F483875
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 862 | 287 | 857 | 457 |
Family's Representative Sequence
| Representative Sequence | 3300005337|Ga0070682_100000094|Ga0070682_10000009464 |
| Length | 508 |
| Sequence | MNTGGVRAHSRWLSAPRDTTGTYANPVAPRMGRGTSGIPSGMHVRRAPALRWLHASRWPPAIGRYAAGVLLLLATSAFAQDADRLVTAALGNTRAYETLSYLTDEIGPRPSGSANAARAVKWTSEQFRAWGIDVRTEKVTVPHWVRGEEHASLVSHNDQKIVLTALGGSVATPAAGITAEVIEVSSFDELKQLGTKVKGKIVYYNNPMDLELVKARHGFEAYSRAVIYRGSGASRAAEYGAVAALIRSVGSASLRTPHTGAMRYDPKQPKIPSAAMTTEDAELVHRLIARGDRVRMHVTLTPKTLPDVESANVIAEIRGSEHPEEIVLIGGHLDSWDLGTGAIDDGSGVAMVMETLRLIKESGLRPKRTIRAVLFMNEENGLNGGRAYFAGHKNEKHVAAIETDAGAAAPTGFNTTLKGEALEAMTARTKVLDRVGAHRFEFAAETGADTSFLIDSGVTGFGLIPDPLHYFDYHHTPADTLDKIDPKELAQDTAAVAALAWTISNNER |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2885429604 | Sphingomonas sp. WZY 27 | Isolate | Rhizosphere |
| 2 | 2928027323 | Sphingomonas sp. 1185 | Isolate | Unclassified |
| 3 | 2984555340 | Sphingomonas sp. SORGH_AS789 | Isolate | Aerial Root |
| 4 | 2984564862 | Sphingomonas sp. SORGH_AS870 | Isolate | Aerial Root |
| 5 | 2993356040 | Sphingomonas sp. SORGH_AS742 | Isolate | Aerial Root |
| 6 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 7 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 8 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 9 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 10 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 11 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 12 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 13 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 14 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 15 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 16 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 17 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 18 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 19 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 20 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 21 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 22 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 23 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 29 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 33 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 54 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 58 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 60 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 66 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 68 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 69 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 70 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 72 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 73 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 74 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 75 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 76 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 77 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 78 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 79 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 80 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 81 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 83 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 84 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 85 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 86 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 115 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 117 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 118 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 122 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 183 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 187 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 188 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 189 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 190 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 191 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 192 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 193 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 194 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 195 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 196 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 197 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 198 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 199 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 200 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 201 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 202 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 203 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 204 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 205 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 206 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 207 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 208 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 209 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 210 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 211 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 212 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 213 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 214 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 215 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 216 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 217 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 218 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 219 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 220 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 221 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 222 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 251 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 252 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 253 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 254 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 255 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 256 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 257 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 258 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 259 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 260 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 261 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 262 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 263 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 264 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 265 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 266 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 267 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 268 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 269 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 270 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 271 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 272 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 273 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 274 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 278 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 279 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 280 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 281 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 282 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 283 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 284 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 285 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 286 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 287 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.42 |
| Metatranscriptomes | 0 |
| Isolates | 0.58 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.35 |
| Bulb | 0 |
| Endosphere | 3.02 |
| Nodule | 0 |
| Rhizoplane | 4.52 |
| Rhizosphere | 88.05 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.06 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1000462 | 3300001904 | Bacteria | 7637 |
| 2 | JGI24736J21556_1000548 | 3300001904 | Bacteria | 6981 |
| 3 | JGI24741J21665_1001717 | 3300001915 | Bacteria | 6041 |
| 4 | JGI24752J21851_1000063 | 3300001976 | Bacteria | 13680 |
| 5 | JGI24740J21852_10000610 | 3300001979 | Bacteria | 15461 |
| 6 | JGI24740J21852_10006244 | 3300001979 | Bacteria | 4957 |
| 7 | JGI24740J21852_10013329 | 3300001979 | Bacteria | 3069 |
| 8 | JGI24739J22299_10000438 | 3300001989 | Bacteria | 14466 |
| 9 | JGI24739J22299_10002661 | 3300001989 | Bacteria | 6875 |
| 10 | JGI24739J22299_10006758 | 3300001989 | Bacteria | 4320 |
| 11 | JGI24739J22299_10032172 | 3300001989 | Bacteria | 1807 |
| 12 | JGI24737J22298_10000016 | 3300001990 | Bacteria | 49280 |
| 13 | JGI24737J22298_10000754 | 3300001990 | Bacteria | 11436 |
| 14 | JGI24737J22298_10001348 | 3300001990 | Bacteria | 8690 |
| 15 | JGI24737J22298_10004346 | 3300001990 | Bacteria | 4949 |
| 16 | JGI24737J22298_10004813 | 3300001990 | Bacteria | 4689 |
| 17 | JGI24737J22298_10012522 | 3300001990 | Bacteria | 2766 |
| 18 | JGI24735J21928_10001176 | 3300002067 | Bacteria | 9351 |
| 19 | JGI24748J21848_1000101 | 3300002074 | Bacteria | 19763 |
| 20 | JGI24738J21930_10000106 | 3300002075 | Bacteria | 19367 |
| 21 | JGI24738J21930_10001777 | 3300002075 | Bacteria | 5871 |
| 22 | JGI24738J21930_10001908 | 3300002075 | Bacteria | 5627 |
| 23 | JGI24749J21850_1002872 | 3300002076 | Bacteria | 2413 |
| 24 | JGI24744J21845_10002156 | 3300002077 | Bacteria | 3997 |
| 25 | JGI24034J26672_10000034 | 3300002239 | Bacteria | 85929 |
| 26 | JGI25165J46597_1000032 | 3300003214 | Bacteria | 294371 |
| 27 | JGI25165J46597_1001377 | 3300003214 | Bacteria | 13380 |
| 28 | JGI25153J46596_10000006 | 3300003215 | Bacteria | 447760 |
| 29 | Ga0055525_1000040 | 3300003759 | Bacteria | 286933 |
| 30 | Ga0055542_1000046 | 3300003762 | Bacteria | 201922 |
| 31 | Ga0055529_1000007 | 3300003763 | Bacteria | 403604 |
| 32 | Ga0070658_10004220 | 3300005327 | Bacteria | 11756 |
| 33 | Ga0070658_10007750 | 3300005327 | Bacteria | 8653 |
| 34 | Ga0070658_10012050 | 3300005327 | Bacteria | 6944 |
| 35 | Ga0070658_10012348 | 3300005327 | Bacteria | 6860 |
| 36 | Ga0070658_10037304 | 3300005327 | Bacteria | 3917 |
| 37 | Ga0070658_10039282 | 3300005327 | Bacteria | 3817 |
| 38 | Ga0070658_10041821 | 3300005327 | Bacteria | 3697 |
| 39 | Ga0070658_10044376 | 3300005327 | Bacteria | 3593 |
| 40 | Ga0070658_10140303 | 3300005327 | Bacteria | 2018 |
| 41 | Ga0070676_10005331 | 3300005328 | Bacteria | 6845 |
| 42 | Ga0070683_100000109 | 3300005329 | Bacteria | 54186 |
| 43 | Ga0070690_100000068 | 3300005330 | Bacteria | 51626 |
| 44 | Ga0070690_100009353 | 3300005330 | Bacteria | 5676 |
| 45 | Ga0070670_100000051 | 3300005331 | Bacteria | 131351 |
| 46 | Ga0070670_100002017 | 3300005331 | Bacteria | 16606 |
| 47 | Ga0070670_100024824 | 3300005331 | Bacteria | 5156 |
| 48 | Ga0070670_100027828 | 3300005331 | Bacteria | 4863 |
| 49 | Ga0070670_100050975 | 3300005331 | Bacteria | 3556 |
| 50 | Ga0070670_100054032 | 3300005331 | Bacteria | 3448 |
| 51 | Ga0070670_100171692 | 3300005331 | Bacteria | 1881 |
| 52 | Ga0068869_100000516 | 3300005334 | Bacteria | 21591 |
| 53 | Ga0068869_100002134 | 3300005334 | Bacteria | 11887 |
| 54 | Ga0068869_100013879 | 3300005334 | Bacteria | 5371 |
| 55 | Ga0070666_10000002 | 3300005335 | Bacteria | 478684 |
| 56 | Ga0070666_10000717 | 3300005335 | Bacteria | 20096 |
| 57 | Ga0070680_100039350 | 3300005336 | Bacteria | 3827 |
| 58 | Ga0070682_100000094 | 3300005337 | Bacteria | 81230 |
| 59 | Ga0068868_100000038 | 3300005338 | Bacteria | 71746 |
| 60 | Ga0068868_100001094 | 3300005338 | Bacteria | 18562 |
| 61 | Ga0068868_100003632 | 3300005338 | Bacteria | 10767 |
| 62 | Ga0068868_100014837 | 3300005338 | Bacteria | 5751 |
| 63 | Ga0068868_100024491 | 3300005338 | Bacteria | 4581 |
| 64 | Ga0068868_100144729 | 3300005338 | Bacteria | 1953 |
| 65 | Ga0070660_100000436 | 3300005339 | Bacteria | 27606 |
| 66 | Ga0070660_100003726 | 3300005339 | Bacteria | 10530 |
| 67 | Ga0070660_100005239 | 3300005339 | Bacteria | 8966 |
| 68 | Ga0070689_100004818 | 3300005340 | Bacteria | 9156 |
| 69 | Ga0070689_100019280 | 3300005340 | Bacteria | 5041 |
| 70 | Ga0070687_100002359 | 3300005343 | Bacteria | 7040 |
| 71 | Ga0070661_100024728 | 3300005344 | Bacteria | 4309 |
| 72 | Ga0070661_100052604 | 3300005344 | Bacteria | 2981 |
| 73 | Ga0070661_100055938 | 3300005344 | Bacteria | 2889 |
| 74 | Ga0070661_100070617 | 3300005344 | Bacteria | 2568 |
| 75 | Ga0070661_100113825 | 3300005344 | Bacteria | 2022 |
| 76 | Ga0070692_10011298 | 3300005345 | Bacteria | 4094 |
| 77 | Ga0070668_100002981 | 3300005347 | Bacteria | 12519 |
| 78 | Ga0070668_100016412 | 3300005347 | Bacteria | 5536 |
| 79 | Ga0070669_100000229 | 3300005353 | Bacteria | 46742 |
| 80 | Ga0070669_100000811 | 3300005353 | Bacteria | 22744 |
| 81 | Ga0070675_100000060 | 3300005354 | Bacteria | 66785 |
| 82 | Ga0070675_100007442 | 3300005354 | Bacteria | 8456 |
| 83 | Ga0070675_100025145 | 3300005354 | Bacteria | 4772 |
| 84 | Ga0070675_100049263 | 3300005354 | Bacteria | 3457 |
| 85 | Ga0070675_100063772 | 3300005354 | Bacteria | 3046 |
| 86 | Ga0070671_100001075 | 3300005355 | Bacteria | 20195 |
| 87 | Ga0070671_100002434 | 3300005355 | Bacteria | 14391 |
| 88 | Ga0070671_100010584 | 3300005355 | Bacteria | 7408 |
| 89 | Ga0070671_100027863 | 3300005355 | Bacteria | 4651 |
| 90 | Ga0070671_100037728 | 3300005355 | Bacteria | 4008 |
| 91 | Ga0070671_100084037 | 3300005355 | Bacteria | 2662 |
| 92 | Ga0070671_100094013 | 3300005355 | Bacteria | 2512 |
| 93 | Ga0070671_100097573 | 3300005355 | Bacteria | 2464 |
| 94 | Ga0070671_100129121 | 3300005355 | Bacteria | 2128 |
| 95 | Ga0070671_100148149 | 3300005355 | Bacteria | 1982 |
| 96 | Ga0070671_100176849 | 3300005355 | Bacteria | 1806 |
| 97 | Ga0070674_100001467 | 3300005356 | Bacteria | 12583 |
| 98 | Ga0070674_100041488 | 3300005356 | Bacteria | 3119 |
| 99 | Ga0070674_100048818 | 3300005356 | Bacteria | 2907 |
| 100 | Ga0070674_100066915 | 3300005356 | Bacteria | 2526 |
| 101 | Ga0070673_100000003 | 3300005364 | Bacteria | 216759 |
| 102 | Ga0070673_100000661 | 3300005364 | Bacteria | 18949 |
| 103 | Ga0070673_100003749 | 3300005364 | Bacteria | 9531 |
| 104 | Ga0070673_100005252 | 3300005364 | Bacteria | 8268 |
| 105 | Ga0070673_100011740 | 3300005364 | Bacteria | 5990 |
| 106 | Ga0070673_100035307 | 3300005364 | Bacteria | 3790 |
| 107 | Ga0070673_100073319 | 3300005364 | Bacteria | 2755 |
| 108 | Ga0070659_100001213 | 3300005366 | Bacteria | 18709 |
| 109 | Ga0070659_100017252 | 3300005366 | Bacteria | 5428 |
| 110 | Ga0070659_100029989 | 3300005366 | Bacteria | 4207 |
| 111 | Ga0070659_100078208 | 3300005366 | Bacteria | 2638 |
| 112 | Ga0070659_100079665 | 3300005366 | Bacteria | 2614 |
| 113 | Ga0070667_100000418 | 3300005367 | Bacteria | 45252 |
| 114 | Ga0070667_100001262 | 3300005367 | Bacteria | 22964 |
| 115 | Ga0070667_100001721 | 3300005367 | Bacteria | 19565 |
| 116 | Ga0070667_100006338 | 3300005367 | Bacteria | 9833 |
| 117 | Ga0070667_100009153 | 3300005367 | Bacteria | 8198 |
| 118 | Ga0070667_100009740 | 3300005367 | Bacteria | 7966 |
| 119 | Ga0070667_100021197 | 3300005367 | Bacteria | 5399 |
| 120 | Ga0070667_100028675 | 3300005367 | Bacteria | 4635 |
| 121 | Ga0070667_100032476 | 3300005367 | Bacteria | 4354 |
| 122 | Ga0070667_100097370 | 3300005367 | Bacteria | 2538 |
