 Bacteria 5539
155 Ga0070699_100029902 3300005518 Bacteria 4699
156 Ga0070679_100219426 3300005530 Bacteria 1863
157 Ga0070684_100000090 3300005535 Bacteria 59104
158 Ga0068853_100000861 3300005539 Bacteria 21166
159 Ga0068853_100038381 3300005539 Bacteria 4079
160 Ga0068853_100091967 3300005539 Bacteria 2668
161 Ga0070672_100000284 3300005543 Bacteria 28813
162 Ga0070672_100010085 3300005543 Bacteria 6540
163 Ga0070672_100033724 3300005543 Bacteria 3880
164 Ga0070672_100062542 3300005543 Bacteria 2938
165 Ga0070672_100083436 3300005543 Bacteria 2565
166 Ga0070672_100106176 3300005543 Bacteria 2284
167 Ga0070672_100109090 3300005543 Bacteria 2254
168 Ga0070672_100141726 3300005543 Bacteria 1983
169 Ga0070686_100000003 3300005544 Bacteria 308397
170 Ga0070686_100080279 3300005544 Bacteria 2158
171 Ga0070696_100004864 3300005546 Bacteria 8976
172 Ga0070696_100066656 3300005546 Bacteria 2525
173 Ga0070693_100034929 3300005547 Bacteria 2785
174 Ga0070665_100000036 3300005548 Bacteria 314603
175 Ga0070665_100000086 3300005548 Bacteria 178229
176 Ga0070665_100010104 3300005548 Bacteria 9547
177 Ga0070665_100015373 3300005548 Bacteria 7686
178 Ga0070665_100029738 3300005548 Bacteria 5497
179 Ga0070665_100040418 3300005548 Bacteria 4688
180 Ga0070665_100046993 3300005548 Bacteria 4332
181 Ga0070665_100077516 3300005548 Bacteria 3330
182 Ga0070665_100086621 3300005548 Bacteria 3137
183 Ga0068855_100000273 3300005563 Bacteria 63616
184 Ga0070664_100001250 3300005564 Bacteria 20349
185 Ga0070664_100008626 3300005564 Bacteria 8248
186 Ga0070664_100023867 3300005564 Bacteria 5052
187 Ga0070664_100117168 3300005564 Bacteria 2330
188 Ga0070664_100158101 3300005564 Bacteria 2004
189 Ga0068857_100002439 3300005577 Bacteria 15178
190 Ga0068857_100007522 3300005577 Bacteria 9373
191 Ga0068857_100012284 3300005577 Bacteria 7450
192 Ga0068857_100015505 3300005577 Bacteria 6659
193 Ga0068857_100095500 3300005577 Bacteria 2664
194 Ga0068854_100000323 3300005578 Bacteria 31550
195 Ga0068854_100016183 3300005578 Bacteria 4964
196 Ga0068854_100022892 3300005578 Bacteria 4262
197 Ga0068854_100063253 3300005578 Bacteria 2686
198 Ga0068854_100127969 3300005578 Bacteria 1936
199 Ga0068856_100017633 3300005614 Bacteria 6920
200 Ga0070702_100008512 3300005615 Bacteria 4973
201 Ga0070702_100038908 3300005615 Bacteria 2652
202 Ga0068852_100000399 3300005616 Bacteria 29083
203 Ga0068852_100001669 3300005616 Bacteria 15127
204 Ga0068852_100039665 3300005616 Bacteria 3966
205 Ga0068859_100000229 3300005617 Bacteria 55082
206 Ga0068859_100003622 3300005617 Bacteria 15749
207 Ga0068859_100023445 3300005617 Bacteria 6193
208 Ga0068859_100024066 3300005617 Bacteria 6111
209 Ga0068859_100032511 3300005617 Bacteria 5240
210 Ga0068859_100138543 3300005617 Bacteria 2507
211 Ga0068864_100000004 3300005618 Bacteria 489341
212 Ga0068864_100000171 3300005618 Bacteria 59747
213 Ga0068864_100000345 3300005618 Bacteria 40863
214 Ga0068864_100002129 3300005618 Bacteria 16377
215 Ga0068864_100004504 3300005618 Bacteria 11457
216 Ga0068864_100021357 3300005618 Bacteria 5423
217 Ga0068864_100023357 3300005618 Bacteria 5192
218 Ga0068864_100041418 3300005618 Bacteria 3939
219 Ga0068864_100123925 3300005618 Bacteria 2313
220 Ga0068861_100036033 3300005719 Bacteria 3669
221 Ga0068861_100066915 3300005719 Bacteria 2771
222 Ga0068861_100138987 3300005719 Bacteria 1980
223 Ga0068851_10021662 3300005834 Bacteria 3121
224 Ga0068851_10095169 3300005834 Bacteria 1573
225 Ga0068870_10024826 3300005840 Bacteria 2969
226 Ga0068863_100000002 3300005841 Bacteria 489510
227 Ga0068863_100000034 3300005841 Bacteria 168359
228 Ga0068863_100000847 3300005841 Bacteria 30527
229 Ga0068863_100001129 3300005841 Bacteria 26682
230 Ga0068863_100007002 3300005841 Bacteria 11053
231 Ga0068863_100014132 3300005841 Bacteria 7691
232 Ga0068863_100037323 3300005841 Bacteria 4626
233 Ga0068863_100048245 3300005841 Bacteria 4038
234 Ga0068863_100105895 3300005841 Bacteria 2675
235 Ga0068858_100000223 3300005842 Bacteria 61546
236 Ga0068858_100000313 3300005842 Bacteria 51649
237 Ga0068858_100000977 3300005842 Bacteria 29542
238 Ga0068858_100003837 3300005842 Bacteria 14863
239 Ga0068858_100017369 3300005842 Bacteria 6749
240 Ga0068858_100021876 3300005842 Bacteria 5973
241 Ga0068858_100032038 3300005842 Bacteria 4883
242 Ga0068858_100124585 3300005842 Bacteria 2412
243 Ga0068860_100000001 3300005843 Bacteria 703043
244 Ga0068860_100009456 3300005843 Bacteria 9680
245 Ga0068860_100024577 3300005843 Bacteria 5819
246 Ga0068860_100036710 3300005843 Bacteria 4693
247 Ga0068860_100254017 3300005843 Bacteria 1712
248 Ga0068862_100000002 3300005844 Bacteria 489341
249 Ga0068862_100001230 3300005844 Bacteria 24152
250 Ga0068862_100045471 3300005844 Bacteria 3746
251 Ga0068862_100125340 3300005844 Bacteria 2267
252 Ga0068862_100151202 3300005844 Bacteria 2066
253 Ga0097621_100041586 3300006237 Bacteria 3700
254 Ga0097621_100069582 3300006237 Bacteria 2906
255 Ga0068871_100018393 3300006358 Bacteria 5310
256 Ga0068871_100029816 3300006358 Bacteria 4289
257 Ga0068871_100062292 3300006358 Bacteria 3048
258 Ga0068871_100104763 3300006358 Bacteria 2373
259 Ga0075428_100000061 3300006844 Bacteria 88478
260 Ga0075431_100002173 3300006847 Bacteria 18741
261 Ga0068865_100000011 3300006881 Bacteria 154581
262 Ga0097620_100000229 3300006931 Bacteria 55082
263 Ga0097620_100003622 3300006931 Bacteria 15749
264 Ga0097620_100023445 3300006931 Bacteria 6193
265 Ga0097620_100024066 3300006931 Bacteria 6111
266 Ga0097620_100032513 3300006931 Bacteria 5240
267 Ga0097620_100138535 3300006931 Bacteria 2507
268 Ga0105251_10002895 3300009011 Bacteria 12902
269 Ga0105240_10029601 3300009093 Bacteria 7130
270 Ga0105240_10105270 3300009093 Bacteria 3425
271 Ga0105240_10298853 3300009093 Bacteria 1842
272 Ga0111539_10000030 3300009094 Bacteria 175454
273 Ga0111539_10001888 3300009094 Bacteria 27854
274 Ga0105245_10000003 3300009098 Bacteria 488207
275 Ga0105245_10000157 3300009098 Bacteria 64143
276 Ga0105245_10008190 3300009098 Bacteria 9144
277 Ga0114129_10023321 3300009147 Bacteria 8778
278 Ga0105243_10000042 3300009148 Bacteria 159276
279 Ga0105243_10000744 3300009148 Bacteria 31197
280 Ga0105241_10008325 3300009174 Bacteria 7636
281 Ga0105241_10025579 3300009174 Bacteria 4387
282 Ga0105242_10001059 3300009176 Bacteria 21641
283 Ga0105242_10002569 3300009176 Bacteria 14211
284 Ga0105242_10029151 3300009176 Bacteria 4399
285 Ga0105248_10000010 3300009177 Bacteria 344314
286 Ga0105248_10000075 3300009177 Bacteria 114243
287 Ga0105248_10001396 3300009177 Bacteria 26955
288 Ga0105248_10009109 3300009177 Bacteria 10918
289 Ga0105248_10010582 3300009177 Bacteria 10166
290 Ga0105248_10020058 3300009177 Bacteria 7404
291 Ga0105248_10025569 3300009177 Bacteria 6565
292 Ga0105248_10038152 3300009177 Bacteria 5376
293 Ga0105248_10208203 3300009177 Bacteria 2204
294 Ga0105238_10000041 3300009551 Bacteria 155330
295 Ga0105238_10010516 3300009551 Bacteria 9289
296 Ga0105238_10127790 3300009551 Bacteria 2520
297 Ga0105249_10000026 3300009553 Bacteria 232053
298 Ga0105249_10000041 3300009553 Bacteria 195999
299 Ga0105249_10018777 3300009553 Bacteria 6160
300 Ga0105249_10042959 3300009553 Bacteria 4111
301 Ga0105239_10091084 3300010375 Bacteria 3365
302 Ga0105246_10000049 3300011119 Bacteria 46856
303 Ga0105246_10145098 3300011119 Bacteria 1790
304 Ga0157373_10012550 3300013100 Bacteria 6228
305 Ga0157373_10014217 3300013100 Bacteria 5837
306 Ga0157373_10016948 3300013100 Bacteria 5308
307 Ga0157373_10090625 3300013100 Bacteria 2153
308 Ga0157371_10000097 3300013102 Bacteria 134150
309 Ga0157371_10006551 3300013102 Bacteria 9574
310 Ga0157371_10009191 3300013102 Bacteria 7802
311 Ga0157371_10010860 3300013102 Bacteria 7065
312 Ga0157370_10000008 3300013104 Bacteria 240668
313 Ga0157370_10063152 3300013104 Bacteria 3510
314 Ga0157370_10097185 3300013104 Bacteria 2763
315 Ga0157369_10004298 3300013105 Bacteria 16846
316 Ga0157369_10012993 3300013105 Bacteria 9433
317 Ga0157369_10026851 3300013105 Bacteria 6385
318 Ga0157369_10063594 3300013105 Bacteria 3975
319 Ga0157374_10000006 3300013296 Bacteria 640284
320 Ga0157374_10004689 3300013296 Bacteria 11476
321 Ga0157374_10004864 3300013296 Bacteria 11270
322 Ga0157374_10049753 3300013296 Bacteria 3894
323 Ga0157374_10094173 3300013296 Bacteria 2862
324 Ga0157378_10000633 3300013297 Bacteria 33010
325 Ga0157378_10001598 3300013297 Bacteria 20501
326 Ga0157378_10002972 3300013297 Bacteria 15070
327 Ga0157378_10003092 3300013297 Bacteria 14798
328 Ga0157378_10026060 3300013297 Bacteria 5153
329 Ga0157378_10055168 3300013297 Bacteria 3539
330 Ga0157378_10174747 3300013297 Bacteria 2017
331 Ga0163162_10025452 3300013306 Bacteria 5848
332 Ga0163162_10035012 3300013306 Bacteria 4999
333 Ga0163162_10045432 3300013306 Bacteria 4400
334 Ga0157372_10018358 3300013307 Bacteria 7518
335 Ga0157372_10119479 3300013307 Bacteria 3026
336 Ga0157375_10000018 3300013308 Bacteria 285123
337 Ga0157375_10000024 3300013308 Bacteria 231767
338 Ga0157375_10004452 3300013308 Bacteria 12162
339 Ga0157375_10038010 3300013308 Bacteria 4618
340 Ga0157375_10095484 3300013308 Bacteria 3044
341 Ga0157375_10281745 3300013308 Bacteria 1825
342 Ga0163163_10081544 3300014325 Bacteria 3237
343 Ga0163163_10177395 3300014325 Bacteria 2177
344 Ga0157380_10007826 3300014326 Bacteria 7605
345 Ga0157377_10000011 3300014745 Bacteria 305350
346 Ga0157377_10000057 3300014745 Bacteria 87502
347 Ga0157377_10009297 3300014745 Bacteria 4815
348 Ga0157377_10102130 3300014745 Bacteria 1710
349 Ga0157379_10020748 3300014968 Bacteria 5813
350 Ga0157379_10125868 3300014968 Bacteria 2306
351 Ga0157379_10288073 3300014968 Bacteria 1495
352 Ga0157376_10000009 3300014969 Bacteria 340244
353 Ga0157376_10000072 3300014969 Bacteria 77631
354 Ga0157376_10086902 3300014969 Bacteria 2697
355 Ga0183363_1001 3300015690 Bacteria 611534
356 Ga0163161_10000008 3300017792 Bacteria 294642
357 Ga0163161_10074630 3300017792 Bacteria 2487
358 Ga0163161_10080096 3300017792 Bacteria 2403
359 Ga0213873_10000003 3300021358 Bacteria 973849
360 Ga0213873_10000255 3300021358 Bacteria 9238
361 Ga0213876_10000003 3300021384 Bacteria 973849
362 Ga0213876_10000018 3300021384 Bacteria 282299
363 Ga0213876_10004303 3300021384 Bacteria 7980
364 Ga0213876_10013306 3300021384 Bacteria 4373
365 Ga0213876_10035134 3300021384 Bacteria 2644
366 Ga0209563_100019 3300025230 Bacteria 697828
367 Ga0207427_100735 3300025231 Bacteria 15112
368 Ga0209437_101732 3300025233 Bacteria 4784
369 Ga0209026_1002303 3300025250 Bacteria 7280
370 Ga0209148_1000026 3300025254 Bacteria 629213
371 Ga0209148_1000441 3300025254 Bacteria 45707
372 Ga0209148_1003631 3300025254 Bacteria 4128
373 Ga0209233_1000066 3300025261 Bacteria 381218
374 Ga0209233_1000858 3300025261 Bacteria 13432
375 Ga0209455_1000005 3300025272 Bacteria 1416756
376 Ga0209455_1002591 3300025272 Bacteria 6882
377 Ga0209758_1000001 3300025297 Bacteria 1981790
378 Ga0207697_10000144 3300025315 Bacteria 34657
379 Ga0207697_10019307 3300025315 Bacteria 2791
380 Ga0207656_10021949 3300025321 Bacteria 2556
381 Ga0207713_1005772 3300025735 Bacteria 7664
382 Ga0207682_10045957 3300025893 Bacteria 1793
383 Ga0207642_10013328 3300025899 Bacteria 2998
384 Ga0207642_10024206 3300025899 Bacteria 2438
385 Ga0207642_10037717 3300025899 Bacteria 2085