| 123 | Ga0070667_100127771 | 3300005367 | Bacteria | 2216 |
| 124 | Ga0070713_100010249 | 3300005436 | Bacteria | 6765 |
| 125 | Ga0070713_100025207 | 3300005436 | Bacteria | 4646 |
| 126 | Ga0070705_100012263 | 3300005440 | Bacteria | 4352 |
| 127 | Ga0070700_100000002 | 3300005441 | Bacteria | 261904 |
| 128 | Ga0070694_100006532 | 3300005444 | Bacteria | 7081 |
| 129 | Ga0070663_100002208 | 3300005455 | Bacteria | 10893 |
| 130 | Ga0070663_100059657 | 3300005455 | Bacteria | 2742 |
| 131 | Ga0070678_100006037 | 3300005456 | Bacteria | 7066 |
| 132 | Ga0070678_100059147 | 3300005456 | Bacteria | 2816 |
| 133 | Ga0070678_100083340 | 3300005456 | Bacteria | 2430 |
| 134 | Ga0070662_100001359 | 3300005457 | Bacteria | 15030 |
| 135 | Ga0070662_100004688 | 3300005457 | Bacteria | 8667 |
| 136 | Ga0070662_100011778 | 3300005457 | Bacteria | 5776 |
| 137 | Ga0070662_100019584 | 3300005457 | Bacteria | 4596 |
| 138 | Ga0070662_100031271 | 3300005457 | Bacteria | 3735 |
| 139 | Ga0070662_100040079 | 3300005457 | Bacteria | 3333 |
| 140 | Ga0070662_100052030 | 3300005457 | Bacteria | 2959 |
| 141 | Ga0070662_100065191 | 3300005457 | Bacteria | 2669 |
| 142 | Ga0070662_100108027 | 3300005457 | Bacteria | 2115 |
| 143 | Ga0070662_100122079 | 3300005457 | Bacteria | 1998 |
| 144 | Ga0070662_100157654 | 3300005457 | Bacteria | 1773 |
| 145 | Ga0068867_100000001 | 3300005459 | Bacteria | 427563 |
| 146 | Ga0068867_100003553 | 3300005459 | Bacteria | 10963 |
| 147 | Ga0068867_100037589 | 3300005459 | Bacteria | 3519 |
| 148 | Ga0068867_100040177 | 3300005459 | Bacteria | 3412 |
| 149 | Ga0068867_100185083 | 3300005459 | Bacteria | 1658 |
| 150 | Ga0070685_10000337 | 3300005466 | Bacteria | 28829 |
| 151 | Ga0070685_10102351 | 3300005466 | Bacteria | 1751 |
| 152 | Ga0070707_100002311 | 3300005468 | Bacteria | 18215 |
| 153 | Ga0070707_100046695 | 3300005468 | Bacteria | 4145 |
| 154 | Ga0070699_100021683 | 3300005518 | Bacteria | 5539 |
| 155 | Ga0070699_100029902 | 3300005518 | Bacteria | 4699 |
| 156 | Ga0070679_100219426 | 3300005530 | Bacteria | 1863 |
| 157 | Ga0070684_100000090 | 3300005535 | Bacteria | 59104 |
| 158 | Ga0068853_100000861 | 3300005539 | Bacteria | 21166 |
| 159 | Ga0068853_100038381 | 3300005539 | Bacteria | 4079 |
| 160 | Ga0068853_100091967 | 3300005539 | Bacteria | 2668 |
| 161 | Ga0070672_100000284 | 3300005543 | Bacteria | 28813 |
| 162 | Ga0070672_100010085 | 3300005543 | Bacteria | 6540 |
| 163 | Ga0070672_100033724 | 3300005543 | Bacteria | 3880 |
| 164 | Ga0070672_100062542 | 3300005543 | Bacteria | 2938 |
| 165 | Ga0070672_100083436 | 3300005543 | Bacteria | 2565 |
| 166 | Ga0070672_100106176 | 3300005543 | Bacteria | 2284 |
| 167 | Ga0070672_100109090 | 3300005543 | Bacteria | 2254 |
| 168 | Ga0070672_100141726 | 3300005543 | Bacteria | 1983 |
| 169 | Ga0070686_100000003 | 3300005544 | Bacteria | 308397 |
| 170 | Ga0070686_100080279 | 3300005544 | Bacteria | 2158 |
| 171 | Ga0070696_100004864 | 3300005546 | Bacteria | 8976 |
| 172 | Ga0070696_100066656 | 3300005546 | Bacteria | 2525 |
| 173 | Ga0070693_100034929 | 3300005547 | Bacteria | 2785 |
| 174 | Ga0070665_100000036 | 3300005548 | Bacteria | 314603 |
| 175 | Ga0070665_100000086 | 3300005548 | Bacteria | 178229 |
| 176 | Ga0070665_100010104 | 3300005548 | Bacteria | 9547 |
| 177 | Ga0070665_100015373 | 3300005548 | Bacteria | 7686 |
| 178 | Ga0070665_100029738 | 3300005548 | Bacteria | 5497 |
| 179 | Ga0070665_100040418 | 3300005548 | Bacteria | 4688 |
| 180 | Ga0070665_100046993 | 3300005548 | Bacteria | 4332 |
| 181 | Ga0070665_100077516 | 3300005548 | Bacteria | 3330 |
| 182 | Ga0070665_100086621 | 3300005548 | Bacteria | 3137 |
| 183 | Ga0068855_100000273 | 3300005563 | Bacteria | 63616 |
| 184 | Ga0070664_100001250 | 3300005564 | Bacteria | 20349 |
| 185 | Ga0070664_100008626 | 3300005564 | Bacteria | 8248 |
| 186 | Ga0070664_100023867 | 3300005564 | Bacteria | 5052 |
| 187 | Ga0070664_100117168 | 3300005564 | Bacteria | 2330 |
| 188 | Ga0070664_100158101 | 3300005564 | Bacteria | 2004 |
| 189 | Ga0068857_100002439 | 3300005577 | Bacteria | 15178 |
| 190 | Ga0068857_100007522 | 3300005577 | Bacteria | 9373 |
| 191 | Ga0068857_100012284 | 3300005577 | Bacteria | 7450 |
| 192 | Ga0068857_100015505 | 3300005577 | Bacteria | 6659 |
| 193 | Ga0068857_100095500 | 3300005577 | Bacteria | 2664 |
| 194 | Ga0068854_100000323 | 3300005578 | Bacteria | 31550 |
| 195 | Ga0068854_100016183 | 3300005578 | Bacteria | 4964 |
| 196 | Ga0068854_100022892 | 3300005578 | Bacteria | 4262 |
| 197 | Ga0068854_100063253 | 3300005578 | Bacteria | 2686 |
| 198 | Ga0068854_100127969 | 3300005578 | Bacteria | 1936 |
| 199 | Ga0068856_100017633 | 3300005614 | Bacteria | 6920 |
| 200 | Ga0070702_100008512 | 3300005615 | Bacteria | 4973 |
| 201 | Ga0070702_100038908 | 3300005615 | Bacteria | 2652 |
| 202 | Ga0068852_100000399 | 3300005616 | Bacteria | 29083 |
| 203 | Ga0068852_100001669 | 3300005616 | Bacteria | 15127 |
| 204 | Ga0068852_100039665 | 3300005616 | Bacteria | 3966 |
| 205 | Ga0068859_100000229 | 3300005617 | Bacteria | 55082 |
| 206 | Ga0068859_100003622 | 3300005617 | Bacteria | 15749 |
| 207 | Ga0068859_100023445 | 3300005617 | Bacteria | 6193 |
| 208 | Ga0068859_100024066 | 3300005617 | Bacteria | 6111 |
| 209 | Ga0068859_100032511 | 3300005617 | Bacteria | 5240 |
| 210 | Ga0068859_100138543 | 3300005617 | Bacteria | 2507 |
| 211 | Ga0068864_100000004 | 3300005618 | Bacteria | 489341 |
| 212 | Ga0068864_100000171 | 3300005618 | Bacteria | 59747 |
| 213 | Ga0068864_100000345 | 3300005618 | Bacteria | 40863 |
| 214 | Ga0068864_100002129 | 3300005618 | Bacteria | 16377 |
| 215 | Ga0068864_100004504 | 3300005618 | Bacteria | 11457 |
| 216 | Ga0068864_100021357 | 3300005618 | Bacteria | 5423 |
| 217 | Ga0068864_100023357 | 3300005618 | Bacteria | 5192 |
| 218 | Ga0068864_100041418 | 3300005618 | Bacteria | 3939 |
| 219 | Ga0068864_100123925 | 3300005618 | Bacteria | 2313 |
| 220 | Ga0068861_100036033 | 3300005719 | Bacteria | 3669 |
| 221 | Ga0068861_100066915 | 3300005719 | Bacteria | 2771 |
| 222 | Ga0068861_100138987 | 3300005719 | Bacteria | 1980 |
| 223 | Ga0068851_10021662 | 3300005834 | Bacteria | 3121 |
| 224 | Ga0068851_10095169 | 3300005834 | Bacteria | 1573 |
| 225 | Ga0068870_10024826 | 3300005840 | Bacteria | 2969 |
| 226 | Ga0068863_100000002 | 3300005841 | Bacteria | 489510 |
| 227 | Ga0068863_100000034 | 3300005841 | Bacteria | 168359 |
| 228 | Ga0068863_100000847 | 3300005841 | Bacteria | 30527 |
| 229 | Ga0068863_100001129 | 3300005841 | Bacteria | 26682 |
| 230 | Ga0068863_100007002 | 3300005841 | Bacteria | 11053 |
| 231 | Ga0068863_100014132 | 3300005841 | Bacteria | 7691 |
| 232 | Ga0068863_100037323 | 3300005841 | Bacteria | 4626 |
| 233 | Ga0068863_100048245 | 3300005841 | Bacteria | 4038 |
| 234 | Ga0068863_100105895 | 3300005841 | Bacteria | 2675 |
| 235 | Ga0068858_100000223 | 3300005842 | Bacteria | 61546 |
| 236 | Ga0068858_100000313 | 3300005842 | Bacteria | 51649 |
| 237 | Ga0068858_100000977 | 3300005842 | Bacteria | 29542 |
| 238 | Ga0068858_100003837 | 3300005842 | Bacteria | 14863 |
| 239 | Ga0068858_100017369 | 3300005842 | Bacteria | 6749 |
| 240 | Ga0068858_100021876 | 3300005842 | Bacteria | 5973 |
| 241 | Ga0068858_100032038 | 3300005842 | Bacteria | 4883 |
| 242 | Ga0068858_100124585 | 3300005842 | Bacteria | 2412 |
| 243 | Ga0068860_100000001 | 3300005843 | Bacteria | 703043 |
| 244 | Ga0068860_100009456 | 3300005843 | Bacteria | 9680 |
| 245 | Ga0068860_100024577 | 3300005843 | Bacteria | 5819 |
| 246 | Ga0068860_100036710 | 3300005843 | Bacteria | 4693 |
| 247 | Ga0068860_100254017 | 3300005843 | Bacteria | 1712 |
| 248 | Ga0068862_100000002 | 3300005844 | Bacteria | 489341 |
| 249 | Ga0068862_100001230 | 3300005844 | Bacteria | 24152 |
| 250 | Ga0068862_100045471 | 3300005844 | Bacteria | 3746 |
| 251 | Ga0068862_100125340 | 3300005844 | Bacteria | 2267 |
| 252 | Ga0068862_100151202 | 3300005844 | Bacteria | 2066 |
| 253 | Ga0097621_100041586 | 3300006237 | Bacteria | 3700 |
| 254 | Ga0097621_100069582 | 3300006237 | Bacteria | 2906 |
| 255 | Ga0068871_100018393 | 3300006358 | Bacteria | 5310 |
| 256 | Ga0068871_100029816 | 3300006358 | Bacteria | 4289 |
| 257 | Ga0068871_100062292 | 3300006358 | Bacteria | 3048 |
| 258 | Ga0068871_100104763 | 3300006358 | Bacteria | 2373 |
| 259 | Ga0075428_100000061 | 3300006844 | Bacteria | 88478 |
| 260 | Ga0075431_100002173 | 3300006847 | Bacteria | 18741 |
| 261 | Ga0068865_100000011 | 3300006881 | Bacteria | 154581 |
| 262 | Ga0097620_100000229 | 3300006931 | Bacteria | 55082 |
| 263 | Ga0097620_100003622 | 3300006931 | Bacteria | 15749 |
| 264 | Ga0097620_100023445 | 3300006931 | Bacteria | 6193 |
| 265 | Ga0097620_100024066 | 3300006931 | Bacteria | 6111 |
| 266 | Ga0097620_100032513 | 3300006931 | Bacteria | 5240 |
| 267 | Ga0097620_100138535 | 3300006931 | Bacteria | 2507 |
| 268 | Ga0105251_10002895 | 3300009011 | Bacteria | 12902 |
| 269 | Ga0105240_10029601 | 3300009093 | Bacteria | 7130 |
| 270 | Ga0105240_10105270 | 3300009093 | Bacteria | 3425 |
| 271 | Ga0105240_10298853 | 3300009093 | Bacteria | 1842 |
| 272 | Ga0111539_10000030 | 3300009094 | Bacteria | 175454 |
| 273 | Ga0111539_10001888 | 3300009094 | Bacteria | 27854 |
| 274 | Ga0105245_10000003 | 3300009098 | Bacteria | 488207 |
| 275 | Ga0105245_10000157 | 3300009098 | Bacteria | 64143 |
| 276 | Ga0105245_10008190 | 3300009098 | Bacteria | 9144 |
| 277 | Ga0114129_10023321 | 3300009147 | Bacteria | 8778 |
| 278 | Ga0105243_10000042 | 3300009148 | Bacteria | 159276 |
| 279 | Ga0105243_10000744 | 3300009148 | Bacteria | 31197 |
| 280 | Ga0105241_10008325 | 3300009174 | Bacteria | 7636 |
| 281 | Ga0105241_10025579 | 3300009174 | Bacteria | 4387 |
| 282 | Ga0105242_10001059 | 3300009176 | Bacteria | 21641 |
| 283 | Ga0105242_10002569 | 3300009176 | Bacteria | 14211 |
| 284 | Ga0105242_10029151 | 3300009176 | Bacteria | 4399 |
| 285 | Ga0105248_10000010 | 3300009177 | Bacteria | 344314 |
| 286 | Ga0105248_10000075 | 3300009177 | Bacteria | 114243 |
| 287 | Ga0105248_10001396 | 3300009177 | Bacteria | 26955 |
| 288 | Ga0105248_10009109 | 3300009177 | Bacteria | 10918 |
| 289 | Ga0105248_10010582 | 3300009177 | Bacteria | 10166 |
| 290 | Ga0105248_10020058 | 3300009177 | Bacteria | 7404 |
| 291 | Ga0105248_10025569 | 3300009177 | Bacteria | 6565 |
| 292 | Ga0105248_10038152 | 3300009177 | Bacteria | 5376 |
| 293 | Ga0105248_10208203 | 3300009177 | Bacteria | 2204 |
| 294 | Ga0105238_10000041 | 3300009551 | Bacteria | 155330 |
| 295 | Ga0105238_10010516 | 3300009551 | Bacteria | 9289 |
| 296 | Ga0105238_10127790 | 3300009551 | Bacteria | 2520 |
| 297 | Ga0105249_10000026 | 3300009553 | Bacteria | 232053 |
| 298 | Ga0105249_10000041 | 3300009553 | Bacteria | 195999 |
| 299 | Ga0105249_10018777 | 3300009553 | Bacteria | 6160 |
| 300 | Ga0105249_10042959 | 3300009553 | Bacteria | 4111 |
| 301 | Ga0105239_10091084 | 3300010375 | Bacteria | 3365 |
| 302 | Ga0105246_10000049 | 3300011119 | Bacteria | 46856 |
| 303 | Ga0105246_10145098 | 3300011119 | Bacteria | 1790 |
| 304 | Ga0157373_10012550 | 3300013100 | Bacteria | 6228 |
| 305 | Ga0157373_10014217 | 3300013100 | Bacteria | 5837 |
| 306 | Ga0157373_10016948 | 3300013100 | Bacteria | 5308 |
| 307 | Ga0157373_10090625 | 3300013100 | Bacteria | 2153 |
| 308 | Ga0157371_10000097 | 3300013102 | Bacteria | 134150 |
| 309 | Ga0157371_10006551 | 3300013102 | Bacteria | 9574 |
| 310 | Ga0157371_10009191 | 3300013102 | Bacteria | 7802 |
| 311 | Ga0157371_10010860 | 3300013102 | Bacteria | 7065 |
| 312 | Ga0157370_10000008 | 3300013104 | Bacteria | 240668 |
| 313 | Ga0157370_10063152 | 3300013104 | Bacteria | 3510 |
| 314 | Ga0157370_10097185 | 3300013104 | Bacteria | 2763 |
| 315 | Ga0157369_10004298 | 3300013105 | Bacteria | 16846 |
| 316 | Ga0157369_10012993 | 3300013105 | Bacteria | 9433 |
| 317 | Ga0157369_10026851 | 3300013105 | Bacteria | 6385 |
| 318 | Ga0157369_10063594 | 3300013105 | Bacteria | 3975 |
| 319 | Ga0157374_10000006 | 3300013296 | Bacteria | 640284 |
| 320 | Ga0157374_10004689 | 3300013296 | Bacteria | 11476 |
| 321 | Ga0157374_10004864 | 3300013296 | Bacteria | 11270 |
| 322 | Ga0157374_10049753 | 3300013296 | Bacteria | 3894 |
| 323 | Ga0157374_10094173 | 3300013296 | Bacteria | 2862 |
| 324 | Ga0157378_10000633 | 3300013297 | Bacteria | 33010 |
| 325 | Ga0157378_10001598 | 3300013297 | Bacteria | 20501 |
| 326 | Ga0157378_10002972 | 3300013297 | Bacteria | 15070 |
| 327 | Ga0157378_10003092 | 3300013297 | Bacteria | 14798 |
| 328 | Ga0157378_10026060 | 3300013297 | Bacteria | 5153 |
| 329 | Ga0157378_10055168 | 3300013297 | Bacteria | 3539 |
| 330 | Ga0157378_10174747 | 3300013297 | Bacteria | 2017 |
| 331 | Ga0163162_10025452 | 3300013306 | Bacteria | 5848 |
| 332 | Ga0163162_10035012 | 3300013306 | Bacteria | 4999 |
| 333 | Ga0163162_10045432 | 3300013306 | Bacteria | 4400 |
| 334 | Ga0157372_10018358 | 3300013307 | Bacteria | 7518 |
| 335 | Ga0157372_10119479 | 3300013307 | Bacteria | 3026 |
| 336 | Ga0157375_10000018 | 3300013308 | Bacteria | 285123 |
| 337 | Ga0157375_10000024 | 3300013308 | Bacteria | 231767 |
| 338 | Ga0157375_10004452 | 3300013308 | Bacteria | 12162 |
| 339 | Ga0157375_10038010 | 3300013308 | Bacteria | 4618 |
| 340 | Ga0157375_10095484 | 3300013308 | Bacteria | 3044 |
| 341 | Ga0157375_10281745 | 3300013308 | Bacteria | 1825 |
| 342 | Ga0163163_10081544 | 3300014325 | Bacteria | 3237 |
| 343 | Ga0163163_10177395 | 3300014325 | Bacteria | 2177 |
| 344 | Ga0157380_10007826 | 3300014326 | Bacteria | 7605 |
| 345 | Ga0157377_10000011 | 3300014745 | Bacteria | 305350 |
| 346 | Ga0157377_10000057 | 3300014745 | Bacteria | 87502 |
| 347 | Ga0157377_10009297 | 3300014745 | Bacteria | 4815 |
| 348 | Ga0157377_10102130 | 3300014745 | Bacteria | 1710 |
| 349 | Ga0157379_10020748 | 3300014968 | Bacteria | 5813 |
| 350 | Ga0157379_10125868 | 3300014968 | Bacteria | 2306 |
| 351 | Ga0157379_10288073 | 3300014968 | Bacteria | 1495 |
| 352 | Ga0157376_10000009 | 3300014969 | Bacteria | 340244 |
| 353 | Ga0157376_10000072 | 3300014969 | Bacteria | 77631 |
| 354 | Ga0157376_10086902 | 3300014969 | Bacteria | 2697 |
| 355 | Ga0183363_1001 | 3300015690 | Bacteria | 611534 |
| 356 | Ga0163161_10000008 | 3300017792 | Bacteria | 294642 |
| 357 | Ga0163161_10074630 | 3300017792 | Bacteria | 2487 |
| 358 | Ga0163161_10080096 | 3300017792 | Bacteria | 2403 |
| 359 | Ga0213873_10000003 | 3300021358 | Bacteria | 973849 |
| 360 | Ga0213873_10000255 | 3300021358 | Bacteria | 9238 |
| 361 | Ga0213876_10000003 | 3300021384 | Bacteria | 973849 |
| 362 | Ga0213876_10000018 | 3300021384 | Bacteria | 282299 |
| 363 | Ga0213876_10004303 | 3300021384 | Bacteria | 7980 |
| 364 | Ga0213876_10013306 | 3300021384 | Bacteria | 4373 |
| 365 | Ga0213876_10035134 | 3300021384 | Bacteria | 2644 |
| 366 | Ga0209563_100019 | 3300025230 | Bacteria | 697828 |
| 367 | Ga0207427_100735 | 3300025231 | Bacteria | 15112 |
| 368 | Ga0209437_101732 | 3300025233 | Bacteria | 4784 |
| 369 | Ga0209026_1002303 | 3300025250 | Bacteria | 7280 |
| 370 | Ga0209148_1000026 | 3300025254 | Bacteria | 629213 |
| 371 | Ga0209148_1000441 | 3300025254 | Bacteria | 45707 |
| 372 | Ga0209148_1003631 | 3300025254 | Bacteria | 4128 |
| 373 | Ga0209233_1000066 | 3300025261 | Bacteria | 381218 |
| 374 | Ga0209233_1000858 | 3300025261 | Bacteria | 13432 |
| 375 | Ga0209455_1000005 | 3300025272 | Bacteria | 1416756 |
| 376 | Ga0209455_1002591 | 3300025272 | Bacteria | 6882 |
| 377 | Ga0209758_1000001 | 3300025297 | Bacteria | 1981790 |