386 Ga0207688_10000184 3300025901 Bacteria 27851
387 Ga0207688_10059976 3300025901 Bacteria 2143
388 Ga0207680_10000004 3300025903 Bacteria 827324
389 Ga0207680_10011971 3300025903 Bacteria 4405
390 Ga0207680_10032752 3300025903 Bacteria 2958
391 Ga0207680_10055524 3300025903 Bacteria 2387
392 Ga0207680_10058425 3300025903 Bacteria 2338
393 Ga0207647_10000521 3300025904 Bacteria 30717
394 Ga0207647_10000671 3300025904 Bacteria 26786
395 Ga0207647_10003571 3300025904 Bacteria 11672
396 Ga0207647_10005571 3300025904 Bacteria 9206
397 Ga0207647_10008857 3300025904 Bacteria 7180
398 Ga0207647_10009220 3300025904 Bacteria 7018
399 Ga0207647_10023395 3300025904 Bacteria 4085
400 Ga0207647_10041001 3300025904 Bacteria 2913
401 Ga0207647_10043299 3300025904 Bacteria 2818
402 Ga0207645_10000395 3300025907 Bacteria 35956
403 Ga0207645_10014251 3300025907 Bacteria 5325
404 Ga0207645_10041769 3300025907 Bacteria 2935
405 Ga0207705_10000027 3300025909 Bacteria 248863
406 Ga0207705_10002122 3300025909 Bacteria 15392
407 Ga0207705_10006608 3300025909 Bacteria 8580
408 Ga0207705_10007211 3300025909 Bacteria 8187
409 Ga0207684_10030060 3300025910 Bacteria 4625
410 Ga0207684_10152210 3300025910 Bacteria 1990
411 Ga0207654_10002556 3300025911 Bacteria 9233
412 Ga0207695_10035013 3300025913 Bacteria 5451
413 Ga0207695_10099147 3300025913 Bacteria 2911
414 Ga0207695_10233769 3300025913 Bacteria 1741
415 Ga0207671_10009431 3300025914 Bacteria 8161
416 Ga0207671_10012841 3300025914 Bacteria 6709
417 Ga0207660_10083302 3300025917 Bacteria 2355
418 Ga0207662_10002339 3300025918 Bacteria 9500
419 Ga0207657_10002012 3300025919 Bacteria 21985
420 Ga0207657_10002889 3300025919 Bacteria 18453
421 Ga0207657_10007114 3300025919 Bacteria 11493
422 Ga0207657_10009672 3300025919 Bacteria 9675
423 Ga0207657_10015357 3300025919 Bacteria 7421
424 Ga0207657_10017929 3300025919 Bacteria 6774
425 Ga0207657_10019079 3300025919 Bacteria 6525
426 Ga0207657_10050325 3300025919 Bacteria 3626
427 Ga0207657_10123364 3300025919 Bacteria 2130
428 Ga0207657_10129422 3300025919 Bacteria 2070
429 Ga0207649_10003137 3300025920 Bacteria 9065
430 Ga0207649_10070838 3300025920 Bacteria 2224
431 Ga0207646_10001040 3300025922 Bacteria 35403
432 Ga0207681_10000178 3300025923 Bacteria 52013
433 Ga0207681_10001616 3300025923 Bacteria 14532
434 Ga0207681_10006977 3300025923 Bacteria 6932
435 Ga0207681_10030252 3300025923 Bacteria 3528
436 Ga0207694_10000001 3300025924 Bacteria 4078485
437 Ga0207694_10007758 3300025924 Bacteria 8128
438 Ga0207694_10020747 3300025924 Bacteria 4974
439 Ga0207694_10101136 3300025924 Bacteria 2284
440 Ga0207694_10141891 3300025924 Bacteria 1932
441 Ga0207650_10000083 3300025925 Bacteria 127270
442 Ga0207650_10000460 3300025925 Bacteria 34271
443 Ga0207650_10006457 3300025925 Bacteria 7987
444 Ga0207650_10014155 3300025925 Bacteria 5541
445 Ga0207650_10033910 3300025925 Bacteria 3701
446 Ga0207650_10044991 3300025925 Bacteria 3246
447 Ga0207650_10090865 3300025925 Bacteria 2332
448 Ga0207659_10000011 3300025926 Bacteria 275661
449 Ga0207659_10007196 3300025926 Bacteria 6835
450 Ga0207659_10008668 3300025926 Bacteria 6326
451 Ga0207659_10031366 3300025926 Bacteria 3638
452 Ga0207687_10000002 3300025927 Bacteria 975489
453 Ga0207687_10001915 3300025927 Bacteria 14312
454 Ga0207687_10003139 3300025927 Bacteria 11207
455 Ga0207644_10000570 3300025931 Bacteria 23662
456 Ga0207644_10001392 3300025931 Bacteria 15594
457 Ga0207644_10005796 3300025931 Bacteria 8040
458 Ga0207644_10012016 3300025931 Bacteria 5742
459 Ga0207644_10016201 3300025931 Bacteria 5015
460 Ga0207644_10029050 3300025931 Bacteria 3833
461 Ga0207644_10038386 3300025931 Bacteria 3373
462 Ga0207644_10043996 3300025931 Bacteria 3170
463 Ga0207644_10046831 3300025931 Bacteria 3083
464 Ga0207644_10069903 3300025931 Bacteria 2564
465 Ga0207644_10089388 3300025931 Bacteria 2292
466 Ga0207644_10111936 3300025931 Bacteria 2065
467 Ga0207644_10148433 3300025931 Bacteria 1812
468 Ga0207690_10020142 3300025932 Bacteria 4117
469 Ga0207690_10063175 3300025932 Bacteria 2524
470 Ga0207706_10000467 3300025933 Bacteria 43202
471 Ga0207706_10001512 3300025933 Bacteria 23067
472 Ga0207706_10004027 3300025933 Bacteria 13904
473 Ga0207706_10012744 3300025933 Bacteria 7652
474 Ga0207706_10013579 3300025933 Bacteria 7399
475 Ga0207706_10013914 3300025933 Bacteria 7296
476 Ga0207706_10018693 3300025933 Bacteria 6235
477 Ga0207706_10022801 3300025933 Bacteria 5617
478 Ga0207706_10045652 3300025933 Bacteria 3881
479 Ga0207706_10052751 3300025933 Bacteria 3590
480 Ga0207706_10056151 3300025933 Bacteria 3472
481 Ga0207706_10087589 3300025933 Bacteria 2738
482 Ga0207706_10146686 3300025933 Bacteria 2076
483 Ga0207706_10167138 3300025933 Bacteria 1933
484 Ga0207706_10223547 3300025933 Bacteria 1648
485 Ga0207686_10000797 3300025934 Bacteria 19358
486 Ga0207686_10116167 3300025934 Bacteria 1813
487 Ga0207709_10000119 3300025935 Bacteria 121452
488 Ga0207709_10000188 3300025935 Bacteria 82582
489 Ga0207670_10006452 3300025936 Bacteria 6505
490 Ga0207670_10012070 3300025936 Bacteria 5038
491 Ga0207669_10000614 3300025937 Bacteria 15500
492 Ga0207669_10063582 3300025937 Bacteria 2279
493 Ga0207669_10067673 3300025937 Bacteria 2227
494 Ga0207704_10000001 3300025938 Bacteria 716296
495 Ga0207704_10003382 3300025938 Bacteria 7244
496 Ga0207691_10000281 3300025940 Bacteria 50396
497 Ga0207691_10000884 3300025940 Bacteria 29746
498 Ga0207691_10005043 3300025940 Bacteria 12741
499 Ga0207691_10009981 3300025940 Bacteria 9119
500 Ga0207691_10014306 3300025940 Bacteria 7568
501 Ga0207691_10112603 3300025940 Bacteria 2418
502 Ga0207691_10126344 3300025940 Bacteria 2262
503 Ga0207711_10000035 3300025941 Bacteria 177223
504 Ga0207711_10000077 3300025941 Bacteria 106500
505 Ga0207711_10005454 3300025941 Bacteria 10751
506 Ga0207711_10010239 3300025941 Bacteria 7785
507 Ga0207711_10028216 3300025941 Bacteria 4722
508 Ga0207711_10033608 3300025941 Bacteria 4341
509 Ga0207711_10064523 3300025941 Bacteria 3163
510 Ga0207689_10000212 3300025942 Bacteria 51394
511 Ga0207689_10000824 3300025942 Bacteria 29889
512 Ga0207689_10004329 3300025942 Bacteria 12928
513 Ga0207689_10053183 3300025942 Bacteria 3336
514 Ga0207661_10000013 3300025944 Bacteria 348811
515 Ga0207679_10001980 3300025945 Bacteria 12706
516 Ga0207679_10010666 3300025945 Bacteria 5924
517 Ga0207679_10048360 3300025945 Bacteria 3096
518 Ga0207679_10055472 3300025945 Bacteria 2921
519 Ga0207679_10157427 3300025945 Bacteria 1856
520 Ga0207667_10000010 3300025949 Bacteria 477432
521 Ga0207667_10000109 3300025949 Bacteria 132054
522 Ga0207667_10005836 3300025949 Bacteria 14998
523 Ga0207667_10248124 3300025949 Bacteria 1821
524 Ga0207651_10000002 3300025960 Bacteria 427663
525 Ga0207651_10000536 3300025960 Bacteria 15928
526 Ga0207651_10010118 3300025960 Bacteria 5207
527 Ga0207651_10011469 3300025960 Bacteria 4964
528 Ga0207651_10032299 3300025960 Bacteria 3360
529 Ga0207651_10039985 3300025960 Bacteria 3098
530 Ga0207712_10000001 3300025961 Bacteria 750309
531 Ga0207712_10000460 3300025961 Bacteria 34444
532 Ga0207712_10011591 3300025961 Bacteria 5621
533 Ga0207712_10156584 3300025961 Bacteria 1765
534 Ga0207668_10000064 3300025972 Bacteria 87025
535 Ga0207640_10001306 3300025981 Bacteria 13525
536 Ga0207640_10015707 3300025981 Bacteria 4387
537 Ga0207640_10027350 3300025981 Bacteria 3474
538 Ga0207640_10102716 3300025981 Bacteria 2008
539 Ga0207640_10136456 3300025981 Bacteria 1782
540 Ga0207658_10000575 3300025986 Bacteria 33049
541 Ga0207658_10000909 3300025986 Bacteria 24536
542 Ga0207658_10001752 3300025986 Bacteria 16336
543 Ga0207658_10008040 3300025986 Bacteria 7186
544 Ga0207658_10033284 3300025986 Bacteria 3675
545 Ga0207658_10049735 3300025986 Bacteria 3081
546 Ga0207658_10075142 3300025986 Bacteria 2570
547 Ga0207677_10000011 3300026023 Bacteria 199704
548 Ga0207677_10000042 3300026023 Bacteria 110706
549 Ga0207677_10000179 3300026023 Bacteria 50536
550 Ga0207677_10004781 3300026023 Bacteria 7307
551 Ga0207677_10006345 3300026023 Bacteria 6482
552 Ga0207703_10000961 3300026035 Bacteria 27866
553 Ga0207703_10002285 3300026035 Bacteria 16709
554 Ga0207703_10002971 3300026035 Bacteria 14368
555 Ga0207703_10022901 3300026035 Bacteria 4907
556 Ga0207703_10038353 3300026035 Bacteria 3823
557 Ga0207703_10082173 3300026035 Bacteria 2688
558 Ga0207703_10092526 3300026035 Bacteria 2545
559 Ga0207639_10000020 3300026041 Bacteria 236698
560 Ga0207639_10015675 3300026041 Bacteria 5348
561 Ga0207639_10031577 3300026041 Bacteria 3893
562 Ga0207639_10229861 3300026041 Bacteria 1607
563 Ga0207678_10000804 3300026067 Bacteria 28814
564 Ga0207678_10004243 3300026067 Bacteria 12857
565 Ga0207678_10007057 3300026067 Bacteria 9975
566 Ga0207678_10008718 3300026067 Bacteria 8930
567 Ga0207678_10029379 3300026067 Bacteria 4797
568 Ga0207678_10033132 3300026067 Bacteria 4502
569 Ga0207708_10000120 3300026075 Bacteria 60395
570 Ga0207702_10001740 3300026078 Bacteria 21419
571 Ga0207702_10007466 3300026078 Bacteria 9325
572 Ga0207702_10010297 3300026078 Bacteria 7833
573 Ga0207702_10139307 3300026078 Bacteria 2193
574 Ga0207641_10000002 3300026088 Bacteria 981004
575 Ga0207641_10000057 3300026088 Bacteria 168603
576 Ga0207641_10000140 3300026088 Bacteria 105699
577 Ga0207641_10004215 3300026088 Bacteria 12531
578 Ga0207641_10013509 3300026088 Bacteria 6698
579 Ga0207641_10014457 3300026088 Bacteria 6466
580 Ga0207648_10000001 3300026089 Bacteria 427499
581 Ga0207648_10001054 3300026089 Bacteria 30851
582 Ga0207648_10003316 3300026089 Bacteria 16906
583 Ga0207648_10118231 3300026089 Bacteria 2329
584 Ga0207676_10000005 3300026095 Bacteria 698744
585 Ga0207676_10000008 3300026095 Bacteria 588913
586 Ga0207676_10001402 3300026095 Bacteria 17933
587 Ga0207676_10002110 3300026095 Bacteria 14402
588 Ga0207676_10003752 3300026095 Bacteria 10734
589 Ga0207676_10005764 3300026095 Bacteria 8760
590 Ga0207676_10029077 3300026095 Bacteria 4134
591 Ga0207676_10124322 3300026095 Bacteria 2181
592 Ga0207674_10000501 3300026116 Bacteria 51694
593 Ga0207674_10002481 3300026116 Bacteria 23258
594 Ga0207674_10003712 3300026116 Bacteria 18642
595 Ga0207674_10003718 3300026116 Bacteria 18629
596 Ga0207674_10006227 3300026116 Bacteria 14065
597 Ga0207674_10009494 3300026116 Bacteria 11108
598 Ga0207674_10012021 3300026116 Bacteria 9698
599 Ga0207674_10018843 3300026116 Bacteria 7487
600 Ga0207674_10025767 3300026116 Bacteria 6263
601 Ga0207674_10057185 3300026116 Bacteria 3954
602 Ga0207674_10211466 3300026116 Bacteria 1888
603 Ga0207675_100001962 3300026118 Bacteria 20508
604 Ga0207675_100004465 3300026118 Bacteria 13521
605 Ga0207675_100024355 3300026118 Bacteria 5629
606 Ga0207675_100096482 3300026118 Bacteria 2783
607 Ga0207683_10002637 3300026121 Bacteria 15673
608 Ga0207683_10002725 3300026121 Bacteria 15428
609 Ga0207683_10003626 3300026121 Bacteria 13437
610 Ga0207683_10045172 3300026121 Bacteria 3852
611 Ga0207683_10074801 3300026121 Bacteria 2998
612 Ga0207698_10000173 3300026142 Bacteria 40043
613 Ga0207698_10005136 3300026142 Bacteria 8046
614 Ga0207698_10079654 3300026142 Bacteria 2635
615 Ga0207698_10157231 3300026142 Bacteria 1982
616 Ga0207428_10000038 3300027907 Bacteria 216105
617 Ga0268266_10000002 3300028379 Bacteria 3059047
618 Ga0268266_10000042 3300028379 Bacteria 316826
619 Ga0268266_10000186 3300028379 Bacteria 110448
620 Ga0268266_10011692 3300028379 Bacteria 7616
621 Ga0268266_10026764 3300028379 Bacteria 4907
622 Ga0268265_10000003 3300028380 Bacteria 949201
623 Ga0268265_10000233 3300028380 Bacteria 63492
624 Ga0268265_10012742 3300028380 Bacteria 5707
625 Ga0268265_10027723 3300028380 Bacteria 4046
626 Ga0268264_10000006 3300028381 Bacteria 827324
627 Ga0268264_10001603 3300028381 Bacteria 20935
628 Ga0268264_10002242 3300028381 Bacteria 17146
629 Ga0268264_10011459 3300028381 Bacteria 7320
630 Ga0268264_10050762 3300028381 Bacteria 3455
631 Ga0268264_10062678 3300028381 Bacteria 3123
632 Ga0268264_10066433 3300028381 Bacteria 3041
633 Ga0307517_10100623 3300028786 Bacteria 2281
634 Ga0307511_10009527 3300030521 Bacteria 9675
635 Ga0307513_10016487 3300031456 Bacteria 8905
636 Ga0307405_10091897 3300031731 Bacteria 2012
637 Ga0307410_10110823 3300031852 Bacteria 1986
638 Ga0307412_10136313 3300031911 Bacteria 1791
639 Ga0307414_10041965 3300032004 Bacteria 3104
640 Ga0307415_100049958 3300032126 Bacteria 2831
641 Ga0307415_100068967 3300032126 Bacteria 2477
642 Ga0307510_10005870 3300033180 Bacteria 14645
643 Ga0307510_10120323 3300033180 Bacteria 2333
644 Ga0373932_0000023 3300035112 Bacteria 46650
645 Ga0373941_0001517 3300035115 Bacteria 4921
646 Ga0373931_0120169 3300035691 Bacteria 1501
647 Ga0373937_0049528 3300036401 Bacteria 3847
648 Ga0395899_0000700 3300037312 Bacteria 33694
649 Ga0395899_0001530 3300037312 Bacteria 19532
650 Ga0395899_0002034 3300037312 Bacteria 16646
651 Ga0395899_0012272 3300037312 Bacteria 6562
652 Ga0395899_0082210 3300037312 Bacteria 2343
653 Ga0395899_0089319 3300037312 Bacteria 2235
654 Ga0395900_0000238 3300037418 Bacteria 86469
655 Ga0395900_0006820 3300037418 Bacteria 11848
656 Ga0395900_0011114 3300037418 Bacteria 9203
657 Ga0395900_0011723 3300037418 Bacteria 8962
658 Ga0395900_0011835 3300037418 Bacteria 8922
659 Ga0395900_0013648 3300037418 Bacteria 8294
660 Ga0395900_0014002 3300037418 Bacteria 8188
661 Ga0395900_0014434 3300037418 Bacteria 8062
662 Ga0395900_0022863 3300037418 Bacteria 6397
663 Ga0395900_0023959 3300037418 Bacteria 6246
664 Ga0395900_0029522 3300037418 Bacteria 5624
665 Ga0395900_0033108 3300037418 Bacteria 5319
666 Ga0395900_0055551 3300037418 Bacteria 4077
667 Ga0395900_0074913 3300037418 Bacteria 3479
668 Ga0395900_0102201 3300037418 Bacteria 2945
669 Ga0395900_0116945 3300037418 Bacteria 2736
670 Ga0395900_0120486 3300037418 Bacteria 2692
671 Ga0395900_0147789 3300037418 Bacteria 2402
672 Ga0395900_0234975 3300037418 Bacteria 1842
673 Ga0395898_0000245 3300037466 Bacteria 136315
674 Ga0395898_0014864 3300037466 Bacteria 7990
675 Ga0395898_0036104 3300037466 Bacteria 4909
676 Ga0395898_0045291 3300037466 Bacteria 4325
677 Ga0395905_0000006 3300037471 Bacteria 549428
678 Ga0395905_0000207 3300037471 Bacteria 91620
679 Ga0395905_0001434 3300037471 Bacteria 28687
680 Ga0395905_0001992 3300037471 Bacteria 23333
681 Ga0395905_0002904 3300037471 Bacteria 18697
682 Ga0395905_0003926 3300037471 Bacteria 15644
683 Ga0395905_0004078 3300037471 Bacteria 15315
684 Ga0395905_0004250 3300037471 Bacteria 14960
685 Ga0395905_0005866 3300037471 Bacteria 12473
686 Ga0395905_0012036 3300037471 Bacteria 8340
687 Ga0395905_0013442 3300037471 Bacteria 7844
688 Ga0395905_0021293 3300037471 Bacteria 6134
689 Ga0395905_0066247 3300037471 Bacteria 3382
690 Ga0395905_0104617 3300037471 Bacteria 2657
691 Ga0395905_0108390 3300037471 Bacteria 2607
692 Ga0395905_0111970 3300037471 Bacteria 2563
693 Ga0395905_0118496 3300037471 Bacteria 2488
694 Ga0395905_0119340 3300037471 Bacteria 2478
695 Ga0395905_0124048 3300037471 Bacteria 2428
696 Ga0395905_0132674 3300037471 Bacteria 2343
697 Ga0395905_0149919 3300037471 Bacteria 2194
698 Ga0395905_0235237 3300037471 Bacteria 1712
699 Ga0395901_0000156 3300038443 Bacteria 88513
700 Ga0395901_0002990 3300038443 Bacteria 17050
701 Ga0395901_0008535 3300038443 Bacteria 10351
702 Ga0395901_0069527 3300038443 Bacteria 3667
703 Ga0395901_0081122 3300038443 Bacteria 3388
704 Ga0395901_0085911 3300038443 Bacteria 3289
705 Ga0395901_0088865 3300038443 Bacteria 3232
706 Ga0395901_0099564 3300038443 Bacteria 3048
707 Ga0395901_0107328 3300038443 Bacteria 2931
708 Ga0395901_0119786 3300038443 Bacteria 2765
709 Ga0436365_0235589 3300039437 Bacteria 57306
710 Ga0436365_0853705 3300039437 Bacteria 99517
711 Ga0436365_0900843 3300039437 Bacteria 6714
712 Ga0436365_1775746 3300039437 Bacteria 7536
713 Ga0436365_1817329 3300039437 Bacteria 2533
714 Ga0436362_0232622 3300039453 Bacteria 12494
715 Ga0436362_0649416 3300039453 Bacteria 210038
716 Ga0451793_0526473 3300041452 Bacteria 1433
717 Ga0451807_0730426 3300041486 Bacteria 1625
718 Ga0439448_0000759 3300042005 Bacteria 7818
719 Ga0439448_0001509 3300042005 Bacteria 6063
720 Ga0439448_0002911 3300042005 Bacteria 4691
721 Ga0439455_0001129 3300042012 Bacteria 4288
722 Ga0439455_0007492 3300042012 Bacteria 2309
723 Ga0439455_0008558 3300042012 Bacteria 2196
724 Ga0439458_0000161 3300042157 Bacteria 14947
725 Ga0439458_0000188 3300042157 Bacteria 14084
726 Ga0439458_0000449 3300042157 Bacteria 10415
727 Ga0453683_0025920 3300044673 Bacteria 3723
728 Ga0466963_0008253 3300044694 Bacteria 6242
729 Ga0466964_0014359 3300044706 Bacteria 3011
730 Ga0466971_0017109 3300044719 Bacteria 3204
731 Ga0466968_0023758 3300044735 Bacteria 2500
732 Ga0466970_0025984 3300044765 Bacteria 3068
733 Ga0466957_0023524 3300044842 Bacteria 3642
734 Ga0466960_0015617 3300044901 Bacteria 3277
735 Ga0451576_0077239 3300045051 Bacteria 3465
736 Ga0466958_0039399 3300045836 Bacteria 2839
737 Ga0466967_0050468 3300045976 Bacteria 3643
738 Ga0466967_0192478 3300045976 Bacteria 1928
739 Ga0495638_0001888 3300046460 Bacteria 18107
740 Ga0495638_0003983 3300046460 Bacteria 11360
741 Ga0495650_0000467 3300046471 Bacteria 62422
742 Ga0495584_0020786 3300046491 Bacteria 3334
743 Ga0495585_0031886 3300046492 Bacteria 2989
744 Ga0495583_0002885 3300046506 Bacteria 13913
745 Ga0495583_0008879 3300046506 Bacteria 6078
746 Ga0495583_0025207 3300046506 Bacteria 2975
747 Ga0495606_0000434 3300046507 Bacteria 69495
748 Ga0495606_0090117 3300046507 Bacteria 1888
749 Ga0495620_0005921 3300046515 Bacteria 6779
750 Ga0495643_0002587 3300046522 Bacteria 14120
751 Ga0495643_0006647 3300046522 Bacteria 7583
752 Ga0495643_0011683 3300046522 Bacteria 5333
753 Ga0495648_0000256 3300046524 Bacteria 60519
754 Ga0495663_0011587 3300046525 Bacteria 2453
755 Ga0495642_0023658 3300046528 Bacteria 2426
756 Ga0495598_0000085 3300046537 Bacteria 15414
757 Ga0495621_0000048 3300046539 Bacteria 23712
758 Ga0495622_0013680 3300046557 Bacteria 3762
759 Ga0495633_0004258 3300046558 Bacteria 9153
760 Ga0495668_0000163 3300046616 Bacteria 99607
761 Ga0495668_0016495 3300046616 Bacteria 4293
762 Ga0495668_0026213 3300046616 Bacteria 3308
763 Ga0495668_0046072 3300046616 Bacteria 2423
764 Ga0495611_0037567 3300046648 Bacteria 2152
765 Ga0495625_0000064 3300046660 Bacteria 174730
766 Ga0495625_0000424 3300046660 Bacteria 63593
767 Ga0495625_0010290 3300046660 Bacteria 7755
768 Ga0495625_0023460 3300046660 Bacteria 4713
769 Ga0495669_0000316 3300046684 Bacteria 26706
770 Ga0495669_0000334 3300046684 Bacteria 25057
771 Ga0495669_0000664 3300046684 Bacteria 14953
772 Ga0495669_0013496 3300046684 Bacteria 3482
773 Ga0495670_0007564 3300046691 Bacteria 5340
774 Ga0495670_0032603 3300046691 Bacteria 2591
775 Ga0495649_0049440 3300046694 Bacteria 2284
776 Ga0495600_0000343 3300046809 Bacteria 24780
777 Ga0495683_0039113 3300047323 Bacteria 2398
778 Ga0495683_0071516 3300047323 Bacteria 1702
779 Ga0495687_000557 3300047443 Bacteria 43965
780 Ga0495687_000933 3300047443 Bacteria 30343
781 Ga0495677_0041054 3300047445 Bacteria 1692
782 Ga0495679_017619 3300047446 Bacteria 2554
783 Ga0495681_0024192 3300047470 Bacteria 3207
784 Ga0495686_0001453 3300047472 Bacteria 25811
785 Ga0495686_0050587 3300047472 Bacteria 2611
786 Ga0495686_0079207 3300047472 Bacteria 2009
787 Ga0496101_0155765 3300048904 Bacteria 1750
788 Ga0496102_0001183 3300048905 Bacteria 23700
789 Ga0496102_0170594 3300048905 Bacteria 2048
790 Ga0496102_0208841 3300048905 Bacteria 1841
791 Ga0496103_0000335 3300048906 Bacteria 42986
792 Ga0496103_0001645 3300048906 Bacteria 14637
793 Ga0496103_0012628 3300048906 Bacteria 5010
794 Ga0496104_0015207 3300048907 Bacteria 6967
795 Ga0496105_0000773 3300048908 Bacteria 21686
796 Ga0496105_0208128 3300048908 Bacteria 1595
797 Ga0496107_0006696 3300048910 Bacteria 7933
798 Ga0496107_0067092 3300048910 Bacteria 2602
799 Ga0496107_0176678 3300048910 Bacteria 1585
800 Ga0496108_0001136 3300048911 Bacteria 20807
801 Ga0496108_0012594 3300048911 Bacteria 6889
802 Ga0496108_0024692 3300048911 Bacteria 4950
803 Ga0496108_0274491 3300048911 Bacteria 1467
804 Ga0496109_0064383 3300048912 Bacteria 3355
805 Ga0496109_0080123 3300048912 Bacteria 3008
806 Ga0496110_0013306 3300048913 Bacteria 6797
807 Ga0496110_0015116 3300048913 Bacteria 6416
808 Ga0496110_0021896 3300048913 Bacteria 5420
809 Ga0496110_0036892 3300048913 Bacteria 4247
810 Ga0496111_0018292 3300048914 Bacteria 4853
811 Ga0496111_0031128 3300048914 Bacteria 3799
812 Ga0496112_0024638 3300048915 Bacteria 5766
813 Ga0496112_0033925 3300048915 Bacteria 4965
814 Ga0496112_0048573 3300048915 Bacteria 4161
815 Ga0496112_0092528 3300048915 Bacteria 2993
816 Ga0496112_0273389 3300048915 Bacteria 1637
817 Ga0496113_0035258 3300048916 Bacteria 3658
818 Ga0496113_0043307 3300048916 Bacteria 3330
819 Ga0496114_0000021 3300048917 Bacteria 227038
820 Ga0496114_0017739 3300048917 Bacteria 5752
821 Ga0496114_0217872 3300048917 Bacteria 1675
822 Ga0496115_0000172 3300048918 Bacteria 59971
823 Ga0496115_0001399 3300048918 Bacteria 17242
824 Ga0496116_0007730 3300048919 Bacteria 9463
825 Ga0496117_0000582 3300048920 Bacteria 60157
826 Ga0496117_0046513 3300048920 Bacteria 3120
827 Ga0496118_0001620 3300048921 Bacteria 33243
828 Ga0496118_0002822 3300048921 Bacteria 22727
829 Ga0496118_0017941 3300048921 Bacteria 6416
830 Ga0496119_0002551 3300048922 Bacteria 19826
831 Ga0496121_0001258 3300048924 Bacteria 43842
832 Ga0496121_0024763 3300048924 Bacteria 5726
833 Ga0496121_0029837 3300048924 Bacteria 5027
834 Ga0496121_0076262 3300048924 Bacteria 2674
835 Ga0496122_0036178 3300048925 Bacteria 3999
836 Ga0496123_0019169 3300048926 Bacteria 5400
837 Ga0496124_0000606 3300048927 Bacteria 60251
838 Ga0496124_0134340 3300048927 Bacteria 1961
839 Ga0496125_0000666 3300048928 Bacteria 57200
840 Ga0496125_0035969 3300048928 Bacteria 4332
841 Ga0496126_0001153 3300048929 Bacteria 43798
842 Ga0501043_0052116 3300049579 Bacteria 3215
843 Ga0501073_0002418 3300049589 Bacteria 13973
844 Ga0501080_0011801 3300049742 Bacteria 8006
845 nmdc:mga06r32_1472_c1 3300050510 Bacteria 21188
846 nmdc:mga08y16_27_c1 3300050511 Bacteria 214573
847 nmdc:mga0a205_9502_c1 3300050515 Bacteria 8897
848 Ga0500610_0003524 3300053079 Bacteria 6031
849 Ga0500643_009852 3300053087 Bacteria 3613
850 Ga0500595_000235 3300053119 Bacteria 37436
851 Ga0500595_000472 3300053119 Bacteria 24818
852 Ga0500658_0000029 3300053134 Bacteria 99170
853 Ga0500568_0043746 3300053139 Bacteria 1789
854 Ga0500636_0005698 3300053177 Bacteria 7121
855 Ga0500645_000170 3300053730 Bacteria 51134
856 Ga0500645_017906 3300053730 Bacteria 2217
857 Ga0466962_0037656 3300061719 Bacteria 2316