| 378 | Ga0207697_10000144 | 3300025315 | Bacteria | 34657 |
| 379 | Ga0207697_10019307 | 3300025315 | Bacteria | 2791 |
| 380 | Ga0207656_10021949 | 3300025321 | Bacteria | 2556 |
| 381 | Ga0207713_1005772 | 3300025735 | Bacteria | 7664 |
| 382 | Ga0207682_10045957 | 3300025893 | Bacteria | 1793 |
| 383 | Ga0207642_10013328 | 3300025899 | Bacteria | 2998 |
| 384 | Ga0207642_10024206 | 3300025899 | Bacteria | 2438 |
| 385 | Ga0207642_10037717 | 3300025899 | Bacteria | 2085 |
| 386 | Ga0207688_10000184 | 3300025901 | Bacteria | 27851 |
| 387 | Ga0207688_10059976 | 3300025901 | Bacteria | 2143 |
| 388 | Ga0207680_10000004 | 3300025903 | Bacteria | 827324 |
| 389 | Ga0207680_10011971 | 3300025903 | Bacteria | 4405 |
| 390 | Ga0207680_10032752 | 3300025903 | Bacteria | 2958 |
| 391 | Ga0207680_10055524 | 3300025903 | Bacteria | 2387 |
| 392 | Ga0207680_10058425 | 3300025903 | Bacteria | 2338 |
| 393 | Ga0207647_10000521 | 3300025904 | Bacteria | 30717 |
| 394 | Ga0207647_10000671 | 3300025904 | Bacteria | 26786 |
| 395 | Ga0207647_10003571 | 3300025904 | Bacteria | 11672 |
| 396 | Ga0207647_10005571 | 3300025904 | Bacteria | 9206 |
| 397 | Ga0207647_10008857 | 3300025904 | Bacteria | 7180 |
| 398 | Ga0207647_10009220 | 3300025904 | Bacteria | 7018 |
| 399 | Ga0207647_10023395 | 3300025904 | Bacteria | 4085 |
| 400 | Ga0207647_10041001 | 3300025904 | Bacteria | 2913 |
| 401 | Ga0207647_10043299 | 3300025904 | Bacteria | 2818 |
| 402 | Ga0207645_10000395 | 3300025907 | Bacteria | 35956 |
| 403 | Ga0207645_10014251 | 3300025907 | Bacteria | 5325 |
| 404 | Ga0207645_10041769 | 3300025907 | Bacteria | 2935 |
| 405 | Ga0207705_10000027 | 3300025909 | Bacteria | 248863 |
| 406 | Ga0207705_10002122 | 3300025909 | Bacteria | 15392 |
| 407 | Ga0207705_10006608 | 3300025909 | Bacteria | 8580 |
| 408 | Ga0207705_10007211 | 3300025909 | Bacteria | 8187 |
| 409 | Ga0207684_10030060 | 3300025910 | Bacteria | 4625 |
| 410 | Ga0207684_10152210 | 3300025910 | Bacteria | 1990 |
| 411 | Ga0207654_10002556 | 3300025911 | Bacteria | 9233 |
| 412 | Ga0207695_10035013 | 3300025913 | Bacteria | 5451 |
| 413 | Ga0207695_10099147 | 3300025913 | Bacteria | 2911 |
| 414 | Ga0207695_10233769 | 3300025913 | Bacteria | 1741 |
| 415 | Ga0207671_10009431 | 3300025914 | Bacteria | 8161 |
| 416 | Ga0207671_10012841 | 3300025914 | Bacteria | 6709 |
| 417 | Ga0207660_10083302 | 3300025917 | Bacteria | 2355 |
| 418 | Ga0207662_10002339 | 3300025918 | Bacteria | 9500 |
| 419 | Ga0207657_10002012 | 3300025919 | Bacteria | 21985 |
| 420 | Ga0207657_10002889 | 3300025919 | Bacteria | 18453 |
| 421 | Ga0207657_10007114 | 3300025919 | Bacteria | 11493 |
| 422 | Ga0207657_10009672 | 3300025919 | Bacteria | 9675 |
| 423 | Ga0207657_10015357 | 3300025919 | Bacteria | 7421 |
| 424 | Ga0207657_10017929 | 3300025919 | Bacteria | 6774 |
| 425 | Ga0207657_10019079 | 3300025919 | Bacteria | 6525 |
| 426 | Ga0207657_10050325 | 3300025919 | Bacteria | 3626 |
| 427 | Ga0207657_10123364 | 3300025919 | Bacteria | 2130 |
| 428 | Ga0207657_10129422 | 3300025919 | Bacteria | 2070 |
| 429 | Ga0207649_10003137 | 3300025920 | Bacteria | 9065 |
| 430 | Ga0207649_10070838 | 3300025920 | Bacteria | 2224 |
| 431 | Ga0207646_10001040 | 3300025922 | Bacteria | 35403 |
| 432 | Ga0207681_10000178 | 3300025923 | Bacteria | 52013 |
| 433 | Ga0207681_10001616 | 3300025923 | Bacteria | 14532 |
| 434 | Ga0207681_10006977 | 3300025923 | Bacteria | 6932 |
| 435 | Ga0207681_10030252 | 3300025923 | Bacteria | 3528 |
| 436 | Ga0207694_10000001 | 3300025924 | Bacteria | 4078485 |
| 437 | Ga0207694_10007758 | 3300025924 | Bacteria | 8128 |
| 438 | Ga0207694_10020747 | 3300025924 | Bacteria | 4974 |
| 439 | Ga0207694_10101136 | 3300025924 | Bacteria | 2284 |
| 440 | Ga0207694_10141891 | 3300025924 | Bacteria | 1932 |
| 441 | Ga0207650_10000083 | 3300025925 | Bacteria | 127270 |
| 442 | Ga0207650_10000460 | 3300025925 | Bacteria | 34271 |
| 443 | Ga0207650_10006457 | 3300025925 | Bacteria | 7987 |
| 444 | Ga0207650_10014155 | 3300025925 | Bacteria | 5541 |
| 445 | Ga0207650_10033910 | 3300025925 | Bacteria | 3701 |
| 446 | Ga0207650_10044991 | 3300025925 | Bacteria | 3246 |
| 447 | Ga0207650_10090865 | 3300025925 | Bacteria | 2332 |
| 448 | Ga0207659_10000011 | 3300025926 | Bacteria | 275661 |
| 449 | Ga0207659_10007196 | 3300025926 | Bacteria | 6835 |
| 450 | Ga0207659_10008668 | 3300025926 | Bacteria | 6326 |
| 451 | Ga0207659_10031366 | 3300025926 | Bacteria | 3638 |
| 452 | Ga0207687_10000002 | 3300025927 | Bacteria | 975489 |
| 453 | Ga0207687_10001915 | 3300025927 | Bacteria | 14312 |
| 454 | Ga0207687_10003139 | 3300025927 | Bacteria | 11207 |
| 455 | Ga0207644_10000570 | 3300025931 | Bacteria | 23662 |
| 456 | Ga0207644_10001392 | 3300025931 | Bacteria | 15594 |
| 457 | Ga0207644_10005796 | 3300025931 | Bacteria | 8040 |
| 458 | Ga0207644_10012016 | 3300025931 | Bacteria | 5742 |
| 459 | Ga0207644_10016201 | 3300025931 | Bacteria | 5015 |
| 460 | Ga0207644_10029050 | 3300025931 | Bacteria | 3833 |
| 461 | Ga0207644_10038386 | 3300025931 | Bacteria | 3373 |
| 462 | Ga0207644_10043996 | 3300025931 | Bacteria | 3170 |
| 463 | Ga0207644_10046831 | 3300025931 | Bacteria | 3083 |
| 464 | Ga0207644_10069903 | 3300025931 | Bacteria | 2564 |
| 465 | Ga0207644_10089388 | 3300025931 | Bacteria | 2292 |
| 466 | Ga0207644_10111936 | 3300025931 | Bacteria | 2065 |
| 467 | Ga0207644_10148433 | 3300025931 | Bacteria | 1812 |
| 468 | Ga0207690_10020142 | 3300025932 | Bacteria | 4117 |
| 469 | Ga0207690_10063175 | 3300025932 | Bacteria | 2524 |
| 470 | Ga0207706_10000467 | 3300025933 | Bacteria | 43202 |
| 471 | Ga0207706_10001512 | 3300025933 | Bacteria | 23067 |
| 472 | Ga0207706_10004027 | 3300025933 | Bacteria | 13904 |
| 473 | Ga0207706_10012744 | 3300025933 | Bacteria | 7652 |
| 474 | Ga0207706_10013579 | 3300025933 | Bacteria | 7399 |
| 475 | Ga0207706_10013914 | 3300025933 | Bacteria | 7296 |
| 476 | Ga0207706_10018693 | 3300025933 | Bacteria | 6235 |
| 477 | Ga0207706_10022801 | 3300025933 | Bacteria | 5617 |
| 478 | Ga0207706_10045652 | 3300025933 | Bacteria | 3881 |
| 479 | Ga0207706_10052751 | 3300025933 | Bacteria | 3590 |
| 480 | Ga0207706_10056151 | 3300025933 | Bacteria | 3472 |
| 481 | Ga0207706_10087589 | 3300025933 | Bacteria | 2738 |
| 482 | Ga0207706_10146686 | 3300025933 | Bacteria | 2076 |
| 483 | Ga0207706_10167138 | 3300025933 | Bacteria | 1933 |
| 484 | Ga0207706_10223547 | 3300025933 | Bacteria | 1648 |
| 485 | Ga0207686_10000797 | 3300025934 | Bacteria | 19358 |
| 486 | Ga0207686_10116167 | 3300025934 | Bacteria | 1813 |
| 487 | Ga0207709_10000119 | 3300025935 | Bacteria | 121452 |
| 488 | Ga0207709_10000188 | 3300025935 | Bacteria | 82582 |
| 489 | Ga0207670_10006452 | 3300025936 | Bacteria | 6505 |
| 490 | Ga0207670_10012070 | 3300025936 | Bacteria | 5038 |
| 491 | Ga0207669_10000614 | 3300025937 | Bacteria | 15500 |
| 492 | Ga0207669_10063582 | 3300025937 | Bacteria | 2279 |
| 493 | Ga0207669_10067673 | 3300025937 | Bacteria | 2227 |
| 494 | Ga0207704_10000001 | 3300025938 | Bacteria | 716296 |
| 495 | Ga0207704_10003382 | 3300025938 | Bacteria | 7244 |
| 496 | Ga0207691_10000281 | 3300025940 | Bacteria | 50396 |
| 497 | Ga0207691_10000884 | 3300025940 | Bacteria | 29746 |
| 498 | Ga0207691_10005043 | 3300025940 | Bacteria | 12741 |
| 499 | Ga0207691_10009981 | 3300025940 | Bacteria | 9119 |
| 500 | Ga0207691_10014306 | 3300025940 | Bacteria | 7568 |
| 501 | Ga0207691_10112603 | 3300025940 | Bacteria | 2418 |
| 502 | Ga0207691_10126344 | 3300025940 | Bacteria | 2262 |
| 503 | Ga0207711_10000035 | 3300025941 | Bacteria | 177223 |
| 504 | Ga0207711_10000077 | 3300025941 | Bacteria | 106500 |
| 505 | Ga0207711_10005454 | 3300025941 | Bacteria | 10751 |
| 506 | Ga0207711_10010239 | 3300025941 | Bacteria | 7785 |
| 507 | Ga0207711_10028216 | 3300025941 | Bacteria | 4722 |
| 508 | Ga0207711_10033608 | 3300025941 | Bacteria | 4341 |
| 509 | Ga0207711_10064523 | 3300025941 | Bacteria | 3163 |
| 510 | Ga0207689_10000212 | 3300025942 | Bacteria | 51394 |
| 511 | Ga0207689_10000824 | 3300025942 | Bacteria | 29889 |
| 512 | Ga0207689_10004329 | 3300025942 | Bacteria | 12928 |
| 513 | Ga0207689_10053183 | 3300025942 | Bacteria | 3336 |
| 514 | Ga0207661_10000013 | 3300025944 | Bacteria | 348811 |
| 515 | Ga0207679_10001980 | 3300025945 | Bacteria | 12706 |
| 516 | Ga0207679_10010666 | 3300025945 | Bacteria | 5924 |
| 517 | Ga0207679_10048360 | 3300025945 | Bacteria | 3096 |
| 518 | Ga0207679_10055472 | 3300025945 | Bacteria | 2921 |
| 519 | Ga0207679_10157427 | 3300025945 | Bacteria | 1856 |
| 520 | Ga0207667_10000010 | 3300025949 | Bacteria | 477432 |
| 521 | Ga0207667_10000109 | 3300025949 | Bacteria | 132054 |
| 522 | Ga0207667_10005836 | 3300025949 | Bacteria | 14998 |
| 523 | Ga0207667_10248124 | 3300025949 | Bacteria | 1821 |
| 524 | Ga0207651_10000002 | 3300025960 | Bacteria | 427663 |
| 525 | Ga0207651_10000536 | 3300025960 | Bacteria | 15928 |
| 526 | Ga0207651_10010118 | 3300025960 | Bacteria | 5207 |
| 527 | Ga0207651_10011469 | 3300025960 | Bacteria | 4964 |
| 528 | Ga0207651_10032299 | 3300025960 | Bacteria | 3360 |
| 529 | Ga0207651_10039985 | 3300025960 | Bacteria | 3098 |
| 530 | Ga0207712_10000001 | 3300025961 | Bacteria | 750309 |
| 531 | Ga0207712_10000460 | 3300025961 | Bacteria | 34444 |
| 532 | Ga0207712_10011591 | 3300025961 | Bacteria | 5621 |
| 533 | Ga0207712_10156584 | 3300025961 | Bacteria | 1765 |
| 534 | Ga0207668_10000064 | 3300025972 | Bacteria | 87025 |
| 535 | Ga0207640_10001306 | 3300025981 | Bacteria | 13525 |
| 536 | Ga0207640_10015707 | 3300025981 | Bacteria | 4387 |
| 537 | Ga0207640_10027350 | 3300025981 | Bacteria | 3474 |
| 538 | Ga0207640_10102716 | 3300025981 | Bacteria | 2008 |
| 539 | Ga0207640_10136456 | 3300025981 | Bacteria | 1782 |
| 540 | Ga0207658_10000575 | 3300025986 | Bacteria | 33049 |
| 541 | Ga0207658_10000909 | 3300025986 | Bacteria | 24536 |
| 542 | Ga0207658_10001752 | 3300025986 | Bacteria | 16336 |
| 543 | Ga0207658_10008040 | 3300025986 | Bacteria | 7186 |
| 544 | Ga0207658_10033284 | 3300025986 | Bacteria | 3675 |
| 545 | Ga0207658_10049735 | 3300025986 | Bacteria | 3081 |
| 546 | Ga0207658_10075142 | 3300025986 | Bacteria | 2570 |
| 547 | Ga0207677_10000011 | 3300026023 | Bacteria | 199704 |
| 548 | Ga0207677_10000042 | 3300026023 | Bacteria | 110706 |
| 549 | Ga0207677_10000179 | 3300026023 | Bacteria | 50536 |
| 550 | Ga0207677_10004781 | 3300026023 | Bacteria | 7307 |
| 551 | Ga0207677_10006345 | 3300026023 | Bacteria | 6482 |
| 552 | Ga0207703_10000961 | 3300026035 | Bacteria | 27866 |
| 553 | Ga0207703_10002285 | 3300026035 | Bacteria | 16709 |
| 554 | Ga0207703_10002971 | 3300026035 | Bacteria | 14368 |
| 555 | Ga0207703_10022901 | 3300026035 | Bacteria | 4907 |
| 556 | Ga0207703_10038353 | 3300026035 | Bacteria | 3823 |
| 557 | Ga0207703_10082173 | 3300026035 | Bacteria | 2688 |
| 558 | Ga0207703_10092526 | 3300026035 | Bacteria | 2545 |
| 559 | Ga0207639_10000020 | 3300026041 | Bacteria | 236698 |
| 560 | Ga0207639_10015675 | 3300026041 | Bacteria | 5348 |
| 561 | Ga0207639_10031577 | 3300026041 | Bacteria | 3893 |
| 562 | Ga0207639_10229861 | 3300026041 | Bacteria | 1607 |
| 563 | Ga0207678_10000804 | 3300026067 | Bacteria | 28814 |
| 564 | Ga0207678_10004243 | 3300026067 | Bacteria | 12857 |
| 565 | Ga0207678_10007057 | 3300026067 | Bacteria | 9975 |
| 566 | Ga0207678_10008718 | 3300026067 | Bacteria | 8930 |
| 567 | Ga0207678_10029379 | 3300026067 | Bacteria | 4797 |
| 568 | Ga0207678_10033132 | 3300026067 | Bacteria | 4502 |
| 569 | Ga0207708_10000120 | 3300026075 | Bacteria | 60395 |
| 570 | Ga0207702_10001740 | 3300026078 | Bacteria | 21419 |
| 571 | Ga0207702_10007466 | 3300026078 | Bacteria | 9325 |
| 572 | Ga0207702_10010297 | 3300026078 | Bacteria | 7833 |
| 573 | Ga0207702_10139307 | 3300026078 | Bacteria | 2193 |
| 574 | Ga0207641_10000002 | 3300026088 | Bacteria | 981004 |
| 575 | Ga0207641_10000057 | 3300026088 | Bacteria | 168603 |
| 576 | Ga0207641_10000140 | 3300026088 | Bacteria | 105699 |
| 577 | Ga0207641_10004215 | 3300026088 | Bacteria | 12531 |
| 578 | Ga0207641_10013509 | 3300026088 | Bacteria | 6698 |
| 579 | Ga0207641_10014457 | 3300026088 | Bacteria | 6466 |
| 580 | Ga0207648_10000001 | 3300026089 | Bacteria | 427499 |
| 581 | Ga0207648_10001054 | 3300026089 | Bacteria | 30851 |
| 582 | Ga0207648_10003316 | 3300026089 | Bacteria | 16906 |
| 583 | Ga0207648_10118231 | 3300026089 | Bacteria | 2329 |
| 584 | Ga0207676_10000005 | 3300026095 | Bacteria | 698744 |
| 585 | Ga0207676_10000008 | 3300026095 | Bacteria | 588913 |
| 586 | Ga0207676_10001402 | 3300026095 | Bacteria | 17933 |
| 587 | Ga0207676_10002110 | 3300026095 | Bacteria | 14402 |
| 588 | Ga0207676_10003752 | 3300026095 | Bacteria | 10734 |
| 589 | Ga0207676_10005764 | 3300026095 | Bacteria | 8760 |
| 590 | Ga0207676_10029077 | 3300026095 | Bacteria | 4134 |
| 591 | Ga0207676_10124322 | 3300026095 | Bacteria | 2181 |
| 592 | Ga0207674_10000501 | 3300026116 | Bacteria | 51694 |
| 593 | Ga0207674_10002481 | 3300026116 | Bacteria | 23258 |
| 594 | Ga0207674_10003712 | 3300026116 | Bacteria | 18642 |
| 595 | Ga0207674_10003718 | 3300026116 | Bacteria | 18629 |
| 596 | Ga0207674_10006227 | 3300026116 | Bacteria | 14065 |
| 597 | Ga0207674_10009494 | 3300026116 | Bacteria | 11108 |
| 598 | Ga0207674_10012021 | 3300026116 | Bacteria | 9698 |
| 599 | Ga0207674_10018843 | 3300026116 | Bacteria | 7487 |
| 600 | Ga0207674_10025767 | 3300026116 | Bacteria | 6263 |
| 601 | Ga0207674_10057185 | 3300026116 | Bacteria | 3954 |
| 602 | Ga0207674_10211466 | 3300026116 | Bacteria | 1888 |
| 603 | Ga0207675_100001962 | 3300026118 | Bacteria | 20508 |
| 604 | Ga0207675_100004465 | 3300026118 | Bacteria | 13521 |
| 605 | Ga0207675_100024355 | 3300026118 | Bacteria | 5629 |
| 606 | Ga0207675_100096482 | 3300026118 | Bacteria | 2783 |
| 607 | Ga0207683_10002637 | 3300026121 | Bacteria | 15673 |
| 608 | Ga0207683_10002725 | 3300026121 | Bacteria | 15428 |
| 609 | Ga0207683_10003626 | 3300026121 | Bacteria | 13437 |
| 610 | Ga0207683_10045172 | 3300026121 | Bacteria | 3852 |
| 611 | Ga0207683_10074801 | 3300026121 | Bacteria | 2998 |
| 612 | Ga0207698_10000173 | 3300026142 | Bacteria | 40043 |
| 613 | Ga0207698_10005136 | 3300026142 | Bacteria | 8046 |
| 614 | Ga0207698_10079654 | 3300026142 | Bacteria | 2635 |
| 615 | Ga0207698_10157231 | 3300026142 | Bacteria | 1982 |
| 616 | Ga0207428_10000038 | 3300027907 | Bacteria | 216105 |
| 617 | Ga0268266_10000002 | 3300028379 | Bacteria | 3059047 |
| 618 | Ga0268266_10000042 | 3300028379 | Bacteria | 316826 |
| 619 | Ga0268266_10000186 | 3300028379 | Bacteria | 110448 |
| 620 | Ga0268266_10011692 | 3300028379 | Bacteria | 7616 |
| 621 | Ga0268266_10026764 | 3300028379 | Bacteria | 4907 |
| 622 | Ga0268265_10000003 | 3300028380 | Bacteria | 949201 |
| 623 | Ga0268265_10000233 | 3300028380 | Bacteria | 63492 |
| 624 | Ga0268265_10012742 | 3300028380 | Bacteria | 5707 |
| 625 | Ga0268265_10027723 | 3300028380 | Bacteria | 4046 |
| 626 | Ga0268264_10000006 | 3300028381 | Bacteria | 827324 |
| 627 | Ga0268264_10001603 | 3300028381 | Bacteria | 20935 |
| 628 | Ga0268264_10002242 | 3300028381 | Bacteria | 17146 |
| 629 | Ga0268264_10011459 | 3300028381 | Bacteria | 7320 |
| 630 | Ga0268264_10050762 | 3300028381 | Bacteria | 3455 |
| 631 | Ga0268264_10062678 | 3300028381 | Bacteria | 3123 |
| 632 | Ga0268264_10066433 | 3300028381 | Bacteria | 3041 |
| 633 | Ga0307517_10100623 | 3300028786 | Bacteria | 2281 |
| 634 | Ga0307511_10009527 | 3300030521 | Bacteria | 9675 |