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048917 Ga0496114_0217872 Ga0496114_0217872_10_1164 376
2 3300048916 Ga0496113_0043307 Ga0496113_0043307_2081_3235 377
3 3300047445 Ga0495677_0041054 Ga0495677_0041054_494_1672 385
4 3300041486 Ga0451807_0730426 Ga0451807_0730426_355_1566 396
5 3300014745 Ga0157377_10000057 Ga0157377_1000005746 405
6 3300048924 Ga0496121_0076262 Ga0496121_0076262_558_1901 410
7 3300001990 JGI24737J22298_10000754 JGI24737J22298_100007545 414
8 3300025904 Ga0207647_10005571 Ga0207647_100055716 414
9 3300037418 Ga0395900_0006820 Ga0395900_0006820_4446_5783 414
10 3300038443 Ga0395901_0107328 Ga0395901_0107328_1485_2822 414
11 3300001989 JGI24739J22299_10000438 JGI24739J22299_100004386 415
12 3300002067 JGI24735J21928_10001176 JGI24735J21928_100011764 415
13 3300002075 JGI24738J21930_10000106 JGI24738J21930_100001067 415
14 3300005457 Ga0070662_100011778 Ga0070662_1000117783 415
15 3300009094 Ga0111539_10001888 Ga0111539_1000188816 415
16 3300025933 Ga0207706_10012744 Ga0207706_100127444 415
17 3300005340 Ga0070689_100019280 Ga0070689_1000192801 417
18 3300005842 Ga0068858_100000223 Ga0068858_10000022330 417
19 3300009176 Ga0105242_10002569 Ga0105242_100025696 417
20 3300025936 Ga0207670_10012070 Ga0207670_100120705 417
21 3300025960 Ga0207651_10011469 Ga0207651_100114695 417
22 3300026035 Ga0207703_10038353 Ga0207703_100383531 417
23 3300044694 Ga0466963_0008253 Ga0466963_0008253_261_1547 417
24 3300044719 Ga0466971_0017109 Ga0466971_0017109_1038_2324 417
25 3300045836 Ga0466958_0039399 Ga0466958_0039399_898_2184 417
26 3300045976 Ga0466967_0192478 Ga0466967_0192478_255_1541 417
27 3300048928 Ga0496125_0035969 Ga0496125_0035969_1354_2697 417
28 3300061719 Ga0466962_0037656 Ga0466962_0037656_307_1593 417
29 3300048921 Ga0496118_0017941 Ga0496118_0017941_1110_2453 418
30 3300048924 Ga0496121_0024763 Ga0496121_0024763_180_1523 418
31 3300048926 Ga0496123_0019169 Ga0496123_0019169_1498_2841 418
32 3300005615 Ga0070702_100008512 Ga0070702_1000085122 419
33 3300005354 Ga0070675_100000060 Ga0070675_10000006016 420
34 3300021358 Ga0213873_10000003 Ga0213873_1000000358 420
35 3300021384 Ga0213876_10000003 Ga0213876_10000003810 420
36 3300039437 Ga0436365_0235589 Ga0436365_0235589_4701_6077 420
37 3300039453 Ga0436362_0649416 Ga0436362_0649416_20880_22256 420
38 3300005719 Ga0068861_100066915 Ga0068861_1000669152 422
39 3300025910 Ga0207684_10152210 Ga0207684_101522103 422
40 3300025917 Ga0207660_10083302 Ga0207660_100833021 422
41 3300026118 Ga0207675_100096482 Ga0207675_1000964822 422
42 3300053119 Ga0500595_000472 Ga0500595_000472_20234_21610 422
43 3300005327 Ga0070658_10039282 Ga0070658_100392825 423
44 3300005468 Ga0070707_100002311 Ga0070707_1000023117 423
45 3300005518 Ga0070699_100021683 Ga0070699_1000216831 423
46 3300009093 Ga0105240_10029601 Ga0105240_100296012 423
47 3300013105 Ga0157369_10063594 Ga0157369_100635945 423
48 3300025254 Ga0209148_1003631 Ga0209148_10036315 423
49 3300025272 Ga0209455_1002591 Ga0209455_10025911 423
50 3300025904 Ga0207647_10003571 Ga0207647_100035715 423
51 3300025904 Ga0207647_10023395 Ga0207647_100233952 423
52 3300025910 Ga0207684_10030060 Ga0207684_100300602 423
53 3300025913 Ga0207695_10099147 Ga0207695_100991472 423
54 3300025919 Ga0207657_10050325 Ga0207657_100503251 423
55 3300025922 Ga0207646_10001040 Ga0207646_100010408 423
56 3300026089 Ga0207648_10003316 Ga0207648_100033162 423
57 3300013307 Ga0157372_10119479 Ga0157372_101194792 424
58 3300047472 Ga0495686_0050587 Ga0495686_0050587_1266_2597 424
59 3300005331 Ga0070670_100027828 Ga0070670_1000278286 425
60 3300005339 Ga0070660_100000436 Ga0070660_10000043619 425
61 3300005354 Ga0070675_100049263 Ga0070675_1000492635 425
62 3300005356 Ga0070674_100041488 Ga0070674_1000414882 425
63 3300005367 Ga0070667_100127771 Ga0070667_1001277712 425
64 3300005457 Ga0070662_100040079 Ga0070662_1000400793 425
65 3300005518 Ga0070699_100029902 Ga0070699_1000299023 425
66 3300005614 Ga0068856_100017633 Ga0068856_1000176336 425
67 3300009147 Ga0114129_10023321 Ga0114129_100233213 425
68 3300025315 Ga0207697_10019307 Ga0207697_100193073 425
69 3300025901 Ga0207688_10059976 Ga0207688_100599762 425
70 3300025919 Ga0207657_10017929 Ga0207657_100179291 425
71 3300025960 Ga0207651_10032299 Ga0207651_100322992 425
72 3300026067 Ga0207678_10007057 Ga0207678_100070575 425
73 3300026078 Ga0207702_10007466 Ga0207702_100074666 425
74 3300005441 Ga0070700_100000002 Ga0070700_100000002129 426
75 3300005577 Ga0068857_100012284 Ga0068857_1000122844 426
76 3300005618 Ga0068864_100000171 Ga0068864_10000017113 426
77 3300005840 Ga0068870_10024826 Ga0068870_100248263 426
78 3300006847 Ga0075431_100002173 Ga0075431_10000217310 426
79 3300009094 Ga0111539_10000030 Ga0111539_10000030152 426
80 3300013297 Ga0157378_10055168 Ga0157378_100551682 426
81 3300013308 Ga0157375_10000018 Ga0157375_10000018136 426
82 3300014745 Ga0157377_10102130 Ga0157377_101021302 426
83 3300025927 Ga0207687_10003139 Ga0207687_100031395 426
84 3300025940 Ga0207691_10000884 Ga0207691_100008847 426
85 3300026075 Ga0207708_10000120 Ga0207708_1000012038 426
86 3300026095 Ga0207676_10000008 Ga0207676_10000008142 426
87 3300026116 Ga0207674_10018843 Ga0207674_100188434 426
88 3300027907 Ga0207428_10000038 Ga0207428_10000038203 426
89 3300035112 Ga0373932_0000023 Ga0373932_0000023_9781_11112 426
90 3300035115 Ga0373941_0001517 Ga0373941_0001517_2222_3676 426
91 3300044673 Ga0453683_0025920 Ga0453683_0025920_1052_2392 426
92 3300046515 Ga0495620_0005921 Ga0495620_0005921_353_1711 426
93 3300050510 nmdc:mga06r32_1472_c1 nmdc:mga06r32_1472_c1_19683_21029 426
94 3300050511 nmdc:mga08y16_27_c1 nmdc:mga08y16_27_c1_205131_206501 426
95 3300005356 Ga0070674_100001467 Ga0070674_10000146710 427
96 3300005364 Ga0070673_100073319 Ga0070673_1000733192 427
97 3300005456 Ga0070678_100083340 Ga0070678_1000833402 427
98 3300005543 Ga0070672_100141726 Ga0070672_1001417261 427
99 3300006358 Ga0068871_100062292 Ga0068871_1000622921 427
100 3300009148 Ga0105243_10000744 Ga0105243_100007445 427
101 3300013297 Ga0157378_10026060 Ga0157378_100260603 427
102 3300025935 Ga0207709_10000188 Ga0207709_1000018858 427
103 3300025937 Ga0207669_10000614 Ga0207669_100006142 427
104 3300025960 Ga0207651_10039985 Ga0207651_100399852 427
105 3300026121 Ga0207683_10045172 Ga0207683_100451722 427
106 3300036401 Ga0373937_0049528 Ga0373937_0049528_462_1907 427
107 3300044765 Ga0466970_0025984 Ga0466970_0025984_343_1746 427
108 3300045051 Ga0451576_0077239 Ga0451576_0077239_1990_3399 427
109 3300046522 Ga0495643_0006647 Ga0495643_0006647_16_1350 427
110 3300005331 Ga0070670_100054032 Ga0070670_1000540322 428
111 3300005355 Ga0070671_100129121 Ga0070671_1001291212 428
112 3300005468 Ga0070707_100046695 Ga0070707_1000466953 428
113 3300005539 Ga0068853_100038381 Ga0068853_1000383812 428
114 3300009093 Ga0105240_10105270 Ga0105240_101052701 428
115 3300009098 Ga0105245_10000003 Ga0105245_1000000358 428
116 3300025923 Ga0207681_10006977 Ga0207681_100069773 428
117 3300025925 Ga0207650_10014155 Ga0207650_100141554 428
118 3300025927 Ga0207687_10000002 Ga0207687_1000000258 428
119 3300025931 Ga0207644_10046831 Ga0207644_100468312 428
120 3300025937 Ga0207669_10067673 Ga0207669_100676732 428
121 3300026041 Ga0207639_10000020 Ga0207639_10000020123 428
122 3300003759 Ga0055525_1000040 Ga0055525_1000040256 429
123 3300005327 Ga0070658_10012348 Ga0070658_100123487 429
124 3300005329 Ga0070683_100000109 Ga0070683_10000010937 429
125 3300005330 Ga0070690_100009353 Ga0070690_1000093535 429
126 3300005331 Ga0070670_100002017 Ga0070670_1000020171 429
127 3300005334 Ga0068869_100013879 Ga0068869_1000138792 429
128 3300005336 Ga0070680_100039350 Ga0070680_1000393502 429
129 3300005338 Ga0068868_100000038 Ga0068868_1000000381 429
130 3300005338 Ga0068868_100001094 Ga0068868_10000109411 429
131 3300005338 Ga0068868_100024491 Ga0068868_1000244913 429
132 3300005364 Ga0070673_100011740 Ga0070673_1000117408 429
133 3300005367 Ga0070667_100001262 Ga0070667_10000126210 429
134 3300005367 Ga0070667_100021197 Ga0070667_1000211974 429
135 3300005367 Ga0070667_100028675 Ga0070667_1000286754 429
136 3300005456 Ga0070678_100006037 Ga0070678_1000060377 429
137 3300005535 Ga0070684_100000090 Ga0070684_10000009029 429
138 3300005543 Ga0070672_100106176 Ga0070672_1001061762 429
139 3300005544 Ga0070686_100080279 Ga0070686_1000802792 429
140 3300005578 Ga0068854_100022892 Ga0068854_1000228922 429
141 3300005578 Ga0068854_100063253 Ga0068854_1000632532 429
142 3300005616 Ga0068852_100039665 Ga0068852_1000396653 429
143 3300005841 Ga0068863_100037323 Ga0068863_1000373232 429
144 3300005842 Ga0068858_100000977 Ga0068858_1000009775 429
145 3300005844 Ga0068862_100125340 Ga0068862_1001253402 429
146 3300006237 Ga0097621_100041586 Ga0097621_1000415865 429
147 3300006358 Ga0068871_100029816 Ga0068871_1000298165 429
148 3300009176 Ga0105242_10029151 Ga0105242_100291515 429
149 3300009177 Ga0105248_10010582 Ga0105248_100105825 429
150 3300009551 Ga0105238_10000041 Ga0105238_1000004161 429
151 3300009551 Ga0105238_10010516 Ga0105238_100105164 429
152 3300010375 Ga0105239_10091084 Ga0105239_100910843 429
153 3300013102 Ga0157371_10006551 Ga0157371_100065519 429
154 3300013105 Ga0157369_10012993 Ga0157369_100129932 429
155 3300013105 Ga0157369_10026851 Ga0157369_100268517 429
156 3300013296 Ga0157374_10000006 Ga0157374_10000006108 429
157 3300013297 Ga0157378_10000633 Ga0157378_1000063321 429
158 3300013297 Ga0157378_10003092 Ga0157378_100030926 429
159 3300013297 Ga0157378_10174747 Ga0157378_101747471 429
160 3300013308 Ga0157375_10000024 Ga0157375_1000002453 429
161 3300014325 Ga0163163_10177395 Ga0163163_101773952 429
162 3300014745 Ga0157377_10000011 Ga0157377_1000001177 429
163 3300014969 Ga0157376_10000009 Ga0157376_10000009244 429
164 3300014969 Ga0157376_10086902 Ga0157376_100869022 429
165 3300021358 Ga0213873_10000255 Ga0213873_100002554 429
166 3300021384 Ga0213876_10000018 Ga0213876_10000018173 429
167 3300021384 Ga0213876_10013306 Ga0213876_100133063 429
168 3300021384 Ga0213876_10035134 Ga0213876_100351342 429
169 3300025230 Ga0209563_100019 Ga0209563_10001922 429
170 3300025899 Ga0207642_10013328 Ga0207642_100133283 429
171 3300025899 Ga0207642_10024206 Ga0207642_100242062 429
172 3300025903 Ga0207680_10011971 Ga0207680_100119715 429
173 3300025919 Ga0207657_10123364 Ga0207657_101233642 429
174 3300025924 Ga0207694_10000001 Ga0207694_100000013290 429
175 3300025924 Ga0207694_10141891 Ga0207694_101418912 429
176 3300025925 Ga0207650_10000460 Ga0207650_1000046027 429
177 3300025926 Ga0207659_10000011 Ga0207659_10000011230 429
178 3300025931 Ga0207644_10012016 Ga0207644_100120162 429
179 3300025931 Ga0207644_10043996 Ga0207644_100439961 429
180 3300025933 Ga0207706_10004027 Ga0207706_1000402713 429
181 3300025940 Ga0207691_10014306 Ga0207691_100143068 429
182 3300025941 Ga0207711_10028216 Ga0207711_100282163 429
183 3300025942 Ga0207689_10053183 Ga0207689_100531832 429
184 3300025944 Ga0207661_10000013 Ga0207661_1000001357 429
185 3300025986 Ga0207658_10001752 Ga0207658_100017526 429
186 3300025986 Ga0207658_10049735 Ga0207658_100497353 429
187 3300026023 Ga0207677_10000011 Ga0207677_1000001151 429
188 3300026023 Ga0207677_10000179 Ga0207677_1000017929 429
189 3300026023 Ga0207677_10004781 Ga0207677_100047815 429
190 3300026035 Ga0207703_10022901 Ga0207703_100229013 429
191 3300026035 Ga0207703_10092526 Ga0207703_100925265 429
192 3300026121 Ga0207683_10002725 Ga0207683_100027253 429
193 3300026142 Ga0207698_10157231 Ga0207698_101572312 429
194 3300028380 Ga0268265_10012742 Ga0268265_100127426 429
195 3300028381 Ga0268264_10050762 Ga0268264_100507624 429
196 3300028381 Ga0268264_10062678 Ga0268264_100626781 429
197 3300030521 Ga0307511_10009527 Ga0307511_100095278 429
198 3300037471 Ga0395905_0000207 Ga0395905_0000207_16327_17733 429
199 3300039437 Ga0436365_0853705 Ga0436365_0853705_98067_99443 429
200 3300039437 Ga0436365_0900843 Ga0436365_0900843_370_1713 429
201 3300039437 Ga0436365_1775746 Ga0436365_1775746_5848_7194 429
202 3300039453 Ga0436362_0232622 Ga0436362_0232622_9625_11001 429
203 3300047446 Ga0495679_017619 Ga0495679_017619_45_1388 429
204 3300048905 Ga0496102_0208841 Ga0496102_0208841_136_1539 429
205 3300048908 Ga0496105_0208128 Ga0496105_0208128_170_1573 429
206 3300048910 Ga0496107_0176678 Ga0496107_0176678_134_1537 429
207 3300048911 Ga0496108_0274491 Ga0496108_0274491_24_1427 429
208 3300048913 Ga0496110_0015116 Ga0496110_0015116_3007_4410 429
209 3300048915 Ga0496112_0273389 Ga0496112_0273389_50_1453 429
210 3300049589 Ga0501073_0002418 Ga0501073_0002418_6247_7626 429
211 3300049742 Ga0501080_0011801 Ga0501080_0011801_2349_3728 429
212 3300005366 Ga0070659_100017252 Ga0070659_1000172525 430
213 3300005564 Ga0070664_100158101 Ga0070664_1001581012 430
214 3300013100 Ga0157373_10016948 Ga0157373_100169482 430
215 3300025919 Ga0207657_10015357 Ga0207657_100153575 430
216 3300025945 Ga0207679_10157427 Ga0207679_101574272 430
217 3300037471 Ga0395905_0104617 Ga0395905_0104617_351_1754 430