| 635 | Ga0307513_10016487 | 3300031456 | Bacteria | 8905 |
| 636 | Ga0307405_10091897 | 3300031731 | Bacteria | 2012 |
| 637 | Ga0307410_10110823 | 3300031852 | Bacteria | 1986 |
| 638 | Ga0307412_10136313 | 3300031911 | Bacteria | 1791 |
| 639 | Ga0307414_10041965 | 3300032004 | Bacteria | 3104 |
| 640 | Ga0307415_100049958 | 3300032126 | Bacteria | 2831 |
| 641 | Ga0307415_100068967 | 3300032126 | Bacteria | 2477 |
| 642 | Ga0307510_10005870 | 3300033180 | Bacteria | 14645 |
| 643 | Ga0307510_10120323 | 3300033180 | Bacteria | 2333 |
| 644 | Ga0373932_0000023 | 3300035112 | Bacteria | 46650 |
| 645 | Ga0373941_0001517 | 3300035115 | Bacteria | 4921 |
| 646 | Ga0373931_0120169 | 3300035691 | Bacteria | 1501 |
| 647 | Ga0373937_0049528 | 3300036401 | Bacteria | 3847 |
| 648 | Ga0395899_0000700 | 3300037312 | Bacteria | 33694 |
| 649 | Ga0395899_0001530 | 3300037312 | Bacteria | 19532 |
| 650 | Ga0395899_0002034 | 3300037312 | Bacteria | 16646 |
| 651 | Ga0395899_0012272 | 3300037312 | Bacteria | 6562 |
| 652 | Ga0395899_0082210 | 3300037312 | Bacteria | 2343 |
| 653 | Ga0395899_0089319 | 3300037312 | Bacteria | 2235 |
| 654 | Ga0395900_0000238 | 3300037418 | Bacteria | 86469 |
| 655 | Ga0395900_0006820 | 3300037418 | Bacteria | 11848 |
| 656 | Ga0395900_0011114 | 3300037418 | Bacteria | 9203 |
| 657 | Ga0395900_0011723 | 3300037418 | Bacteria | 8962 |
| 658 | Ga0395900_0011835 | 3300037418 | Bacteria | 8922 |
| 659 | Ga0395900_0013648 | 3300037418 | Bacteria | 8294 |
| 660 | Ga0395900_0014002 | 3300037418 | Bacteria | 8188 |
| 661 | Ga0395900_0014434 | 3300037418 | Bacteria | 8062 |
| 662 | Ga0395900_0022863 | 3300037418 | Bacteria | 6397 |
| 663 | Ga0395900_0023959 | 3300037418 | Bacteria | 6246 |
| 664 | Ga0395900_0029522 | 3300037418 | Bacteria | 5624 |
| 665 | Ga0395900_0033108 | 3300037418 | Bacteria | 5319 |
| 666 | Ga0395900_0055551 | 3300037418 | Bacteria | 4077 |
| 667 | Ga0395900_0074913 | 3300037418 | Bacteria | 3479 |
| 668 | Ga0395900_0102201 | 3300037418 | Bacteria | 2945 |
| 669 | Ga0395900_0116945 | 3300037418 | Bacteria | 2736 |
| 670 | Ga0395900_0120486 | 3300037418 | Bacteria | 2692 |
| 671 | Ga0395900_0147789 | 3300037418 | Bacteria | 2402 |
| 672 | Ga0395900_0234975 | 3300037418 | Bacteria | 1842 |
| 673 | Ga0395898_0000245 | 3300037466 | Bacteria | 136315 |
| 674 | Ga0395898_0014864 | 3300037466 | Bacteria | 7990 |
| 675 | Ga0395898_0036104 | 3300037466 | Bacteria | 4909 |
| 676 | Ga0395898_0045291 | 3300037466 | Bacteria | 4325 |
| 677 | Ga0395905_0000006 | 3300037471 | Bacteria | 549428 |
| 678 | Ga0395905_0000207 | 3300037471 | Bacteria | 91620 |
| 679 | Ga0395905_0001434 | 3300037471 | Bacteria | 28687 |
| 680 | Ga0395905_0001992 | 3300037471 | Bacteria | 23333 |
| 681 | Ga0395905_0002904 | 3300037471 | Bacteria | 18697 |
| 682 | Ga0395905_0003926 | 3300037471 | Bacteria | 15644 |
| 683 | Ga0395905_0004078 | 3300037471 | Bacteria | 15315 |
| 684 | Ga0395905_0004250 | 3300037471 | Bacteria | 14960 |
| 685 | Ga0395905_0005866 | 3300037471 | Bacteria | 12473 |
| 686 | Ga0395905_0012036 | 3300037471 | Bacteria | 8340 |
| 687 | Ga0395905_0013442 | 3300037471 | Bacteria | 7844 |
| 688 | Ga0395905_0021293 | 3300037471 | Bacteria | 6134 |
| 689 | Ga0395905_0066247 | 3300037471 | Bacteria | 3382 |
| 690 | Ga0395905_0104617 | 3300037471 | Bacteria | 2657 |
| 691 | Ga0395905_0108390 | 3300037471 | Bacteria | 2607 |
| 692 | Ga0395905_0111970 | 3300037471 | Bacteria | 2563 |
| 693 | Ga0395905_0118496 | 3300037471 | Bacteria | 2488 |
| 694 | Ga0395905_0119340 | 3300037471 | Bacteria | 2478 |
| 695 | Ga0395905_0124048 | 3300037471 | Bacteria | 2428 |
| 696 | Ga0395905_0132674 | 3300037471 | Bacteria | 2343 |
| 697 | Ga0395905_0149919 | 3300037471 | Bacteria | 2194 |
| 698 | Ga0395905_0235237 | 3300037471 | Bacteria | 1712 |
| 699 | Ga0395901_0000156 | 3300038443 | Bacteria | 88513 |
| 700 | Ga0395901_0002990 | 3300038443 | Bacteria | 17050 |
| 701 | Ga0395901_0008535 | 3300038443 | Bacteria | 10351 |
| 702 | Ga0395901_0069527 | 3300038443 | Bacteria | 3667 |
| 703 | Ga0395901_0081122 | 3300038443 | Bacteria | 3388 |
| 704 | Ga0395901_0085911 | 3300038443 | Bacteria | 3289 |
| 705 | Ga0395901_0088865 | 3300038443 | Bacteria | 3232 |
| 706 | Ga0395901_0099564 | 3300038443 | Bacteria | 3048 |
| 707 | Ga0395901_0107328 | 3300038443 | Bacteria | 2931 |
| 708 | Ga0395901_0119786 | 3300038443 | Bacteria | 2765 |
| 709 | Ga0436365_0235589 | 3300039437 | Bacteria | 57306 |
| 710 | Ga0436365_0853705 | 3300039437 | Bacteria | 99517 |
| 711 | Ga0436365_0900843 | 3300039437 | Bacteria | 6714 |
| 712 | Ga0436365_1775746 | 3300039437 | Bacteria | 7536 |
| 713 | Ga0436365_1817329 | 3300039437 | Bacteria | 2533 |
| 714 | Ga0436362_0232622 | 3300039453 | Bacteria | 12494 |
| 715 | Ga0436362_0649416 | 3300039453 | Bacteria | 210038 |
| 716 | Ga0451793_0526473 | 3300041452 | Bacteria | 1433 |
| 717 | Ga0451807_0730426 | 3300041486 | Bacteria | 1625 |
| 718 | Ga0439448_0000759 | 3300042005 | Bacteria | 7818 |
| 719 | Ga0439448_0001509 | 3300042005 | Bacteria | 6063 |
| 720 | Ga0439448_0002911 | 3300042005 | Bacteria | 4691 |
| 721 | Ga0439455_0001129 | 3300042012 | Bacteria | 4288 |
| 722 | Ga0439455_0007492 | 3300042012 | Bacteria | 2309 |
| 723 | Ga0439455_0008558 | 3300042012 | Bacteria | 2196 |
| 724 | Ga0439458_0000161 | 3300042157 | Bacteria | 14947 |
| 725 | Ga0439458_0000188 | 3300042157 | Bacteria | 14084 |
| 726 | Ga0439458_0000449 | 3300042157 | Bacteria | 10415 |
| 727 | Ga0453683_0025920 | 3300044673 | Bacteria | 3723 |
| 728 | Ga0466963_0008253 | 3300044694 | Bacteria | 6242 |
| 729 | Ga0466964_0014359 | 3300044706 | Bacteria | 3011 |
| 730 | Ga0466971_0017109 | 3300044719 | Bacteria | 3204 |
| 731 | Ga0466968_0023758 | 3300044735 | Bacteria | 2500 |
| 732 | Ga0466970_0025984 | 3300044765 | Bacteria | 3068 |
| 733 | Ga0466957_0023524 | 3300044842 | Bacteria | 3642 |
| 734 | Ga0466960_0015617 | 3300044901 | Bacteria | 3277 |
| 735 | Ga0451576_0077239 | 3300045051 | Bacteria | 3465 |
| 736 | Ga0466958_0039399 | 3300045836 | Bacteria | 2839 |
| 737 | Ga0466967_0050468 | 3300045976 | Bacteria | 3643 |
| 738 | Ga0466967_0192478 | 3300045976 | Bacteria | 1928 |
| 739 | Ga0495638_0001888 | 3300046460 | Bacteria | 18107 |
| 740 | Ga0495638_0003983 | 3300046460 | Bacteria | 11360 |
| 741 | Ga0495650_0000467 | 3300046471 | Bacteria | 62422 |
| 742 | Ga0495584_0020786 | 3300046491 | Bacteria | 3334 |
| 743 | Ga0495585_0031886 | 3300046492 | Bacteria | 2989 |
| 744 | Ga0495583_0002885 | 3300046506 | Bacteria | 13913 |
| 745 | Ga0495583_0008879 | 3300046506 | Bacteria | 6078 |
| 746 | Ga0495583_0025207 | 3300046506 | Bacteria | 2975 |
| 747 | Ga0495606_0000434 | 3300046507 | Bacteria | 69495 |
| 748 | Ga0495606_0090117 | 3300046507 | Bacteria | 1888 |
| 749 | Ga0495620_0005921 | 3300046515 | Bacteria | 6779 |
| 750 | Ga0495643_0002587 | 3300046522 | Bacteria | 14120 |
| 751 | Ga0495643_0006647 | 3300046522 | Bacteria | 7583 |
| 752 | Ga0495643_0011683 | 3300046522 | Bacteria | 5333 |
| 753 | Ga0495648_0000256 | 3300046524 | Bacteria | 60519 |
| 754 | Ga0495663_0011587 | 3300046525 | Bacteria | 2453 |
| 755 | Ga0495642_0023658 | 3300046528 | Bacteria | 2426 |
| 756 | Ga0495598_0000085 | 3300046537 | Bacteria | 15414 |
| 757 | Ga0495621_0000048 | 3300046539 | Bacteria | 23712 |
| 758 | Ga0495622_0013680 | 3300046557 | Bacteria | 3762 |
| 759 | Ga0495633_0004258 | 3300046558 | Bacteria | 9153 |
| 760 | Ga0495668_0000163 | 3300046616 | Bacteria | 99607 |
| 761 | Ga0495668_0016495 | 3300046616 | Bacteria | 4293 |
| 762 | Ga0495668_0026213 | 3300046616 | Bacteria | 3308 |
| 763 | Ga0495668_0046072 | 3300046616 | Bacteria | 2423 |
| 764 | Ga0495611_0037567 | 3300046648 | Bacteria | 2152 |
| 765 | Ga0495625_0000064 | 3300046660 | Bacteria | 174730 |
| 766 | Ga0495625_0000424 | 3300046660 | Bacteria | 63593 |
| 767 | Ga0495625_0010290 | 3300046660 | Bacteria | 7755 |
| 768 | Ga0495625_0023460 | 3300046660 | Bacteria | 4713 |
| 769 | Ga0495669_0000316 | 3300046684 | Bacteria | 26706 |
| 770 | Ga0495669_0000334 | 3300046684 | Bacteria | 25057 |
| 771 | Ga0495669_0000664 | 3300046684 | Bacteria | 14953 |
| 772 | Ga0495669_0013496 | 3300046684 | Bacteria | 3482 |
| 773 | Ga0495670_0007564 | 3300046691 | Bacteria | 5340 |
| 774 | Ga0495670_0032603 | 3300046691 | Bacteria | 2591 |
| 775 | Ga0495649_0049440 | 3300046694 | Bacteria | 2284 |
| 776 | Ga0495600_0000343 | 3300046809 | Bacteria | 24780 |
| 777 | Ga0495683_0039113 | 3300047323 | Bacteria | 2398 |
| 778 | Ga0495683_0071516 | 3300047323 | Bacteria | 1702 |
| 779 | Ga0495687_000557 | 3300047443 | Bacteria | 43965 |
| 780 | Ga0495687_000933 | 3300047443 | Bacteria | 30343 |
| 781 | Ga0495677_0041054 | 3300047445 | Bacteria | 1692 |
| 782 | Ga0495679_017619 | 3300047446 | Bacteria | 2554 |
| 783 | Ga0495681_0024192 | 3300047470 | Bacteria | 3207 |
| 784 | Ga0495686_0001453 | 3300047472 | Bacteria | 25811 |
| 785 | Ga0495686_0050587 | 3300047472 | Bacteria | 2611 |
| 786 | Ga0495686_0079207 | 3300047472 | Bacteria | 2009 |
| 787 | Ga0496101_0155765 | 3300048904 | Bacteria | 1750 |
| 788 | Ga0496102_0001183 | 3300048905 | Bacteria | 23700 |
| 789 | Ga0496102_0170594 | 3300048905 | Bacteria | 2048 |
| 790 | Ga0496102_0208841 | 3300048905 | Bacteria | 1841 |
| 791 | Ga0496103_0000335 | 3300048906 | Bacteria | 42986 |
| 792 | Ga0496103_0001645 | 3300048906 | Bacteria | 14637 |
| 793 | Ga0496103_0012628 | 3300048906 | Bacteria | 5010 |
| 794 | Ga0496104_0015207 | 3300048907 | Bacteria | 6967 |
| 795 | Ga0496105_0000773 | 3300048908 | Bacteria | 21686 |
| 796 | Ga0496105_0208128 | 3300048908 | Bacteria | 1595 |
| 797 | Ga0496107_0006696 | 3300048910 | Bacteria | 7933 |
| 798 | Ga0496107_0067092 | 3300048910 | Bacteria | 2602 |
| 799 | Ga0496107_0176678 | 3300048910 | Bacteria | 1585 |
| 800 | Ga0496108_0001136 | 3300048911 | Bacteria | 20807 |
| 801 | Ga0496108_0012594 | 3300048911 | Bacteria | 6889 |
| 802 | Ga0496108_0024692 | 3300048911 | Bacteria | 4950 |
| 803 | Ga0496108_0274491 | 3300048911 | Bacteria | 1467 |
| 804 | Ga0496109_0064383 | 3300048912 | Bacteria | 3355 |
| 805 | Ga0496109_0080123 | 3300048912 | Bacteria | 3008 |
| 806 | Ga0496110_0013306 | 3300048913 | Bacteria | 6797 |
| 807 | Ga0496110_0015116 | 3300048913 | Bacteria | 6416 |
| 808 | Ga0496110_0021896 | 3300048913 | Bacteria | 5420 |
| 809 | Ga0496110_0036892 | 3300048913 | Bacteria | 4247 |
| 810 | Ga0496111_0018292 | 3300048914 | Bacteria | 4853 |
| 811 | Ga0496111_0031128 | 3300048914 | Bacteria | 3799 |
| 812 | Ga0496112_0024638 | 3300048915 | Bacteria | 5766 |
| 813 | Ga0496112_0033925 | 3300048915 | Bacteria | 4965 |
| 814 | Ga0496112_0048573 | 3300048915 | Bacteria | 4161 |
| 815 | Ga0496112_0092528 | 3300048915 | Bacteria | 2993 |
| 816 | Ga0496112_0273389 | 3300048915 | Bacteria | 1637 |
| 817 | Ga0496113_0035258 | 3300048916 | Bacteria | 3658 |
| 818 | Ga0496113_0043307 | 3300048916 | Bacteria | 3330 |
| 819 | Ga0496114_0000021 | 3300048917 | Bacteria | 227038 |
| 820 | Ga0496114_0017739 | 3300048917 | Bacteria | 5752 |
| 821 | Ga0496114_0217872 | 3300048917 | Bacteria | 1675 |
| 822 | Ga0496115_0000172 | 3300048918 | Bacteria | 59971 |
| 823 | Ga0496115_0001399 | 3300048918 | Bacteria | 17242 |
| 824 | Ga0496116_0007730 | 3300048919 | Bacteria | 9463 |
| 825 | Ga0496117_0000582 | 3300048920 | Bacteria | 60157 |
| 826 | Ga0496117_0046513 | 3300048920 | Bacteria | 3120 |
| 827 | Ga0496118_0001620 | 3300048921 | Bacteria | 33243 |
| 828 | Ga0496118_0002822 | 3300048921 | Bacteria | 22727 |
| 829 | Ga0496118_0017941 | 3300048921 | Bacteria | 6416 |
| 830 | Ga0496119_0002551 | 3300048922 | Bacteria | 19826 |
| 831 | Ga0496121_0001258 | 3300048924 | Bacteria | 43842 |
| 832 | Ga0496121_0024763 | 3300048924 | Bacteria | 5726 |
| 833 | Ga0496121_0029837 | 3300048924 | Bacteria | 5027 |
| 834 | Ga0496121_0076262 | 3300048924 | Bacteria | 2674 |
| 835 | Ga0496122_0036178 | 3300048925 | Bacteria | 3999 |
| 836 | Ga0496123_0019169 | 3300048926 | Bacteria | 5400 |
| 837 | Ga0496124_0000606 | 3300048927 | Bacteria | 60251 |
| 838 | Ga0496124_0134340 | 3300048927 | Bacteria | 1961 |
| 839 | Ga0496125_0000666 | 3300048928 | Bacteria | 57200 |
| 840 | Ga0496125_0035969 | 3300048928 | Bacteria | 4332 |
| 841 | Ga0496126_0001153 | 3300048929 | Bacteria | 43798 |
| 842 | Ga0501043_0052116 | 3300049579 | Bacteria | 3215 |
| 843 | Ga0501073_0002418 | 3300049589 | Bacteria | 13973 |
| 844 | Ga0501080_0011801 | 3300049742 | Bacteria | 8006 |
| 845 | nmdc:mga06r32_1472_c1 | 3300050510 | Bacteria | 21188 |
| 846 | nmdc:mga08y16_27_c1 | 3300050511 | Bacteria | 214573 |
| 847 | nmdc:mga0a205_9502_c1 | 3300050515 | Bacteria | 8897 |
| 848 | Ga0500610_0003524 | 3300053079 | Bacteria | 6031 |
| 849 | Ga0500643_009852 | 3300053087 | Bacteria | 3613 |
| 850 | Ga0500595_000235 | 3300053119 | Bacteria | 37436 |
| 851 | Ga0500595_000472 | 3300053119 | Bacteria | 24818 |
| 852 | Ga0500658_0000029 | 3300053134 | Bacteria | 99170 |
| 853 | Ga0500568_0043746 | 3300053139 | Bacteria | 1789 |
| 854 | Ga0500636_0005698 | 3300053177 | Bacteria | 7121 |
| 855 | Ga0500645_000170 | 3300053730 | Bacteria | 51134 |
| 856 | Ga0500645_017906 | 3300053730 | Bacteria | 2217 |
| 857 | Ga0466962_0037656 | 3300061719 | Bacteria | 2316 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048917 | Ga0496114_0217872 | Ga0496114_0217872_10_1164 | 376 |
| 2 | 3300048916 | Ga0496113_0043307 | Ga0496113_0043307_2081_3235 | 377 |
| 3 | 3300047445 | Ga0495677_0041054 | Ga0495677_0041054_494_1672 | 385 |
| 4 | 3300041486 | Ga0451807_0730426 | Ga0451807_0730426_355_1566 | 396 |
| 5 | 3300014745 | Ga0157377_10000057 | Ga0157377_1000005746 | 405 |
| 6 | 3300048924 | Ga0496121_0076262 | Ga0496121_0076262_558_1901 | 410 |
| 7 | 3300001990 | JGI24737J22298_10000754 | JGI24737J22298_100007545 | 414 |
| 8 | 3300025904 | Ga0207647_10005571 | Ga0207647_100055716 | 414 |
| 9 | 3300037418 | Ga0395900_0006820 | Ga0395900_0006820_4446_5783 | 414 |
| 10 | 3300038443 | Ga0395901_0107328 | Ga0395901_0107328_1485_2822 | 414 |
| 11 | 3300001989 | JGI24739J22299_10000438 | JGI24739J22299_100004386 | 415 |
| 12 | 3300002067 | JGI24735J21928_10001176 | JGI24735J21928_100011764 | 415 |
| 13 | 3300002075 | JGI24738J21930_10000106 | JGI24738J21930_100001067 | 415 |
| 14 | 3300005457 | Ga0070662_100011778 | Ga0070662_1000117783 | 415 |
| 15 | 3300009094 | Ga0111539_10001888 | Ga0111539_1000188816 | 415 |
| 16 | 3300025933 | Ga0207706_10012744 | Ga0207706_100127444 | 415 |
| 17 | 3300005340 | Ga0070689_100019280 | Ga0070689_1000192801 | 417 |
| 18 | 3300005842 | Ga0068858_100000223 | Ga0068858_10000022330 | 417 |
| 19 | 3300009176 | Ga0105242_10002569 | Ga0105242_100025696 | 417 |
| 20 | 3300025936 | Ga0207670_10012070 | Ga0207670_100120705 | 417 |
| 21 | 3300025960 | Ga0207651_10011469 | Ga0207651_100114695 | 417 |
| 22 | 3300026035 | Ga0207703_10038353 | Ga0207703_100383531 | 417 |
| 23 | 3300044694 | Ga0466963_0008253 | Ga0466963_0008253_261_1547 | 417 |
| 24 | 3300044719 | Ga0466971_0017109 | Ga0466971_0017109_1038_2324 | 417 |
| 25 | 3300045836 | Ga0466958_0039399 | Ga0466958_0039399_898_2184 | 417 |
| 26 | 3300045976 | Ga0466967_0192478 | Ga0466967_0192478_255_1541 | 417 |
| 27 | 3300048928 | Ga0496125_0035969 | Ga0496125_0035969_1354_2697 | 417 |
| 28 | 3300061719 | Ga0466962_0037656 | Ga0466962_0037656_307_1593 | 417 |
| 29 | 3300048921 | Ga0496118_0017941 | Ga0496118_0017941_1110_2453 | 418 |
| 30 | 3300048924 | Ga0496121_0024763 | Ga0496121_0024763_180_1523 | 418 |
| 31 | 3300048926 | Ga0496123_0019169 | Ga0496123_0019169_1498_2841 | 418 |