218 3300005337 Ga0070682_100000094 Ga0070682_10000009464 431
219 3300005343 Ga0070687_100002359 Ga0070687_1000023594 431
220 3300005466 Ga0070685_10102351 Ga0070685_101023512 431
221 3300005719 Ga0068861_100138987 Ga0068861_1001389872 431
222 3300006844 Ga0075428_100000061 Ga0075428_10000006165 431
223 3300025918 Ga0207662_10002339 Ga0207662_100023393 431
224 3300005327 Ga0070658_10012050 Ga0070658_100120502 432
225 3300005577 Ga0068857_100015505 Ga0068857_1000155056 432
226 3300005616 Ga0068852_100000399 Ga0068852_1000003997 432
227 3300025909 Ga0207705_10000027 Ga0207705_100000278 432
228 3300026078 Ga0207702_10139307 Ga0207702_101393072 432
229 3300026116 Ga0207674_10057185 Ga0207674_100571853 432
230 3300026142 Ga0207698_10000173 Ga0207698_1000017333 432
231 3300037471 Ga0395905_0003926 Ga0395905_0003926_10396_11796 432
232 3300048912 Ga0496109_0064383 Ga0496109_0064383_1652_3058 432
233 3300053730 Ga0500645_017906 Ga0500645_017906_344_1714 432
234 3300001990 JGI24737J22298_10012522 JGI24737J22298_100125222 433
235 3300005327 Ga0070658_10140303 Ga0070658_101403032 433
236 3300005345 Ga0070692_10011298 Ga0070692_100112983 433
237 3300005366 Ga0070659_100079665 Ga0070659_1000796652 433
238 3300005444 Ga0070694_100006532 Ga0070694_1000065326 433
239 3300005843 Ga0068860_100254017 Ga0068860_1002540172 433
240 3300009553 Ga0105249_10018777 Ga0105249_100187777 433
241 3300014968 Ga0157379_10020748 Ga0157379_100207482 433
242 3300025904 Ga0207647_10000521 Ga0207647_1000052130 433
243 3300025933 Ga0207706_10018693 Ga0207706_100186935 433
244 3300025934 Ga0207686_10116167 Ga0207686_101161672 433
245 3300025942 Ga0207689_10004329 Ga0207689_100043294 433
246 3300028381 Ga0268264_10002242 Ga0268264_100022426 433
247 3300042012 Ga0439455_0007492 Ga0439455_0007492_43_1383 433
248 3300046684 Ga0495669_0013496 Ga0495669_0013496_261_1661 433
249 3300025904 Ga0207647_10008857 Ga0207647_100088578 434
250 3300001979 JGI24740J21852_10013329 JGI24740J21852_100133293 435
251 3300001989 JGI24739J22299_10032172 JGI24739J22299_100321722 435
252 3300002075 JGI24738J21930_10001777 JGI24738J21930_100017775 435
253 3300002077 JGI24744J21845_10002156 JGI24744J21845_100021563 435
254 3300003214 JGI25165J46597_1001377 JGI25165J46597_10013776 435
255 3300005327 Ga0070658_10044376 Ga0070658_100443762 435
256 3300005328 Ga0070676_10005331 Ga0070676_100053316 435
257 3300005334 Ga0068869_100000516 Ga0068869_10000051615 435
258 3300005338 Ga0068868_100003632 Ga0068868_1000036326 435
259 3300005339 Ga0070660_100005239 Ga0070660_1000052394 435
260 3300005354 Ga0070675_100025145 Ga0070675_1000251452 435
261 3300005355 Ga0070671_100027863 Ga0070671_1000278632 435
262 3300005355 Ga0070671_100094013 Ga0070671_1000940132 435
263 3300005364 Ga0070673_100000003 Ga0070673_100000003105 435
264 3300005455 Ga0070663_100002208 Ga0070663_1000022087 435
265 3300005457 Ga0070662_100019584 Ga0070662_1000195844 435
266 3300005457 Ga0070662_100065191 Ga0070662_1000651911 435
267 3300005459 Ga0068867_100000001 Ga0068867_100000001131 435
268 3300005539 Ga0068853_100091967 Ga0068853_1000919671 435
269 3300005543 Ga0070672_100010085 Ga0070672_1000100853 435
270 3300005543 Ga0070672_100062542 Ga0070672_1000625425 435
271 3300005563 Ga0068855_100000273 Ga0068855_1000002736 435
272 3300005578 Ga0068854_100000323 Ga0068854_1000003237 435
273 3300006237 Ga0097621_100069582 Ga0097621_1000695822 435
274 3300006881 Ga0068865_100000011 Ga0068865_100000011117 435
275 3300009093 Ga0105240_10298853 Ga0105240_102988531 435
276 3300009098 Ga0105245_10000157 Ga0105245_1000015716 435
277 3300009148 Ga0105243_10000042 Ga0105243_10000042135 435
278 3300009176 Ga0105242_10001059 Ga0105242_1000105913 435
279 3300009551 Ga0105238_10127790 Ga0105238_101277903 435
280 3300011119 Ga0105246_10000049 Ga0105246_1000004933 435
281 3300013100 Ga0157373_10012550 Ga0157373_100125506 435
282 3300013104 Ga0157370_10000008 Ga0157370_10000008172 435
283 3300013105 Ga0157369_10004298 Ga0157369_100042986 435
284 3300013296 Ga0157374_10004689 Ga0157374_100046897 435
285 3300013297 Ga0157378_10002972 Ga0157378_100029726 435
286 3300013308 Ga0157375_10004452 Ga0157375_100044527 435
287 3300014969 Ga0157376_10000072 Ga0157376_1000007272 435
288 3300017792 Ga0163161_10080096 Ga0163161_100800963 435
289 3300025231 Ga0207427_100735 Ga0207427_1007358 435
290 3300025250 Ga0209026_1002303 Ga0209026_10023032 435
291 3300025254 Ga0209148_1000441 Ga0209148_100044146 435
292 3300025261 Ga0209233_1000858 Ga0209233_10008585 435
293 3300025907 Ga0207645_10000395 Ga0207645_100003957 435
294 3300025909 Ga0207705_10002122 Ga0207705_100021222 435
295 3300025913 Ga0207695_10233769 Ga0207695_102337692 435
296 3300025919 Ga0207657_10002889 Ga0207657_100028897 435
297 3300025919 Ga0207657_10129422 Ga0207657_101294223 435
298 3300025924 Ga0207694_10101136 Ga0207694_101011362 435
299 3300025926 Ga0207659_10007196 Ga0207659_100071966 435
300 3300025927 Ga0207687_10001915 Ga0207687_1000191516 435
301 3300025931 Ga0207644_10038386 Ga0207644_100383862 435
302 3300025931 Ga0207644_10111936 Ga0207644_101119362 435
303 3300025933 Ga0207706_10013579 Ga0207706_100135795 435
304 3300025933 Ga0207706_10022801 Ga0207706_100228012 435
305 3300025934 Ga0207686_10000797 Ga0207686_100007976 435
306 3300025935 Ga0207709_10000119 Ga0207709_1000011916 435
307 3300025938 Ga0207704_10000001 Ga0207704_10000001649 435
308 3300025942 Ga0207689_10000824 Ga0207689_1000082425 435
309 3300025949 Ga0207667_10000109 Ga0207667_10000109139 435
310 3300025960 Ga0207651_10000002 Ga0207651_10000002318 435
311 3300025961 Ga0207712_10156584 Ga0207712_101565842 435
312 3300025981 Ga0207640_10001306 Ga0207640_100013069 435
313 3300025981 Ga0207640_10136456 Ga0207640_101364562 435
314 3300026023 Ga0207677_10000042 Ga0207677_1000004215 435
315 3300026041 Ga0207639_10229861 Ga0207639_102298611 435
316 3300026067 Ga0207678_10004243 Ga0207678_100042437 435
317 3300026089 Ga0207648_10000001 Ga0207648_10000001318 435
318 3300026121 Ga0207683_10003626 Ga0207683_100036263 435
319 3300028786 Ga0307517_10100623 Ga0307517_101006232 435
320 3300037312 Ga0395899_0002034 Ga0395899_0002034_7727_9073 435
321 3300037418 Ga0395900_0014434 Ga0395900_0014434_2016_3362 435
322 3300037471 Ga0395905_0118496 Ga0395905_0118496_838_2244 435
323 3300041452 Ga0451793_0526473 Ga0451793_0526473_10_1353 435
324 3300042005 Ga0439448_0000759 Ga0439448_0000759_3565_4905 435
325 3300042005 Ga0439448_0002911 Ga0439448_0002911_1124_2464 435
326 3300042012 Ga0439455_0001129 Ga0439455_0001129_1247_2587 435
327 3300042157 Ga0439458_0000188 Ga0439458_0000188_9037_10377 435
328 3300044706 Ga0466964_0014359 Ga0466964_0014359_610_1950 435
329 3300044735 Ga0466968_0023758 Ga0466968_0023758_272_1612 435
330 3300044842 Ga0466957_0023524 Ga0466957_0023524_39_1382 435
331 3300044901 Ga0466960_0015617 Ga0466960_0015617_707_2047 435
332 3300037418 Ga0395900_0234975 Ga0395900_0234975_61_1467 436
333 3300013296 Ga0157374_10094173 Ga0157374_100941731 437
334 3300047472 Ga0495686_0001453 Ga0495686_0001453_17438_18850 437
335 3300005547 Ga0070693_100034929 Ga0070693_1000349294 438
336 3300013100 Ga0157373_10090625 Ga0157373_100906252 438
337 3300025981 Ga0207640_10102716 Ga0207640_101027162 438
338 3300031852 Ga0307410_10110823 Ga0307410_101108232 438
339 3300035691 Ga0373931_0120169 Ga0373931_0120169_40_1446 438
340 iso_pu_bacteria 2885429604 2885430041 438
341 iso_pu_bacteria 2928027323 2928027635 438
342 iso_pu_bacteria 2984555340 2984558071 438
343 iso_pu_bacteria 2984564862 2984567561 438
344 iso_pu_bacteria 2993356040 2993358614 438
345 3300001979 JGI24740J21852_10000610 JGI24740J21852_1000061012 439
346 3300003762 Ga0055542_1000046 Ga0055542_1000046158 439
347 3300003763 Ga0055529_1000007 Ga0055529_100000771 439
348 3300005440 Ga0070705_100012263 Ga0070705_1000122632 439
349 3300005546 Ga0070696_100066656 Ga0070696_1000666561 439
350 3300005615 Ga0070702_100038908 Ga0070702_1000389082 439
351 3300005618 Ga0068864_100123925 Ga0068864_1001239252 439
352 3300025254 Ga0209148_1000026 Ga0209148_1000026314 439
353 3300025272 Ga0209455_1000005 Ga0209455_10000051061 439
354 3300026118 Ga0207675_100004465 Ga0207675_10000446513 439
355 3300037418 Ga0395900_0011723 Ga0395900_0011723_2453_3862 439
356 3300037466 Ga0395898_0014864 Ga0395898_0014864_6350_7759 439
357 3300037471 Ga0395905_0005866 Ga0395905_0005866_8981_10390 439
358 3300037471 Ga0395905_0149919 Ga0395905_0149919_212_1618 439
359 3300038443 Ga0395901_0002990 Ga0395901_0002990_14571_15980 439
360 3300053139 Ga0500568_0043746 Ga0500568_0043746_73_1443 439
361 3300005355 Ga0070671_100176849 Ga0070671_1001768491 440
362 3300005543 Ga0070672_100083436 Ga0070672_1000834362 440
363 3300025893 Ga0207682_10045957 Ga0207682_100459572 440
364 3300025931 Ga0207644_10148433 Ga0207644_101484332 440
365 3300025933 Ga0207706_10052751 Ga0207706_100527512 440
366 3300025940 Ga0207691_10126344 Ga0207691_101263443 440
367 3300031731 Ga0307405_10091897 Ga0307405_100918973 440
368 3300031911 Ga0307412_10136313 Ga0307412_101363131 440
369 3300032004 Ga0307414_10041965 Ga0307414_100419654 440
370 3300032126 Ga0307415_100049958 Ga0307415_1000499582 440
371 3300032126 Ga0307415_100068967 Ga0307415_1000689672 440
372 3300037471 Ga0395905_0132674 Ga0395905_0132674_746_2116 440
373 3300053134 Ga0500658_0000029 Ga0500658_0000029_15126_16529 440
374 3300005344 Ga0070661_100113825 Ga0070661_1001138251 441
375 3300005355 Ga0070671_100002434 Ga0070671_10000243414 441
376 3300005355 Ga0070671_100010584 Ga0070671_1000105843 441
377 3300005364 Ga0070673_100005252 Ga0070673_1000052527 441
378 3300005367 Ga0070667_100001721 Ga0070667_10000172110 441
379 3300005436 Ga0070713_100025207 Ga0070713_1000252072 441
380 3300005456 Ga0070678_100059147 Ga0070678_1000591472 441
381 3300005457 Ga0070662_100157654 Ga0070662_1001576542 441
382 3300005543 Ga0070672_100109090 Ga0070672_1001090901 441
383 3300005548 Ga0070665_100046993 Ga0070665_1000469935 441
384 3300005548 Ga0070665_100086621 Ga0070665_1000866212 441
385 3300005564 Ga0070664_100008626 Ga0070664_1000086265 441
386 3300005617 Ga0068859_100000229 Ga0068859_10000022945 441
387 3300005618 Ga0068864_100000345 Ga0068864_10000034521 441
388 3300005841 Ga0068863_100000847 Ga0068863_10000084721 441
389 3300005842 Ga0068858_100124585 Ga0068858_1001245852 441
390 3300005843 Ga0068860_100009456 Ga0068860_1000094566 441
391 3300006931 Ga0097620_100000229 Ga0097620_10000022945 441
392 3300009177 Ga0105248_10000075 Ga0105248_1000007566 441
393 3300009553 Ga0105249_10042959 Ga0105249_100429592 441
394 3300013104 Ga0157370_10097185 Ga0157370_100971854 441
395 3300013296 Ga0157374_10049753 Ga0157374_100497532 441
396 3300013306 Ga0163162_10025452 Ga0163162_100254522 441
397 3300013308 Ga0157375_10095484 Ga0157375_100954842 441
398 3300014968 Ga0157379_10125868 Ga0157379_101258682 441
399 3300025920 Ga0207649_10070838 Ga0207649_100708382 441
400 3300025926 Ga0207659_10031366 Ga0207659_100313664 441
401 3300025931 Ga0207644_10005796 Ga0207644_100057962 441
402 3300025931 Ga0207644_10016201 Ga0207644_100162015 441
403 3300025931 Ga0207644_10089388 Ga0207644_100893883 441
404 3300025933 Ga0207706_10167138 Ga0207706_101671383 441
405 3300025940 Ga0207691_10005043 Ga0207691_100050438 441
406 3300025940 Ga0207691_10112603 Ga0207691_101126032 441
407 3300025941 Ga0207711_10000077 Ga0207711_1000007766 441
408 3300025949 Ga0207667_10248124 Ga0207667_102481241 441
409 3300025961 Ga0207712_10011591 Ga0207712_100115914 441
410 3300025986 Ga0207658_10000909 Ga0207658_1000090916 441
411 3300026035 Ga0207703_10082173 Ga0207703_100821732 441
412 3300026067 Ga0207678_10029379 Ga0207678_100293793 441
413 3300026088 Ga0207641_10000140 Ga0207641_1000014058 441
414 3300026095 Ga0207676_10002110 Ga0207676_100021107 441
415 3300026121 Ga0207683_10074801 Ga0207683_100748015 441
416 3300028379 Ga0268266_10011692 Ga0268266_100116927 441
417 3300028381 Ga0268264_10001603 Ga0268264_1000160310 441
418 3300037418 Ga0395900_0116945 Ga0395900_0116945_789_2195 441
419 3300037418 Ga0395900_0147789 Ga0395900_0147789_887_2290 441
420 3300037466 Ga0395898_0045291 Ga0395898_0045291_2136_3542 441
421 3300037471 Ga0395905_0001434 Ga0395905_0001434_25948_27351 441
422 3300037471 Ga0395905_0119340 Ga0395905_0119340_1011_2414 441
423 3300037471 Ga0395905_0124048 Ga0395905_0124048_65_1468 441
424 3300038443 Ga0395901_0119786 Ga0395901_0119786_1271_2674 441
425 3300045976 Ga0466967_0050468 Ga0466967_0050468_1729_3168 441
426 3300046460 Ga0495638_0003983 Ga0495638_0003983_120_1505 441
427 3300046537 Ga0495598_0000085 Ga0495598_0000085_842_2245 441
428 3300046539 Ga0495621_0000048 Ga0495621_0000048_948_2351 441
429 3300046616 Ga0495668_0026213 Ga0495668_0026213_745_2148 441
430 3300046684 Ga0495669_0000316 Ga0495669_0000316_20312_21721 441
431 3300046684 Ga0495669_0000664 Ga0495669_0000664_5024_6427 441
432 3300046691 Ga0495670_0007564 Ga0495670_0007564_366_1769 441
433 3300048911 Ga0496108_0001136 Ga0496108_0001136_7635_9038 441
434 3300048915 Ga0496112_0033925 Ga0496112_0033925_2389_3792 441
435 3300048915 Ga0496112_0048573 Ga0496112_0048573_1890_3293 441
436 3300048917 Ga0496114_0017739 Ga0496114_0017739_3905_5308 441
437 3300048918 Ga0496115_0001399 Ga0496115_0001399_5023_6426 441
438 3300001989 JGI24739J22299_10006758 JGI24739J22299_100067586 442
439 3300001990 JGI24737J22298_10000016 JGI24737J22298_1000001624 442
440 3300002075 JGI24738J21930_10001908 JGI24738J21930_100019086 442
441 3300005327 Ga0070658_10037304 Ga0070658_100373045 442
442 3300005327 Ga0070658_10041821 Ga0070658_100418213 442
443 3300005331 Ga0070670_100024824 Ga0070670_1000248244 442
444 3300005331 Ga0070670_100050975 Ga0070670_1000509752 442
445 3300005331 Ga0070670_100171692 Ga0070670_1001716922 442
446 3300005334 Ga0068869_100002134 Ga0068869_1000021347 442
447 3300005335 Ga0070666_10000717 Ga0070666_1000071710 442
448 3300005338 Ga0068868_100014837 Ga0068868_1000148374 442
449 3300005338 Ga0068868_100144729 Ga0068868_1001447292 442
450 3300005339 Ga0070660_100003726 Ga0070660_1000037266 442
451 3300005344 Ga0070661_100024728 Ga0070661_1000247285 442
452 3300005344 Ga0070661_100052604 Ga0070661_1000526045 442
453 3300005344 Ga0070661_100055938 Ga0070661_1000559382 442
454 3300005347 Ga0070668_100002981 Ga0070668_1000029812 442
455 3300005347 Ga0070668_100016412 Ga0070668_1000164124 442
456 3300005353 Ga0070669_100000811 Ga0070669_10000081111 442
457 3300005354 Ga0070675_100007442 Ga0070675_1000074425 442
458 3300005354 Ga0070675_100063772 Ga0070675_1000637723 442
459 3300005355 Ga0070671_100001075 Ga0070671_1000010754 442
460 3300005355 Ga0070671_100037728 Ga0070671_1000377283 442
461 3300005355 Ga0070671_100097573 Ga0070671_1000975732 442
462 3300005355 Ga0070671_100148149 Ga0070671_1001481493 442
463 3300005356 Ga0070674_100048818 Ga0070674_1000488185 442
464 3300005356 Ga0070674_100066915 Ga0070674_1000669152 442
465 3300005364 Ga0070673_100000661 Ga0070673_10000066110 442
466 3300005364 Ga0070673_100003749 Ga0070673_1000037496 442
467 3300005364 Ga0070673_100035307 Ga0070673_1000353073 442
468 3300005366 Ga0070659_100001213 Ga0070659_1000012137 442
469 3300005366 Ga0070659_100029989 Ga0070659_1000299891 442
470 3300005366 Ga0070659_100078208 Ga0070659_1000782082 442
471 3300005367 Ga0070667_100006338 Ga0070667_1000063383 442
472 3300005367 Ga0070667_100009153 Ga0070667_1000091535 442
473 3300005367 Ga0070667_100009740 Ga0070667_1000097406 442
474 3300005367 Ga0070667_100032476 Ga0070667_1000324762 442
475 3300005436 Ga0070713_100010249 Ga0070713_1000102493 442
476 3300005457 Ga0070662_100001359 Ga0070662_10000135914 442
477 3300005457 Ga0070662_100004688 Ga0070662_1000046884 442
478 3300005457 Ga0070662_100031271 Ga0070662_1000312713 442
479 3300005457 Ga0070662_100052030 Ga0070662_1000520303 442
480 3300005457 Ga0070662_100122079 Ga0070662_1001220792 442
481 3300005459 Ga0068867_100003553 Ga0068867_1000035537 442
482 3300005459 Ga0068867_100037589 Ga0068867_1000375892 442
483 3300005459 Ga0068867_100040177 Ga0068867_1000401773 442
484 3300005530 Ga0070679_100219426 Ga0070679_1002194262 442
485 3300005539 Ga0068853_100000861 Ga0068853_1000008617 442
486 3300005543 Ga0070672_100000284 Ga0070672_10000028414 442
487 3300005543 Ga0070672_100033724 Ga0070672_1000337243 442
488 3300005546 Ga0070696_100004864 Ga0070696_1000048647 442
489 3300005548 Ga0070665_100010104 Ga0070665_1000101042 442
490 3300005548 Ga0070665_100015373 Ga0070665_1000153732 442
491 3300005548 Ga0070665_100029738 Ga0070665_1000297383 442
492 3300005548 Ga0070665_100040418 Ga0070665_1000404185 442
493 3300005548 Ga0070665_100077516 Ga0070665_1000775165 442
494 3300005564 Ga0070664_100001250 Ga0070664_1000012505 442
495 3300005564 Ga0070664_100023867 Ga0070664_1000238674 442
496 3300005577 Ga0068857_100002439 Ga0068857_1000024396 442
497 3300005577 Ga0068857_100007522 Ga0068857_1000075222 442
498 3300005577 Ga0068857_100095500 Ga0068857_1000955002 442
499 3300005578 Ga0068854_100016183 Ga0068854_1000161836 442
500 3300005616 Ga0068852_100001669 Ga0068852_10000166911 442
501 3300005617 Ga0068859_100003622 Ga0068859_10000362213 442
502 3300005617 Ga0068859_100023445 Ga0068859_1000234454 442
503 3300005617 Ga0068859_100032511 Ga0068859_1000325115 442
504 3300005618 Ga0068864_100002129 Ga0068864_10000212911 442
505 3300005618 Ga0068864_100023357 Ga0068864_1000233573 442
506 3300005618 Ga0068864_100041418 Ga0068864_1000414183 442
507 3300005841 Ga0068863_100001129 Ga0068863_1000011296 442
508 3300005841 Ga0068863_100007002 Ga0068863_1000070029 442
509 3300005841 Ga0068863_100014132 Ga0068863_1000141323 442
510 3300005841 Ga0068863_100048245 Ga0068863_1000482452 442
511 3300005841 Ga0068863_100105895 Ga0068863_1001058955 442
512 3300005842 Ga0068858_100003837 Ga0068858_1000038372 442
513 3300005842 Ga0068858_100017369 Ga0068858_1000173698 442
514 3300005842 Ga0068858_100032038 Ga0068858_1000320382 442
515 3300005843 Ga0068860_100024577 Ga0068860_1000245775 442
516 3300005843 Ga0068860_100036710 Ga0068860_1000367102 442
517 3300005844 Ga0068862_100045471 Ga0068862_1000454715 442
518 3300005844 Ga0068862_100151202 Ga0068862_1001512022 442
519 3300006358 Ga0068871_100018393 Ga0068871_1000183932 442
520 3300006358 Ga0068871_100104763 Ga0068871_1001047632 442
521 3300006931 Ga0097620_100003622 Ga0097620_10000362213 442
522 3300006931 Ga0097620_100023445 Ga0097620_1000234453 442
523 3300006931 Ga0097620_100032513 Ga0097620_1000325135 442
524 3300009098 Ga0105245_10008190 Ga0105245_100081906 442
525 3300009174 Ga0105241_10025579 Ga0105241_100255794 442
526 3300009177 Ga0105248_10001396 Ga0105248_1000139627 442
527 3300009177 Ga0105248_10020058 Ga0105248_100200585 442
528 3300009177 Ga0105248_10025569 Ga0105248_100255696 442
529 3300009177 Ga0105248_10208203 Ga0105248_102082033 442
530 3300011119 Ga0105246_10145098 Ga0105246_101450981 442
531 3300013100 Ga0157373_10014217 Ga0157373_100142174 442
532 3300013102 Ga0157371_10009191 Ga0157371_100091916 442
533 3300013102 Ga0157371_10010860 Ga0157371_100108607 442
534 3300013296 Ga0157374_10004864 Ga0157374_100048647 442
535 3300013297 Ga0157378_10001598 Ga0157378_100015986 442
536 3300013306 Ga0163162_10035012 Ga0163162_100350124 442
537 3300013307 Ga0157372_10018358 Ga0157372_100183586 442
538 3300013308 Ga0157375_10038010 Ga0157375_100380102 442
539 3300013308 Ga0157375_10281745 Ga0157375_102817452 442
540 3300014325 Ga0163163_10081544 Ga0163163_100815441 442
541 3300014745 Ga0157377_10009297 Ga0157377_100092974 442
542 3300017792 Ga0163161_10074630 Ga0163161_100746302 442
543 3300021384 Ga0213876_10004303 Ga0213876_100043036 442
544 3300025315 Ga0207697_10000144 Ga0207697_100001446 442
545 3300025899 Ga0207642_10037717 Ga0207642_100377172 442
546 3300025901 Ga0207688_10000184 Ga0207688_1000018416 442
547 3300025903 Ga0207680_10032752 Ga0207680_100327522 442
548 3300025903 Ga0207680_10055524 Ga0207680_100555242 442
549 3300025903 Ga0207680_10058425 Ga0207680_100584253 442
550 3300025904 Ga0207647_10000671 Ga0207647_100006713 442
551 3300025904 Ga0207647_10043299 Ga0207647_100432993 442
552 3300025907 Ga0207645_10014251 Ga0207645_100142512 442
553 3300025907 Ga0207645_10041769 Ga0207645_100417692 442
554 3300025909 Ga0207705_10007211 Ga0207705_100072117 442
555 3300025919 Ga0207657_10002012 Ga0207657_1000201218 442
556 3300025919 Ga0207657_10007114 Ga0207657_100071149 442
557 3300025919 Ga0207657_10009672 Ga0207657_100096727 442
558 3300025923 Ga0207681_10001616 Ga0207681_100016166 442
559 3300025923 Ga0207681_10030252 Ga0207681_100302525 442
560 3300025925 Ga0207650_10006457 Ga0207650_100064575 442
561 3300025925 Ga0207650_10033910 Ga0207650_100339105 442
562 3300025925 Ga0207650_10044991 Ga0207650_100449911 442
563 3300025925 Ga0207650_10090865 Ga0207650_100908652 442
564 3300025926 Ga0207659_10008668 Ga0207659_100086685 442
565 3300025931 Ga0207644_10001392 Ga0207644_100013926 442
566 3300025931 Ga0207644_10029050 Ga0207644_100290505 442
567 3300025931 Ga0207644_10069903 Ga0207644_100699032 442
568 3300025932 Ga0207690_10020142 Ga0207690_100201426 442
569 3300025932 Ga0207690_10063175 Ga0207690_100631754 442
570 3300025933 Ga0207706_10000467 Ga0207706_1000046722 442
571 3300025933 Ga0207706_10001512 Ga0207706_100015124 442
572 3300025933 Ga0207706_10013914 Ga0207706_100139143 442
573 3300025933 Ga0207706_10045652 Ga0207706_100456523 442
574 3300025933 Ga0207706_10087589 Ga0207706_100875893 442
575 3300025933 Ga0207706_10223547 Ga0207706_102235471 442
576 3300025937 Ga0207669_10063582 Ga0207669_100635822 442
577 3300025938 Ga0207704_10003382 Ga0207704_100033825 442
578 3300025940 Ga0207691_10000281 Ga0207691_1000028126 442
579 3300025940 Ga0207691_10009981 Ga0207691_100099815 442
580 3300025941 Ga0207711_10010239 Ga0207711_100102393 442
581 3300025941 Ga0207711_10033608 Ga0207711_100336083 442
582 3300025941 Ga0207711_10064523 Ga0207711_100645234 442
583 3300025942 Ga0207689_10000212 Ga0207689_1000021232 442
584 3300025945 Ga0207679_10001980 Ga0207679_100019804 442
585 3300025945 Ga0207679_10010666 Ga0207679_100106664 442
586 3300025945 Ga0207679_10048360 Ga0207679_100483602 442
587 3300025945 Ga0207679_10055472 Ga0207679_100554725 442
588 3300025960 Ga0207651_10000536 Ga0207651_100005368 442
589 3300025960 Ga0207651_10010118 Ga0207651_100101183 442
590 3300025972 Ga0207668_10000064 Ga0207668_1000006451 442
591 3300025981 Ga0207640_10027350 Ga0207640_100273502 442
592 3300025986 Ga0207658_10008040 Ga0207658_100080403 442
593 3300025986 Ga0207658_10033284 Ga0207658_100332843 442
594 3300026023 Ga0207677_10006345 Ga0207677_100063455 442
595 3300026035 Ga0207703_10002285 Ga0207703_100022856 442
596 3300026041 Ga0207639_10031577 Ga0207639_100315775 442
597 3300026067 Ga0207678_10000804 Ga0207678_1000080430 442
598 3300026067 Ga0207678_10033132 Ga0207678_100331323 442
599 3300026088 Ga0207641_10004215 Ga0207641_100042155 442
600 3300026088 Ga0207641_10013509 Ga0207641_100135096 442
601 3300026088 Ga0207641_10014457 Ga0207641_100144575 442
602 3300026089 Ga0207648_10001054 Ga0207648_1000105415 442
603 3300026089 Ga0207648_10118231 Ga0207648_101182312 442
604 3300026095 Ga0207676_10003752 Ga0207676_100037523 442
605 3300026095 Ga0207676_10005764 Ga0207676_100057647 442
606 3300026095 Ga0207676_10029077 Ga0207676_100290773 442
607 3300026095 Ga0207676_10124322 Ga0207676_101243222 442
608 3300026116 Ga0207674_10000501 Ga0207674_1000050132 442
609 3300026116 Ga0207674_10002481 Ga0207674_100024819 442
610 3300026116 Ga0207674_10003712 Ga0207674_100037127 442
611 3300026116 Ga0207674_10003718 Ga0207674_100037186 442
612 3300026116 Ga0207674_10006227 Ga0207674_100062272 442
613 3300026116 Ga0207674_10009494 Ga0207674_100094948 442
614 3300026116 Ga0207674_10025767 Ga0207674_100257675 442
615 3300026118 Ga0207675_100024355 Ga0207675_1000243556 442
616 3300026121 Ga0207683_10002637 Ga0207683_100026372 442
617 3300028379 Ga0268266_10000186 Ga0268266_1000018643 442
618 3300028379 Ga0268266_10026764 Ga0268266_100267645 442
619 3300028380 Ga0268265_10027723 Ga0268265_100277233 442
620 3300028381 Ga0268264_10011459 Ga0268264_100114594 442
621 3300028381 Ga0268264_10066433 Ga0268264_100664332 442
622 3300037312 Ga0395899_0000700 Ga0395899_0000700_12653_14059 442
623 3300037312 Ga0395899_0001530 Ga0395899_0001530_937_2343 442
624 3300037312 Ga0395899_0012272 Ga0395899_0012272_985_2391 442
625 3300037312 Ga0395899_0082210 Ga0395899_0082210_386_1792 442
626 3300037312 Ga0395899_0089319 Ga0395899_0089319_551_1957 442
627 3300037418 Ga0395900_0000238 Ga0395900_0000238_49966_51372 442
628 3300037418 Ga0395900_0011114 Ga0395900_0011114_2045_3451 442
629 3300037418 Ga0395900_0011835 Ga0395900_0011835_1902_3308 442
630 3300037418 Ga0395900_0013648 Ga0395900_0013648_2348_3754 442
631 3300037418 Ga0395900_0014002 Ga0395900_0014002_544_1950 442
632 3300037418 Ga0395900_0022863 Ga0395900_0022863_1116_2522 442
633 3300037418 Ga0395900_0023959 Ga0395900_0023959_3362_4768 442
634 3300037418 Ga0395900_0029522 Ga0395900_0029522_2862_4268 442
635 3300037418 Ga0395900_0033108 Ga0395900_0033108_1961_3367 442
636 3300037418 Ga0395900_0055551 Ga0395900_0055551_1012_2418 442
637 3300037418 Ga0395900_0074913 Ga0395900_0074913_1617_3023 442
638 3300037418 Ga0395900_0102201 Ga0395900_0102201_666_2072 442
639 3300037418 Ga0395900_0120486 Ga0395900_0120486_826_2238 442
640 3300037466 Ga0395898_0000245 Ga0395898_0000245_61448_62854 442
641 3300037466 Ga0395898_0036104 Ga0395898_0036104_1468_2874 442
642 3300037471 Ga0395905_0000006 Ga0395905_0000006_141512_142918 442
643 3300037471 Ga0395905_0001992 Ga0395905_0001992_5678_7084 442
644 3300037471 Ga0395905_0002904 Ga0395905_0002904_10878_12284 442
645 3300037471 Ga0395905_0004078 Ga0395905_0004078_442_1848 442
646 3300037471 Ga0395905_0004250 Ga0395905_0004250_3675_5081 442
647 3300037471 Ga0395905_0012036 Ga0395905_0012036_6526_7932 442
648 3300037471 Ga0395905_0013442 Ga0395905_0013442_2949_4358 442
649 3300037471 Ga0395905_0021293 Ga0395905_0021293_2861_4267 442
650 3300037471 Ga0395905_0066247 Ga0395905_0066247_848_2254 442
651 3300037471 Ga0395905_0108390 Ga0395905_0108390_812_2218 442
652 3300037471 Ga0395905_0111970 Ga0395905_0111970_270_1676 442