| 32 | 3300005615 | Ga0070702_100008512 | Ga0070702_1000085122 | 419 |
| 33 | 3300005354 | Ga0070675_100000060 | Ga0070675_10000006016 | 420 |
| 34 | 3300021358 | Ga0213873_10000003 | Ga0213873_1000000358 | 420 |
| 35 | 3300021384 | Ga0213876_10000003 | Ga0213876_10000003810 | 420 |
| 36 | 3300039437 | Ga0436365_0235589 | Ga0436365_0235589_4701_6077 | 420 |
| 37 | 3300039453 | Ga0436362_0649416 | Ga0436362_0649416_20880_22256 | 420 |
| 38 | 3300005719 | Ga0068861_100066915 | Ga0068861_1000669152 | 422 |
| 39 | 3300025910 | Ga0207684_10152210 | Ga0207684_101522103 | 422 |
| 40 | 3300025917 | Ga0207660_10083302 | Ga0207660_100833021 | 422 |
| 41 | 3300026118 | Ga0207675_100096482 | Ga0207675_1000964822 | 422 |
| 42 | 3300053119 | Ga0500595_000472 | Ga0500595_000472_20234_21610 | 422 |
| 43 | 3300005327 | Ga0070658_10039282 | Ga0070658_100392825 | 423 |
| 44 | 3300005468 | Ga0070707_100002311 | Ga0070707_1000023117 | 423 |
| 45 | 3300005518 | Ga0070699_100021683 | Ga0070699_1000216831 | 423 |
| 46 | 3300009093 | Ga0105240_10029601 | Ga0105240_100296012 | 423 |
| 47 | 3300013105 | Ga0157369_10063594 | Ga0157369_100635945 | 423 |
| 48 | 3300025254 | Ga0209148_1003631 | Ga0209148_10036315 | 423 |
| 49 | 3300025272 | Ga0209455_1002591 | Ga0209455_10025911 | 423 |
| 50 | 3300025904 | Ga0207647_10003571 | Ga0207647_100035715 | 423 |
| 51 | 3300025904 | Ga0207647_10023395 | Ga0207647_100233952 | 423 |
| 52 | 3300025910 | Ga0207684_10030060 | Ga0207684_100300602 | 423 |
| 53 | 3300025913 | Ga0207695_10099147 | Ga0207695_100991472 | 423 |
| 54 | 3300025919 | Ga0207657_10050325 | Ga0207657_100503251 | 423 |
| 55 | 3300025922 | Ga0207646_10001040 | Ga0207646_100010408 | 423 |
| 56 | 3300026089 | Ga0207648_10003316 | Ga0207648_100033162 | 423 |
| 57 | 3300013307 | Ga0157372_10119479 | Ga0157372_101194792 | 424 |
| 58 | 3300047472 | Ga0495686_0050587 | Ga0495686_0050587_1266_2597 | 424 |
| 59 | 3300005331 | Ga0070670_100027828 | Ga0070670_1000278286 | 425 |
| 60 | 3300005339 | Ga0070660_100000436 | Ga0070660_10000043619 | 425 |
| 61 | 3300005354 | Ga0070675_100049263 | Ga0070675_1000492635 | 425 |
| 62 | 3300005356 | Ga0070674_100041488 | Ga0070674_1000414882 | 425 |
| 63 | 3300005367 | Ga0070667_100127771 | Ga0070667_1001277712 | 425 |
| 64 | 3300005457 | Ga0070662_100040079 | Ga0070662_1000400793 | 425 |
| 65 | 3300005518 | Ga0070699_100029902 | Ga0070699_1000299023 | 425 |
| 66 | 3300005614 | Ga0068856_100017633 | Ga0068856_1000176336 | 425 |
| 67 | 3300009147 | Ga0114129_10023321 | Ga0114129_100233213 | 425 |
| 68 | 3300025315 | Ga0207697_10019307 | Ga0207697_100193073 | 425 |
| 69 | 3300025901 | Ga0207688_10059976 | Ga0207688_100599762 | 425 |
| 70 | 3300025919 | Ga0207657_10017929 | Ga0207657_100179291 | 425 |
| 71 | 3300025960 | Ga0207651_10032299 | Ga0207651_100322992 | 425 |
| 72 | 3300026067 | Ga0207678_10007057 | Ga0207678_100070575 | 425 |
| 73 | 3300026078 | Ga0207702_10007466 | Ga0207702_100074666 | 425 |
| 74 | 3300005441 | Ga0070700_100000002 | Ga0070700_100000002129 | 426 |
| 75 | 3300005577 | Ga0068857_100012284 | Ga0068857_1000122844 | 426 |
| 76 | 3300005618 | Ga0068864_100000171 | Ga0068864_10000017113 | 426 |
| 77 | 3300005840 | Ga0068870_10024826 | Ga0068870_100248263 | 426 |
| 78 | 3300006847 | Ga0075431_100002173 | Ga0075431_10000217310 | 426 |
| 79 | 3300009094 | Ga0111539_10000030 | Ga0111539_10000030152 | 426 |
| 80 | 3300013297 | Ga0157378_10055168 | Ga0157378_100551682 | 426 |
| 81 | 3300013308 | Ga0157375_10000018 | Ga0157375_10000018136 | 426 |
| 82 | 3300014745 | Ga0157377_10102130 | Ga0157377_101021302 | 426 |
| 83 | 3300025927 | Ga0207687_10003139 | Ga0207687_100031395 | 426 |
| 84 | 3300025940 | Ga0207691_10000884 | Ga0207691_100008847 | 426 |
| 85 | 3300026075 | Ga0207708_10000120 | Ga0207708_1000012038 | 426 |
| 86 | 3300026095 | Ga0207676_10000008 | Ga0207676_10000008142 | 426 |
| 87 | 3300026116 | Ga0207674_10018843 | Ga0207674_100188434 | 426 |
| 88 | 3300027907 | Ga0207428_10000038 | Ga0207428_10000038203 | 426 |
| 89 | 3300035112 | Ga0373932_0000023 | Ga0373932_0000023_9781_11112 | 426 |
| 90 | 3300035115 | Ga0373941_0001517 | Ga0373941_0001517_2222_3676 | 426 |
| 91 | 3300044673 | Ga0453683_0025920 | Ga0453683_0025920_1052_2392 | 426 |
| 92 | 3300046515 | Ga0495620_0005921 | Ga0495620_0005921_353_1711 | 426 |
| 93 | 3300050510 | nmdc:mga06r32_1472_c1 | nmdc:mga06r32_1472_c1_19683_21029 | 426 |
| 94 | 3300050511 | nmdc:mga08y16_27_c1 | nmdc:mga08y16_27_c1_205131_206501 | 426 |
| 95 | 3300005356 | Ga0070674_100001467 | Ga0070674_10000146710 | 427 |
| 96 | 3300005364 | Ga0070673_100073319 | Ga0070673_1000733192 | 427 |
| 97 | 3300005456 | Ga0070678_100083340 | Ga0070678_1000833402 | 427 |
| 98 | 3300005543 | Ga0070672_100141726 | Ga0070672_1001417261 | 427 |
| 99 | 3300006358 | Ga0068871_100062292 | Ga0068871_1000622921 | 427 |
| 100 | 3300009148 | Ga0105243_10000744 | Ga0105243_100007445 | 427 |
| 101 | 3300013297 | Ga0157378_10026060 | Ga0157378_100260603 | 427 |
| 102 | 3300025935 | Ga0207709_10000188 | Ga0207709_1000018858 | 427 |
| 103 | 3300025937 | Ga0207669_10000614 | Ga0207669_100006142 | 427 |
| 104 | 3300025960 | Ga0207651_10039985 | Ga0207651_100399852 | 427 |
| 105 | 3300026121 | Ga0207683_10045172 | Ga0207683_100451722 | 427 |
| 106 | 3300036401 | Ga0373937_0049528 | Ga0373937_0049528_462_1907 | 427 |
| 107 | 3300044765 | Ga0466970_0025984 | Ga0466970_0025984_343_1746 | 427 |
| 108 | 3300045051 | Ga0451576_0077239 | Ga0451576_0077239_1990_3399 | 427 |
| 109 | 3300046522 | Ga0495643_0006647 | Ga0495643_0006647_16_1350 | 427 |
| 110 | 3300005331 | Ga0070670_100054032 | Ga0070670_1000540322 | 428 |
| 111 | 3300005355 | Ga0070671_100129121 | Ga0070671_1001291212 | 428 |
| 112 | 3300005468 | Ga0070707_100046695 | Ga0070707_1000466953 | 428 |
| 113 | 3300005539 | Ga0068853_100038381 | Ga0068853_1000383812 | 428 |
| 114 | 3300009093 | Ga0105240_10105270 | Ga0105240_101052701 | 428 |
| 115 | 3300009098 | Ga0105245_10000003 | Ga0105245_1000000358 | 428 |
| 116 | 3300025923 | Ga0207681_10006977 | Ga0207681_100069773 | 428 |
| 117 | 3300025925 | Ga0207650_10014155 | Ga0207650_100141554 | 428 |
| 118 | 3300025927 | Ga0207687_10000002 | Ga0207687_1000000258 | 428 |
| 119 | 3300025931 | Ga0207644_10046831 | Ga0207644_100468312 | 428 |
| 120 | 3300025937 | Ga0207669_10067673 | Ga0207669_100676732 | 428 |
| 121 | 3300026041 | Ga0207639_10000020 | Ga0207639_10000020123 | 428 |
| 122 | 3300003759 | Ga0055525_1000040 | Ga0055525_1000040256 | 429 |
| 123 | 3300005327 | Ga0070658_10012348 | Ga0070658_100123487 | 429 |
| 124 | 3300005329 | Ga0070683_100000109 | Ga0070683_10000010937 | 429 |
| 125 | 3300005330 | Ga0070690_100009353 | Ga0070690_1000093535 | 429 |
| 126 | 3300005331 | Ga0070670_100002017 | Ga0070670_1000020171 | 429 |
| 127 | 3300005334 | Ga0068869_100013879 | Ga0068869_1000138792 | 429 |
| 128 | 3300005336 | Ga0070680_100039350 | Ga0070680_1000393502 | 429 |
| 129 | 3300005338 | Ga0068868_100000038 | Ga0068868_1000000381 | 429 |
| 130 | 3300005338 | Ga0068868_100001094 | Ga0068868_10000109411 | 429 |
| 131 | 3300005338 | Ga0068868_100024491 | Ga0068868_1000244913 | 429 |
| 132 | 3300005364 | Ga0070673_100011740 | Ga0070673_1000117408 | 429 |
| 133 | 3300005367 | Ga0070667_100001262 | Ga0070667_10000126210 | 429 |
| 134 | 3300005367 | Ga0070667_100021197 | Ga0070667_1000211974 | 429 |
| 135 | 3300005367 | Ga0070667_100028675 | Ga0070667_1000286754 | 429 |
| 136 | 3300005456 | Ga0070678_100006037 | Ga0070678_1000060377 | 429 |
| 137 | 3300005535 | Ga0070684_100000090 | Ga0070684_10000009029 | 429 |
| 138 | 3300005543 | Ga0070672_100106176 | Ga0070672_1001061762 | 429 |
| 139 | 3300005544 | Ga0070686_100080279 | Ga0070686_1000802792 | 429 |
| 140 | 3300005578 | Ga0068854_100022892 | Ga0068854_1000228922 | 429 |
| 141 | 3300005578 | Ga0068854_100063253 | Ga0068854_1000632532 | 429 |
| 142 | 3300005616 | Ga0068852_100039665 | Ga0068852_1000396653 | 429 |
| 143 | 3300005841 | Ga0068863_100037323 | Ga0068863_1000373232 | 429 |
| 144 | 3300005842 | Ga0068858_100000977 | Ga0068858_1000009775 | 429 |
| 145 | 3300005844 | Ga0068862_100125340 | Ga0068862_1001253402 | 429 |
| 146 | 3300006237 | Ga0097621_100041586 | Ga0097621_1000415865 | 429 |
| 147 | 3300006358 | Ga0068871_100029816 | Ga0068871_1000298165 | 429 |
| 148 | 3300009176 | Ga0105242_10029151 | Ga0105242_100291515 | 429 |
| 149 | 3300009177 | Ga0105248_10010582 | Ga0105248_100105825 | 429 |
| 150 | 3300009551 | Ga0105238_10000041 | Ga0105238_1000004161 | 429 |
| 151 | 3300009551 | Ga0105238_10010516 | Ga0105238_100105164 | 429 |
| 152 | 3300010375 | Ga0105239_10091084 | Ga0105239_100910843 | 429 |
| 153 | 3300013102 | Ga0157371_10006551 | Ga0157371_100065519 | 429 |
| 154 | 3300013105 | Ga0157369_10012993 | Ga0157369_100129932 | 429 |
| 155 | 3300013105 | Ga0157369_10026851 | Ga0157369_100268517 | 429 |
| 156 | 3300013296 | Ga0157374_10000006 | Ga0157374_10000006108 | 429 |
| 157 | 3300013297 | Ga0157378_10000633 | Ga0157378_1000063321 | 429 |
| 158 | 3300013297 | Ga0157378_10003092 | Ga0157378_100030926 | 429 |
| 159 | 3300013297 | Ga0157378_10174747 | Ga0157378_101747471 | 429 |
| 160 | 3300013308 | Ga0157375_10000024 | Ga0157375_1000002453 | 429 |
| 161 | 3300014325 | Ga0163163_10177395 | Ga0163163_101773952 | 429 |
| 162 | 3300014745 | Ga0157377_10000011 | Ga0157377_1000001177 | 429 |
| 163 | 3300014969 | Ga0157376_10000009 | Ga0157376_10000009244 | 429 |
| 164 | 3300014969 | Ga0157376_10086902 | Ga0157376_100869022 | 429 |
| 165 | 3300021358 | Ga0213873_10000255 | Ga0213873_100002554 | 429 |
| 166 | 3300021384 | Ga0213876_10000018 | Ga0213876_10000018173 | 429 |
| 167 | 3300021384 | Ga0213876_10013306 | Ga0213876_100133063 | 429 |
| 168 | 3300021384 | Ga0213876_10035134 | Ga0213876_100351342 | 429 |
| 169 | 3300025230 | Ga0209563_100019 | Ga0209563_10001922 | 429 |
| 170 | 3300025899 | Ga0207642_10013328 | Ga0207642_100133283 | 429 |
| 171 | 3300025899 | Ga0207642_10024206 | Ga0207642_100242062 | 429 |
| 172 | 3300025903 | Ga0207680_10011971 | Ga0207680_100119715 | 429 |
| 173 | 3300025919 | Ga0207657_10123364 | Ga0207657_101233642 | 429 |
| 174 | 3300025924 | Ga0207694_10000001 | Ga0207694_100000013290 | 429 |
| 175 | 3300025924 | Ga0207694_10141891 | Ga0207694_101418912 | 429 |
| 176 | 3300025925 | Ga0207650_10000460 | Ga0207650_1000046027 | 429 |
| 177 | 3300025926 | Ga0207659_10000011 | Ga0207659_10000011230 | 429 |
| 178 | 3300025931 | Ga0207644_10012016 | Ga0207644_100120162 | 429 |
| 179 | 3300025931 | Ga0207644_10043996 | Ga0207644_100439961 | 429 |
| 180 | 3300025933 | Ga0207706_10004027 | Ga0207706_1000402713 | 429 |
| 181 | 3300025940 | Ga0207691_10014306 | Ga0207691_100143068 | 429 |
| 182 | 3300025941 | Ga0207711_10028216 | Ga0207711_100282163 | 429 |
| 183 | 3300025942 | Ga0207689_10053183 | Ga0207689_100531832 | 429 |
| 184 | 3300025944 | Ga0207661_10000013 | Ga0207661_1000001357 | 429 |
| 185 | 3300025986 | Ga0207658_10001752 | Ga0207658_100017526 | 429 |
| 186 | 3300025986 | Ga0207658_10049735 | Ga0207658_100497353 | 429 |
| 187 | 3300026023 | Ga0207677_10000011 | Ga0207677_1000001151 | 429 |
| 188 | 3300026023 | Ga0207677_10000179 | Ga0207677_1000017929 | 429 |
| 189 | 3300026023 | Ga0207677_10004781 | Ga0207677_100047815 | 429 |
| 190 | 3300026035 | Ga0207703_10022901 | Ga0207703_100229013 | 429 |
| 191 | 3300026035 | Ga0207703_10092526 | Ga0207703_100925265 | 429 |
| 192 | 3300026121 | Ga0207683_10002725 | Ga0207683_100027253 | 429 |
| 193 | 3300026142 | Ga0207698_10157231 | Ga0207698_101572312 | 429 |
| 194 | 3300028380 | Ga0268265_10012742 | Ga0268265_100127426 | 429 |
| 195 | 3300028381 | Ga0268264_10050762 | Ga0268264_100507624 | 429 |
| 196 | 3300028381 | Ga0268264_10062678 | Ga0268264_100626781 | 429 |
| 197 | 3300030521 | Ga0307511_10009527 | Ga0307511_100095278 | 429 |
| 198 | 3300037471 | Ga0395905_0000207 | Ga0395905_0000207_16327_17733 | 429 |
| 199 | 3300039437 | Ga0436365_0853705 | Ga0436365_0853705_98067_99443 | 429 |
| 200 | 3300039437 | Ga0436365_0900843 | Ga0436365_0900843_370_1713 | 429 |
| 201 | 3300039437 | Ga0436365_1775746 | Ga0436365_1775746_5848_7194 | 429 |
| 202 | 3300039453 | Ga0436362_0232622 | Ga0436362_0232622_9625_11001 | 429 |
| 203 | 3300047446 | Ga0495679_017619 | Ga0495679_017619_45_1388 | 429 |
| 204 | 3300048905 | Ga0496102_0208841 | Ga0496102_0208841_136_1539 | 429 |
| 205 | 3300048908 | Ga0496105_0208128 | Ga0496105_0208128_170_1573 | 429 |
| 206 | 3300048910 | Ga0496107_0176678 | Ga0496107_0176678_134_1537 | 429 |
| 207 | 3300048911 | Ga0496108_0274491 | Ga0496108_0274491_24_1427 | 429 |
| 208 | 3300048913 | Ga0496110_0015116 | Ga0496110_0015116_3007_4410 | 429 |
| 209 | 3300048915 | Ga0496112_0273389 | Ga0496112_0273389_50_1453 | 429 |
| 210 | 3300049589 | Ga0501073_0002418 | Ga0501073_0002418_6247_7626 | 429 |
| 211 | 3300049742 | Ga0501080_0011801 | Ga0501080_0011801_2349_3728 | 429 |
| 212 | 3300005366 | Ga0070659_100017252 | Ga0070659_1000172525 | 430 |
| 213 | 3300005564 | Ga0070664_100158101 | Ga0070664_1001581012 | 430 |
| 214 | 3300013100 | Ga0157373_10016948 | Ga0157373_100169482 | 430 |
| 215 | 3300025919 | Ga0207657_10015357 | Ga0207657_100153575 | 430 |
| 216 | 3300025945 | Ga0207679_10157427 | Ga0207679_101574272 | 430 |
| 217 | 3300037471 | Ga0395905_0104617 | Ga0395905_0104617_351_1754 | 430 |
| 218 | 3300005337 | Ga0070682_100000094 | Ga0070682_10000009464 | 431 |
| 219 | 3300005343 | Ga0070687_100002359 | Ga0070687_1000023594 | 431 |
| 220 | 3300005466 | Ga0070685_10102351 | Ga0070685_101023512 | 431 |
| 221 | 3300005719 | Ga0068861_100138987 | Ga0068861_1001389872 | 431 |
| 222 | 3300006844 | Ga0075428_100000061 | Ga0075428_10000006165 | 431 |
| 223 | 3300025918 | Ga0207662_10002339 | Ga0207662_100023393 | 431 |
| 224 | 3300005327 | Ga0070658_10012050 | Ga0070658_100120502 | 432 |
| 225 | 3300005577 | Ga0068857_100015505 | Ga0068857_1000155056 | 432 |
| 226 | 3300005616 | Ga0068852_100000399 | Ga0068852_1000003997 | 432 |
| 227 | 3300025909 | Ga0207705_10000027 | Ga0207705_100000278 | 432 |
| 228 | 3300026078 | Ga0207702_10139307 | Ga0207702_101393072 | 432 |
| 229 | 3300026116 | Ga0207674_10057185 | Ga0207674_100571853 | 432 |
| 230 | 3300026142 | Ga0207698_10000173 | Ga0207698_1000017333 | 432 |
| 231 | 3300037471 | Ga0395905_0003926 | Ga0395905_0003926_10396_11796 | 432 |
| 232 | 3300048912 | Ga0496109_0064383 | Ga0496109_0064383_1652_3058 | 432 |
| 233 | 3300053730 | Ga0500645_017906 | Ga0500645_017906_344_1714 | 432 |
| 234 | 3300001990 | JGI24737J22298_10012522 | JGI24737J22298_100125222 | 433 |
| 235 | 3300005327 | Ga0070658_10140303 | Ga0070658_101403032 | 433 |
| 236 | 3300005345 | Ga0070692_10011298 | Ga0070692_100112983 | 433 |
| 237 | 3300005366 | Ga0070659_100079665 | Ga0070659_1000796652 | 433 |
| 238 | 3300005444 | Ga0070694_100006532 | Ga0070694_1000065326 | 433 |
| 239 | 3300005843 | Ga0068860_100254017 | Ga0068860_1002540172 | 433 |
| 240 | 3300009553 | Ga0105249_10018777 | Ga0105249_100187777 | 433 |
| 241 | 3300014968 | Ga0157379_10020748 | Ga0157379_100207482 | 433 |
| 242 | 3300025904 | Ga0207647_10000521 | Ga0207647_1000052130 | 433 |
| 243 | 3300025933 | Ga0207706_10018693 | Ga0207706_100186935 | 433 |
| 244 | 3300025934 | Ga0207686_10116167 | Ga0207686_101161672 | 433 |
| 245 | 3300025942 | Ga0207689_10004329 | Ga0207689_100043294 | 433 |
| 246 | 3300028381 | Ga0268264_10002242 | Ga0268264_100022426 | 433 |
| 247 | 3300042012 | Ga0439455_0007492 | Ga0439455_0007492_43_1383 | 433 |
| 248 | 3300046684 | Ga0495669_0013496 | Ga0495669_0013496_261_1661 | 433 |
| 249 | 3300025904 | Ga0207647_10008857 | Ga0207647_100088578 | 434 |