653 3300037471 Ga0395905_0235237 Ga0395905_0235237_272_1684 442
654 3300038443 Ga0395901_0000156 Ga0395901_0000156_34280_35686 442
655 3300038443 Ga0395901_0008535 Ga0395901_0008535_6603_8009 442
656 3300038443 Ga0395901_0069527 Ga0395901_0069527_1278_2687 442
657 3300038443 Ga0395901_0081122 Ga0395901_0081122_1408_2814 442
658 3300038443 Ga0395901_0085911 Ga0395901_0085911_1062_2474 442
659 3300038443 Ga0395901_0088865 Ga0395901_0088865_35_1441 442
660 3300038443 Ga0395901_0099564 Ga0395901_0099564_1559_2965 442
661 3300039437 Ga0436365_1817329 Ga0436365_1817329_623_2029 442
662 3300042005 Ga0439448_0001509 Ga0439448_0001509_201_1607 442
663 3300042012 Ga0439455_0008558 Ga0439455_0008558_113_1519 442
664 3300042157 Ga0439458_0000161 Ga0439458_0000161_13139_14545 442
665 3300042157 Ga0439458_0000449 Ga0439458_0000449_5799_7205 442
666 3300046460 Ga0495638_0001888 Ga0495638_0001888_3257_4645 442
667 3300046507 Ga0495606_0090117 Ga0495606_0090117_138_1526 442
668 3300046660 Ga0495625_0000064 Ga0495625_0000064_136261_137646 442
669 3300046691 Ga0495670_0032603 Ga0495670_0032603_928_2361 442
670 3300048905 Ga0496102_0170594 Ga0496102_0170594_71_1477 442
671 3300048906 Ga0496103_0012628 Ga0496103_0012628_3450_4856 442
672 3300048910 Ga0496107_0006696 Ga0496107_0006696_6082_7488 442
673 3300048911 Ga0496108_0012594 Ga0496108_0012594_789_2195 442
674 3300048911 Ga0496108_0024692 Ga0496108_0024692_2334_3740 442
675 3300048912 Ga0496109_0080123 Ga0496109_0080123_1028_2434 442
676 3300048913 Ga0496110_0013306 Ga0496110_0013306_2339_3745 442
677 3300048913 Ga0496110_0021896 Ga0496110_0021896_523_1929 442
678 3300048914 Ga0496111_0031128 Ga0496111_0031128_1751_3157 442
679 3300048915 Ga0496112_0024638 Ga0496112_0024638_2902_4308 442
680 3300048917 Ga0496114_0000021 Ga0496114_0000021_73945_75351 442
681 3300050515 nmdc:mga0a205_9502_c1 nmdc:mga0a205_9502_c1_1784_3190 442
682 3300005355 Ga0070671_100084037 Ga0070671_1000840372 443
683 3300005459 Ga0068867_100185083 Ga0068867_1001850831 443
684 3300005618 Ga0068864_100004504 Ga0068864_10000450411 443
685 3300005842 Ga0068858_100000313 Ga0068858_10000031310 443
686 3300009177 Ga0105248_10009109 Ga0105248_1000910910 443
687 3300015690 Ga0183363_1001 Ga0183363_1001482 443
688 3300025941 Ga0207711_10005454 Ga0207711_100054541 443
689 3300026035 Ga0207703_10000961 Ga0207703_1000096110 443
690 3300033180 Ga0307510_10005870 Ga0307510_100058706 443
691 3300046506 Ga0495583_0025207 Ga0495583_0025207_1220_2620 443
692 3300046616 Ga0495668_0016495 Ga0495668_0016495_1582_2982 443
693 3300046660 Ga0495625_0010290 Ga0495625_0010290_2436_3836 443
694 3300048915 Ga0496112_0092528 Ga0496112_0092528_329_1738 443
695 3300053087 Ga0500643_009852 Ga0500643_009852_1591_2991 443
696 3300001915 JGI24741J21665_1001717 JGI24741J21665_10017175 444
697 3300001990 JGI24737J22298_10001348 JGI24737J22298_100013488 444
698 3300001990 JGI24737J22298_10004346 JGI24737J22298_100043462 444
699 3300003214 JGI25165J46597_1000032 JGI25165J46597_1000032208 444
700 3300003215 JGI25153J46596_10000006 JGI25153J46596_10000006374 444
701 3300005327 Ga0070658_10007750 Ga0070658_100077509 444
702 3300005367 Ga0070667_100097370 Ga0070667_1000973701 444
703 3300005455 Ga0070663_100059657 Ga0070663_1000596572 444
704 3300005457 Ga0070662_100108027 Ga0070662_1001080271 444
705 3300005548 Ga0070665_100000086 Ga0070665_100000086143 444
706 3300005564 Ga0070664_100117168 Ga0070664_1001171681 444
707 3300005834 Ga0068851_10095169 Ga0068851_100951691 444
708 3300009174 Ga0105241_10008325 Ga0105241_100083253 444
709 3300013102 Ga0157371_10000097 Ga0157371_1000009770 444
710 3300025233 Ga0209437_101732 Ga0209437_1017325 444
711 3300025261 Ga0209233_1000066 Ga0209233_1000066209 444
712 3300025297 Ga0209758_1000001 Ga0209758_10000011453 444
713 3300025904 Ga0207647_10041001 Ga0207647_100410014 444
714 3300025909 Ga0207705_10006608 Ga0207705_100066081 444
715 3300025914 Ga0207671_10009431 Ga0207671_100094315 444
716 3300025919 Ga0207657_10019079 Ga0207657_100190795 444
717 3300025920 Ga0207649_10003137 Ga0207649_100031377 444
718 3300025924 Ga0207694_10007758 Ga0207694_100077584 444
719 3300025933 Ga0207706_10056151 Ga0207706_100561514 444
720 3300025949 Ga0207667_10000010 Ga0207667_10000010317 444
721 3300025981 Ga0207640_10015707 Ga0207640_100157072 444
722 3300025986 Ga0207658_10075142 Ga0207658_100751424 444
723 3300026067 Ga0207678_10008718 Ga0207678_100087185 444
724 3300026078 Ga0207702_10001740 Ga0207702_1000174019 444
725 3300026116 Ga0207674_10012021 Ga0207674_100120217 444
726 3300026142 Ga0207698_10005136 Ga0207698_100051366 444
727 3300028379 Ga0268266_10000002 Ga0268266_100000022417 444
728 3300031456 Ga0307513_10016487 Ga0307513_100164879 444
729 3300033180 Ga0307510_10120323 Ga0307510_101203232 444
730 3300046471 Ga0495650_0000467 Ga0495650_0000467_26173_27585 444
731 3300046491 Ga0495584_0020786 Ga0495584_0020786_1650_3062 444
732 3300046492 Ga0495585_0031886 Ga0495585_0031886_749_2161 444
733 3300046506 Ga0495583_0002885 Ga0495583_0002885_8971_10383 444
734 3300046506 Ga0495583_0008879 Ga0495583_0008879_3796_5208 444
735 3300046507 Ga0495606_0000434 Ga0495606_0000434_56200_57612 444
736 3300046522 Ga0495643_0002587 Ga0495643_0002587_12545_13957 444
737 3300046522 Ga0495643_0011683 Ga0495643_0011683_670_2082 444
738 3300046524 Ga0495648_0000256 Ga0495648_0000256_36276_37688 444
739 3300046525 Ga0495663_0011587 Ga0495663_0011587_148_1560 444
740 3300046528 Ga0495642_0023658 Ga0495642_0023658_442_1854 444
741 3300046557 Ga0495622_0013680 Ga0495622_0013680_1081_2493 444
742 3300046558 Ga0495633_0004258 Ga0495633_0004258_835_2247 444
743 3300046616 Ga0495668_0000163 Ga0495668_0000163_53971_55383 444
744 3300046616 Ga0495668_0046072 Ga0495668_0046072_87_1499 444
745 3300046648 Ga0495611_0037567 Ga0495611_0037567_324_1736 444
746 3300046660 Ga0495625_0000424 Ga0495625_0000424_30979_32391 444
747 3300046660 Ga0495625_0023460 Ga0495625_0023460_1293_2705 444
748 3300046684 Ga0495669_0000334 Ga0495669_0000334_2002_3414 444
749 3300046694 Ga0495649_0049440 Ga0495649_0049440_563_1975 444
750 3300046809 Ga0495600_0000343 Ga0495600_0000343_22433_23845 444
751 3300047323 Ga0495683_0039113 Ga0495683_0039113_897_2309 444
752 3300047323 Ga0495683_0071516 Ga0495683_0071516_198_1610 444
753 3300047443 Ga0495687_000557 Ga0495687_000557_27108_28520 444
754 3300047443 Ga0495687_000933 Ga0495687_000933_12644_14056 444
755 3300047470 Ga0495681_0024192 Ga0495681_0024192_369_1781 444
756 3300047472 Ga0495686_0079207 Ga0495686_0079207_606_1991 444
757 3300048905 Ga0496102_0001183 Ga0496102_0001183_369_1781 444
758 3300048906 Ga0496103_0000335 Ga0496103_0000335_20552_21964 444
759 3300048907 Ga0496104_0015207 Ga0496104_0015207_4445_5857 444
760 3300048908 Ga0496105_0000773 Ga0496105_0000773_6352_7764 444
761 3300048913 Ga0496110_0036892 Ga0496110_0036892_704_2116 444
762 3300048914 Ga0496111_0018292 Ga0496111_0018292_2901_4313 444
763 3300048916 Ga0496113_0035258 Ga0496113_0035258_964_2376 444
764 3300048918 Ga0496115_0000172 Ga0496115_0000172_38050_39462 444
765 3300048919 Ga0496116_0007730 Ga0496116_0007730_7640_9052 444
766 3300048920 Ga0496117_0000582 Ga0496117_0000582_38207_39619 444
767 3300048921 Ga0496118_0002822 Ga0496118_0002822_20629_22041 444
768 3300048922 Ga0496119_0002551 Ga0496119_0002551_4214_5626 444
769 3300048924 Ga0496121_0001258 Ga0496121_0001258_21895_23307 444
770 3300048925 Ga0496122_0036178 Ga0496122_0036178_926_2338 444
771 3300048927 Ga0496124_0000606 Ga0496124_0000606_20587_21999 444
772 3300048928 Ga0496125_0000666 Ga0496125_0000666_38672_40084 444
773 3300048929 Ga0496126_0001153 Ga0496126_0001153_20456_21868 444
774 3300053079 Ga0500610_0003524 Ga0500610_0003524_2130_3542 444
775 3300053119 Ga0500595_000235 Ga0500595_000235_28672_30084 444
776 3300053177 Ga0500636_0005698 Ga0500636_0005698_5616_7028 444
777 3300053730 Ga0500645_000170 Ga0500645_000170_2097_3509 444
778 3300049579 Ga0501043_0052116 Ga0501043_0052116_864_2249 445
779 3300005331 Ga0070670_100000051 Ga0070670_10000005194 446
780 3300005367 Ga0070667_100000418 Ga0070667_1000004189 446
781 3300005617 Ga0068859_100138543 Ga0068859_1001385433 446
782 3300005618 Ga0068864_100000004 Ga0068864_100000004115 446
783 3300005841 Ga0068863_100000002 Ga0068863_100000002115 446
784 3300005844 Ga0068862_100000002 Ga0068862_100000002386 446
785 3300006931 Ga0097620_100138535 Ga0097620_1001385352 446
786 3300009011 Ga0105251_10002895 Ga0105251_1000289510 446
787 3300009177 Ga0105248_10000010 Ga0105248_10000010230 446
788 3300009553 Ga0105249_10000041 Ga0105249_1000004182 446
789 3300014968 Ga0157379_10288073 Ga0157379_102880731 446
790 3300025735 Ga0207713_1005772 Ga0207713_10057727 446
791 3300025925 Ga0207650_10000083 Ga0207650_1000008377 446
792 3300025941 Ga0207711_10000035 Ga0207711_1000003567 446
793 3300025961 Ga0207712_10000460 Ga0207712_1000046023 446
794 3300025986 Ga0207658_10000575 Ga0207658_100005755 446
795 3300026088 Ga0207641_10000002 Ga0207641_10000002596 446
796 3300026095 Ga0207676_10000005 Ga0207676_10000005211 446
797 3300028380 Ga0268265_10000003 Ga0268265_10000003393 446
798 3300048921 Ga0496118_0001620 Ga0496118_0001620_28555_29940 446
799 3300005578 Ga0068854_100127969 Ga0068854_1001279691 448
800 3300025933 Ga0207706_10146686 Ga0207706_101466862 448
801 3300026041 Ga0207639_10015675 Ga0207639_100156753 448
802 3300026116 Ga0207674_10211466 Ga0207674_102114662 448
803 3300001904 JGI24736J21556_1000462 JGI24736J21556_10004626 451
804 3300001904 JGI24736J21556_1000548 JGI24736J21556_10005488 451
805 3300001976 JGI24752J21851_1000063 JGI24752J21851_100006316 451
806 3300001979 JGI24740J21852_10006244 JGI24740J21852_100062443 451
807 3300001989 JGI24739J22299_10002661 JGI24739J22299_100026613 451
808 3300001990 JGI24737J22298_10004813 JGI24737J22298_100048134 451
809 3300002074 JGI24748J21848_1000101 JGI24748J21848_100010114 451
810 3300002076 JGI24749J21850_1002872 JGI24749J21850_10028722 451
811 3300002239 JGI24034J26672_10000034 JGI24034J26672_1000003483 451
812 3300005327 Ga0070658_10004220 Ga0070658_1000422012 451
813 3300005330 Ga0070690_100000068 Ga0070690_10000006825 451
814 3300005335 Ga0070666_10000002 Ga0070666_10000002146 451
815 3300005340 Ga0070689_100004818 Ga0070689_1000048184 451
816 3300005344 Ga0070661_100070617 Ga0070661_1000706172 451
817 3300005353 Ga0070669_100000229 Ga0070669_10000022912 451
818 3300005466 Ga0070685_10000337 Ga0070685_1000033713 451
819 3300005544 Ga0070686_100000003 Ga0070686_100000003221 451
820 3300005548 Ga0070665_100000036 Ga0070665_100000036192 451
821 3300005617 Ga0068859_100024066 Ga0068859_1000240662 451
822 3300005618 Ga0068864_100021357 Ga0068864_1000213573 451
823 3300005719 Ga0068861_100036033 Ga0068861_1000360334 451
824 3300005834 Ga0068851_10021662 Ga0068851_100216623 451
825 3300005841 Ga0068863_100000034 Ga0068863_100000034135 451
826 3300005842 Ga0068858_100021876 Ga0068858_1000218766 451
827 3300005843 Ga0068860_100000001 Ga0068860_100000001147 451
828 3300005844 Ga0068862_100001230 Ga0068862_10000123019 451
829 3300006931 Ga0097620_100024066 Ga0097620_1000240662 451
830 3300009177 Ga0105248_10038152 Ga0105248_100381524 451
831 3300009553 Ga0105249_10000026 Ga0105249_10000026146 451
832 3300013104 Ga0157370_10063152 Ga0157370_100631522 451
833 3300013306 Ga0163162_10045432 Ga0163162_100454322 451
834 3300014326 Ga0157380_10007826 Ga0157380_100078262 451
835 3300017792 Ga0163161_10000008 Ga0163161_10000008161 451
836 3300025321 Ga0207656_10021949 Ga0207656_100219492 451
837 3300025903 Ga0207680_10000004 Ga0207680_10000004713 451
838 3300025904 Ga0207647_10009220 Ga0207647_100092206 451
839 3300025911 Ga0207654_10002556 Ga0207654_100025568 451
840 3300025913 Ga0207695_10035013 Ga0207695_100350133 451
841 3300025914 Ga0207671_10012841 Ga0207671_100128414 451
842 3300025923 Ga0207681_10000178 Ga0207681_1000017836 451
843 3300025924 Ga0207694_10020747 Ga0207694_100207472 451
844 3300025931 Ga0207644_10000570 Ga0207644_100005704 451
845 3300025936 Ga0207670_10006452 Ga0207670_100064527 451
846 3300025949 Ga0207667_10005836 Ga0207667_1000583615 451
847 3300025961 Ga0207712_10000001 Ga0207712_10000001587 451
848 3300026035 Ga0207703_10002971 Ga0207703_100029712 451
849 3300026078 Ga0207702_10010297 Ga0207702_100102973 451
850 3300026088 Ga0207641_10000057 Ga0207641_10000057133 451
851 3300026095 Ga0207676_10001402 Ga0207676_1000140211 451
852 3300026118 Ga0207675_100001962 Ga0207675_1000019625 451
853 3300026142 Ga0207698_10079654 Ga0207698_100796542 451
854 3300028379 Ga0268266_10000042 Ga0268266_10000042147 451
855 3300028380 Ga0268265_10000233 Ga0268265_1000023352 451
856 3300028381 Ga0268264_10000006 Ga0268264_10000006713 451
857 3300048904 Ga0496101_0155765 Ga0496101_0155765_347_1732 451
858 3300048906 Ga0496103_0001645 Ga0496103_0001645_11573_12958 451
859 3300048910 Ga0496107_0067092 Ga0496107_0067092_419_1804 451
860 3300048920 Ga0496117_0046513 Ga0496117_0046513_1240_2625 451
861 3300048924 Ga0496121_0029837 Ga0496121_0029837_416_1801 451
862 3300048927 Ga0496124_0134340 Ga0496124_0134340_137_1522 451

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04389

Peptidase_M28

Peptidase family M28

312

500

0.89

PF01546

Peptidase_M20

Peptidase family M20/M25/M40

337

502

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
3iib-assembly1.cif.gz_A-2 crystal structure of peptidase m28 precursor (yp_926796.1) from shewanella amazonensis sb2b at 1.70 a resolution 0.9672 22 447
3iib-assembly1.cif.gz_A-2 crystal structure of peptidase m28 precursor (yp_926796.1) from shewanella amazonensis sb2b at 1.70 a resolution 0.9308 22 447
2imo-assembly1.cif.gz_B crystal structure of allantoate amidohydrolase from escherichia coli at ph 4.6 0.8721 248 325
1z2l-assembly1.cif.gz_B crystal structure of allantoate-amidohydrolase from e.coli k12 in complex with substrate allantoate 0.8538 248 315
2imo-assembly1.cif.gz_A crystal structure of allantoate amidohydrolase from escherichia coli at ph 4.6 0.8374 247 315
ID Description Score Start End Superfamily
3iibA02 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1; 0.9401 89 238 3.50.30.30
3iibA02 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1; 0.934 89 238 3.50.30.30
3iibA01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9294 22 437 3.40.630.10
af_Q54MN6_157_296_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.8888 89 238 3.40.630.10
af_Q54MN6_157_296_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.8829 89 238 3.40.630.10
ID Description Score Start End GO Terms
AF-A0A7U0IZZ0-F1-model_v4 deleted 0.9868 43 442
AF-A0A4Q2Z542-F1-model_v4 Carboxypeptidase Q (Plasma glutamate carboxypeptidase) 0.9849 14 304 GO:0004180
GO:0005576
GO:0005764
GO:0070573
AF-A0A1Q3V4D6-F1-model_v4 Carboxypeptidase Q (Plasma glutamate carboxypeptidase) 0.9845 96 443 GO:0004180
GO:0005576
GO:0005764
GO:0070573
AF-A0A2W4YSJ0-F1-model_v4 deleted 0.9832 27 285
AF-A0A258CMX4-F1-model_v4 Carboxypeptidase Q (Plasma glutamate carboxypeptidase) 0.9825 301 443 GO:0004180
GO:0005576
GO:0005764
GO:0070573

Feature Viewer

pLDDT pTM Quality
92.12 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map