| 250 | 3300001979 | JGI24740J21852_10013329 | JGI24740J21852_100133293 | 435 |
| 251 | 3300001989 | JGI24739J22299_10032172 | JGI24739J22299_100321722 | 435 |
| 252 | 3300002075 | JGI24738J21930_10001777 | JGI24738J21930_100017775 | 435 |
| 253 | 3300002077 | JGI24744J21845_10002156 | JGI24744J21845_100021563 | 435 |
| 254 | 3300003214 | JGI25165J46597_1001377 | JGI25165J46597_10013776 | 435 |
| 255 | 3300005327 | Ga0070658_10044376 | Ga0070658_100443762 | 435 |
| 256 | 3300005328 | Ga0070676_10005331 | Ga0070676_100053316 | 435 |
| 257 | 3300005334 | Ga0068869_100000516 | Ga0068869_10000051615 | 435 |
| 258 | 3300005338 | Ga0068868_100003632 | Ga0068868_1000036326 | 435 |
| 259 | 3300005339 | Ga0070660_100005239 | Ga0070660_1000052394 | 435 |
| 260 | 3300005354 | Ga0070675_100025145 | Ga0070675_1000251452 | 435 |
| 261 | 3300005355 | Ga0070671_100027863 | Ga0070671_1000278632 | 435 |
| 262 | 3300005355 | Ga0070671_100094013 | Ga0070671_1000940132 | 435 |
| 263 | 3300005364 | Ga0070673_100000003 | Ga0070673_100000003105 | 435 |
| 264 | 3300005455 | Ga0070663_100002208 | Ga0070663_1000022087 | 435 |
| 265 | 3300005457 | Ga0070662_100019584 | Ga0070662_1000195844 | 435 |
| 266 | 3300005457 | Ga0070662_100065191 | Ga0070662_1000651911 | 435 |
| 267 | 3300005459 | Ga0068867_100000001 | Ga0068867_100000001131 | 435 |
| 268 | 3300005539 | Ga0068853_100091967 | Ga0068853_1000919671 | 435 |
| 269 | 3300005543 | Ga0070672_100010085 | Ga0070672_1000100853 | 435 |
| 270 | 3300005543 | Ga0070672_100062542 | Ga0070672_1000625425 | 435 |
| 271 | 3300005563 | Ga0068855_100000273 | Ga0068855_1000002736 | 435 |
| 272 | 3300005578 | Ga0068854_100000323 | Ga0068854_1000003237 | 435 |
| 273 | 3300006237 | Ga0097621_100069582 | Ga0097621_1000695822 | 435 |
| 274 | 3300006881 | Ga0068865_100000011 | Ga0068865_100000011117 | 435 |
| 275 | 3300009093 | Ga0105240_10298853 | Ga0105240_102988531 | 435 |
| 276 | 3300009098 | Ga0105245_10000157 | Ga0105245_1000015716 | 435 |
| 277 | 3300009148 | Ga0105243_10000042 | Ga0105243_10000042135 | 435 |
| 278 | 3300009176 | Ga0105242_10001059 | Ga0105242_1000105913 | 435 |
| 279 | 3300009551 | Ga0105238_10127790 | Ga0105238_101277903 | 435 |
| 280 | 3300011119 | Ga0105246_10000049 | Ga0105246_1000004933 | 435 |
| 281 | 3300013100 | Ga0157373_10012550 | Ga0157373_100125506 | 435 |
| 282 | 3300013104 | Ga0157370_10000008 | Ga0157370_10000008172 | 435 |
| 283 | 3300013105 | Ga0157369_10004298 | Ga0157369_100042986 | 435 |
| 284 | 3300013296 | Ga0157374_10004689 | Ga0157374_100046897 | 435 |
| 285 | 3300013297 | Ga0157378_10002972 | Ga0157378_100029726 | 435 |
| 286 | 3300013308 | Ga0157375_10004452 | Ga0157375_100044527 | 435 |
| 287 | 3300014969 | Ga0157376_10000072 | Ga0157376_1000007272 | 435 |
| 288 | 3300017792 | Ga0163161_10080096 | Ga0163161_100800963 | 435 |
| 289 | 3300025231 | Ga0207427_100735 | Ga0207427_1007358 | 435 |
| 290 | 3300025250 | Ga0209026_1002303 | Ga0209026_10023032 | 435 |
| 291 | 3300025254 | Ga0209148_1000441 | Ga0209148_100044146 | 435 |
| 292 | 3300025261 | Ga0209233_1000858 | Ga0209233_10008585 | 435 |
| 293 | 3300025907 | Ga0207645_10000395 | Ga0207645_100003957 | 435 |
| 294 | 3300025909 | Ga0207705_10002122 | Ga0207705_100021222 | 435 |
| 295 | 3300025913 | Ga0207695_10233769 | Ga0207695_102337692 | 435 |
| 296 | 3300025919 | Ga0207657_10002889 | Ga0207657_100028897 | 435 |
| 297 | 3300025919 | Ga0207657_10129422 | Ga0207657_101294223 | 435 |
| 298 | 3300025924 | Ga0207694_10101136 | Ga0207694_101011362 | 435 |
| 299 | 3300025926 | Ga0207659_10007196 | Ga0207659_100071966 | 435 |
| 300 | 3300025927 | Ga0207687_10001915 | Ga0207687_1000191516 | 435 |
| 301 | 3300025931 | Ga0207644_10038386 | Ga0207644_100383862 | 435 |
| 302 | 3300025931 | Ga0207644_10111936 | Ga0207644_101119362 | 435 |
| 303 | 3300025933 | Ga0207706_10013579 | Ga0207706_100135795 | 435 |
| 304 | 3300025933 | Ga0207706_10022801 | Ga0207706_100228012 | 435 |
| 305 | 3300025934 | Ga0207686_10000797 | Ga0207686_100007976 | 435 |
| 306 | 3300025935 | Ga0207709_10000119 | Ga0207709_1000011916 | 435 |
| 307 | 3300025938 | Ga0207704_10000001 | Ga0207704_10000001649 | 435 |
| 308 | 3300025942 | Ga0207689_10000824 | Ga0207689_1000082425 | 435 |
| 309 | 3300025949 | Ga0207667_10000109 | Ga0207667_10000109139 | 435 |
| 310 | 3300025960 | Ga0207651_10000002 | Ga0207651_10000002318 | 435 |
| 311 | 3300025961 | Ga0207712_10156584 | Ga0207712_101565842 | 435 |
| 312 | 3300025981 | Ga0207640_10001306 | Ga0207640_100013069 | 435 |
| 313 | 3300025981 | Ga0207640_10136456 | Ga0207640_101364562 | 435 |
| 314 | 3300026023 | Ga0207677_10000042 | Ga0207677_1000004215 | 435 |
| 315 | 3300026041 | Ga0207639_10229861 | Ga0207639_102298611 | 435 |
| 316 | 3300026067 | Ga0207678_10004243 | Ga0207678_100042437 | 435 |
| 317 | 3300026089 | Ga0207648_10000001 | Ga0207648_10000001318 | 435 |
| 318 | 3300026121 | Ga0207683_10003626 | Ga0207683_100036263 | 435 |
| 319 | 3300028786 | Ga0307517_10100623 | Ga0307517_101006232 | 435 |
| 320 | 3300037312 | Ga0395899_0002034 | Ga0395899_0002034_7727_9073 | 435 |
| 321 | 3300037418 | Ga0395900_0014434 | Ga0395900_0014434_2016_3362 | 435 |
| 322 | 3300037471 | Ga0395905_0118496 | Ga0395905_0118496_838_2244 | 435 |
| 323 | 3300041452 | Ga0451793_0526473 | Ga0451793_0526473_10_1353 | 435 |
| 324 | 3300042005 | Ga0439448_0000759 | Ga0439448_0000759_3565_4905 | 435 |
| 325 | 3300042005 | Ga0439448_0002911 | Ga0439448_0002911_1124_2464 | 435 |
| 326 | 3300042012 | Ga0439455_0001129 | Ga0439455_0001129_1247_2587 | 435 |
| 327 | 3300042157 | Ga0439458_0000188 | Ga0439458_0000188_9037_10377 | 435 |
| 328 | 3300044706 | Ga0466964_0014359 | Ga0466964_0014359_610_1950 | 435 |
| 329 | 3300044735 | Ga0466968_0023758 | Ga0466968_0023758_272_1612 | 435 |
| 330 | 3300044842 | Ga0466957_0023524 | Ga0466957_0023524_39_1382 | 435 |
| 331 | 3300044901 | Ga0466960_0015617 | Ga0466960_0015617_707_2047 | 435 |
| 332 | 3300037418 | Ga0395900_0234975 | Ga0395900_0234975_61_1467 | 436 |
| 333 | 3300013296 | Ga0157374_10094173 | Ga0157374_100941731 | 437 |
| 334 | 3300047472 | Ga0495686_0001453 | Ga0495686_0001453_17438_18850 | 437 |
| 335 | 3300005547 | Ga0070693_100034929 | Ga0070693_1000349294 | 438 |
| 336 | 3300013100 | Ga0157373_10090625 | Ga0157373_100906252 | 438 |
| 337 | 3300025981 | Ga0207640_10102716 | Ga0207640_101027162 | 438 |
| 338 | 3300031852 | Ga0307410_10110823 | Ga0307410_101108232 | 438 |
| 339 | 3300035691 | Ga0373931_0120169 | Ga0373931_0120169_40_1446 | 438 |
| 340 | iso_pu_bacteria | 2885429604 | 2885430041 | 438 |
| 341 | iso_pu_bacteria | 2928027323 | 2928027635 | 438 |
| 342 | iso_pu_bacteria | 2984555340 | 2984558071 | 438 |
| 343 | iso_pu_bacteria | 2984564862 | 2984567561 | 438 |
| 344 | iso_pu_bacteria | 2993356040 | 2993358614 | 438 |
| 345 | 3300001979 | JGI24740J21852_10000610 | JGI24740J21852_1000061012 | 439 |
| 346 | 3300003762 | Ga0055542_1000046 | Ga0055542_1000046158 | 439 |
| 347 | 3300003763 | Ga0055529_1000007 | Ga0055529_100000771 | 439 |
| 348 | 3300005440 | Ga0070705_100012263 | Ga0070705_1000122632 | 439 |
| 349 | 3300005546 | Ga0070696_100066656 | Ga0070696_1000666561 | 439 |
| 350 | 3300005615 | Ga0070702_100038908 | Ga0070702_1000389082 | 439 |
| 351 | 3300005618 | Ga0068864_100123925 | Ga0068864_1001239252 | 439 |
| 352 | 3300025254 | Ga0209148_1000026 | Ga0209148_1000026314 | 439 |
| 353 | 3300025272 | Ga0209455_1000005 | Ga0209455_10000051061 | 439 |
| 354 | 3300026118 | Ga0207675_100004465 | Ga0207675_10000446513 | 439 |
| 355 | 3300037418 | Ga0395900_0011723 | Ga0395900_0011723_2453_3862 | 439 |
| 356 | 3300037466 | Ga0395898_0014864 | Ga0395898_0014864_6350_7759 | 439 |
| 357 | 3300037471 | Ga0395905_0005866 | Ga0395905_0005866_8981_10390 | 439 |
| 358 | 3300037471 | Ga0395905_0149919 | Ga0395905_0149919_212_1618 | 439 |
| 359 | 3300038443 | Ga0395901_0002990 | Ga0395901_0002990_14571_15980 | 439 |
| 360 | 3300053139 | Ga0500568_0043746 | Ga0500568_0043746_73_1443 | 439 |
| 361 | 3300005355 | Ga0070671_100176849 | Ga0070671_1001768491 | 440 |
| 362 | 3300005543 | Ga0070672_100083436 | Ga0070672_1000834362 | 440 |
| 363 | 3300025893 | Ga0207682_10045957 | Ga0207682_100459572 | 440 |
| 364 | 3300025931 | Ga0207644_10148433 | Ga0207644_101484332 | 440 |
| 365 | 3300025933 | Ga0207706_10052751 | Ga0207706_100527512 | 440 |
| 366 | 3300025940 | Ga0207691_10126344 | Ga0207691_101263443 | 440 |
| 367 | 3300031731 | Ga0307405_10091897 | Ga0307405_100918973 | 440 |
| 368 | 3300031911 | Ga0307412_10136313 | Ga0307412_101363131 | 440 |
| 369 | 3300032004 | Ga0307414_10041965 | Ga0307414_100419654 | 440 |
| 370 | 3300032126 | Ga0307415_100049958 | Ga0307415_1000499582 | 440 |
| 371 | 3300032126 | Ga0307415_100068967 | Ga0307415_1000689672 | 440 |
| 372 | 3300037471 | Ga0395905_0132674 | Ga0395905_0132674_746_2116 | 440 |
| 373 | 3300053134 | Ga0500658_0000029 | Ga0500658_0000029_15126_16529 | 440 |
| 374 | 3300005344 | Ga0070661_100113825 | Ga0070661_1001138251 | 441 |
| 375 | 3300005355 | Ga0070671_100002434 | Ga0070671_10000243414 | 441 |
| 376 | 3300005355 | Ga0070671_100010584 | Ga0070671_1000105843 | 441 |
| 377 | 3300005364 | Ga0070673_100005252 | Ga0070673_1000052527 | 441 |
| 378 | 3300005367 | Ga0070667_100001721 | Ga0070667_10000172110 | 441 |
| 379 | 3300005436 | Ga0070713_100025207 | Ga0070713_1000252072 | 441 |
| 380 | 3300005456 | Ga0070678_100059147 | Ga0070678_1000591472 | 441 |
| 381 | 3300005457 | Ga0070662_100157654 | Ga0070662_1001576542 | 441 |
| 382 | 3300005543 | Ga0070672_100109090 | Ga0070672_1001090901 | 441 |
| 383 | 3300005548 | Ga0070665_100046993 | Ga0070665_1000469935 | 441 |
| 384 | 3300005548 | Ga0070665_100086621 | Ga0070665_1000866212 | 441 |
| 385 | 3300005564 | Ga0070664_100008626 | Ga0070664_1000086265 | 441 |
| 386 | 3300005617 | Ga0068859_100000229 | Ga0068859_10000022945 | 441 |
| 387 | 3300005618 | Ga0068864_100000345 | Ga0068864_10000034521 | 441 |
| 388 | 3300005841 | Ga0068863_100000847 | Ga0068863_10000084721 | 441 |
| 389 | 3300005842 | Ga0068858_100124585 | Ga0068858_1001245852 | 441 |
| 390 | 3300005843 | Ga0068860_100009456 | Ga0068860_1000094566 | 441 |
| 391 | 3300006931 | Ga0097620_100000229 | Ga0097620_10000022945 | 441 |
| 392 | 3300009177 | Ga0105248_10000075 | Ga0105248_1000007566 | 441 |
| 393 | 3300009553 | Ga0105249_10042959 | Ga0105249_100429592 | 441 |
| 394 | 3300013104 | Ga0157370_10097185 | Ga0157370_100971854 | 441 |
| 395 | 3300013296 | Ga0157374_10049753 | Ga0157374_100497532 | 441 |
| 396 | 3300013306 | Ga0163162_10025452 | Ga0163162_100254522 | 441 |
| 397 | 3300013308 | Ga0157375_10095484 | Ga0157375_100954842 | 441 |
| 398 | 3300014968 | Ga0157379_10125868 | Ga0157379_101258682 | 441 |
| 399 | 3300025920 | Ga0207649_10070838 | Ga0207649_100708382 | 441 |
| 400 | 3300025926 | Ga0207659_10031366 | Ga0207659_100313664 | 441 |
| 401 | 3300025931 | Ga0207644_10005796 | Ga0207644_100057962 | 441 |
| 402 | 3300025931 | Ga0207644_10016201 | Ga0207644_100162015 | 441 |
| 403 | 3300025931 | Ga0207644_10089388 | Ga0207644_100893883 | 441 |
| 404 | 3300025933 | Ga0207706_10167138 | Ga0207706_101671383 | 441 |
| 405 | 3300025940 | Ga0207691_10005043 | Ga0207691_100050438 | 441 |
| 406 | 3300025940 | Ga0207691_10112603 | Ga0207691_101126032 | 441 |
| 407 | 3300025941 | Ga0207711_10000077 | Ga0207711_1000007766 | 441 |
| 408 | 3300025949 | Ga0207667_10248124 | Ga0207667_102481241 | 441 |
| 409 | 3300025961 | Ga0207712_10011591 | Ga0207712_100115914 | 441 |
| 410 | 3300025986 | Ga0207658_10000909 | Ga0207658_1000090916 | 441 |
| 411 | 3300026035 | Ga0207703_10082173 | Ga0207703_100821732 | 441 |
| 412 | 3300026067 | Ga0207678_10029379 | Ga0207678_100293793 | 441 |
| 413 | 3300026088 | Ga0207641_10000140 | Ga0207641_1000014058 | 441 |
| 414 | 3300026095 | Ga0207676_10002110 | Ga0207676_100021107 | 441 |
| 415 | 3300026121 | Ga0207683_10074801 | Ga0207683_100748015 | 441 |
| 416 | 3300028379 | Ga0268266_10011692 | Ga0268266_100116927 | 441 |
| 417 | 3300028381 | Ga0268264_10001603 | Ga0268264_1000160310 | 441 |
| 418 | 3300037418 | Ga0395900_0116945 | Ga0395900_0116945_789_2195 | 441 |
| 419 | 3300037418 | Ga0395900_0147789 | Ga0395900_0147789_887_2290 | 441 |
| 420 | 3300037466 | Ga0395898_0045291 | Ga0395898_0045291_2136_3542 | 441 |
| 421 | 3300037471 | Ga0395905_0001434 | Ga0395905_0001434_25948_27351 | 441 |
| 422 | 3300037471 | Ga0395905_0119340 | Ga0395905_0119340_1011_2414 | 441 |
| 423 | 3300037471 | Ga0395905_0124048 | Ga0395905_0124048_65_1468 | 441 |
| 424 | 3300038443 | Ga0395901_0119786 | Ga0395901_0119786_1271_2674 | 441 |
| 425 | 3300045976 | Ga0466967_0050468 | Ga0466967_0050468_1729_3168 | 441 |
| 426 | 3300046460 | Ga0495638_0003983 | Ga0495638_0003983_120_1505 | 441 |
| 427 | 3300046537 | Ga0495598_0000085 | Ga0495598_0000085_842_2245 | 441 |
| 428 | 3300046539 | Ga0495621_0000048 | Ga0495621_0000048_948_2351 | 441 |
| 429 | 3300046616 | Ga0495668_0026213 | Ga0495668_0026213_745_2148 | 441 |
| 430 | 3300046684 | Ga0495669_0000316 | Ga0495669_0000316_20312_21721 | 441 |
| 431 | 3300046684 | Ga0495669_0000664 | Ga0495669_0000664_5024_6427 | 441 |
| 432 | 3300046691 | Ga0495670_0007564 | Ga0495670_0007564_366_1769 | 441 |
| 433 | 3300048911 | Ga0496108_0001136 | Ga0496108_0001136_7635_9038 | 441 |
| 434 | 3300048915 | Ga0496112_0033925 | Ga0496112_0033925_2389_3792 | 441 |
| 435 | 3300048915 | Ga0496112_0048573 | Ga0496112_0048573_1890_3293 | 441 |
| 436 | 3300048917 | Ga0496114_0017739 | Ga0496114_0017739_3905_5308 | 441 |
| 437 | 3300048918 | Ga0496115_0001399 | Ga0496115_0001399_5023_6426 | 441 |
| 438 | 3300001989 | JGI24739J22299_10006758 | JGI24739J22299_100067586 | 442 |
| 439 | 3300001990 | JGI24737J22298_10000016 | JGI24737J22298_1000001624 | 442 |
| 440 | 3300002075 | JGI24738J21930_10001908 | JGI24738J21930_100019086 | 442 |
| 441 | 3300005327 | Ga0070658_10037304 | Ga0070658_100373045 | 442 |
| 442 | 3300005327 | Ga0070658_10041821 | Ga0070658_100418213 | 442 |
| 443 | 3300005331 | Ga0070670_100024824 | Ga0070670_1000248244 | 442 |
| 444 | 3300005331 | Ga0070670_100050975 | Ga0070670_1000509752 | 442 |
| 445 | 3300005331 | Ga0070670_100171692 | Ga0070670_1001716922 | 442 |
| 446 | 3300005334 | Ga0068869_100002134 | Ga0068869_1000021347 | 442 |
| 447 | 3300005335 | Ga0070666_10000717 | Ga0070666_1000071710 | 442 |
| 448 | 3300005338 | Ga0068868_100014837 | Ga0068868_1000148374 | 442 |
| 449 | 3300005338 | Ga0068868_100144729 | Ga0068868_1001447292 | 442 |
| 450 | 3300005339 | Ga0070660_100003726 | Ga0070660_1000037266 | 442 |
| 451 | 3300005344 | Ga0070661_100024728 | Ga0070661_1000247285 | 442 |
| 452 | 3300005344 | Ga0070661_100052604 | Ga0070661_1000526045 | 442 |
| 453 | 3300005344 | Ga0070661_100055938 | Ga0070661_1000559382 | 442 |
| 454 | 3300005347 | Ga0070668_100002981 | Ga0070668_1000029812 | 442 |
| 455 | 3300005347 | Ga0070668_100016412 | Ga0070668_1000164124 | 442 |
| 456 | 3300005353 | Ga0070669_100000811 | Ga0070669_10000081111 | 442 |
| 457 | 3300005354 | Ga0070675_100007442 | Ga0070675_1000074425 | 442 |
| 458 | 3300005354 | Ga0070675_100063772 | Ga0070675_1000637723 | 442 |
| 459 | 3300005355 | Ga0070671_100001075 | Ga0070671_1000010754 | 442 |
| 460 | 3300005355 | Ga0070671_100037728 | Ga0070671_1000377283 | 442 |
| 461 | 3300005355 | Ga0070671_100097573 | Ga0070671_1000975732 | 442 |
| 462 | 3300005355 | Ga0070671_100148149 | Ga0070671_1001481493 | 442 |
| 463 | 3300005356 | Ga0070674_100048818 | Ga0070674_1000488185 | 442 |
| 464 | 3300005356 | Ga0070674_100066915 | Ga0070674_1000669152 | 442 |
| 465 | 3300005364 | Ga0070673_100000661 | Ga0070673_10000066110 | 442 |
| 466 | 3300005364 | Ga0070673_100003749 | Ga0070673_1000037496 | 442 |
| 467 | 3300005364 | Ga0070673_100035307 | Ga0070673_1000353073 | 442 |
| 468 | 3300005366 | Ga0070659_100001213 | Ga0070659_1000012137 | 442 |
| 469 | 3300005366 | Ga0070659_100029989 | Ga0070659_1000299891 | 442 |
| 470 | 3300005366 | Ga0070659_100078208 | Ga0070659_1000782082 | 442 |
| 471 | 3300005367 | Ga0070667_100006338 | Ga0070667_1000063383 | 442 |
| 472 | 3300005367 | Ga0070667_100009153 | Ga0070667_1000091535 | 442 |
| 473 | 3300005367 | Ga0070667_100009740 | Ga0070667_1000097406 | 442 |
| 474 | 3300005367 | Ga0070667_100032476 | Ga0070667_1000324762 | 442 |
| 475 | 3300005436 | Ga0070713_100010249 | Ga0070713_1000102493 | 442 |
| 476 | 3300005457 | Ga0070662_100001359 | Ga0070662_10000135914 | 442 |
| 477 | 3300005457 | Ga0070662_100004688 | Ga0070662_1000046884 | 442 |
| 478 | 3300005457 | Ga0070662_100031271 | Ga0070662_1000312713 | 442 |
| 479 | 3300005457 | Ga0070662_100052030 | Ga0070662_1000520303 | 442 |
| 480 | 3300005457 | Ga0070662_100122079 | Ga0070662_1001220792 | 442 |
| 481 | 3300005459 | Ga0068867_100003553 | Ga0068867_1000035537 | 442 |
| 482 | 3300005459 | Ga0068867_100037589 | Ga0068867_1000375892 | 442 |
| 483 | 3300005459 | Ga0068867_100040177 | Ga0068867_1000401773 | 442 |
| 484 | 3300005530 | Ga0070679_100219426 | Ga0070679_1002194262 | 442 |
| 485 | 3300005539 | Ga0068853_100000861 | Ga0068853_1000008617 | 442 |
| 486 | 3300005543 | Ga0070672_100000284 | Ga0070672_10000028414 | 442 |
| 487 | 3300005543 | Ga0070672_100033724 | Ga0070672_1000337243 | 442 |
| 488 | 3300005546 | Ga0070696_100004864 | Ga0070696_1000048647 | 442 |
| 489 | 3300005548 | Ga0070665_100010104 | Ga0070665_1000101042 | 442 |
| 490 | 3300005548 | Ga0070665_100015373 | Ga0070665_1000153732 | 442 |
| 491 | 3300005548 | Ga0070665_100029738 | Ga0070665_1000297383 | 442 |
| 492 | 3300005548 | Ga0070665_100040418 | Ga0070665_1000404185 | 442 |
| 493 | 3300005548 | Ga0070665_100077516 | Ga0070665_1000775165 | 442 |
| 494 | 3300005564 | Ga0070664_100001250 | Ga0070664_1000012505 | 442 |
| 495 | 3300005564 | Ga0070664_100023867 | Ga0070664_1000238674 | 442 |
| 496 | 3300005577 | Ga0068857_100002439 | Ga0068857_1000024396 | 442 |
| 497 | 3300005577 | Ga0068857_100007522 | Ga0068857_1000075222 | 442 |
| 498 | 3300005577 | Ga0068857_100095500 | Ga0068857_1000955002 | 442 |
| 499 | 3300005578 | Ga0068854_100016183 | Ga0068854_1000161836 | 442 |
| 500 | 3300005616 | Ga0068852_100001669 | Ga0068852_10000166911 | 442 |
| 501 | 3300005617 | Ga0068859_100003622 | Ga0068859_10000362213 | 442 |
| 502 | 3300005617 | Ga0068859_100023445 | Ga0068859_1000234454 | 442 |
| 503 | 3300005617 | Ga0068859_100032511 | Ga0068859_1000325115 | 442 |
| 504 | 3300005618 | Ga0068864_100002129 | Ga0068864_10000212911 | 442 |
| 505 | 3300005618 | Ga0068864_100023357 | Ga0068864_1000233573 | 442 |
| 506 | 3300005618 | Ga0068864_100041418 | Ga0068864_1000414183 | 442 |
| 507 | 3300005841 | Ga0068863_100001129 | Ga0068863_1000011296 | 442 |
| 508 | 3300005841 | Ga0068863_100007002 | Ga0068863_1000070029 | 442 |
| 509 | 3300005841 | Ga0068863_100014132 | Ga0068863_1000141323 | 442 |
| 510 | 3300005841 | Ga0068863_100048245 | Ga0068863_1000482452 | 442 |
| 511 | 3300005841 | Ga0068863_100105895 | Ga0068863_1001058955 | 442 |
| 512 | 3300005842 | Ga0068858_100003837 | Ga0068858_1000038372 | 442 |
| 513 | 3300005842 | Ga0068858_100017369 | Ga0068858_1000173698 | 442 |
| 514 | 3300005842 | Ga0068858_100032038 | Ga0068858_1000320382 | 442 |
| 515 | 3300005843 | Ga0068860_100024577 | Ga0068860_1000245775 | 442 |
| 516 | 3300005843 | Ga0068860_100036710 | Ga0068860_1000367102 | 442 |
| 517 | 3300005844 | Ga0068862_100045471 | Ga0068862_1000454715 | 442 |
| 518 | 3300005844 | Ga0068862_100151202 | Ga0068862_1001512022 | 442 |
| 519 | 3300006358 | Ga0068871_100018393 | Ga0068871_1000183932 | 442 |
| 520 | 3300006358 | Ga0068871_100104763 | Ga0068871_1001047632 | 442 |
| 521 | 3300006931 | Ga0097620_100003622 | Ga0097620_10000362213 | 442 |
| 522 | 3300006931 | Ga0097620_100023445 | Ga0097620_1000234453 | 442 |
| 523 | 3300006931 | Ga0097620_100032513 | Ga0097620_1000325135 | 442 |
| 524 | 3300009098 | Ga0105245_10008190 | Ga0105245_100081906 | 442 |
| 525 | 3300009174 | Ga0105241_10025579 | Ga0105241_100255794 | 442 |
| 526 | 3300009177 | Ga0105248_10001396 | Ga0105248_1000139627 | 442 |
| 527 | 3300009177 | Ga0105248_10020058 | Ga0105248_100200585 | 442 |
| 528 | 3300009177 | Ga0105248_10025569 | Ga0105248_100255696 | 442 |
| 529 | 3300009177 | Ga0105248_10208203 | Ga0105248_102082033 | 442 |
| 530 | 3300011119 | Ga0105246_10145098 | Ga0105246_101450981 | 442 |
| 531 | 3300013100 | Ga0157373_10014217 | Ga0157373_100142174 | 442 |
| 532 | 3300013102 | Ga0157371_10009191 | Ga0157371_100091916 | 442 |
| 533 | 3300013102 | Ga0157371_10010860 | Ga0157371_100108607 | 442 |
| 534 | 3300013296 | Ga0157374_10004864 | Ga0157374_100048647 | 442 |
| 535 | 3300013297 | Ga0157378_10001598 | Ga0157378_100015986 | 442 |
| 536 | 3300013306 | Ga0163162_10035012 | Ga0163162_100350124 | 442 |
| 537 | 3300013307 | Ga0157372_10018358 | Ga0157372_100183586 | 442 |
| 538 | 3300013308 | Ga0157375_10038010 | Ga0157375_100380102 | 442 |
| 539 | 3300013308 | Ga0157375_10281745 | Ga0157375_102817452 | 442 |
| 540 | 3300014325 | Ga0163163_10081544 | Ga0163163_100815441 | 442 |
| 541 | 3300014745 | Ga0157377_10009297 | Ga0157377_100092974 | 442 |
| 542 | 3300017792 | Ga0163161_10074630 | Ga0163161_100746302 | 442 |
| 543 | 3300021384 | Ga0213876_10004303 | Ga0213876_100043036 | 442 |
| 544 | 3300025315 | Ga0207697_10000144 | Ga0207697_100001446 | 442 |
| 545 | 3300025899 | Ga0207642_10037717 | Ga0207642_100377172 | 442 |
| 546 | 3300025901 | Ga0207688_10000184 | Ga0207688_1000018416 | 442 |
| 547 | 3300025903 | Ga0207680_10032752 | Ga0207680_100327522 | 442 |
| 548 | 3300025903 | Ga0207680_10055524 | Ga0207680_100555242 | 442 |
| 549 | 3300025903 | Ga0207680_10058425 | Ga0207680_100584253 | 442 |
| 550 | 3300025904 | Ga0207647_10000671 | Ga0207647_100006713 | 442 |
| 551 | 3300025904 | Ga0207647_10043299 | Ga0207647_100432993 | 442 |
| 552 | 3300025907 | Ga0207645_10014251 | Ga0207645_100142512 | 442 |
| 553 | 3300025907 | Ga0207645_10041769 | Ga0207645_100417692 | 442 |
| 554 | 3300025909 | Ga0207705_10007211 | Ga0207705_100072117 | 442 |
| 555 | 3300025919 | Ga0207657_10002012 | Ga0207657_1000201218 | 442 |
| 556 | 3300025919 | Ga0207657_10007114 | Ga0207657_100071149 | 442 |
| 557 | 3300025919 | Ga0207657_10009672 | Ga0207657_100096727 | 442 |
| 558 | 3300025923 | Ga0207681_10001616 | Ga0207681_100016166 | 442 |
| 559 | 3300025923 | Ga0207681_10030252 | Ga0207681_100302525 | 442 |
| 560 | 3300025925 | Ga0207650_10006457 | Ga0207650_100064575 | 442 |
| 561 | 3300025925 | Ga0207650_10033910 | Ga0207650_100339105 | 442 |
| 562 | 3300025925 | Ga0207650_10044991 | Ga0207650_100449911 | 442 |
| 563 | 3300025925 | Ga0207650_10090865 | Ga0207650_100908652 | 442 |
| 564 | 3300025926 | Ga0207659_10008668 | Ga0207659_100086685 | 442 |
| 565 | 3300025931 | Ga0207644_10001392 | Ga0207644_100013926 | 442 |
| 566 | 3300025931 | Ga0207644_10029050 | Ga0207644_100290505 | 442 |
| 567 | 3300025931 | Ga0207644_10069903 | Ga0207644_100699032 | 442 |
| 568 | 3300025932 | Ga0207690_10020142 | Ga0207690_100201426 | 442 |
| 569 | 3300025932 | Ga0207690_10063175 | Ga0207690_100631754 | 442 |
| 570 | 3300025933 | Ga0207706_10000467 | Ga0207706_1000046722 | 442 |
| 571 | 3300025933 | Ga0207706_10001512 | Ga0207706_100015124 | 442 |
| 572 | 3300025933 | Ga0207706_10013914 | Ga0207706_100139143 | 442 |
| 573 | 3300025933 | Ga0207706_10045652 | Ga0207706_100456523 | 442 |
| 574 | 3300025933 | Ga0207706_10087589 | Ga0207706_100875893 | 442 |
| 575 | 3300025933 | Ga0207706_10223547 | Ga0207706_102235471 | 442 |
| 576 | 3300025937 | Ga0207669_10063582 | Ga0207669_100635822 | 442 |
| 577 | 3300025938 | Ga0207704_10003382 | Ga0207704_100033825 | 442 |
| 578 | 3300025940 | Ga0207691_10000281 | Ga0207691_1000028126 | 442 |
| 579 | 3300025940 | Ga0207691_10009981 | Ga0207691_100099815 | 442 |
| 580 | 3300025941 | Ga0207711_10010239 | Ga0207711_100102393 | 442 |
| 581 | 3300025941 | Ga0207711_10033608 | Ga0207711_100336083 | 442 |
| 582 | 3300025941 | Ga0207711_10064523 | Ga0207711_100645234 | 442 |
| 583 | 3300025942 | Ga0207689_10000212 | Ga0207689_1000021232 | 442 |
| 584 | 3300025945 | Ga0207679_10001980 | Ga0207679_100019804 | 442 |
| 585 | 3300025945 | Ga0207679_10010666 | Ga0207679_100106664 | 442 |
| 586 | 3300025945 | Ga0207679_10048360 | Ga0207679_100483602 | 442 |
| 587 | 3300025945 | Ga0207679_10055472 | Ga0207679_100554725 | 442 |
| 588 | 3300025960 | Ga0207651_10000536 | Ga0207651_100005368 | 442 |
| 589 | 3300025960 | Ga0207651_10010118 | Ga0207651_100101183 | 442 |
| 590 | 3300025972 | Ga0207668_10000064 | Ga0207668_1000006451 | 442 |
| 591 | 3300025981 | Ga0207640_10027350 | Ga0207640_100273502 | 442 |
| 592 | 3300025986 | Ga0207658_10008040 | Ga0207658_100080403 | 442 |
| 593 | 3300025986 | Ga0207658_10033284 | Ga0207658_100332843 | 442 |
| 594 | 3300026023 | Ga0207677_10006345 | Ga0207677_100063455 | 442 |
| 595 | 3300026035 | Ga0207703_10002285 | Ga0207703_100022856 | 442 |
| 596 | 3300026041 | Ga0207639_10031577 | Ga0207639_100315775 | 442 |
| 597 | 3300026067 | Ga0207678_10000804 | Ga0207678_1000080430 | 442 |
| 598 | 3300026067 | Ga0207678_10033132 | Ga0207678_100331323 | 442 |
| 599 | 3300026088 | Ga0207641_10004215 | Ga0207641_100042155 | 442 |
| 600 | 3300026088 | Ga0207641_10013509 | Ga0207641_100135096 | 442 |
| 601 | 3300026088 | Ga0207641_10014457 | Ga0207641_100144575 | 442 |
| 602 | 3300026089 | Ga0207648_10001054 | Ga0207648_1000105415 | 442 |
| 603 | 3300026089 | Ga0207648_10118231 | Ga0207648_101182312 | 442 |
| 604 | 3300026095 | Ga0207676_10003752 | Ga0207676_100037523 | 442 |
| 605 | 3300026095 | Ga0207676_10005764 | Ga0207676_100057647 | 442 |
| 606 | 3300026095 | Ga0207676_10029077 | Ga0207676_100290773 | 442 |
| 607 | 3300026095 | Ga0207676_10124322 | Ga0207676_101243222 | 442 |
| 608 | 3300026116 | Ga0207674_10000501 | Ga0207674_1000050132 | 442 |
| 609 | 3300026116 | Ga0207674_10002481 | Ga0207674_100024819 | 442 |
| 610 | 3300026116 | Ga0207674_10003712 | Ga0207674_100037127 | 442 |
| 611 | 3300026116 | Ga0207674_10003718 | Ga0207674_100037186 | 442 |
| 612 | 3300026116 | Ga0207674_10006227 | Ga0207674_100062272 | 442 |
| 613 | 3300026116 | Ga0207674_10009494 | Ga0207674_100094948 | 442 |
| 614 | 3300026116 | Ga0207674_10025767 | Ga0207674_100257675 | 442 |
| 615 | 3300026118 | Ga0207675_100024355 | Ga0207675_1000243556 | 442 |
| 616 | 3300026121 | Ga0207683_10002637 | Ga0207683_100026372 | 442 |
| 617 | 3300028379 | Ga0268266_10000186 | Ga0268266_1000018643 | 442 |
| 618 | 3300028379 | Ga0268266_10026764 | Ga0268266_100267645 | 442 |
| 619 | 3300028380 | Ga0268265_10027723 | Ga0268265_100277233 | 442 |
| 620 | 3300028381 | Ga0268264_10011459 | Ga0268264_100114594 | 442 |
| 621 | 3300028381 | Ga0268264_10066433 | Ga0268264_100664332 | 442 |
| 622 | 3300037312 | Ga0395899_0000700 | Ga0395899_0000700_12653_14059 | 442 |
| 623 | 3300037312 | Ga0395899_0001530 | Ga0395899_0001530_937_2343 | 442 |
| 624 | 3300037312 | Ga0395899_0012272 | Ga0395899_0012272_985_2391 | 442 |
| 625 | 3300037312 | Ga0395899_0082210 | Ga0395899_0082210_386_1792 | 442 |
| 626 | 3300037312 | Ga0395899_0089319 | Ga0395899_0089319_551_1957 | 442 |
| 627 | 3300037418 | Ga0395900_0000238 | Ga0395900_0000238_49966_51372 | 442 |
| 628 | 3300037418 | Ga0395900_0011114 | Ga0395900_0011114_2045_3451 | 442 |
| 629 | 3300037418 | Ga0395900_0011835 | Ga0395900_0011835_1902_3308 | 442 |
| 630 | 3300037418 | Ga0395900_0013648 | Ga0395900_0013648_2348_3754 | 442 |
| 631 | 3300037418 | Ga0395900_0014002 | Ga0395900_0014002_544_1950 | 442 |
| 632 | 3300037418 | Ga0395900_0022863 | Ga0395900_0022863_1116_2522 | 442 |
| 633 | 3300037418 | Ga0395900_0023959 | Ga0395900_0023959_3362_4768 | 442 |
| 634 | 3300037418 | Ga0395900_0029522 | Ga0395900_0029522_2862_4268 | 442 |
| 635 | 3300037418 | Ga0395900_0033108 | Ga0395900_0033108_1961_3367 | 442 |
| 636 | 3300037418 | Ga0395900_0055551 | Ga0395900_0055551_1012_2418 | 442 |
| 637 | 3300037418 | Ga0395900_0074913 | Ga0395900_0074913_1617_3023 | 442 |
| 638 | 3300037418 | Ga0395900_0102201 | Ga0395900_0102201_666_2072 | 442 |
| 639 | 3300037418 | Ga0395900_0120486 | Ga0395900_0120486_826_2238 | 442 |
| 640 | 3300037466 | Ga0395898_0000245 | Ga0395898_0000245_61448_62854 | 442 |
| 641 | 3300037466 | Ga0395898_0036104 | Ga0395898_0036104_1468_2874 | 442 |
| 642 | 3300037471 | Ga0395905_0000006 | Ga0395905_0000006_141512_142918 | 442 |
| 643 | 3300037471 | Ga0395905_0001992 | Ga0395905_0001992_5678_7084 | 442 |
| 644 | 3300037471 | Ga0395905_0002904 | Ga0395905_0002904_10878_12284 | 442 |
| 645 | 3300037471 | Ga0395905_0004078 | Ga0395905_0004078_442_1848 | 442 |
| 646 | 3300037471 | Ga0395905_0004250 | Ga0395905_0004250_3675_5081 | 442 |
| 647 | 3300037471 | Ga0395905_0012036 | Ga0395905_0012036_6526_7932 | 442 |
| 648 | 3300037471 | Ga0395905_0013442 | Ga0395905_0013442_2949_4358 | 442 |
| 649 | 3300037471 | Ga0395905_0021293 | Ga0395905_0021293_2861_4267 | 442 |
| 650 | 3300037471 | Ga0395905_0066247 | Ga0395905_0066247_848_2254 | 442 |
| 651 | 3300037471 | Ga0395905_0108390 | Ga0395905_0108390_812_2218 | 442 |
| 652 | 3300037471 | Ga0395905_0111970 | Ga0395905_0111970_270_1676 | 442 |
| 653 | 3300037471 | Ga0395905_0235237 | Ga0395905_0235237_272_1684 | 442 |
| 654 | 3300038443 | Ga0395901_0000156 | Ga0395901_0000156_34280_35686 | 442 |
| 655 | 3300038443 | Ga0395901_0008535 | Ga0395901_0008535_6603_8009 | 442 |
| 656 | 3300038443 | Ga0395901_0069527 | Ga0395901_0069527_1278_2687 | 442 |
| 657 | 3300038443 | Ga0395901_0081122 | Ga0395901_0081122_1408_2814 | 442 |
| 658 | 3300038443 | Ga0395901_0085911 | Ga0395901_0085911_1062_2474 | 442 |
| 659 | 3300038443 | Ga0395901_0088865 | Ga0395901_0088865_35_1441 | 442 |
| 660 | 3300038443 | Ga0395901_0099564 | Ga0395901_0099564_1559_2965 | 442 |
| 661 | 3300039437 | Ga0436365_1817329 | Ga0436365_1817329_623_2029 | 442 |
| 662 | 3300042005 | Ga0439448_0001509 | Ga0439448_0001509_201_1607 | 442 |
| 663 | 3300042012 | Ga0439455_0008558 | Ga0439455_0008558_113_1519 | 442 |
| 664 | 3300042157 | Ga0439458_0000161 | Ga0439458_0000161_13139_14545 | 442 |
| 665 | 3300042157 | Ga0439458_0000449 | Ga0439458_0000449_5799_7205 | 442 |
| 666 | 3300046460 | Ga0495638_0001888 | Ga0495638_0001888_3257_4645 | 442 |
| 667 | 3300046507 | Ga0495606_0090117 | Ga0495606_0090117_138_1526 | 442 |
| 668 | 3300046660 | Ga0495625_0000064 | Ga0495625_0000064_136261_137646 | 442 |
| 669 | 3300046691 | Ga0495670_0032603 | Ga0495670_0032603_928_2361 | 442 |
| 670 | 3300048905 | Ga0496102_0170594 | Ga0496102_0170594_71_1477 | 442 |
| 671 | 3300048906 | Ga0496103_0012628 | Ga0496103_0012628_3450_4856 | 442 |
| 672 | 3300048910 | Ga0496107_0006696 | Ga0496107_0006696_6082_7488 | 442 |
| 673 | 3300048911 | Ga0496108_0012594 | Ga0496108_0012594_789_2195 | 442 |
| 674 | 3300048911 | Ga0496108_0024692 | Ga0496108_0024692_2334_3740 | 442 |
| 675 | 3300048912 | Ga0496109_0080123 | Ga0496109_0080123_1028_2434 | 442 |
| 676 | 3300048913 | Ga0496110_0013306 | Ga0496110_0013306_2339_3745 | 442 |
| 677 | 3300048913 | Ga0496110_0021896 | Ga0496110_0021896_523_1929 | 442 |
| 678 | 3300048914 | Ga0496111_0031128 | Ga0496111_0031128_1751_3157 | 442 |
| 679 | 3300048915 | Ga0496112_0024638 | Ga0496112_0024638_2902_4308 | 442 |
| 680 | 3300048917 | Ga0496114_0000021 | Ga0496114_0000021_73945_75351 | 442 |
| 681 | 3300050515 | nmdc:mga0a205_9502_c1 | nmdc:mga0a205_9502_c1_1784_3190 | 442 |
| 682 | 3300005355 | Ga0070671_100084037 | Ga0070671_1000840372 | 443 |
| 683 | 3300005459 | Ga0068867_100185083 | Ga0068867_1001850831 | 443 |
| 684 | 3300005618 | Ga0068864_100004504 | Ga0068864_10000450411 | 443 |
| 685 | 3300005842 | Ga0068858_100000313 | Ga0068858_10000031310 | 443 |
| 686 | 3300009177 | Ga0105248_10009109 | Ga0105248_1000910910 | 443 |
| 687 | 3300015690 | Ga0183363_1001 | Ga0183363_1001482 | 443 |
| 688 | 3300025941 | Ga0207711_10005454 | Ga0207711_100054541 | 443 |
| 689 | 3300026035 | Ga0207703_10000961 | Ga0207703_1000096110 | 443 |
| 690 | 3300033180 | Ga0307510_10005870 | Ga0307510_100058706 | 443 |
| 691 | 3300046506 | Ga0495583_0025207 | Ga0495583_0025207_1220_2620 | 443 |
| 692 | 3300046616 | Ga0495668_0016495 | Ga0495668_0016495_1582_2982 | 443 |
| 693 | 3300046660 | Ga0495625_0010290 | Ga0495625_0010290_2436_3836 | 443 |
| 694 | 3300048915 | Ga0496112_0092528 | Ga0496112_0092528_329_1738 | 443 |
| 695 | 3300053087 | Ga0500643_009852 | Ga0500643_009852_1591_2991 | 443 |
| 696 | 3300001915 | JGI24741J21665_1001717 | JGI24741J21665_10017175 | 444 |
| 697 | 3300001990 | JGI24737J22298_10001348 | JGI24737J22298_100013488 | 444 |
| 698 | 3300001990 | JGI24737J22298_10004346 | JGI24737J22298_100043462 | 444 |
| 699 | 3300003214 | JGI25165J46597_1000032 | JGI25165J46597_1000032208 | 444 |
| 700 | 3300003215 | JGI25153J46596_10000006 | JGI25153J46596_10000006374 | 444 |
| 701 | 3300005327 | Ga0070658_10007750 | Ga0070658_100077509 | 444 |
| 702 | 3300005367 | Ga0070667_100097370 | Ga0070667_1000973701 | 444 |
| 703 | 3300005455 | Ga0070663_100059657 | Ga0070663_1000596572 | 444 |
| 704 | 3300005457 | Ga0070662_100108027 | Ga0070662_1001080271 | 444 |
| 705 | 3300005548 | Ga0070665_100000086 | Ga0070665_100000086143 | 444 |
| 706 | 3300005564 | Ga0070664_100117168 | Ga0070664_1001171681 | 444 |
| 707 | 3300005834 | Ga0068851_10095169 | Ga0068851_100951691 | 444 |
| 708 | 3300009174 | Ga0105241_10008325 | Ga0105241_100083253 | 444 |
| 709 | 3300013102 | Ga0157371_10000097 | Ga0157371_1000009770 | 444 |
| 710 | 3300025233 | Ga0209437_101732 | Ga0209437_1017325 | 444 |
| 711 | 3300025261 | Ga0209233_1000066 | Ga0209233_1000066209 | 444 |
| 712 | 3300025297 | Ga0209758_1000001 | Ga0209758_10000011453 | 444 |
| 713 | 3300025904 | Ga0207647_10041001 | Ga0207647_100410014 | 444 |
| 714 | 3300025909 | Ga0207705_10006608 | Ga0207705_100066081 | 444 |
| 715 | 3300025914 | Ga0207671_10009431 | Ga0207671_100094315 | 444 |
| 716 | 3300025919 | Ga0207657_10019079 | Ga0207657_100190795 | 444 |
| 717 | 3300025920 | Ga0207649_10003137 | Ga0207649_100031377 | 444 |
| 718 | 3300025924 | Ga0207694_10007758 | Ga0207694_100077584 | 444 |
| 719 | 3300025933 | Ga0207706_10056151 | Ga0207706_100561514 | 444 |
| 720 | 3300025949 | Ga0207667_10000010 | Ga0207667_10000010317 | 444 |
| 721 | 3300025981 | Ga0207640_10015707 | Ga0207640_100157072 | 444 |
| 722 | 3300025986 | Ga0207658_10075142 | Ga0207658_100751424 | 444 |
| 723 | 3300026067 | Ga0207678_10008718 | Ga0207678_100087185 | 444 |
| 724 | 3300026078 | Ga0207702_10001740 | Ga0207702_1000174019 | 444 |
| 725 | 3300026116 | Ga0207674_10012021 | Ga0207674_100120217 | 444 |
| 726 | 3300026142 | Ga0207698_10005136 | Ga0207698_100051366 | 444 |
| 727 | 3300028379 | Ga0268266_10000002 | Ga0268266_100000022417 | 444 |
| 728 | 3300031456 | Ga0307513_10016487 | Ga0307513_100164879 | 444 |
| 729 | 3300033180 | Ga0307510_10120323 | Ga0307510_101203232 | 444 |
| 730 | 3300046471 | Ga0495650_0000467 | Ga0495650_0000467_26173_27585 | 444 |
| 731 | 3300046491 | Ga0495584_0020786 | Ga0495584_0020786_1650_3062 | 444 |
| 732 | 3300046492 | Ga0495585_0031886 | Ga0495585_0031886_749_2161 | 444 |
| 733 | 3300046506 | Ga0495583_0002885 | Ga0495583_0002885_8971_10383 | 444 |
| 734 | 3300046506 | Ga0495583_0008879 | Ga0495583_0008879_3796_5208 | 444 |
| 735 | 3300046507 | Ga0495606_0000434 | Ga0495606_0000434_56200_57612 | 444 |
| 736 | 3300046522 | Ga0495643_0002587 | Ga0495643_0002587_12545_13957 | 444 |
| 737 | 3300046522 | Ga0495643_0011683 | Ga0495643_0011683_670_2082 | 444 |
| 738 | 3300046524 | Ga0495648_0000256 | Ga0495648_0000256_36276_37688 | 444 |
| 739 | 3300046525 | Ga0495663_0011587 | Ga0495663_0011587_148_1560 | 444 |
| 740 | 3300046528 | Ga0495642_0023658 | Ga0495642_0023658_442_1854 | 444 |
| 741 | 3300046557 | Ga0495622_0013680 | Ga0495622_0013680_1081_2493 | 444 |
| 742 | 3300046558 | Ga0495633_0004258 | Ga0495633_0004258_835_2247 | 444 |
| 743 | 3300046616 | Ga0495668_0000163 | Ga0495668_0000163_53971_55383 | 444 |
| 744 | 3300046616 | Ga0495668_0046072 | Ga0495668_0046072_87_1499 | 444 |
| 745 | 3300046648 | Ga0495611_0037567 | Ga0495611_0037567_324_1736 | 444 |
| 746 | 3300046660 | Ga0495625_0000424 | Ga0495625_0000424_30979_32391 | 444 |
| 747 | 3300046660 | Ga0495625_0023460 | Ga0495625_0023460_1293_2705 | 444 |
| 748 | 3300046684 | Ga0495669_0000334 | Ga0495669_0000334_2002_3414 | 444 |
| 749 | 3300046694 | Ga0495649_0049440 | Ga0495649_0049440_563_1975 | 444 |
| 750 | 3300046809 | Ga0495600_0000343 | Ga0495600_0000343_22433_23845 | 444 |
| 751 | 3300047323 | Ga0495683_0039113 | Ga0495683_0039113_897_2309 | 444 |
| 752 | 3300047323 | Ga0495683_0071516 | Ga0495683_0071516_198_1610 | 444 |
| 753 | 3300047443 | Ga0495687_000557 | Ga0495687_000557_27108_28520 | 444 |
| 754 | 3300047443 | Ga0495687_000933 | Ga0495687_000933_12644_14056 | 444 |
| 755 | 3300047470 | Ga0495681_0024192 | Ga0495681_0024192_369_1781 | 444 |
| 756 | 3300047472 | Ga0495686_0079207 | Ga0495686_0079207_606_1991 | 444 |
| 757 | 3300048905 | Ga0496102_0001183 | Ga0496102_0001183_369_1781 | 444 |
| 758 | 3300048906 | Ga0496103_0000335 | Ga0496103_0000335_20552_21964 | 444 |
| 759 | 3300048907 | Ga0496104_0015207 | Ga0496104_0015207_4445_5857 | 444 |
| 760 | 3300048908 | Ga0496105_0000773 | Ga0496105_0000773_6352_7764 | 444 |
| 761 | 3300048913 | Ga0496110_0036892 | Ga0496110_0036892_704_2116 | 444 |
| 762 | 3300048914 | Ga0496111_0018292 | Ga0496111_0018292_2901_4313 | 444 |
| 763 | 3300048916 | Ga0496113_0035258 | Ga0496113_0035258_964_2376 | 444 |
| 764 | 3300048918 | Ga0496115_0000172 | Ga0496115_0000172_38050_39462 | 444 |
| 765 | 3300048919 | Ga0496116_0007730 | Ga0496116_0007730_7640_9052 | 444 |
| 766 | 3300048920 | Ga0496117_0000582 | Ga0496117_0000582_38207_39619 | 444 |
| 767 | 3300048921 | Ga0496118_0002822 | Ga0496118_0002822_20629_22041 | 444 |
| 768 | 3300048922 | Ga0496119_0002551 | Ga0496119_0002551_4214_5626 | 444 |
| 769 | 3300048924 | Ga0496121_0001258 | Ga0496121_0001258_21895_23307 | 444 |
| 770 | 3300048925 | Ga0496122_0036178 | Ga0496122_0036178_926_2338 | 444 |
| 771 | 3300048927 | Ga0496124_0000606 | Ga0496124_0000606_20587_21999 | 444 |
| 772 | 3300048928 | Ga0496125_0000666 | Ga0496125_0000666_38672_40084 | 444 |
| 773 | 3300048929 | Ga0496126_0001153 | Ga0496126_0001153_20456_21868 | 444 |
| 774 | 3300053079 | Ga0500610_0003524 | Ga0500610_0003524_2130_3542 | 444 |
| 775 | 3300053119 | Ga0500595_000235 | Ga0500595_000235_28672_30084 | 444 |
| 776 | 3300053177 | Ga0500636_0005698 | Ga0500636_0005698_5616_7028 | 444 |
| 777 | 3300053730 | Ga0500645_000170 | Ga0500645_000170_2097_3509 | 444 |
| 778 | 3300049579 | Ga0501043_0052116 | Ga0501043_0052116_864_2249 | 445 |
| 779 | 3300005331 | Ga0070670_100000051 | Ga0070670_10000005194 | 446 |
| 780 | 3300005367 | Ga0070667_100000418 | Ga0070667_1000004189 | 446 |
| 781 | 3300005617 | Ga0068859_100138543 | Ga0068859_1001385433 | 446 |
| 782 | 3300005618 | Ga0068864_100000004 | Ga0068864_100000004115 | 446 |
| 783 | 3300005841 | Ga0068863_100000002 | Ga0068863_100000002115 | 446 |
| 784 | 3300005844 | Ga0068862_100000002 | Ga0068862_100000002386 | 446 |
| 785 | 3300006931 | Ga0097620_100138535 | Ga0097620_1001385352 | 446 |
| 786 | 3300009011 | Ga0105251_10002895 | Ga0105251_1000289510 | 446 |
| 787 | 3300009177 | Ga0105248_10000010 | Ga0105248_10000010230 | 446 |
| 788 | 3300009553 | Ga0105249_10000041 | Ga0105249_1000004182 | 446 |
| 789 | 3300014968 | Ga0157379_10288073 | Ga0157379_102880731 | 446 |
| 790 | 3300025735 | Ga0207713_1005772 | Ga0207713_10057727 | 446 |
| 791 | 3300025925 | Ga0207650_10000083 | Ga0207650_1000008377 | 446 |
| 792 | 3300025941 | Ga0207711_10000035 | Ga0207711_1000003567 | 446 |
| 793 | 3300025961 | Ga0207712_10000460 | Ga0207712_1000046023 | 446 |
| 794 | 3300025986 | Ga0207658_10000575 | Ga0207658_100005755 | 446 |
| 795 | 3300026088 | Ga0207641_10000002 | Ga0207641_10000002596 | 446 |
| 796 | 3300026095 | Ga0207676_10000005 | Ga0207676_10000005211 | 446 |
| 797 | 3300028380 | Ga0268265_10000003 | Ga0268265_10000003393 | 446 |
| 798 | 3300048921 | Ga0496118_0001620 | Ga0496118_0001620_28555_29940 | 446 |
| 799 | 3300005578 | Ga0068854_100127969 | Ga0068854_1001279691 | 448 |
| 800 | 3300025933 | Ga0207706_10146686 | Ga0207706_101466862 | 448 |
| 801 | 3300026041 | Ga0207639_10015675 | Ga0207639_100156753 | 448 |
| 802 | 3300026116 | Ga0207674_10211466 | Ga0207674_102114662 | 448 |
| 803 | 3300001904 | JGI24736J21556_1000462 | JGI24736J21556_10004626 | 451 |
| 804 | 3300001904 | JGI24736J21556_1000548 | JGI24736J21556_10005488 | 451 |
| 805 | 3300001976 | JGI24752J21851_1000063 | JGI24752J21851_100006316 | 451 |
| 806 | 3300001979 | JGI24740J21852_10006244 | JGI24740J21852_100062443 | 451 |
| 807 | 3300001989 | JGI24739J22299_10002661 | JGI24739J22299_100026613 | 451 |
| 808 | 3300001990 | JGI24737J22298_10004813 | JGI24737J22298_100048134 | 451 |
| 809 | 3300002074 | JGI24748J21848_1000101 | JGI24748J21848_100010114 | 451 |
| 810 | 3300002076 | JGI24749J21850_1002872 | JGI24749J21850_10028722 | 451 |
| 811 | 3300002239 | JGI24034J26672_10000034 | JGI24034J26672_1000003483 | 451 |
| 812 | 3300005327 | Ga0070658_10004220 | Ga0070658_1000422012 | 451 |
| 813 | 3300005330 | Ga0070690_100000068 | Ga0070690_10000006825 | 451 |
| 814 | 3300005335 | Ga0070666_10000002 | Ga0070666_10000002146 | 451 |
| 815 | 3300005340 | Ga0070689_100004818 | Ga0070689_1000048184 | 451 |
| 816 | 3300005344 | Ga0070661_100070617 | Ga0070661_1000706172 | 451 |
| 817 | 3300005353 | Ga0070669_100000229 | Ga0070669_10000022912 | 451 |
| 818 | 3300005466 | Ga0070685_10000337 | Ga0070685_1000033713 | 451 |
| 819 | 3300005544 | Ga0070686_100000003 | Ga0070686_100000003221 | 451 |
| 820 | 3300005548 | Ga0070665_100000036 | Ga0070665_100000036192 | 451 |
| 821 | 3300005617 | Ga0068859_100024066 | Ga0068859_1000240662 | 451 |
| 822 | 3300005618 | Ga0068864_100021357 | Ga0068864_1000213573 | 451 |
| 823 | 3300005719 | Ga0068861_100036033 | Ga0068861_1000360334 | 451 |
| 824 | 3300005834 | Ga0068851_10021662 | Ga0068851_100216623 | 451 |
| 825 | 3300005841 | Ga0068863_100000034 | Ga0068863_100000034135 | 451 |
| 826 | 3300005842 | Ga0068858_100021876 | Ga0068858_1000218766 | 451 |
| 827 | 3300005843 | Ga0068860_100000001 | Ga0068860_100000001147 | 451 |
| 828 | 3300005844 | Ga0068862_100001230 | Ga0068862_10000123019 | 451 |
| 829 | 3300006931 | Ga0097620_100024066 | Ga0097620_1000240662 | 451 |
| 830 | 3300009177 | Ga0105248_10038152 | Ga0105248_100381524 | 451 |
| 831 | 3300009553 | Ga0105249_10000026 | Ga0105249_10000026146 | 451 |
| 832 | 3300013104 | Ga0157370_10063152 | Ga0157370_100631522 | 451 |
| 833 | 3300013306 | Ga0163162_10045432 | Ga0163162_100454322 | 451 |
| 834 | 3300014326 | Ga0157380_10007826 | Ga0157380_100078262 | 451 |
| 835 | 3300017792 | Ga0163161_10000008 | Ga0163161_10000008161 | 451 |
| 836 | 3300025321 | Ga0207656_10021949 | Ga0207656_100219492 | 451 |
| 837 | 3300025903 | Ga0207680_10000004 | Ga0207680_10000004713 | 451 |
| 838 | 3300025904 | Ga0207647_10009220 | Ga0207647_100092206 | 451 |
| 839 | 3300025911 | Ga0207654_10002556 | Ga0207654_100025568 | 451 |
| 840 | 3300025913 | Ga0207695_10035013 | Ga0207695_100350133 | 451 |
| 841 | 3300025914 | Ga0207671_10012841 | Ga0207671_100128414 | 451 |
| 842 | 3300025923 | Ga0207681_10000178 | Ga0207681_1000017836 | 451 |
| 843 | 3300025924 | Ga0207694_10020747 | Ga0207694_100207472 | 451 |
| 844 | 3300025931 | Ga0207644_10000570 | Ga0207644_100005704 | 451 |
| 845 | 3300025936 | Ga0207670_10006452 | Ga0207670_100064527 | 451 |
| 846 | 3300025949 | Ga0207667_10005836 | Ga0207667_1000583615 | 451 |
| 847 | 3300025961 | Ga0207712_10000001 | Ga0207712_10000001587 | 451 |
| 848 | 3300026035 | Ga0207703_10002971 | Ga0207703_100029712 | 451 |
| 849 | 3300026078 | Ga0207702_10010297 | Ga0207702_100102973 | 451 |
| 850 | 3300026088 | Ga0207641_10000057 | Ga0207641_10000057133 | 451 |
| 851 | 3300026095 | Ga0207676_10001402 | Ga0207676_1000140211 | 451 |
| 852 | 3300026118 | Ga0207675_100001962 | Ga0207675_1000019625 | 451 |
| 853 | 3300026142 | Ga0207698_10079654 | Ga0207698_100796542 | 451 |
| 854 | 3300028379 | Ga0268266_10000042 | Ga0268266_10000042147 | 451 |
| 855 | 3300028380 | Ga0268265_10000233 | Ga0268265_1000023352 | 451 |
| 856 | 3300028381 | Ga0268264_10000006 | Ga0268264_10000006713 | 451 |
| 857 | 3300048904 | Ga0496101_0155765 | Ga0496101_0155765_347_1732 | 451 |
| 858 | 3300048906 | Ga0496103_0001645 | Ga0496103_0001645_11573_12958 | 451 |
| 859 | 3300048910 | Ga0496107_0067092 | Ga0496107_0067092_419_1804 | 451 |
| 860 | 3300048920 | Ga0496117_0046513 | Ga0496117_0046513_1240_2625 | 451 |
| 861 | 3300048924 | Ga0496121_0029837 | Ga0496121_0029837_416_1801 | 451 |
| 862 | 3300048927 | Ga0496124_0134340 | Ga0496124_0134340_137_1522 | 451 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3iib-assembly1.cif.gz_A-2 | crystal structure of peptidase m28 precursor (yp_926796.1) from shewanella amazonensis sb2b at 1.70 a resolution | 0.9672 | 22 | 447 |
| 3iib-assembly1.cif.gz_A-2 | crystal structure of peptidase m28 precursor (yp_926796.1) from shewanella amazonensis sb2b at 1.70 a resolution | 0.9308 | 22 | 447 |
| 2imo-assembly1.cif.gz_B | crystal structure of allantoate amidohydrolase from escherichia coli at ph 4.6 | 0.8721 | 248 | 325 |
| 1z2l-assembly1.cif.gz_B | crystal structure of allantoate-amidohydrolase from e.coli k12 in complex with substrate allantoate | 0.8538 | 248 | 315 |
| 2imo-assembly1.cif.gz_A | crystal structure of allantoate amidohydrolase from escherichia coli at ph 4.6 | 0.8374 | 247 | 315 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3iibA02 | Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1; | 0.9401 | 89 | 238 | 3.50.30.30 |
| 3iibA02 | Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1; | 0.934 | 89 | 238 | 3.50.30.30 |
| 3iibA01 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases | 0.9294 | 22 | 437 | 3.40.630.10 |
| af_Q54MN6_157_296_3.40.630.10 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases | 0.8888 | 89 | 238 | 3.40.630.10 |
| af_Q54MN6_157_296_3.40.630.10 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases | 0.8829 | 89 | 238 | 3.40.630.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7U0IZZ0-F1-model_v4 | deleted | 0.9868 | 43 | 442 |
|
| AF-A0A4Q2Z542-F1-model_v4 | Carboxypeptidase Q (Plasma glutamate carboxypeptidase) | 0.9849 | 14 | 304 |
GO:0004180
GO:0005576 GO:0005764 GO:0070573 |
| AF-A0A1Q3V4D6-F1-model_v4 | Carboxypeptidase Q (Plasma glutamate carboxypeptidase) | 0.9845 | 96 | 443 |
GO:0004180
GO:0005576 GO:0005764 GO:0070573 |
| AF-A0A2W4YSJ0-F1-model_v4 | deleted | 0.9832 | 27 | 285 |
|
| AF-A0A258CMX4-F1-model_v4 | Carboxypeptidase Q (Plasma glutamate carboxypeptidase) | 0.9825 | 301 | 443 |
GO:0004180
GO:0005576 GO:0005764 GO:0070573 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar