F483753

General Info

Members Datasets Scaffolds Average Seq Length
858 359 851 294

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0004775|Ga0501034_0004775_4879_5826
Length 315
Sequence VRPNSSFFRNSLFSFSIVTPSDFQAWAAAGQQRIETFLQHVLPQPDIAPQRLHAAMRYAVLGAGKRVRPLLAYAAGELSQADPERVTVAGAAVEIIHAYSLVHDDLPCMDDDVLRRGKPTCHVEFDEPTALLVGDALQSLSFQLLGEYRLADDAGAQLEMVKLLAAAAGSRGMAGGQAIDLAAVGKTLSVPELEFMHIHKTGALIRAAAVLGARCGSGLNESEFAHVDTFAKAVGLAFQVVDDVLDAEAPTATLGKTAGKDAEQGKPTYVSAMGITRARTLAGELREEALKAIAPFGARGARLAQLADFIVLRKF

Samples

Sample ID Description Type Environment
1 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified
2 2547132512 Azospira oryzae 6a3 Isolate Unclassified
3 2843690924 Chromobacterium rhizoryzae JP2-74 Isolate Rhizosphere
4 2846037992 Chromobacterium alticapitis MWU14-2602 Isolate Rhizosphere
5 2857558681 Duganella sp. R-74565 Isolate Unclassified
6 2904424332 Duganella sp. 1411 Isolate Rhizosphere
7 2998344455 Vogesella urethralis SLBN-145 Isolate Rhizosphere
8 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
37 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
38 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
39 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
40 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
41 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
42 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
43 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
44 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
45 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
46 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
47 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
48 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
49 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
50 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
51 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
52 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
53 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
54 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
55 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
56 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
57 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
58 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
59 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
60 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
61 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
62 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
63 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
64 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
65 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
66 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
67 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
68 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
69 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
70 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
71 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
72 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
73 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
74 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
75 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
76 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
77 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
78 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
79 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
80 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
81 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
82 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
83 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
84 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
85 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
87 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
88 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
89 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
90 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
91 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
92 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
93 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
94 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
95 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
97 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
98 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
99 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
101 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
102 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
103 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
104 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
105 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
106 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
107 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
108 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
109 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
110 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
111 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
112 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
113 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
114 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
115 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
116 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
117 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
118 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
119 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
120 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
121 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
122 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
123 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
124 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
125 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
126 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
127 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
195 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
199 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
200 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
201 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
202 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
203 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
204 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
205 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
206 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
207 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
208 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
209 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
210 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
211 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
212 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
213 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
214 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
215 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
216 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
217 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
218 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
219 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
220 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
221 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
222 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
223 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
224 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
225 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
226 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
227 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
228 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
229 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
230 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
231 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
232 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
233 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
234 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
235 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
236 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
237 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
238 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
239 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
240 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
241 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
242 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
243 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
244 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
245 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
246 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
247 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
248 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
249 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
250 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
251 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
252 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
253 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
254 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
255 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
256 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
257 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
258 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
259 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
260 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
261 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
262 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
263 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
264 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
265 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
266 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
267 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
268 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
269 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
270 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
271 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
272 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
273 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
274 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
275 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
276 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
277 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
278 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
279 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
280 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
281 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
282 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
283 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
284 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
285 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
286 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
287 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
288 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
289 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
290 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
291 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
292 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
293 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
294 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
295 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
296 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
297 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
298 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
299 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
300 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
301 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
302 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
303 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
304 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
305 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
306 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
307 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
308 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
309 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
310 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
311 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
312 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
313 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
314 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
315 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
316 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
317 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
318 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
319 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
320 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
321 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
322 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
323 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
324 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
325 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
326 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
327 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
328 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
329 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
330 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
331 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
332 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
333 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
334 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
335 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
336 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
337 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
338 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
339 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
340 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
341 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
342 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
343 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
344 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
345 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
346 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
347 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
348 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
349 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
350 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
351 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
352 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
353 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
354 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
355 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
356 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
357 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
358 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
359 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.18
Metatranscriptomes 0
Isolates 0.82

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.93
Nodule 0
Rhizoplane 3.38
Rhizosphere 94.41
Stem 0
Stem Tuber 0
Unclassified 1.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055529_1001152 3300003763 Bacteria 11088
2 Ga0065712_10078545 3300005290 Bacteria 3332
3 Ga0070658_10006078 3300005327 Bacteria 9790
4 Ga0070658_10014263 3300005327 Bacteria 6376
5 Ga0070658_10292253 3300005327 Bacteria 1389
6 Ga0070676_10083905 3300005328 Bacteria 1939
7 Ga0070683_100001788 3300005329 Bacteria 16752
8 Ga0070683_100086367 3300005329 Bacteria 2941
9 Ga0070683_100408010 3300005329 Bacteria 1296
10 Ga0070690_100004680 3300005330 Bacteria 7626
11 Ga0070690_100021086 3300005330 Bacteria 3975
12 Ga0070690_100047414 3300005330 Bacteria 2734
13 Ga0070670_100000732 3300005331 Bacteria 25485
14 Ga0070670_100019332 3300005331 Bacteria 5844
15 Ga0070670_100025573 3300005331 Bacteria 5078
16 Ga0070670_100328728 3300005331 Bacteria 1340
17 Ga0070677_10057910 3300005333 Bacteria 1589
18 Ga0068869_100005486 3300005334 Bacteria 7981
19 Ga0068869_100075504 3300005334 Bacteria 2504
20 Ga0068869_100076604 3300005334 Bacteria 2486
21 Ga0070666_10020043 3300005335 Bacteria 4320
22 Ga0070680_100077278 3300005336 Bacteria 2742
23 Ga0070682_100012218 3300005337 Bacteria 4917
24 Ga0068868_100000144 3300005338 Bacteria 46092
25 Ga0068868_100009584 3300005338 Bacteria 6981
26 Ga0068868_100036103 3300005338 Bacteria 3824
27 Ga0068868_100061532 3300005338 Bacteria 2974
28 Ga0070660_100124427 3300005339 Bacteria 2060
29 Ga0070689_100003377 3300005340 Bacteria 10612
30 Ga0070689_100034210 3300005340 Bacteria 3877
31 Ga0070689_100146638 3300005340 Bacteria 1901
32 Ga0070689_100178636 3300005340 Bacteria 1723
33 Ga0070691_10014877 3300005341 Bacteria 3572
34 Ga0070687_100025518 3300005343 Bacteria 2836
35 Ga0070687_100069063 3300005343 Bacteria 1891
36 Ga0070687_100115196 3300005343 Bacteria 1528
37 Ga0070661_100000601 3300005344 Bacteria 26884
38 Ga0070661_100019649 3300005344 Bacteria 4813
39 Ga0070692_10060371 3300005345 Bacteria 1996
40 Ga0070668_100001724 3300005347 Bacteria 15891
41 Ga0070668_100068947 3300005347 Bacteria 2750
42 Ga0070668_100119513 3300005347 Bacteria 2105
43 Ga0070669_100011126 3300005353 Bacteria 6386
44 Ga0070675_100003810 3300005354 Bacteria 11450
45 Ga0070675_100026322 3300005354 Bacteria 4669
46 Ga0070675_100121920 3300005354 Bacteria 2215
47 Ga0070671_100001156 3300005355 Bacteria 19640
48 Ga0070671_100018208 3300005355 Bacteria 5702
49 Ga0070671_100368300 3300005355 Bacteria 1227
50 Ga0070674_100029925 3300005356 Bacteria 3595
51 Ga0070674_100067969 3300005356 Bacteria 2508
52 Ga0070673_100001260 3300005364 Bacteria 14710
53 Ga0070673_100001686 3300005364 Bacteria 13103
54 Ga0070673_100008218 3300005364 Bacteria 6929
55 Ga0070673_100037390 3300005364 Bacteria 3698
56 Ga0070688_100000431 3300005365 Bacteria 21145
57 Ga0070688_100106161 3300005365 Bacteria 1860
58 Ga0070659_100074768 3300005366 Bacteria 2700
59 Ga0070667_100032338 3300005367 Bacteria 4363
60 Ga0070667_100182385 3300005367 Bacteria 1857
61 Ga0070703_10018923 3300005406 Bacteria 1995
62 Ga0070703_10044178 3300005406 Bacteria 1400
63 Ga0070709_10057937 3300005434 Bacteria 2455
64 Ga0070709_10112717 3300005434 Bacteria 1830
65 Ga0070709_10201226 3300005434 Bacteria 1410
66 Ga0070714_100015547 3300005435 Bacteria 6122
67 Ga0070714_100050194 3300005435 Bacteria 3553
68 Ga0070714_100238897 3300005435 Bacteria 1676
69 Ga0070714_100264979 3300005435 Bacteria 1592
70 Ga0070713_100002492 3300005436 Bacteria 12025
71 Ga0070713_100087771 3300005436 Bacteria 2668
72 Ga0070701_10094082 3300005438 Bacteria 1648
73 Ga0070711_100002587 3300005439 Bacteria 10362
74 Ga0070705_100025920 3300005440 Bacteria 3186
75 Ga0070705_100173673 3300005440 Bacteria 1453
76 Ga0070700_100056967 3300005441 Bacteria 2451
77 Ga0070700_100185410 3300005441 Bacteria 1451
78 Ga0070700_100255082 3300005441 Bacteria 1260
79 Ga0070700_100380031 3300005441 Unclassified 1056
80 Ga0070694_100053962 3300005444 Bacteria 2722
81 Ga0070708_100020748 3300005445 Bacteria 5547
82 Ga0070663_100207376 3300005455 Bacteria 1533
83 Ga0070663_100238042 3300005455 Bacteria 1436
84 Ga0070678_100000019 3300005456 Bacteria 51607
85 Ga0070678_100079745 3300005456 Bacteria 2477
86 Ga0070678_100092645 3300005456 Bacteria 2322
87 Ga0070678_100196457 3300005456 Bacteria 1662
88 Ga0070662_100044204 3300005457 Bacteria 3190
89 Ga0070662_100138785 3300005457 Bacteria 1882
90 Ga0070681_10006660 3300005458 Bacteria 11245
91 Ga0070681_10075482 3300005458 Bacteria 3331
92 Ga0068867_100007906 3300005459 Bacteria 7514
93 Ga0068867_100026778 3300005459 Bacteria 4142
94 Ga0068867_100142867 3300005459 Bacteria 1872
95 Ga0070685_10000733 3300005466 Bacteria 17900
96 Ga0070685_10048220 3300005466 Bacteria 2452
97 Ga0070685_10136900 3300005466 Bacteria 1537
98 Ga0070706_100028196 3300005467 Bacteria 5168
99 Ga0070706_100037830 3300005467 Bacteria 4455
100 Ga0070706_100091409 3300005467 Bacteria 2823
101 Ga0070707_100012077 3300005468 Bacteria 8063
102 Ga0070707_100034979 3300005468 Bacteria 4790
103 Ga0070707_100145097 3300005468 Bacteria 2310
104 Ga0070698_100175897 3300005471 Bacteria 2080
105 Ga0070699_100006062 3300005518 Bacteria 10568
106 Ga0070699_100050568 3300005518 Bacteria 3598
107 Ga0070699_100071219 3300005518 Bacteria 3023
108 Ga0070679_100010085 3300005530 Bacteria 8952
109 Ga0070679_100015526 3300005530 Bacteria 7317
110 Ga0070679_100092317 3300005530 Bacteria 3015
111 Ga0070679_100509638 3300005530 Bacteria 1147
112 Ga0070684_100034952 3300005535 Bacteria 4299
113 Ga0070684_100057055 3300005535 Bacteria 3409
114 Ga0070684_100117514 3300005535 Bacteria 2390
115 Ga0070697_100030915 3300005536 Bacteria 4303
116 Ga0070697_100036887 3300005536 Bacteria 3948
117 Ga0068853_100074850 3300005539 Bacteria 2955
118 Ga0068853_100105607 3300005539 Bacteria 2495
119 Ga0068853_100116004 3300005539 Bacteria 2384
120 Ga0070672_100000151 3300005543 Bacteria 38113
121 Ga0070672_100028153 3300005543 Bacteria 4199
122 Ga0070672_100054868 3300005543 Bacteria 3120
123 Ga0070672_100154670 3300005543 Bacteria 1899
124 Ga0070672_100207337 3300005543 Bacteria 1641
125 Ga0070686_100025941 3300005544 Bacteria 3531
126 Ga0070686_100402778 3300005544 Bacteria 1041
127 Ga0070695_100018618 3300005545 Bacteria 4217
128 Ga0070695_100108342 3300005545 Bacteria 1881
129 Ga0070695_100112029 3300005545 Bacteria 1853
130 Ga0070696_100028401 3300005546 Bacteria 3818
131 Ga0070696_100156059 3300005546 Bacteria 1679
132 Ga0070696_100393929 3300005546 Bacteria 1082
133 Ga0070693_100045002 3300005547 Bacteria 2499
134 Ga0070693_100216139 3300005547 Bacteria 1253
135 Ga0070665_100072597 3300005548 Bacteria 3449
136 Ga0070665_100248437 3300005548 Bacteria 1779
137 Ga0070665_100397300 3300005548 Bacteria 1386
138 Ga0070704_100018546 3300005549 Bacteria 4452
139 Ga0070704_100158031 3300005549 Bacteria 1790
140 Ga0070704_100209581 3300005549 Bacteria 1578
141 Ga0070704_100226861 3300005549 Bacteria 1521
142 Ga0068855_100017466 3300005563 Bacteria 8629
143 Ga0068855_100043110 3300005563 Bacteria 5346
144 Ga0070664_100000957 3300005564 Bacteria 22562
145 Ga0070664_100083343 3300005564 Bacteria 2758
146 Ga0070664_100121536 3300005564 Bacteria 2287
147 Ga0068857_100021734 3300005577 Bacteria 5646
148 Ga0068854_100003057 3300005578 Bacteria 10409
149 Ga0068854_100003907 3300005578 Bacteria 9337
150 Ga0068854_100032222 3300005578 Bacteria 3644
151 Ga0068854_100122142 3300005578 Bacteria 1979
152 Ga0070702_100018030 3300005615 Bacteria 3653
153 Ga0070702_100023295 3300005615 Bacteria 3288
154 Ga0070702_100102043 3300005615 Bacteria 1762
155 Ga0068852_100000486 3300005616 Bacteria 25959
156 Ga0068852_100001134 3300005616 Bacteria 17618
157 Ga0068852_100014226 3300005616 Bacteria 6114
158 Ga0068852_100019290 3300005616 Bacteria 5394
159 Ga0068852_100084408 3300005616 Bacteria 2826
160 Ga0068852_100193310 3300005616 Bacteria 1921
161 Ga0068852_100195347 3300005616 Bacteria 1912
162 Ga0068852_100294908 3300005616 Bacteria 1568
163 Ga0068859_100007757 3300005617 Bacteria 10897
164 Ga0068859_100056838 3300005617 Bacteria 3940
165 Ga0068859_100060072 3300005617 Bacteria 3831
166 Ga0068859_100144063 3300005617 Bacteria 2457
167 Ga0068859_100149509 3300005617 Bacteria 2411
168 Ga0068864_100002543 3300005618 Bacteria 15058
169 Ga0068864_100007067 3300005618 Bacteria 9217
170 Ga0068864_100019099 3300005618 Bacteria 5729
171 Ga0068864_100020001 3300005618 Bacteria 5598
172 Ga0068864_100270224 3300005618 Bacteria 1584
173 Ga0068864_100275892 3300005618 Bacteria 1568
174 Ga0068861_100132928 3300005719 Bacteria 2021
175 Ga0068861_100281772 3300005719 Bacteria 1432
176 Ga0068851_10003401 3300005834 Bacteria 7083
177 Ga0068851_10012253 3300005834 Bacteria 4038
178 Ga0068870_10025360 3300005840 Bacteria 2942
179 Ga0068863_100004686 3300005841 Bacteria 13475
180 Ga0068863_100031587 3300005841 Bacteria 5052
181 Ga0068863_100138274 3300005841 Bacteria 2327
182 Ga0068863_100338383 3300005841 Bacteria 1464
183 Ga0068863_100438035 3300005841 Bacteria 1281
184 Ga0068858_100011845 3300005842 Bacteria 8221
185 Ga0068858_100026879 3300005842 Bacteria 5345
186 Ga0068858_100080458 3300005842 Bacteria 3027
187 Ga0068860_100070165 3300005843 Bacteria 3331
188 Ga0068860_100134448 3300005843 Bacteria 2375
189 Ga0068862_100004088 3300005844 Bacteria 12372
190 Ga0068862_100084972 3300005844 Bacteria 2749
191 Ga0070716_100113934 3300006173 Bacteria 1680
192 Ga0070712_100020319 3300006175 Bacteria 4345
193 Ga0075366_10007379 3300006195 Bacteria 6069
194 Ga0097621_100000274 3300006237 Bacteria 34921
195 Ga0097621_100010760 3300006237 Bacteria 6710
196 Ga0097621_100043537 3300006237 Bacteria 3619
197 Ga0097621_100051122 3300006237 Bacteria 3362
198 Ga0097621_100059537 3300006237 Bacteria 3127
199 Ga0097621_100166053 3300006237 Bacteria 1900
200 Ga0097621_100173157 3300006237 Bacteria 1861
201 Ga0075370_10059534 3300006353 Bacteria 2174
202 Ga0068871_100000325 3300006358 Bacteria 33222
203 Ga0068871_100009363 3300006358 Bacteria 7092
204 Ga0068871_100015986 3300006358 Bacteria 5637
205 Ga0068871_100067718 3300006358 Bacteria 2930
206 Ga0068871_100176340 3300006358 Bacteria 1835
207 Ga0068871_100247518 3300006358 Bacteria 1552
208 Ga0068871_100272829 3300006358 Bacteria 1478
209 Ga0068871_100306716 3300006358 Bacteria 1395
210 Ga0075428_100001689 3300006844 Bacteria 23548
211 Ga0075428_100011896 3300006844 Bacteria 9678
212 Ga0075430_100005251 3300006846 Bacteria 10922
213 Ga0075431_100008882 3300006847 Bacteria 10068
214 Ga0075433_10012283 3300006852 Bacteria 6908
215 Ga0075434_100073969 3300006871 Bacteria 3401
216 Ga0075434_100206615 3300006871 Bacteria 1984
217 Ga0075434_100635771 3300006871 Bacteria 1086
218 Ga0068865_100070682 3300006881 Bacteria 2473
219 Ga0068865_100084358 3300006881 Bacteria 2289
220 Ga0075436_100039459 3300006914 Bacteria 3259
221 Ga0075436_100070222 3300006914 Bacteria 2421
222 Ga0097620_100007756 3300006931 Bacteria 10897
223 Ga0097620_100056838 3300006931 Bacteria 3940
224 Ga0097620_100060072 3300006931 Bacteria 3831
225 Ga0097620_100144066 3300006931 Bacteria 2457
226 Ga0097620_100149502 3300006931 Bacteria 2411
227 Ga0075435_100027884 3300007076 Bacteria 4422
228 Ga0099795_10036243 3300007788 Bacteria 1730
229 Ga0105240_10006302 3300009093 Bacteria 17457
230 Ga0105240_10032013 3300009093 Bacteria 6811
231 Ga0105240_10043257 3300009093 Bacteria 5732
232 Ga0105240_10089300 3300009093 Bacteria 3770
233 Ga0105240_10103453 3300009093 Bacteria 3460
234 Ga0111539_10000486 3300009094 Bacteria 50337
235 Ga0111539_10001478 3300009094 Bacteria 31398
236 Ga0111539_10009420 3300009094 Bacteria 12324
237 Ga0111539_10009829 3300009094 Bacteria 12075
238 Ga0111539_10116543 3300009094 Bacteria 3132
239 Ga0105245_10174926 3300009098 Bacteria 2047
240 Ga0105245_10178699 3300009098 Bacteria 2026
241 Ga0105245_10328993 3300009098 Bacteria 1507
242 Ga0105245_10538542 3300009098 Bacteria 1188
243 Ga0105247_10050490 3300009101 Bacteria 2560
244 Ga0105247_10079192 3300009101 Bacteria 2067
245 Ga0105243_10136517 3300009148 Bacteria 2087
246 Ga0105241_10397108 3300009174 Bacteria 1208
247 Ga0105242_10014784 3300009176 Bacteria 6044
248 Ga0105242_10071578 3300009176 Bacteria 2878
249 Ga0105242_10203075 3300009176 Bacteria 1761
250 Ga0105242_10350381 3300009176 Bacteria 1363
251 Ga0105248_10006203 3300009177 Bacteria 13106
252 Ga0105248_10016620 3300009177 Bacteria 8101
253 Ga0105248_10036313 3300009177 Bacteria 5511
254 Ga0105248_10048319 3300009177 Bacteria 4773
255 Ga0105248_10063274 3300009177 Bacteria 4153
256 Ga0105248_10277813 3300009177 Bacteria 1886
257 Ga0105237_10049334 3300009545 Bacteria 4232
258 Ga0105238_10037056 3300009551 Bacteria 4959
259 Ga0105238_10054670 3300009551 Bacteria 4009
260 Ga0105238_10140287 3300009551 Bacteria 2394
261 Ga0105249_10065135 3300009553 Bacteria 3352
262 Ga0105239_10015480 3300010375 Bacteria 8449
263 Ga0105239_10098071 3300010375 Bacteria 3239
264 Ga0105239_10594107 3300010375 Bacteria 1262
265 Ga0105246_10069737 3300011119 Bacteria 2470
266 Ga0105246_10237224 3300011119 Bacteria 1440
267 Ga0157373_10047508 3300013100 Bacteria 3062
268 Ga0157373_10112473 3300013100 Bacteria 1914
269 Ga0157370_10016464 3300013104 Bacteria 7484
270 Ga0157370_10041460 3300013104 Bacteria 4440
271 Ga0157370_10099838 3300013104 Bacteria 2720
272 Ga0157369_10132941 3300013105 Bacteria 2636
273 Ga0157369_10155058 3300013105 Bacteria 2419
274 Ga0157369_10334410 3300013105 Bacteria 1573
275 Ga0157374_10001008 3300013296 Bacteria 24403
276 Ga0157374_10002621 3300013296 Bacteria 15179
277 Ga0157374_10010065 3300013296 Bacteria 8118
278 Ga0157374_10018896 3300013296 Bacteria 6093
279 Ga0157374_10077224 3300013296 Bacteria 3151
280 Ga0157378_10015920 3300013297 Bacteria 6585
281 Ga0157378_10087733 3300013297 Bacteria 2822
282 Ga0157378_10117611 3300013297 Bacteria 2445
283 Ga0163162_10008899 3300013306 Bacteria 9764
284 Ga0163162_10010907 3300013306 Bacteria 8846
285 Ga0163162_10020276 3300013306 Bacteria 6528
286 Ga0163162_10074273 3300013306 Bacteria 3458
287 Ga0163162_10108759 3300013306 Bacteria 2869
288 Ga0163162_10302948 3300013306 Bacteria 1730
289 Ga0163162_10528184 3300013306 Bacteria 1309
290 Ga0163162_10891621 3300013306 Bacteria 1003
291 Ga0157372_10042431 3300013307 Bacteria 5032
292 Ga0157372_10157907 3300013307 Bacteria 2620
293 Ga0157375_10018912 3300013308 Bacteria 6255
294 Ga0157375_10021322 3300013308 Bacteria 5938
295 Ga0163163_10002111 3300014325 Bacteria 16771
296 Ga0163163_10051936 3300014325 Bacteria 4043
297 Ga0163163_10539677 3300014325 Bacteria 1229
298 Ga0157380_10237716 3300014326 Bacteria 1640
299 Ga0157377_10005227 3300014745 Bacteria 6078
300 Ga0157377_10009052 3300014745 Bacteria 4878
301 Ga0157377_10101180 3300014745 Bacteria 1717
302 Ga0157379_10001661 3300014968 Bacteria 18379
303 Ga0157379_10014692 3300014968 Bacteria 6868
304 Ga0157379_10062548 3300014968 Bacteria 3329
305 Ga0157379_10065199 3300014968 Bacteria 3256
306 Ga0157376_10005143 3300014969 Bacteria 9119
307 Ga0157376_10006156 3300014969 Bacteria 8451
308 Ga0157376_10013080 3300014969 Bacteria 6180
309 Ga0157376_10040128 3300014969 Bacteria 3824
310 Ga0157376_10041375 3300014969 Bacteria 3772
311 Ga0157376_10045764 3300014969 Bacteria 3605
312 Ga0157376_10148201 3300014969 Bacteria 2113
313 Ga0157376_10390925 3300014969 Bacteria 1342
314 Ga0163161_10045551 3300017792 Bacteria 3164
315 Ga0163161_10052118 3300017792 Bacteria 2966
316 Ga0213872_10016591 3300021361 Bacteria 3416
317 Ga0213872_10078618 3300021361 Bacteria 1482
318 Ga0213876_10050524 3300021384 Bacteria 2197
319 Ga0209455_1001983 3300025272 Bacteria 8388
320 Ga0207697_10030079 3300025315 Bacteria 2223
321 Ga0207656_10012110 3300025321 Bacteria 3274
322 Ga0207656_10147619 3300025321 Bacteria 1112
323 Ga0207682_10001428 3300025893 Bacteria 11026
324 Ga0207642_10001908 3300025899 Bacteria 6431
325 Ga0207642_10202532 3300025899 Bacteria 1097
326 Ga0207710_10029122 3300025900 Bacteria 2401
327 Ga0207710_10042736 3300025900 Bacteria 2014
328 Ga0207688_10013311 3300025901 Bacteria 4469
329 Ga0207680_10002256 3300025903 Bacteria 8999
330 Ga0207685_10038595 3300025905 Bacteria 1767
331 Ga0207699_10024411 3300025906 Bacteria 3306
332 Ga0207699_10116162 3300025906 Bacteria 1723
333 Ga0207645_10016330 3300025907 Bacteria 4916
334 Ga0207645_10030020 3300025907 Bacteria 3503
335 Ga0207645_10041538 3300025907 Bacteria 2943
336 Ga0207643_10030604 3300025908 Bacteria 2997
337 Ga0207643_10069315 3300025908 Bacteria 2027
338 Ga0207643_10124399 3300025908 Bacteria 1530
339 Ga0207705_10002838 3300025909 Bacteria 13260
340 Ga0207705_10003073 3300025909 Bacteria 12725
341 Ga0207705_10039414 3300025909 Bacteria 3386
342 Ga0207654_10053558 3300025911 Bacteria 2330
343 Ga0207707_10069650 3300025912 Bacteria 3066
344 Ga0207707_10134109 3300025912 Bacteria 2166
345 Ga0207695_10003096 3300025913 Bacteria 23815
346 Ga0207695_10117907 3300025913 Bacteria 2626
347 Ga0207695_10260111 3300025913 Bacteria 1633
348 Ga0207671_10437040 3300025914 Bacteria 1042
349 Ga0207693_10000913 3300025915 Bacteria 26504
350 Ga0207693_10005677 3300025915 Bacteria 10374
351 Ga0207693_10079621 3300025915 Bacteria 2564
352 Ga0207663_10001114 3300025916 Bacteria 12351
353 Ga0207663_10031320 3300025916 Bacteria 3147
354 Ga0207662_10007103 3300025918 Bacteria 6083
355 Ga0207657_10002519 3300025919 Bacteria 19811
356 Ga0207657_10055107 3300025919 Bacteria 3436
357 Ga0207649_10001372 3300025920 Bacteria 14441
358 Ga0207652_10003246 3300025921 Bacteria 13489
359 Ga0207652_10025960 3300025921 Bacteria 4875
360 Ga0207652_10369513 3300025921 Bacteria 1295
361 Ga0207646_10067690 3300025922 Bacteria 3188
362 Ga0207646_10164173 3300025922 Bacteria 2005
363 Ga0207681_10034573 3300025923 Bacteria 3324
364 Ga0207694_10012151 3300025924 Bacteria 6493
365 Ga0207694_10096625 3300025924 Bacteria 2336
366 Ga0207694_10129498 3300025924 Bacteria 2022
367 Ga0207650_10000798 3300025925 Bacteria 24176
368 Ga0207650_10024454 3300025925 Bacteria 4294
369 Ga0207650_10116296 3300025925 Bacteria 2076
370 Ga0207650_10221988 3300025925 Bacteria 1521
371 Ga0207650_10375647 3300025925 Bacteria 1173
372 Ga0207659_10001152 3300025926 Bacteria 15749
373 Ga0207659_10031686 3300025926 Bacteria 3623
374 Ga0207659_10038240 3300025926 Bacteria 3336
375 Ga0207659_10147321 3300025926 Bacteria 1834
376 Ga0207659_10220635 3300025926 Bacteria 1524
377 Ga0207687_10055734 3300025927 Bacteria 2771
378 Ga0207687_10098267 3300025927 Bacteria 2149
379 Ga0207687_10215867 3300025927 Bacteria 1507
380 Ga0207687_10243282 3300025927 Bacteria 1427
381 Ga0207700_10021244 3300025928 Bacteria 4428
382 Ga0207700_10156590 3300025928 Bacteria 1888
383 Ga0207664_10007111 3300025929 Bacteria 7758
384 Ga0207664_10055940 3300025929 Bacteria 3132
385 Ga0207644_10000221 3300025931 Bacteria 39277
386 Ga0207644_10014132 3300025931 Bacteria 5340
387 Ga0207644_10208437 3300025931 Bacteria 1544
388 Ga0207690_10071339 3300025932 Bacteria 2395
389 Ga0207706_10010176 3300025933 Bacteria 8608
390 Ga0207706_10038888 3300025933 Bacteria 4219
391 Ga0207706_10038966 3300025933 Bacteria 4215
392 Ga0207706_10062387 3300025933 Bacteria 3282
393 Ga0207686_10000911 3300025934 Bacteria 17729
394 Ga0207686_10025030 3300025934 Bacteria 3466
395 Ga0207686_10064741 3300025934 Unclassified 2328
396 Ga0207709_10031534 3300025935 Bacteria 3097
397 Ga0207709_10038494 3300025935 Bacteria 2849
398 Ga0207670_10117154 3300025936 Bacteria 1930
399 Ga0207670_10130807 3300025936 Bacteria 1838
400 Ga0207670_10143980 3300025936 Bacteria 1760
401 Ga0207669_10015446 3300025937 Bacteria 3851
402 Ga0207669_10122394 3300025937 Bacteria 1769
403 Ga0207704_10079819 3300025938 Bacteria 2110
404 Ga0207704_10284929 3300025938 Bacteria 1258
405 Ga0207665_10006871 3300025939 Bacteria 7532
406 Ga0207691_10000413 3300025940 Bacteria 42800
407 Ga0207691_10002611 3300025940 Bacteria 17592
408 Ga0207691_10040216 3300025940 Bacteria 4322
409 Ga0207691_10066884 3300025940 Bacteria 3250
410 Ga0207691_10099368 3300025940 Bacteria 2598
411 Ga0207691_10161126 3300025940 Bacteria 1968
412 Ga0207711_10002942 3300025941 Bacteria 14893
413 Ga0207711_10003072 3300025941 Bacteria 14581
414 Ga0207711_10211394 3300025941 Bacteria 1772
415 Ga0207689_10000354 3300025942 Bacteria 42996
416 Ga0207689_10006538 3300025942 Bacteria 10286
417 Ga0207689_10022727 3300025942 Bacteria 5269
418 Ga0207689_10278613 3300025942 Bacteria 1385
419 Ga0207661_10010056 3300025944 Bacteria 6798
420 Ga0207679_10004829 3300025945 Bacteria 8405
421 Ga0207667_10004383 3300025949 Bacteria 17283
422 Ga0207667_10017027 3300025949 Bacteria 8198
423 Ga0207651_10000142 3300025960 Bacteria 31331
424 Ga0207651_10000415 3300025960 Bacteria 18156
425 Ga0207651_10111828 3300025960 Bacteria 2052
426 Ga0207712_10193422 3300025961 Bacteria 1607
427 Ga0207668_10020947 3300025972 Bacteria 4163
428 Ga0207658_10064525 3300025986 Bacteria 2747
429 Ga0207658_10159129 3300025986 Bacteria 1849
430 Ga0207658_10238836 3300025986 Bacteria 1538
431 Ga0207677_10000329 3300026023 Bacteria 34285
432 Ga0207677_10002938 3300026023 Bacteria 9003
433 Ga0207677_10023805 3300026023 Bacteria 3790
434 Ga0207677_10032144 3300026023 Bacteria 3370
435 Ga0207677_10044752 3300026023 Bacteria 2951
436 Ga0207677_10121867 3300026023 Bacteria 1963
437 Ga0207677_10289018 3300026023 Bacteria 1349
438 Ga0207677_10365403 3300026023 Bacteria 1214
439 Ga0207703_10000505 3300026035 Bacteria 40406
440 Ga0207703_10000804 3300026035 Bacteria 30944
441 Ga0207703_10010532 3300026035 Bacteria 7230
442 Ga0207703_10020477 3300026035 Bacteria 5173
443 Ga0207703_10085431 3300026035 Bacteria 2641
444 Ga0207703_10552185 3300026035 Bacteria 1086
445 Ga0207639_10181406 3300026041 Bacteria 1791
446 Ga0207639_10281928 3300026041 Bacteria 1462
447 Ga0207708_10004528 3300026075 Bacteria 10227
448 Ga0207702_10087696 3300026078 Bacteria 2717
449 Ga0207702_10590090 3300026078 Bacteria 1089
450 Ga0207641_10012527 3300026088 Bacteria 6951
451 Ga0207641_10056843 3300026088 Bacteria 3326
452 Ga0207641_10063307 3300026088 Bacteria 3159
453 Ga0207641_10079952 3300026088 Bacteria 2835
454 Ga0207648_10004748 3300026089 Bacteria 13886
455 Ga0207648_10051621 3300026089 Bacteria 3594
456 Ga0207648_10066771 3300026089 Bacteria 3136
457 Ga0207648_10107411 3300026089 Bacteria 2450
458 Ga0207648_10223181 3300026089 Bacteria 1675
459 Ga0207676_10000369 3300026095 Bacteria 38481
460 Ga0207676_10010718 3300026095 Bacteria 6535
461 Ga0207676_10058014 3300026095 Bacteria 3051
462 Ga0207676_10216446 3300026095 Bacteria 1703
463 Ga0207676_10222181 3300026095 Bacteria 1683
464 Ga0207676_10390951 3300026095 Bacteria 1297
465 Ga0207674_10016162 3300026116 Bacteria 8176
466 Ga0207674_10032922 3300026116 Bacteria 5432
467 Ga0207674_10106526 3300026116 Bacteria 2781
468 Ga0207675_100003866 3300026118 Bacteria 14554
469 Ga0207675_100065116 3300026118 Bacteria 3407
470 Ga0207675_100087438 3300026118 Bacteria 2927
471 Ga0207675_100110868 3300026118 Bacteria 2589
472 Ga0207683_10000588 3300026121 Bacteria 33464
473 Ga0207683_10048815 3300026121 Bacteria 3704
474 Ga0207683_10051470 3300026121 Bacteria 3608
475 Ga0207683_10087980 3300026121 Bacteria 2763
476 Ga0207683_10097008 3300026121 Bacteria 2628
477 Ga0207683_10107331 3300026121 Bacteria 2498
478 Ga0207698_10000233 3300026142 Bacteria 34707
479 Ga0207698_10018160 3300026142 Bacteria 4787
480 Ga0207698_10034617 3300026142 Bacteria 3684
481 Ga0207698_10168062 3300026142 Bacteria 1928
482 Ga0209969_1000127 3300027360 Bacteria 9734
483 Ga0209984_1006607 3300027424 Bacteria 1426
484 Ga0209995_1000640 3300027471 Bacteria 5405
485 Ga0209588_1033936 3300027671 Bacteria 1637
486 Ga0209974_10001161 3300027876 Bacteria 9381
487 Ga0209974_10009054 3300027876 Bacteria 3384
488 Ga0207428_10002833 3300027907 Bacteria 17208
489 Ga0207428_10008728 3300027907 Bacteria 9144
490 Ga0207428_10013863 3300027907 Bacteria 7021
491 Ga0207428_10070732 3300027907 Bacteria 2742
492 Ga0207428_10092880 3300027907 Bacteria 2341
493 Ga0207428_10148371 3300027907 Bacteria 1786
494 Ga0268266_10272528 3300028379 Bacteria 1571
495 Ga0268265_10004875 3300028380 Bacteria 9248
496 Ga0268265_10262605 3300028380 Bacteria 1536
497 Ga0268264_10000627 3300028381 Bacteria 42022
498 Ga0268264_10004988 3300028381 Bacteria 11239
499 Ga0268264_10107933 3300028381 Bacteria 2433
500 Ga0265318_10009581 3300028577 Bacteria 4252
501 Ga0265323_10013505 3300028653 Bacteria 3255
502 Ga0265324_10000448 3300029957 Bacteria 29201
503 Ga0265330_10001258 3300031235 Bacteria 14845
504 Ga0265330_10012033 3300031235 Bacteria 4047
505 Ga0265330_10087583 3300031235 Bacteria 1338
506 Ga0265332_10000004 3300031238 Bacteria 426592
507 Ga0265332_10001479 3300031238 Bacteria 13111
508 Ga0265332_10082478 3300031238 Bacteria 1363
509 Ga0265328_10000785 3300031239 Bacteria 14687
510 Ga0265325_10015721 3300031241 Bacteria 4248
511 Ga0265325_10016943 3300031241 Bacteria 4062
512 Ga0265325_10086768 3300031241 Bacteria 1548
513 Ga0265329_10001661 3300031242 Bacteria 10655
514 Ga0265329_10008649 3300031242 Bacteria 3844
515 Ga0265331_10000714 3300031250 Bacteria 28280
516 Ga0265331_10001273 3300031250 Bacteria 18843
517 Ga0265331_10024355 3300031250 Bacteria 3062
518 Ga0265331_10028288 3300031250 Bacteria 2804
519 Ga0265331_10030158 3300031250 Bacteria 2701
520 Ga0265331_10101560 3300031250 Bacteria 1323
521 Ga0265327_10000739 3300031251 Bacteria 51006
522 Ga0265327_10002771 3300031251 Bacteria 17740
523 Ga0265327_10109605 3300031251 Bacteria 1321
524 Ga0265316_10018429 3300031344 Bacteria 5999
525 Ga0265316_10034622 3300031344 Bacteria 4101
526 Ga0265316_10086607 3300031344 Bacteria 2394
527 Ga0265316_10138180 3300031344 Bacteria 1832
528 Ga0265316_10336986 3300031344 Bacteria 1093
529 Ga0307509_10000072 3300031507 Bacteria 140566
530 Ga0307509_10340957 3300031507 Unclassified 1226
531 Ga0307508_10012325 3300031616 Bacteria 7818
532 Ga0316575_10000043 3300031665 Bacteria 31191
533 Ga0265314_10000166 3300031711 Bacteria 99589
534 Ga0265314_10091625 3300031711 Bacteria 1978
535 Ga0265314_10165093 3300031711 Bacteria 1343
536 Ga0316576_10151587 3300031727 Bacteria 1747
537 Ga0307405_10008204 3300031731 Bacteria 5280
538 Ga0307413_10039164 3300031824 Bacteria 2754
539 Ga0307410_10039295 3300031852 Bacteria 3106
540 Ga0307406_10012386 3300031901 Bacteria 4864
541 Ga0307407_10005722 3300031903 Bacteria 5430
542 Ga0307412_10002503 3300031911 Bacteria 10213
543 Ga0307412_10088915 3300031911 Bacteria 2156
544 Ga0307412_10335205 3300031911 Bacteria 1209
545 Ga0307412_10487569 3300031911 Bacteria 1023
546 Ga0307409_100002429 3300031995 Bacteria 9733
547 Ga0307409_100328629 3300031995 Bacteria 1434
548 Ga0307416_100005286 3300032002 Bacteria 7909
549 Ga0307416_100052937 3300032002 Bacteria 3253
550 Ga0307416_100241840 3300032002 Bacteria 1750
551 Ga0307416_100277061 3300032002 Bacteria 1651
552 Ga0307416_100380303 3300032002 Bacteria 1442
553 Ga0307411_10031480 3300032005 Bacteria 3265
554 Ga0307411_10280585 3300032005 Bacteria 1326
555 Ga0307411_10437320 3300032005 Bacteria 1091
556 Ga0307415_100003060 3300032126 Bacteria 8439
557 Ga0307415_100125275 3300032126 Bacteria 1935
558 Ga0373930_0020118 3300034816 Bacteria 1298
559 Ga0373928_0004977 3300035084 Bacteria 2533
560 Ga0373934_0000938 3300035086 Bacteria 10559
561 Ga0373934_0001707 3300035086 Bacteria 8069
562 Ga0373934_0042852 3300035086 Bacteria 1788
563 Ga0373952_0000139 3300035092 Bacteria 10580
564 Ga0373923_0004026 3300035111 Bacteria 4818
565 Ga0373923_0040491 3300035111 Bacteria 1918
566 Ga0373936_0011580 3300035113 Bacteria 3342
567 Ga0373953_0033692 3300035117 Bacteria 2004
568 Ga0373954_0001297 3300035118 Bacteria 10054
569 Ga0373954_0003680 3300035118 Bacteria 6530
570 Ga0373954_0007369 3300035118 Bacteria 4813
571 Ga0373956_0000094 3300035119 Bacteria 29858
572 Ga0373957_0001720 3300035120 Bacteria 6015
573 Ga0373957_0005576 3300035120 Bacteria 3908
574 Ga0373960_0025903 3300035121 Bacteria 1598
575 Ga0373943_0029243 3300035170 Bacteria 2603
576 Ga0373955_0003882 3300035172 Bacteria 6591
577 Ga0373955_0031385 3300035172 Bacteria 2782
578 Ga0373955_0041706 3300035172 Bacteria 2461
579 Ga0373962_0020448 3300035242 Bacteria 1739
580 Ga0373924_0001044 3300035410 Bacteria 8805
581 Ga0373924_0034572 3300035410 Bacteria 2046
582 Ga0373935_0061898 3300035692 Bacteria 2396
583 Ga0373935_0075376 3300035692 Bacteria 2182
584 Ga0373935_0100545 3300035692 Bacteria 1905
585 Ga0373927_0028588 3300035695 Bacteria 3637
586 Ga0373927_0030186 3300035695 Bacteria 3537
587 Ga0373927_0262003 3300035695 Bacteria 1137
588 Ga0373933_0000432 3300035724 Bacteria 26397
589 Ga0373933_0091706 3300035724 Bacteria 1875
590 Ga0373933_0115504 3300035724 Bacteria 1677
591 Ga0373933_0401608 3300035724 Bacteria 894
592 Ga0373947_0006348 3300035725 Bacteria 6871
593 Ga0373947_0139285 3300035725 Bacteria 1555
594 Ga0373937_0000255 3300036401 Bacteria 51770
595 Ga0373937_0002035 3300036401 Bacteria 16886
596 Ga0373937_0323700 3300036401 Bacteria 1459
597 Ga0373925_0020083 3300037068 Bacteria 4861
598 Ga0373925_0027214 3300037068 Bacteria 4187
599 Ga0373925_0048045 3300037068 Bacteria 3178
600 Ga0373925_0066275 3300037068 Bacteria 2722
601 Ga0373925_0073651 3300037068 Bacteria 2585
602 Ga0373925_0571939 3300037068 Bacteria 930
603 Ga0395900_0019530 3300037418 Bacteria 6909
604 Ga0395900_0121553 3300037418 Bacteria 2679
605 Ga0395905_0005002 3300037471 Bacteria 13656
606 Ga0395905_0381770 3300037471 Bacteria 1303
607 Ga0436365_0249810 3300039437 Bacteria 2469
608 Ga0436365_0619540 3300039437 Bacteria 2604
609 Ga0436361_0562316 3300039447 Bacteria 3550
610 Ga0436361_0613315 3300039447 Bacteria 1723
611 Ga0451807_2326244 3300041486 Bacteria 1305
612 Ga0451853_1720496 3300041512 Bacteria 2497
613 Ga0451853_3251761 3300041512 Bacteria 1215
614 Ga0439441_002369 3300042001 Bacteria 2649
615 Ga0439435_0035526 3300042436 Bacteria 1374
616 Ga0439435_0054433 3300042436 Bacteria 1152
617 Ga0451577_0000013 3300042876 Bacteria 550689
618 Ga0451577_0000519 3300042876 Bacteria 64350
619 Ga0451577_0003649 3300042876 Bacteria 16882
620 Ga0451577_0016075 3300042876 Bacteria 6941
621 Ga0451577_0024692 3300042876 Bacteria 5464
622 Ga0451577_0081617 3300042876 Bacteria 2884
623 Ga0451577_0118530 3300042876 Bacteria 2371
624 Ga0451577_0212806 3300042876 Bacteria 1746
625 Ga0451577_0295745 3300042876 Bacteria 1467
626 Ga0453683_0000033 3300044673 Bacteria 241479
627 Ga0453683_0023695 3300044673 Bacteria 3911
628 Ga0453683_0052160 3300044673 Bacteria 2561
629 Ga0453683_0089631 3300044673 Bacteria 1928
630 Ga0466966_0081878 3300044684 Bacteria 2009
631 Ga0453684_0000005 3300044712 Bacteria 1431632
632 Ga0453684_0000040 3300044712 Bacteria 690210
633 Ga0453684_0000085 3300044712 Bacteria 397817
634 Ga0453684_0000114 3300044712 Bacteria 356610
635 Ga0453684_0000296 3300044712 Bacteria 211075
636 Ga0453684_0000623 3300044712 Bacteria 129254
637 Ga0453684_0007483 3300044712 Bacteria 20045
638 Ga0453684_0011178 3300044712 Bacteria 15114
639 Ga0453684_0018530 3300044712 Bacteria 10675
640 Ga0453684_0059341 3300044712 Bacteria 4933
641 Ga0453684_0061324 3300044712 Bacteria 4828
642 Ga0453684_0210474 3300044712 Bacteria 2260
643 Ga0453684_0336014 3300044712 Bacteria 1707
644 Ga0453684_0373437 3300044712 Bacteria 1603
645 Ga0466957_0022668 3300044842 Bacteria 3706
646 Ga0451576_0000018 3300045051 Bacteria 550689
647 Ga0451576_0000166 3300045051 Bacteria 166647
648 Ga0451576_0000761 3300045051 Bacteria 63684
649 Ga0451576_0005878 3300045051 Bacteria 15242
650 Ga0451576_0006357 3300045051 Bacteria 14505
651 Ga0451576_0007439 3300045051 Bacteria 13087
652 Ga0451576_0007667 3300045051 Bacteria 12830
653 Ga0451576_0010951 3300045051 Bacteria 10363
654 Ga0451576_0023472 3300045051 Bacteria 6678
655 Ga0451576_0024433 3300045051 Bacteria 6527
656 Ga0451576_0028815 3300045051 Bacteria 5946
657 Ga0451576_0037277 3300045051 Bacteria 5151
658 Ga0451576_0040275 3300045051 Bacteria 4947
659 Ga0466958_0027553 3300045836 Bacteria 3363
660 Ga0495592_0003670 3300046454 Bacteria 11055
661 Ga0495592_0096393 3300046454 Bacteria 2114
662 Ga0495592_0224618 3300046454 Bacteria 1253
663 Ga0495641_0014558 3300046461 Bacteria 4249
664 Ga0495651_0004185 3300046462 Bacteria 11050
665 Ga0495651_0005023 3300046462 Bacteria 10108
666 Ga0495651_0216682 3300046462 Bacteria 1328
667 Ga0495653_0018287 3300046463 Bacteria 5695
668 Ga0495653_0186830 3300046463 Bacteria 1417
669 Ga0495580_0006751 3300046472 Bacteria 9310
670 Ga0495580_0056713 3300046472 Bacteria 2758
671 Ga0495580_0144689 3300046472 Bacteria 1647
672 Ga0495582_0023520 3300046473 Bacteria 3371
673 Ga0495582_0065749 3300046473 Bacteria 2003
674 Ga0495639_0004383 3300046475 Bacteria 6048
675 Ga0495662_0002793 3300046476 Bacteria 8827
676 Ga0495662_0052939 3300046476 Bacteria 1960
677 Ga0495664_0077716 3300046477 Bacteria 1988
678 Ga0495606_0077236 3300046507 Bacteria 2079
679 Ga0495608_0041909 3300046511 Bacteria 3062
680 Ga0495608_0109322 3300046511 Bacteria 1778
681 Ga0495628_0005544 3300046516 Bacteria 11049
682 Ga0495628_0007978 3300046516 Bacteria 9124
683 Ga0495628_0018540 3300046516 Bacteria 5762
684 Ga0495628_0155463 3300046516 Bacteria 1740
685 Ga0495630_0178326 3300046517 Bacteria 1620
686 Ga0495663_0033232 3300046525 Bacteria 1540
687 Ga0495666_0003327 3300046526 Bacteria 8117
688 Ga0495642_0047329 3300046528 Bacteria 1761
689 Ga0495642_0075718 3300046528 Bacteria 1412
690 Ga0495652_0001765 3300046529 Bacteria 23187
691 Ga0495652_0078644 3300046529 Bacteria 2729
692 Ga0495586_0044906 3300046535 Bacteria 2380
693 Ga0495587_0019634 3300046536 Bacteria 4180
694 Ga0495587_0093234 3300046536 Bacteria 1739
695 Ga0495598_0020872 3300046537 Bacteria 1735
696 Ga0495598_0052575 3300046537 Bacteria 1231
697 Ga0495609_0114537 3300046538 Bacteria 1162
698 Ga0495621_0009589 3300046539 Bacteria 2945
699 Ga0495621_0074352 3300046539 Bacteria 1257
700 Ga0495645_0000566 3300046543 Bacteria 25312
701 Ga0495645_0057531 3300046543 Bacteria 2821
702 Ga0495645_0138739 3300046543 Bacteria 1698
703 Ga0495622_0044842 3300046557 Bacteria 2055
704 Ga0495667_0058629 3300046559 Bacteria 2529
705 Ga0495667_0063205 3300046559 Bacteria 2424
706 Ga0495635_0010206 3300046663 Bacteria 6566
707 Ga0495635_0029976 3300046663 Bacteria 3782
708 Ga0495635_0091773 3300046663 Bacteria 2077
709 Ga0495659_0150139 3300046664 Bacteria 935
710 Ga0495588_0091251 3300046674 Bacteria 1596
711 Ga0495657_0007804 3300046675 Bacteria 8217
712 Ga0495599_0000649 3300046678 Bacteria 19700
713 Ga0495599_0001603 3300046678 Bacteria 13048
714 Ga0495599_0007793 3300046678 Bacteria 6499
715 Ga0495658_0076652 3300046683 Bacteria 1954
716 Ga0495669_0013709 3300046684 Bacteria 3460
717 Ga0495613_0009375 3300046689 Bacteria 7263
718 Ga0495613_0043995 3300046689 Bacteria 3304
719 Ga0495660_0063056 3300046810 Bacteria 1985
720 Ga0495581_0000555 3300047315 Bacteria 19346
721 Ga0495604_0141006 3300047317 Bacteria 1722
722 Ga0495636_0071410 3300047318 Bacteria 1482
723 Ga0495674_0025865 3300047319 Bacteria 5373
724 Ga0495674_0363928 3300047319 Bacteria 1172
725 Ga0495680_0294183 3300047322 Bacteria 1141
726 Ga0495675_0007862 3300047444 Bacteria 6589
727 Ga0495675_0122082 3300047444 Bacteria 1622
728 Ga0495684_0014104 3300047471 Bacteria 6147
729 Ga0495684_0055761 3300047471 Bacteria 3014
730 Ga0495686_0059834 3300047472 Bacteria 2369
731 Ga0495602_0184493 3300048088 Bacteria 1606
732 Ga0495614_0019619 3300048089 Bacteria 2926
733 Ga0496100_0079635 3300048903 Bacteria 2208
734 Ga0496100_0152030 3300048903 Bacteria 1652
735 Ga0496101_0173036 3300048904 Bacteria 1660
736 Ga0496101_0221092 3300048904 Bacteria 1470
737 Ga0496102_0322445 3300048905 Bacteria 1455
738 Ga0496103_0078094 3300048906 Bacteria 2079
739 Ga0496104_0001965 3300048907 Bacteria 17807
740 Ga0496104_0012365 3300048907 Bacteria 7672
741 Ga0496104_0241154 3300048907 Bacteria 1720
742 Ga0496104_0554497 3300048907 Bacteria 1060
743 Ga0496105_0005754 3300048908 Bacteria 9445
744 Ga0496107_0160133 3300048910 Bacteria 1668
745 Ga0496108_0005919 3300048911 Bacteria 9911
746 Ga0496108_0027226 3300048911 Bacteria 4718
747 Ga0496108_0309983 3300048911 Bacteria 1375
748 Ga0496109_0012100 3300048912 Bacteria 7438
749 Ga0496109_0063121 3300048912 Bacteria 3388
750 Ga0496109_0141337 3300048912 Bacteria 2251
751 Ga0496110_0002718 3300048913 Bacteria 13361
752 Ga0496110_0265795 3300048913 Bacteria 1562
753 Ga0496110_0795055 3300048913 Bacteria 850
754 Ga0496112_0006687 3300048915 Bacteria 10152
755 Ga0496112_0177882 3300048915 Bacteria 2092
756 Ga0496113_0015267 3300048916 Bacteria 5273
757 Ga0496114_0005749 3300048917 Bacteria 9734
758 Ga0496114_0010696 3300048917 Bacteria 7302
759 Ga0496114_0304428 3300048917 Bacteria 1407
760 Ga0496115_0069557 3300048918 Bacteria 2852
761 Ga0501031_0002174 3300049568 Bacteria 12379
762 Ga0501031_0005161 3300049568 Bacteria 8510
763 Ga0501031_0112465 3300049568 Bacteria 1778
764 Ga0501031_0222448 3300049568 Bacteria 1229
765 Ga0501032_0003661 3300049569 Bacteria 11685
766 Ga0501033_0005554 3300049570 Bacteria 9970
767 Ga0501033_0009133 3300049570 Bacteria 7644
768 Ga0501033_0011745 3300049570 Bacteria 6697
769 Ga0501034_0004775 3300049571 Bacteria 15000
770 Ga0501034_0009146 3300049571 Bacteria 10397
771 Ga0501036_0018327 3300049572 Bacteria 5862
772 Ga0501036_0033402 3300049572 Bacteria 4351
773 Ga0501036_0111332 3300049572 Bacteria 2313
774 Ga0501037_0004141 3300049573 Bacteria 10525
775 Ga0501037_0060307 3300049573 Bacteria 2767
776 Ga0501038_0004863 3300049574 Bacteria 12478
777 Ga0501038_0004918 3300049574 Bacteria 12410
778 Ga0501038_0006265 3300049574 Bacteria 10997
779 Ga0501038_0008709 3300049574 Bacteria 9313
780 Ga0501038_0300304 3300049574 Bacteria 1260
781 Ga0501038_0300943 3300049574 Bacteria 1259
782 Ga0501038_0430038 3300049574 Bacteria 1017
783 Ga0501039_0017522 3300049575 Bacteria 5494
784 Ga0501040_0001889 3300049576 Bacteria 13451
785 Ga0501041_0059554 3300049577 Bacteria 2337
786 Ga0501042_0001673 3300049578 Bacteria 13219
787 Ga0501043_0009685 3300049579 Bacteria 7550
788 Ga0501043_0076663 3300049579 Bacteria 2627
789 Ga0501043_0211778 3300049579 Bacteria 1502
790 Ga0501043_0335646 3300049579 Bacteria 1150
791 Ga0501046_0003282 3300049580 Bacteria 14859
792 Ga0501046_0029693 3300049580 Bacteria 4444
793 Ga0501047_0031198 3300049581 Bacteria 5140
794 Ga0501047_0317882 3300049581 Bacteria 1397
795 Ga0501048_0005615 3300049582 Bacteria 9540
796 Ga0501068_0001418 3300049584 Bacteria 12736
797 Ga0501071_0003792 3300049587 Bacteria 9499
798 Ga0501072_0247656 3300049588 Bacteria 1419
799 Ga0501075_0033905 3300049591 Bacteria 3799
800 Ga0501075_0097371 3300049591 Bacteria 2233
801 Ga0501076_0000441 3300049592 Bacteria 26293
802 Ga0501080_0098834 3300049742 Bacteria 2708
803 Ga0501081_0067272 3300049743 Bacteria 2493
804 Ga0501035_0003875 3300049822 Bacteria 14276
805 Ga0501035_0011429 3300049822 Bacteria 8231
806 Ga0501035_0013582 3300049822 Bacteria 7514
807 Ga0501035_0018997 3300049822 Bacteria 6327
808 Ga0501035_0024993 3300049822 Bacteria 5477
809 Ga0501035_0333918 3300049822 Bacteria 1271
810 Ga0501035_0544842 3300049822 Bacteria 951
811 Ga0501044_0000126 3300049823 Bacteria 92879
812 Ga0501044_0006304 3300049823 Bacteria 13112
813 Ga0501044_0007300 3300049823 Bacteria 12143
814 Ga0501044_0059187 3300049823 Bacteria 3926
815 Ga0501044_0155656 3300049823 Bacteria 2265
816 Ga0501045_0123264 3300049824 Bacteria 1924
817 Ga0501045_0149589 3300049824 Bacteria 1737
818 nmdc:mga07m45_114720_c1 3300050496 Bacteria 1553
819 nmdc:mga09592_56284_c1 3300050508 Bacteria 3323
820 nmdc:mga0qj67_73707_c1 3300050509 Bacteria 2727
821 nmdc:mga06r32_24270_c1 3300050510 Bacteria 5624
822 nmdc:mga08y16_16326_c1 3300050511 Bacteria 7806
823 nmdc:mga08y16_252870_c1 3300050511 Bacteria 1821
824 nmdc:mga08y16_31378_c1 3300050511 Bacteria 5588
825 nmdc:mga08y16_45483_c1 3300050511 Bacteria 4599
826 nmdc:mga08y16_6277_c1 3300050511 Bacteria 12462
827 nmdc:mga08y16_769809_c1 3300050511 Bacteria 957
828 nmdc:mga08y16_78634_c1 3300050511 Bacteria 3438
829 nmdc:mga0n895_159861_c1 3300050512 Bacteria 2284
830 nmdc:mga0n895_521502_c1 3300050512 Bacteria 1196
831 nmdc:mga0n895_540903_c1 3300050512 Bacteria 1171
832 nmdc:mga0n895_9412_c1 3300050512 Bacteria 8547
833 nmdc:mga0rr50_377283_c1 3300050513 Bacteria 1195
834 nmdc:mga0rr50_83470_c1 3300050513 Bacteria 2470
835 nmdc:mga08x19_4020_c1 3300050514 Bacteria 8752
836 nmdc:mga08x19_45541_c1 3300050514 Bacteria 2803
837 nmdc:mga08x19_62148_c1 3300050514 Bacteria 2421
838 nmdc:mga0a205_23653_c2 3300050515 Bacteria 5110
839 nmdc:mga0a205_284100_c1 3300050515 Bacteria 1530
840 Ga0495601_0002848 3300053077 Bacteria 9825
841 Ga0495601_0060165 3300053077 Bacteria 2410
842 Ga0495601_0080004 3300053077 Bacteria 2096
843 Ga0495601_0117921 3300053077 Bacteria 1722
844 Ga0495612_0009151 3300053078 Bacteria 4019
845 Ga0495595_0001451 3300053084 Bacteria 9250
846 Ga0495619_0006417 3300053085 Bacteria 7452
847 Ga0495619_0020619 3300053085 Bacteria 4201
848 Ga0500607_016555 3300053121 Bacteria 4225
849 Ga0500636_0000064 3300053177 Bacteria 51986
850 Ga0500637_0031332 3300053178 Bacteria 2962
851 Ga0530510_0087246 3300061734 Bacteria 2274

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047322 Ga0495680_0294183 Ga0495680_0294183_306_1103 250
2 3300048913 Ga0496110_0795055 Ga0496110_0795055_66_833 253
3 3300035724 Ga0373933_0401608 Ga0373933_0401608_12_782 254
4 3300048911 Ga0496108_0309983 Ga0496108_0309983_12_782 254
5 3300005328 Ga0070676_10083905 Ga0070676_100839052 257
6 3300005340 Ga0070689_100003377 Ga0070689_10000337710 257
7 3300005340 Ga0070689_100178636 Ga0070689_1001786362 257
8 3300005365 Ga0070688_100106161 Ga0070688_1001061612 257
9 3300005438 Ga0070701_10094082 Ga0070701_100940822 257
10 3300005577 Ga0068857_100021734 Ga0068857_1000217346 257
11 3300025936 Ga0207670_10143980 Ga0207670_101439803 257
12 3300026116 Ga0207674_10032922 Ga0207674_100329226 257
13 3300026121 Ga0207683_10097008 Ga0207683_100970082 257
14 3300027876 Ga0209974_10009054 Ga0209974_100090543 257
15 3300037068 Ga0373925_0571939 Ga0373925_0571939_136_918 257
16 3300037471 Ga0395905_0381770 Ga0395905_0381770_27_809 257
17 3300041486 Ga0451807_2326244 Ga0451807_2326244_505_1287 257
18 3300041512 Ga0451853_1720496 Ga0451853_1720496_280_1062 257
19 3300049822 Ga0501035_0544842 Ga0501035_0544842_100_882 257
20 3300050511 nmdc:mga08y16_769809_c1 nmdc:mga08y16_769809_c1_155_937 257
21 3300050512 nmdc:mga0n895_540903_c1 nmdc:mga0n895_540903_c1_31_813 257
22 3300050513 nmdc:mga0rr50_377283_c1 nmdc:mga0rr50_377283_c1_387_1169 257
23 3300025899 Ga0207642_10202532 Ga0207642_102025322 258
24 3300046454 Ga0495592_0096393 Ga0495592_0096393_1257_2051 260
25 3300031727 Ga0316576_10151587 Ga0316576_101515873 261
26 3300046528 Ga0495642_0075718 Ga0495642_0075718_91_966 261
27 3300005330 Ga0070690_100021086 Ga0070690_1000210863 266
28 3300005343 Ga0070687_100025518 Ga0070687_1000255182 266
29 3300005356 Ga0070674_100029925 Ga0070674_1000299252 266
30 3300005367 Ga0070667_100032338 Ga0070667_1000323385 266
31 3300005441 Ga0070700_100056967 Ga0070700_1000569673 266
32 3300005455 Ga0070663_100207376 Ga0070663_1002073762 266
33 3300005615 Ga0070702_100018030 Ga0070702_1000180302 266
34 3300048906 Ga0496103_0078094 Ga0496103_0078094_1257_2069 268
35 3300053121 Ga0500607_016555 Ga0500607_016555_2309_3184 268
36 3300053177 Ga0500636_0000064 Ga0500636_0000064_34325_35200 268
37 3300053178 Ga0500637_0031332 Ga0500637_0031332_1087_1962 268
38 3300046507 Ga0495606_0077236 Ga0495606_0077236_59_958 269
39 3300046538 Ga0495609_0114537 Ga0495609_0114537_59_958 269
40 3300046810 Ga0495660_0063056 Ga0495660_0063056_505_1404 269
41 3300047472 Ga0495686_0059834 Ga0495686_0059834_498_1397 269
42 3300050513 nmdc:mga0rr50_83470_c1 nmdc:mga0rr50_83470_c1_228_1115 269
43 3300050515 nmdc:mga0a205_284100_c1 nmdc:mga0a205_284100_c1_526_1413 269
44 3300031711 Ga0265314_10091625 Ga0265314_100916252 270
45 3300042876 Ga0451577_0000013 Ga0451577_0000013_349642_350529 270
46 3300044673 Ga0453683_0000033 Ga0453683_0000033_228485_229372 270
47 3300044712 Ga0453684_0000040 Ga0453684_0000040_44974_45861 270
48 3300044712 Ga0453684_0000085 Ga0453684_0000085_47289_48176 270
49 3300044712 Ga0453684_0336014 Ga0453684_0336014_753_1643 270
50 3300045051 Ga0451576_0000018 Ga0451576_0000018_200161_201048 270
51 3300005406 Ga0070703_10044178 Ga0070703_100441781 271
52 3300031250 Ga0265331_10001273 Ga0265331_100012734 273
53 3300031250 Ga0265331_10024355 Ga0265331_100243552 273
54 3300031250 Ga0265331_10030158 Ga0265331_100301583 273
55 3300031251 Ga0265327_10000739 Ga0265327_100007398 273
56 3300031251 Ga0265327_10002771 Ga0265327_100027719 273
57 3300044684 Ga0466966_0081878 Ga0466966_0081878_983_1879 273
58 3300044842 Ga0466957_0022668 Ga0466957_0022668_2031_2927 273
59 3300045836 Ga0466958_0027553 Ga0466958_0027553_970_1866 273
60 3300032005 Ga0307411_10437320 Ga0307411_104373202 275
61 3300005456 Ga0070678_100196457 Ga0070678_1001964572 277
62 3300042876 Ga0451577_0000519 Ga0451577_0000519_11196_12062 277
63 3300044712 Ga0453684_0000005 Ga0453684_0000005_1419543_1420409 277
64 3300005616 Ga0068852_100084408 Ga0068852_1000844083 278
65 3300035092 Ga0373952_0000139 Ga0373952_0000139_2325_3170 278
66 3300005343 Ga0070687_100069063 Ga0070687_1000690632 279
67 3300005435 Ga0070714_100264979 Ga0070714_1002649792 279
68 3300005617 Ga0068859_100060072 Ga0068859_1000600722 279
69 3300006931 Ga0097620_100060072 Ga0097620_1000600722 279
70 3300026035 Ga0207703_10085431 Ga0207703_100854312 279
71 3300005471 Ga0070698_100175897 Ga0070698_1001758972 281
72 3300005536 Ga0070697_100036887 Ga0070697_1000368873 281
73 3300005545 Ga0070695_100108342 Ga0070695_1001083422 281
74 3300031911 Ga0307412_10335205 Ga0307412_103352052 281
75 3300032002 Ga0307416_100241840 Ga0307416_1002418402 281
76 3300005467 Ga0070706_100028196 Ga0070706_1000281962 282
77 3300005468 Ga0070707_100034979 Ga0070707_1000349795 282
78 3300005518 Ga0070699_100006062 Ga0070699_10000606212 282
79 3300025922 Ga0207646_10067690 Ga0207646_100676903 282
80 3300042001 Ga0439441_002369 Ga0439441_002369_1550_2437 282
81 3300006852 Ga0075433_10012283 Ga0075433_100122835 283
82 3300006871 Ga0075434_100073969 Ga0075434_1000739692 283
83 3300006914 Ga0075436_100039459 Ga0075436_1000394592 283
84 3300007076 Ga0075435_100027884 Ga0075435_1000278842 283
85 3300042876 Ga0451577_0295745 Ga0451577_0295745_218_1111 283
86 3300044712 Ga0453684_0007483 Ga0453684_0007483_8270_9163 283
87 3300050512 nmdc:mga0n895_9412_c1 nmdc:mga0n895_9412_c1_3262_4149 283
88 3300050514 nmdc:mga08x19_45541_c1 nmdc:mga08x19_45541_c1_760_1647 283
89 3300050515 nmdc:mga0a205_23653_c2 nmdc:mga0a205_23653_c2_1663_2550 283
90 3300007788 Ga0099795_10036243 Ga0099795_100362432 285
91 3300031731 Ga0307405_10008204 Ga0307405_100082045 285
92 3300031901 Ga0307406_10012386 Ga0307406_100123862 285
93 3300031903 Ga0307407_10005722 Ga0307407_100057224 285
94 3300031911 Ga0307412_10002503 Ga0307412_100025033 285
95 3300031995 Ga0307409_100002429 Ga0307409_1000024295 285
96 3300032002 Ga0307416_100005286 Ga0307416_1000052863 285
97 3300032126 Ga0307415_100003060 Ga0307415_1000030608 285
98 3300042876 Ga0451577_0003649 Ga0451577_0003649_9455_10354 285
99 3300027671 Ga0209588_1033936 Ga0209588_10339362 286
100 3300031241 Ga0265325_10086768 Ga0265325_100867683 286
101 3300042876 Ga0451577_0212806 Ga0451577_0212806_65_934 286
102 3300044712 Ga0453684_0000296 Ga0453684_0000296_10756_11622 286
103 3300045051 Ga0451576_0007667 Ga0451576_0007667_10267_11133 286
104 3300046517 Ga0495630_0178326 Ga0495630_0178326_17_886 286
105 3300046559 Ga0495667_0063205 Ga0495667_0063205_1115_1984 286
106 3300048916 Ga0496113_0015267 Ga0496113_0015267_3390_4274 286
107 3300049587 Ga0501071_0003792 Ga0501071_0003792_3269_4138 286
108 3300049591 Ga0501075_0033905 Ga0501075_0033905_2340_3209 286
109 3300049742 Ga0501080_0098834 Ga0501080_0098834_478_1347 286
110 3300049824 Ga0501045_0149589 Ga0501045_0149589_246_1115 286
111 3300061734 Ga0530510_0087246 Ga0530510_0087246_1151_2020 286
112 3300042876 Ga0451577_0016075 Ga0451577_0016075_331_1221 287
113 3300042876 Ga0451577_0081617 Ga0451577_0081617_456_1325 287
114 3300044673 Ga0453683_0089631 Ga0453683_0089631_657_1526 287
115 3300044712 Ga0453684_0011178 Ga0453684_0011178_3679_4548 287
116 3300044712 Ga0453684_0210474 Ga0453684_0210474_13_903 287
117 3300045051 Ga0451576_0000761 Ga0451576_0000761_62115_63005 287
118 3300045051 Ga0451576_0005878 Ga0451576_0005878_10567_11436 287
119 3300045051 Ga0451576_0006357 Ga0451576_0006357_12471_13361 287
120 3300045051 Ga0451576_0010951 Ga0451576_0010951_8792_9682 287
121 3300005549 Ga0070704_100226861 Ga0070704_1002268612 288
122 3300044712 Ga0453684_0061324 Ga0453684_0061324_3696_4586 288
123 3300046454 Ga0495592_0003670 Ga0495592_0003670_2909_3784 288
124 3300046462 Ga0495651_0216682 Ga0495651_0216682_241_1116 288
125 3300046516 Ga0495628_0005544 Ga0495628_0005544_4891_5766 288
126 3300046529 Ga0495652_0001765 Ga0495652_0001765_8067_8942 288
127 3300046543 Ga0495645_0000566 Ga0495645_0000566_6179_7054 288
128 3300046678 Ga0495599_0000649 Ga0495599_0000649_6864_7739 288
129 3300053077 Ga0495601_0080004 Ga0495601_0080004_52_927 288
130 3300005341 Ga0070691_10014877 Ga0070691_100148774 289
131 3300005456 Ga0070678_100079745 Ga0070678_1000797453 289
132 3300005457 Ga0070662_100138785 Ga0070662_1001387852 289
133 3300005459 Ga0068867_100142867 Ga0068867_1001428672 289
134 3300006914 Ga0075436_100070222 Ga0075436_1000702223 289
135 3300009176 Ga0105242_10203075 Ga0105242_102030752 289
136 3300013297 Ga0157378_10015920 Ga0157378_100159206 289
137 3300013306 Ga0163162_10020276 Ga0163162_100202766 289
138 3300014969 Ga0157376_10013080 Ga0157376_100130806 289
139 3300017792 Ga0163161_10052118 Ga0163161_100521183 289
140 3300025899 Ga0207642_10001908 Ga0207642_100019082 289
141 3300025927 Ga0207687_10055734 Ga0207687_100557342 289
142 3300025933 Ga0207706_10010176 Ga0207706_100101767 289
143 3300025934 Ga0207686_10000911 Ga0207686_100009115 289
144 3300025937 Ga0207669_10015446 Ga0207669_100154462 289
145 3300025942 Ga0207689_10022727 Ga0207689_100227275 289
146 3300026023 Ga0207677_10002938 Ga0207677_100029382 289
147 3300026089 Ga0207648_10066771 Ga0207648_100667712 289
148 3300035086 Ga0373934_0000938 Ga0373934_0000938_4011_4925 289
149 3300035086 Ga0373934_0042852 Ga0373934_0042852_832_1713 289
150 3300035111 Ga0373923_0004026 Ga0373923_0004026_888_1769 289
151 3300035111 Ga0373923_0040491 Ga0373923_0040491_476_1390 289
152 3300035113 Ga0373936_0011580 Ga0373936_0011580_1265_2146 289
153 3300035118 Ga0373954_0003680 Ga0373954_0003680_3996_4877 289
154 3300035118 Ga0373954_0007369 Ga0373954_0007369_3035_3916 289
155 3300035119 Ga0373956_0000094 Ga0373956_0000094_22278_23192 289
156 3300035120 Ga0373957_0001720 Ga0373957_0001720_1365_2246 289
157 3300035120 Ga0373957_0005576 Ga0373957_0005576_2956_3870 289
158 3300035172 Ga0373955_0003882 Ga0373955_0003882_4442_5323 289
159 3300035172 Ga0373955_0041706 Ga0373955_0041706_223_1137 289
160 3300035410 Ga0373924_0001044 Ga0373924_0001044_4821_5702 289
161 3300035692 Ga0373935_0061898 Ga0373935_0061898_28_909 289
162 3300035695 Ga0373927_0028588 Ga0373927_0028588_1584_2465 289
163 3300035724 Ga0373933_0000432 Ga0373933_0000432_22874_23788 289
164 3300035724 Ga0373933_0091706 Ga0373933_0091706_35_916 289
165 3300035725 Ga0373947_0139285 Ga0373947_0139285_149_1030 289
166 3300036401 Ga0373937_0000255 Ga0373937_0000255_43750_44664 289
167 3300036401 Ga0373937_0002035 Ga0373937_0002035_3113_3994 289
168 3300046454 Ga0495592_0224618 Ga0495592_0224618_263_1177 289
169 3300046461 Ga0495641_0014558 Ga0495641_0014558_2606_3487 289
170 3300046462 Ga0495651_0004185 Ga0495651_0004185_3424_4305 289
171 3300046462 Ga0495651_0005023 Ga0495651_0005023_2522_3436 289
172 3300046463 Ga0495653_0018287 Ga0495653_0018287_1790_2671 289
173 3300046472 Ga0495580_0006751 Ga0495580_0006751_6768_7649 289
174 3300046473 Ga0495582_0023520 Ga0495582_0023520_1717_2598 289
175 3300046476 Ga0495662_0002793 Ga0495662_0002793_4672_5553 289
176 3300046516 Ga0495628_0007978 Ga0495628_0007978_2799_3680 289
177 3300046516 Ga0495628_0018540 Ga0495628_0018540_355_1236 289
178 3300046516 Ga0495628_0155463 Ga0495628_0155463_478_1359 289
179 3300046526 Ga0495666_0003327 Ga0495666_0003327_2516_3397 289
180 3300046529 Ga0495652_0078644 Ga0495652_0078644_698_1579 289
181 3300046535 Ga0495586_0044906 Ga0495586_0044906_332_1213 289
182 3300046536 Ga0495587_0019634 Ga0495587_0019634_2827_3708 289
183 3300046557 Ga0495622_0044842 Ga0495622_0044842_693_1574 289
184 3300046663 Ga0495635_0029976 Ga0495635_0029976_1789_2670 289
185 3300046675 Ga0495657_0007804 Ga0495657_0007804_5972_6853 289
186 3300046678 Ga0495599_0007793 Ga0495599_0007793_3991_4872 289
187 3300046683 Ga0495658_0076652 Ga0495658_0076652_742_1623 289
188 3300046689 Ga0495613_0009375 Ga0495613_0009375_3224_4105 289
189 3300047318 Ga0495636_0071410 Ga0495636_0071410_559_1443 289
190 3300047319 Ga0495674_0025865 Ga0495674_0025865_2703_3584 289
191 3300047444 Ga0495675_0007862 Ga0495675_0007862_37_918 289
192 3300047444 Ga0495675_0122082 Ga0495675_0122082_255_1169 289
193 3300048088 Ga0495602_0184493 Ga0495602_0184493_301_1182 289
194 3300048089 Ga0495614_0019619 Ga0495614_0019619_959_1840 289
195 3300050514 nmdc:mga08x19_62148_c1 nmdc:mga08x19_62148_c1_23_907 289
196 3300053077 Ga0495601_0002848 Ga0495601_0002848_1781_2662 289
197 3300053077 Ga0495601_0117921 Ga0495601_0117921_266_1147 289
198 3300053084 Ga0495595_0001451 Ga0495595_0001451_3313_4194 289
199 3300053085 Ga0495619_0006417 Ga0495619_0006417_5440_6321 289
200 3300005329 Ga0070683_100086367 Ga0070683_1000863672 290
201 3300005330 Ga0070690_100004680 Ga0070690_1000046805 290
202 3300005331 Ga0070670_100019332 Ga0070670_1000193325 290
203 3300005335 Ga0070666_10020043 Ga0070666_100200432 290
204 3300005336 Ga0070680_100077278 Ga0070680_1000772783 290
205 3300005337 Ga0070682_100012218 Ga0070682_1000122183 290
206 3300005338 Ga0068868_100009584 Ga0068868_1000095845 290
207 3300005340 Ga0070689_100034210 Ga0070689_1000342102 290
208 3300005344 Ga0070661_100019649 Ga0070661_1000196494 290
209 3300005345 Ga0070692_10060371 Ga0070692_100603712 290
210 3300005355 Ga0070671_100018208 Ga0070671_1000182082 290
211 3300005364 Ga0070673_100001260 Ga0070673_1000012607 290
212 3300005365 Ga0070688_100000431 Ga0070688_1000004315 290
213 3300005406 Ga0070703_10018923 Ga0070703_100189232 290
214 3300005434 Ga0070709_10057937 Ga0070709_100579372 290
215 3300005434 Ga0070709_10201226 Ga0070709_102012262 290
216 3300005435 Ga0070714_100238897 Ga0070714_1002388972 290
217 3300005436 Ga0070713_100002492 Ga0070713_1000024928 290
218 3300005439 Ga0070711_100002587 Ga0070711_1000025872 290
219 3300005440 Ga0070705_100025920 Ga0070705_1000259204 290
220 3300005444 Ga0070694_100053962 Ga0070694_1000539622 290
221 3300005445 Ga0070708_100020748 Ga0070708_1000207484 290
222 3300005455 Ga0070663_100238042 Ga0070663_1002380421 290
223 3300005466 Ga0070685_10000733 Ga0070685_100007333 290
224 3300005467 Ga0070706_100037830 Ga0070706_1000378304 290
225 3300005468 Ga0070707_100145097 Ga0070707_1001450973 290
226 3300005518 Ga0070699_100071219 Ga0070699_1000712193 290
227 3300005535 Ga0070684_100034952 Ga0070684_1000349524 290
228 3300005536 Ga0070697_100030915 Ga0070697_1000309152 290
229 3300005539 Ga0068853_100105607 Ga0068853_1001056073 290
230 3300005543 Ga0070672_100207337 Ga0070672_1002073372 290
231 3300005544 Ga0070686_100025941 Ga0070686_1000259412 290
232 3300005545 Ga0070695_100018618 Ga0070695_1000186184 290
233 3300005547 Ga0070693_100216139 Ga0070693_1002161391 290
234 3300005548 Ga0070665_100248437 Ga0070665_1002484372 290
235 3300005549 Ga0070704_100018546 Ga0070704_1000185464 290
236 3300005564 Ga0070664_100121536 Ga0070664_1001215362 290
237 3300005578 Ga0068854_100003907 Ga0068854_1000039072 290
238 3300005578 Ga0068854_100032222 Ga0068854_1000322223 290
239 3300005615 Ga0070702_100023295 Ga0070702_1000232952 290
240 3300005616 Ga0068852_100014226 Ga0068852_1000142264 290
241 3300005618 Ga0068864_100007067 Ga0068864_1000070677 290
242 3300005841 Ga0068863_100004686 Ga0068863_1000046867 290
243 3300005843 Ga0068860_100070165 Ga0068860_1000701652 290
244 3300006173 Ga0070716_100113934 Ga0070716_1001139341 290
245 3300006175 Ga0070712_100020319 Ga0070712_1000203194 290
246 3300006237 Ga0097621_100010760 Ga0097621_1000107603 290
247 3300006358 Ga0068871_100015986 Ga0068871_1000159862 290
248 3300006871 Ga0075434_100206615 Ga0075434_1002066152 290
249 3300009093 Ga0105240_10089300 Ga0105240_100893003 290
250 3300009101 Ga0105247_10050490 Ga0105247_100504902 290
251 3300009148 Ga0105243_10136517 Ga0105243_101365171 290
252 3300009174 Ga0105241_10397108 Ga0105241_103971082 290
253 3300009177 Ga0105248_10036313 Ga0105248_100363132 290
254 3300009551 Ga0105238_10054670 Ga0105238_100546701 290
255 3300010375 Ga0105239_10098071 Ga0105239_100980714 290
256 3300011119 Ga0105246_10237224 Ga0105246_102372241 290
257 3300013104 Ga0157370_10041460 Ga0157370_100414604 290
258 3300013105 Ga0157369_10132941 Ga0157369_101329412 290
259 3300013296 Ga0157374_10002621 Ga0157374_100026218 290
260 3300013306 Ga0163162_10008899 Ga0163162_100088993 290
261 3300014325 Ga0163163_10002111 Ga0163163_1000211110 290
262 3300014745 Ga0157377_10101180 Ga0157377_101011803 290
263 3300014968 Ga0157379_10001661 Ga0157379_1000166110 290
264 3300014969 Ga0157376_10005143 Ga0157376_100051433 290
265 3300025321 Ga0207656_10147619 Ga0207656_101476192 290
266 3300025900 Ga0207710_10029122 Ga0207710_100291223 290
267 3300025903 Ga0207680_10002256 Ga0207680_100022565 290
268 3300025905 Ga0207685_10038595 Ga0207685_100385952 290
269 3300025906 Ga0207699_10024411 Ga0207699_100244112 290
270 3300025911 Ga0207654_10053558 Ga0207654_100535582 290
271 3300025914 Ga0207671_10437040 Ga0207671_104370401 290
272 3300025915 Ga0207693_10000913 Ga0207693_1000091314 290
273 3300025915 Ga0207693_10005677 Ga0207693_100056777 290
274 3300025916 Ga0207663_10001114 Ga0207663_100011146 290
275 3300025919 Ga0207657_10002519 Ga0207657_100025198 290
276 3300025924 Ga0207694_10096625 Ga0207694_100966253 290
277 3300025927 Ga0207687_10098267 Ga0207687_100982673 290
278 3300025928 Ga0207700_10021244 Ga0207700_100212441 290
279 3300025931 Ga0207644_10014132 Ga0207644_100141322 290
280 3300025932 Ga0207690_10071339 Ga0207690_100713393 290
281 3300025933 Ga0207706_10062387 Ga0207706_100623872 290
282 3300025934 Ga0207686_10025030 Ga0207686_100250302 290
283 3300025936 Ga0207670_10130807 Ga0207670_101308072 290
284 3300025939 Ga0207665_10006871 Ga0207665_100068714 290
285 3300025940 Ga0207691_10040216 Ga0207691_100402163 290
286 3300025941 Ga0207711_10002942 Ga0207711_100029427 290
287 3300025960 Ga0207651_10000415 Ga0207651_1000041512 290
288 3300025986 Ga0207658_10064525 Ga0207658_100645251 290
289 3300026023 Ga0207677_10121867 Ga0207677_101218672 290
290 3300026035 Ga0207703_10000505 Ga0207703_1000050531 290
291 3300026041 Ga0207639_10281928 Ga0207639_102819282 290
292 3300026078 Ga0207702_10087696 Ga0207702_100876963 290
293 3300026088 Ga0207641_10012527 Ga0207641_100125276 290
294 3300026095 Ga0207676_10000369 Ga0207676_1000036927 290
295 3300026116 Ga0207674_10016162 Ga0207674_100161625 290
296 3300028379 Ga0268266_10272528 Ga0268266_102725283 290
297 3300028381 Ga0268264_10004988 Ga0268264_100049887 290
298 3300035086 Ga0373934_0001707 Ga0373934_0001707_4145_5029 290
299 3300035117 Ga0373953_0033692 Ga0373953_0033692_765_1649 290
300 3300035118 Ga0373954_0001297 Ga0373954_0001297_4672_5556 290
301 3300035170 Ga0373943_0029243 Ga0373943_0029243_102_986 290
302 3300035172 Ga0373955_0031385 Ga0373955_0031385_943_1827 290
303 3300035410 Ga0373924_0034572 Ga0373924_0034572_806_1690 290
304 3300035692 Ga0373935_0075376 Ga0373935_0075376_1160_2044 290
305 3300035692 Ga0373935_0100545 Ga0373935_0100545_517_1401 290
306 3300035695 Ga0373927_0030186 Ga0373927_0030186_1344_2228 290
307 3300035725 Ga0373947_0006348 Ga0373947_0006348_2440_3324 290
308 3300037068 Ga0373925_0020083 Ga0373925_0020083_646_1530 290
309 3300037068 Ga0373925_0048045 Ga0373925_0048045_2020_2904 290
310 3300037068 Ga0373925_0073651 Ga0373925_0073651_773_1657 290
311 3300046472 Ga0495580_0144689 Ga0495580_0144689_357_1241 290
312 3300046473 Ga0495582_0065749 Ga0495582_0065749_385_1269 290
313 3300046475 Ga0495639_0004383 Ga0495639_0004383_1834_2718 290
314 3300046476 Ga0495662_0052939 Ga0495662_0052939_451_1335 290
315 3300046477 Ga0495664_0077716 Ga0495664_0077716_749_1633 290
316 3300046511 Ga0495608_0109322 Ga0495608_0109322_557_1441 290
317 3300046536 Ga0495587_0093234 Ga0495587_0093234_464_1348 290
318 3300046539 Ga0495621_0074352 Ga0495621_0074352_133_1017 290
319 3300046543 Ga0495645_0138739 Ga0495645_0138739_61_945 290
320 3300046559 Ga0495667_0058629 Ga0495667_0058629_1169_2053 290
321 3300046663 Ga0495635_0010206 Ga0495635_0010206_1761_2645 290
322 3300046664 Ga0495659_0150139 Ga0495659_0150139_36_920 290
323 3300046674 Ga0495588_0091251 Ga0495588_0091251_517_1401 290
324 3300046689 Ga0495613_0043995 Ga0495613_0043995_138_1022 290
325 3300047315 Ga0495581_0000555 Ga0495581_0000555_8404_9288 290
326 3300047317 Ga0495604_0141006 Ga0495604_0141006_816_1700 290
327 3300047319 Ga0495674_0363928 Ga0495674_0363928_147_1031 290
328 3300047471 Ga0495684_0014104 Ga0495684_0014104_3451_4335 290
329 3300048903 Ga0496100_0079635 Ga0496100_0079635_229_1113 290
330 3300048905 Ga0496102_0322445 Ga0496102_0322445_240_1124 290
331 3300048907 Ga0496104_0001965 Ga0496104_0001965_6840_7724 290
332 3300048908 Ga0496105_0005754 Ga0496105_0005754_7426_8310 290
333 3300048910 Ga0496107_0160133 Ga0496107_0160133_697_1581 290
334 3300048912 Ga0496109_0012100 Ga0496109_0012100_1646_2530 290
335 3300048915 Ga0496112_0006687 Ga0496112_0006687_9033_9917 290
336 3300048915 Ga0496112_0177882 Ga0496112_0177882_532_1416 290
337 3300050512 nmdc:mga0n895_159861_c1 nmdc:mga0n895_159861_c1_794_1678 290
338 3300053078 Ga0495612_0009151 Ga0495612_0009151_897_1781 290
339 3300053085 Ga0495619_0020619 Ga0495619_0020619_230_1114 290
340 iso_pu_bacteria 2857558681 2857561933 290
341 iso_pu_bacteria 2904424332 2904429565 290
342 3300005331 Ga0070670_100025573 Ga0070670_1000255733 291
343 3300005334 Ga0068869_100005486 Ga0068869_1000054862 291
344 3300005338 Ga0068868_100036103 Ga0068868_1000361034 291
345 3300005338 Ga0068868_100061532 Ga0068868_1000615322 291
346 3300005343 Ga0070687_100115196 Ga0070687_1001151962 291
347 3300005347 Ga0070668_100001724 Ga0070668_1000017243 291
348 3300005347 Ga0070668_100068947 Ga0070668_1000689472 291
349 3300005347 Ga0070668_100119513 Ga0070668_1001195133 291
350 3300005353 Ga0070669_100011126 Ga0070669_1000111264 291
351 3300005354 Ga0070675_100026322 Ga0070675_1000263223 291
352 3300005355 Ga0070671_100368300 Ga0070671_1003683001 291
353 3300005356 Ga0070674_100067969 Ga0070674_1000679692 291
354 3300005364 Ga0070673_100037390 Ga0070673_1000373905 291
355 3300005367 Ga0070667_100182385 Ga0070667_1001823853 291
356 3300005441 Ga0070700_100255082 Ga0070700_1002550821 291
357 3300005457 Ga0070662_100044204 Ga0070662_1000442042 291
358 3300005459 Ga0068867_100007906 Ga0068867_1000079064 291
359 3300005467 Ga0070706_100091409 Ga0070706_1000914093 291
360 3300005543 Ga0070672_100054868 Ga0070672_1000548682 291
361 3300005543 Ga0070672_100154670 Ga0070672_1001546701 291
362 3300005548 Ga0070665_100072597 Ga0070665_1000725972 291
363 3300005616 Ga0068852_100294908 Ga0068852_1002949082 291
364 3300005617 Ga0068859_100149509 Ga0068859_1001495093 291
365 3300005618 Ga0068864_100002543 Ga0068864_1000025432 291
366 3300005841 Ga0068863_100338383 Ga0068863_1003383832 291
367 3300005842 Ga0068858_100026879 Ga0068858_1000268794 291
368 3300005844 Ga0068862_100004088 Ga0068862_1000040885 291
369 3300006931 Ga0097620_100149502 Ga0097620_1001495023 291
370 3300013306 Ga0163162_10528184 Ga0163162_105281842 291
371 3300025907 Ga0207645_10041538 Ga0207645_100415382 291
372 3300025922 Ga0207646_10164173 Ga0207646_101641732 291
373 3300025925 Ga0207650_10116296 Ga0207650_101162963 291
374 3300025925 Ga0207650_10375647 Ga0207650_103756472 291
375 3300025926 Ga0207659_10031686 Ga0207659_100316862 291
376 3300025937 Ga0207669_10122394 Ga0207669_101223943 291
377 3300025940 Ga0207691_10002611 Ga0207691_100026113 291
378 3300025940 Ga0207691_10161126 Ga0207691_101611262 291
379 3300025942 Ga0207689_10000354 Ga0207689_1000035415 291
380 3300025972 Ga0207668_10020947 Ga0207668_100209473 291
381 3300025986 Ga0207658_10238836 Ga0207658_102388362 291
382 3300026023 Ga0207677_10044752 Ga0207677_100447524 291
383 3300026023 Ga0207677_10289018 Ga0207677_102890182 291
384 3300026035 Ga0207703_10000804 Ga0207703_100008044 291
385 3300026041 Ga0207639_10181406 Ga0207639_101814062 291
386 3300026089 Ga0207648_10004748 Ga0207648_100047484 291
387 3300026089 Ga0207648_10223181 Ga0207648_102231813 291
388 3300026095 Ga0207676_10222181 Ga0207676_102221812 291
389 3300026118 Ga0207675_100003866 Ga0207675_1000038662 291
390 3300026118 Ga0207675_100110868 Ga0207675_1001108682 291
391 3300026121 Ga0207683_10087980 Ga0207683_100879803 291
392 3300026142 Ga0207698_10034617 Ga0207698_100346174 291
393 3300028380 Ga0268265_10004875 Ga0268265_100048757 291
394 3300028381 Ga0268264_10000627 Ga0268264_1000062744 291
395 3300031235 Ga0265330_10001258 Ga0265330_100012583 291
396 3300031238 Ga0265332_10001479 Ga0265332_100014798 291
397 3300031241 Ga0265325_10016943 Ga0265325_100169433 291
398 3300031242 Ga0265329_10001661 Ga0265329_100016613 291
399 3300031344 Ga0265316_10034622 Ga0265316_100346224 291
400 3300031344 Ga0265316_10336986 Ga0265316_103369862 291
401 3300037068 Ga0373925_0066275 Ga0373925_0066275_108_995 291
402 3300046472 Ga0495580_0056713 Ga0495580_0056713_356_1243 291
403 3300048912 Ga0496109_0141337 Ga0496109_0141337_477_1364 291
404 iso_pu_bacteria 2526164512 2526212271 291
405 iso_pu_bacteria 2843690924 2843692431 291
406 iso_pu_bacteria 2846037992 2846042365 291
407 iso_pu_bacteria 2998344455 2998347647 291
408 3300005458 Ga0070681_10075482 Ga0070681_100754822 292
409 3300025912 Ga0207707_10134109 Ga0207707_101341093 292
410 3300029957 Ga0265324_10000448 Ga0265324_100004483 292
411 3300031241 Ga0265325_10015721 Ga0265325_100157213 292
412 3300031251 Ga0265327_10109605 Ga0265327_101096052 292
413 3300035121 Ga0373960_0025903 Ga0373960_0025903_174_1061 292
414 3300042876 Ga0451577_0024692 Ga0451577_0024692_3584_4468 292
415 3300044673 Ga0453683_0052160 Ga0453683_0052160_1104_1988 292
416 3300044712 Ga0453684_0000114 Ga0453684_0000114_185404_186288 292
417 3300044712 Ga0453684_0018530 Ga0453684_0018530_3446_4327 292
418 3300044712 Ga0453684_0059341 Ga0453684_0059341_2120_3004 292
419 3300044712 Ga0453684_0373437 Ga0453684_0373437_331_1215 292
420 3300045051 Ga0451576_0000166 Ga0451576_0000166_120934_121818 292
421 3300045051 Ga0451576_0007439 Ga0451576_0007439_9384_10268 292
422 3300045051 Ga0451576_0023472 Ga0451576_0023472_1681_2565 292
423 3300045051 Ga0451576_0024433 Ga0451576_0024433_2999_3883 292
424 3300045051 Ga0451576_0028815 Ga0451576_0028815_2997_3881 292
425 3300005340 Ga0070689_100146638 Ga0070689_1001466382 293
426 3300005364 Ga0070673_100008218 Ga0070673_1000082186 293
427 3300005441 Ga0070700_100380031 Ga0070700_1003800311 293
428 3300005456 Ga0070678_100092645 Ga0070678_1000926452 293
429 3300005466 Ga0070685_10136900 Ga0070685_101369002 293
430 3300005544 Ga0070686_100402778 Ga0070686_1004027781 293
431 3300005548 Ga0070665_100397300 Ga0070665_1003973002 293
432 3300005549 Ga0070704_100158031 Ga0070704_1001580312 293
433 3300005617 Ga0068859_100007757 Ga0068859_1000077572 293
434 3300005618 Ga0068864_100275892 Ga0068864_1002758922 293
435 3300005719 Ga0068861_100281772 Ga0068861_1002817722 293
436 3300005841 Ga0068863_100031587 Ga0068863_1000315874 293
437 3300005842 Ga0068858_100011845 Ga0068858_1000118452 293
438 3300006237 Ga0097621_100059537 Ga0097621_1000595373 293
439 3300006358 Ga0068871_100306716 Ga0068871_1003067162 293
440 3300006931 Ga0097620_100007756 Ga0097620_10000775611 293
441 3300009101 Ga0105247_10079192 Ga0105247_100791923 293
442 3300009176 Ga0105242_10350381 Ga0105242_103503811 293
443 3300009177 Ga0105248_10006203 Ga0105248_100062033 293
444 3300010375 Ga0105239_10015480 Ga0105239_100154803 293
445 3300011119 Ga0105246_10069737 Ga0105246_100697372 293
446 3300013296 Ga0157374_10010065 Ga0157374_100100655 293
447 3300013306 Ga0163162_10074273 Ga0163162_100742732 293
448 3300013308 Ga0157375_10018912 Ga0157375_100189123 293
449 3300014325 Ga0163163_10051936 Ga0163163_100519362 293
450 3300014968 Ga0157379_10065199 Ga0157379_100651992 293
451 3300014969 Ga0157376_10045764 Ga0157376_100457643 293
452 3300025900 Ga0207710_10042736 Ga0207710_100427363 293
453 3300025926 Ga0207659_10147321 Ga0207659_101473212 293
454 3300025934 Ga0207686_10064741 Ga0207686_100647413 293
455 3300025936 Ga0207670_10117154 Ga0207670_101171542 293
456 3300025938 Ga0207704_10284929 Ga0207704_102849292 293
457 3300025940 Ga0207691_10066884 Ga0207691_100668842 293
458 3300025941 Ga0207711_10003072 Ga0207711_100030725 293
459 3300025942 Ga0207689_10006538 Ga0207689_100065389 293
460 3300025942 Ga0207689_10278613 Ga0207689_102786132 293
461 3300025960 Ga0207651_10111828 Ga0207651_101118283 293
462 3300026023 Ga0207677_10023805 Ga0207677_100238052 293
463 3300026035 Ga0207703_10020477 Ga0207703_100204775 293
464 3300026088 Ga0207641_10056843 Ga0207641_100568432 293
465 3300026089 Ga0207648_10107411 Ga0207648_101074112 293
466 3300026095 Ga0207676_10216446 Ga0207676_102164462 293
467 3300026118 Ga0207675_100087438 Ga0207675_1000874382 293
468 3300026121 Ga0207683_10051470 Ga0207683_100514704 293
469 3300031235 Ga0265330_10012033 Ga0265330_100120332 293
470 3300031250 Ga0265331_10028288 Ga0265331_100282881 293
471 3300031250 Ga0265331_10101560 Ga0265331_101015602 293
472 3300031507 Ga0307509_10340957 Ga0307509_103409571 293
473 3300031665 Ga0316575_10000043 Ga0316575_1000004330 293
474 3300031911 Ga0307412_10088915 Ga0307412_100889153 293
475 3300032002 Ga0307416_100277061 Ga0307416_1002770612 293
476 3300036401 Ga0373937_0323700 Ga0373937_0323700_388_1278 293
477 3300042876 Ga0451577_0118530 Ga0451577_0118530_747_1637 293
478 3300044673 Ga0453683_0023695 Ga0453683_0023695_2716_3606 293
479 3300045051 Ga0451576_0037277 Ga0451576_0037277_413_1303 293
480 3300045051 Ga0451576_0040275 Ga0451576_0040275_2935_3825 293
481 3300048913 Ga0496110_0265795 Ga0496110_0265795_552_1442 293
482 3300005366 Ga0070659_100074768 Ga0070659_1000747682 294
483 3300005435 Ga0070714_100015547 Ga0070714_1000155476 294
484 3300005563 Ga0068855_100043110 Ga0068855_1000431103 294
485 3300009094 Ga0111539_10009829 Ga0111539_100098299 294
486 3300009098 Ga0105245_10178699 Ga0105245_101786991 294
487 3300013100 Ga0157373_10047508 Ga0157373_100475082 294
488 3300013100 Ga0157373_10112473 Ga0157373_101124733 294
489 3300013104 Ga0157370_10016464 Ga0157370_100164644 294
490 3300013297 Ga0157378_10117611 Ga0157378_101176113 294
491 3300014969 Ga0157376_10040128 Ga0157376_100401282 294
492 3300025913 Ga0207695_10260111 Ga0207695_102601112 294
493 3300025927 Ga0207687_10215867 Ga0207687_102158673 294
494 3300025929 Ga0207664_10007111 Ga0207664_100071112 294
495 3300025933 Ga0207706_10038888 Ga0207706_100388882 294
496 3300025949 Ga0207667_10017027 Ga0207667_1001702711 294
497 3300026142 Ga0207698_10168062 Ga0207698_101680622 294
498 3300027907 Ga0207428_10013863 Ga0207428_100138639 294
499 3300027907 Ga0207428_10092880 Ga0207428_100928802 294
500 3300028653 Ga0265323_10013505 Ga0265323_100135053 294
501 3300031344 Ga0265316_10018429 Ga0265316_100184293 294
502 3300031344 Ga0265316_10138180 Ga0265316_101381803 294
503 3300031616 Ga0307508_10012325 Ga0307508_100123253 294
504 3300035084 Ga0373928_0004977 Ga0373928_0004977_1253_2146 294
505 3300037418 Ga0395900_0019530 Ga0395900_0019530_2920_3813 294
506 3300037418 Ga0395900_0121553 Ga0395900_0121553_553_1446 294
507 3300037471 Ga0395905_0005002 Ga0395905_0005002_5486_6379 294
508 3300044712 Ga0453684_0000623 Ga0453684_0000623_23005_23898 294
509 3300048904 Ga0496101_0173036 Ga0496101_0173036_545_1438 294
510 3300048907 Ga0496104_0554497 Ga0496104_0554497_11_904 294
511 3300048911 Ga0496108_0005919 Ga0496108_0005919_2664_3557 294
512 3300048917 Ga0496114_0010696 Ga0496114_0010696_4363_5256 294
513 3300048917 Ga0496114_0304428 Ga0496114_0304428_385_1278 294
514 3300048918 Ga0496115_0069557 Ga0496115_0069557_320_1213 294
515 3300049568 Ga0501031_0002174 Ga0501031_0002174_3317_4210 294
516 3300049568 Ga0501031_0005161 Ga0501031_0005161_1674_2567 294
517 3300049568 Ga0501031_0112465 Ga0501031_0112465_414_1307 294
518 3300049568 Ga0501031_0222448 Ga0501031_0222448_184_1077 294
519 3300049569 Ga0501032_0003661 Ga0501032_0003661_3207_4100 294
520 3300049570 Ga0501033_0005554 Ga0501033_0005554_3076_3969 294
521 3300049570 Ga0501033_0009133 Ga0501033_0009133_4034_4927 294
522 3300049570 Ga0501033_0011745 Ga0501033_0011745_1010_1903 294
523 3300049571 Ga0501034_0009146 Ga0501034_0009146_8170_9063 294
524 3300049572 Ga0501036_0018327 Ga0501036_0018327_1706_2599 294
525 3300049572 Ga0501036_0033402 Ga0501036_0033402_252_1145 294
526 3300049572 Ga0501036_0111332 Ga0501036_0111332_359_1252 294
527 3300049573 Ga0501037_0004141 Ga0501037_0004141_1463_2356 294
528 3300049573 Ga0501037_0060307 Ga0501037_0060307_705_1598 294
529 3300049574 Ga0501038_0004863 Ga0501038_0004863_11150_12043 294
530 3300049574 Ga0501038_0004918 Ga0501038_0004918_8396_9289 294
531 3300049574 Ga0501038_0006265 Ga0501038_0006265_6618_7511 294
532 3300049574 Ga0501038_0008709 Ga0501038_0008709_4263_5156 294
533 3300049574 Ga0501038_0300304 Ga0501038_0300304_104_997 294
534 3300049574 Ga0501038_0300943 Ga0501038_0300943_139_1032 294
535 3300049574 Ga0501038_0430038 Ga0501038_0430038_89_982 294
536 3300049575 Ga0501039_0017522 Ga0501039_0017522_1975_2868 294
537 3300049576 Ga0501040_0001889 Ga0501040_0001889_7859_8752 294
538 3300049578 Ga0501042_0001673 Ga0501042_0001673_8170_9063 294
539 3300049579 Ga0501043_0009685 Ga0501043_0009685_2500_3393 294
540 3300049579 Ga0501043_0211778 Ga0501043_0211778_338_1231 294
541 3300049579 Ga0501043_0335646 Ga0501043_0335646_198_1091 294
542 3300049580 Ga0501046_0003282 Ga0501046_0003282_9809_10702 294
543 3300049580 Ga0501046_0029693 Ga0501046_0029693_662_1555 294
544 3300049581 Ga0501047_0031198 Ga0501047_0031198_931_1824 294
545 3300049581 Ga0501047_0317882 Ga0501047_0317882_195_1088 294
546 3300049582 Ga0501048_0005615 Ga0501048_0005615_3764_4657 294
547 3300049584 Ga0501068_0001418 Ga0501068_0001418_8879_9772 294
548 3300049822 Ga0501035_0003875 Ga0501035_0003875_5466_6359 294
549 3300049822 Ga0501035_0018997 Ga0501035_0018997_1277_2170 294
550 3300049822 Ga0501035_0024993 Ga0501035_0024993_1670_2563 294
551 3300049822 Ga0501035_0333918 Ga0501035_0333918_16_909 294
552 3300049823 Ga0501044_0006304 Ga0501044_0006304_8180_9073 294
553 3300049823 Ga0501044_0007300 Ga0501044_0007300_8170_9063 294
554 3300049823 Ga0501044_0059187 Ga0501044_0059187_151_1044 294
555 3300049823 Ga0501044_0155656 Ga0501044_0155656_899_1792 294
556 3300049824 Ga0501045_0123264 Ga0501045_0123264_1010_1903 294
557 3300050511 nmdc:mga08y16_31378_c1 nmdc:mga08y16_31378_c1_1031_1924 294
558 3300005290 Ga0065712_10078545 Ga0065712_100785454 295
559 3300005327 Ga0070658_10006078 Ga0070658_100060786 295
560 3300005327 Ga0070658_10014263 Ga0070658_100142633 295
561 3300005327 Ga0070658_10292253 Ga0070658_102922531 295
562 3300005329 Ga0070683_100408010 Ga0070683_1004080102 295
563 3300005330 Ga0070690_100047414 Ga0070690_1000474143 295
564 3300005334 Ga0068869_100076604 Ga0068869_1000766042 295
565 3300005339 Ga0070660_100124427 Ga0070660_1001244272 295
566 3300005434 Ga0070709_10112717 Ga0070709_101127172 295
567 3300005435 Ga0070714_100050194 Ga0070714_1000501943 295
568 3300005436 Ga0070713_100087771 Ga0070713_1000877711 295
569 3300005440 Ga0070705_100173673 Ga0070705_1001736732 295
570 3300005458 Ga0070681_10006660 Ga0070681_100066603 295
571 3300005530 Ga0070679_100010085 Ga0070679_1000100857 295
572 3300005530 Ga0070679_100015526 Ga0070679_1000155262 295
573 3300005530 Ga0070679_100509638 Ga0070679_1005096382 295
574 3300005535 Ga0070684_100117514 Ga0070684_1001175143 295
575 3300005539 Ga0068853_100074850 Ga0068853_1000748502 295
576 3300005543 Ga0070672_100028153 Ga0070672_1000281532 295
577 3300005547 Ga0070693_100045002 Ga0070693_1000450022 295
578 3300005563 Ga0068855_100017466 Ga0068855_1000174662 295
579 3300005616 Ga0068852_100001134 Ga0068852_1000011343 295
580 3300005616 Ga0068852_100019290 Ga0068852_1000192903 295
581 3300005616 Ga0068852_100193310 Ga0068852_1001933102 295
582 3300005616 Ga0068852_100195347 Ga0068852_1001953472 295
583 3300005617 Ga0068859_100144063 Ga0068859_1001440633 295
584 3300005618 Ga0068864_100270224 Ga0068864_1002702242 295
585 3300005834 Ga0068851_10003401 Ga0068851_100034019 295
586 3300005842 Ga0068858_100080458 Ga0068858_1000804582 295
587 3300005843 Ga0068860_100134448 Ga0068860_1001344482 295
588 3300006195 Ga0075366_10007379 Ga0075366_100073794 295
589 3300006237 Ga0097621_100043537 Ga0097621_1000435373 295
590 3300006237 Ga0097621_100051122 Ga0097621_1000511222 295
591 3300006237 Ga0097621_100166053 Ga0097621_1001660532 295
592 3300006237 Ga0097621_100173157 Ga0097621_1001731572 295
593 3300006353 Ga0075370_10059534 Ga0075370_100595342 295
594 3300006358 Ga0068871_100009363 Ga0068871_1000093636 295
595 3300006358 Ga0068871_100176340 Ga0068871_1001763403 295
596 3300006358 Ga0068871_100247518 Ga0068871_1002475182 295
597 3300006358 Ga0068871_100272829 Ga0068871_1002728292 295
598 3300006846 Ga0075430_100005251 Ga0075430_1000052518 295
599 3300006847 Ga0075431_100008882 Ga0075431_1000088826 295
600 3300006881 Ga0068865_100070682 Ga0068865_1000706823 295
601 3300006931 Ga0097620_100144066 Ga0097620_1001440663 295
602 3300009093 Ga0105240_10006302 Ga0105240_1000630216 295
603 3300009093 Ga0105240_10043257 Ga0105240_100432576 295
604 3300009093 Ga0105240_10103453 Ga0105240_101034532 295
605 3300009098 Ga0105245_10174926 Ga0105245_101749262 295
606 3300009098 Ga0105245_10328993 Ga0105245_103289932 295
607 3300009098 Ga0105245_10538542 Ga0105245_105385422 295
608 3300009176 Ga0105242_10071578 Ga0105242_100715783 295
609 3300009177 Ga0105248_10016620 Ga0105248_100166204 295
610 3300009177 Ga0105248_10063274 Ga0105248_100632742 295
611 3300009551 Ga0105238_10037056 Ga0105238_100370562 295
612 3300013104 Ga0157370_10099838 Ga0157370_100998383 295
613 3300013105 Ga0157369_10155058 Ga0157369_101550583 295
614 3300013105 Ga0157369_10334410 Ga0157369_103344102 295
615 3300013296 Ga0157374_10018896 Ga0157374_100188965 295
616 3300013296 Ga0157374_10077224 Ga0157374_100772242 295
617 3300013297 Ga0157378_10087733 Ga0157378_100877332 295
618 3300013306 Ga0163162_10302948 Ga0163162_103029482 295
619 3300013307 Ga0157372_10042431 Ga0157372_100424312 295
620 3300013307 Ga0157372_10157907 Ga0157372_101579072 295
621 3300014745 Ga0157377_10005227 Ga0157377_100052274 295
622 3300014969 Ga0157376_10041375 Ga0157376_100413753 295
623 3300014969 Ga0157376_10148201 Ga0157376_101482013 295
624 3300021361 Ga0213872_10016591 Ga0213872_100165912 295
625 3300021361 Ga0213872_10078618 Ga0213872_100786182 295
626 3300021384 Ga0213876_10050524 Ga0213876_100505242 295
627 3300025321 Ga0207656_10012110 Ga0207656_100121102 295
628 3300025906 Ga0207699_10116162 Ga0207699_101161622 295
629 3300025908 Ga0207643_10124399 Ga0207643_101243992 295
630 3300025909 Ga0207705_10002838 Ga0207705_100028389 295
631 3300025909 Ga0207705_10003073 Ga0207705_100030734 295
632 3300025909 Ga0207705_10039414 Ga0207705_100394142 295
633 3300025912 Ga0207707_10069650 Ga0207707_100696502 295
634 3300025913 Ga0207695_10003096 Ga0207695_1000309626 295
635 3300025913 Ga0207695_10117907 Ga0207695_101179073 295
636 3300025915 Ga0207693_10079621 Ga0207693_100796213 295
637 3300025916 Ga0207663_10031320 Ga0207663_100313202 295
638 3300025919 Ga0207657_10055107 Ga0207657_100551072 295
639 3300025921 Ga0207652_10003246 Ga0207652_1000324610 295
640 3300025921 Ga0207652_10025960 Ga0207652_100259604 295
641 3300025921 Ga0207652_10369513 Ga0207652_103695131 295
642 3300025924 Ga0207694_10012151 Ga0207694_100121516 295
643 3300025924 Ga0207694_10129498 Ga0207694_101294983 295
644 3300025926 Ga0207659_10038240 Ga0207659_100382403 295
645 3300025927 Ga0207687_10243282 Ga0207687_102432822 295
646 3300025928 Ga0207700_10156590 Ga0207700_101565903 295
647 3300025929 Ga0207664_10055940 Ga0207664_100559402 295
648 3300025938 Ga0207704_10079819 Ga0207704_100798192 295
649 3300025941 Ga0207711_10211394 Ga0207711_102113942 295
650 3300025949 Ga0207667_10004383 Ga0207667_1000438315 295
651 3300026023 Ga0207677_10032144 Ga0207677_100321442 295
652 3300026023 Ga0207677_10365403 Ga0207677_103654032 295
653 3300026035 Ga0207703_10010532 Ga0207703_100105322 295
654 3300026078 Ga0207702_10590090 Ga0207702_105900902 295
655 3300026095 Ga0207676_10390951 Ga0207676_103909512 295
656 3300026142 Ga0207698_10018160 Ga0207698_100181604 295
657 3300031507 Ga0307509_10000072 Ga0307509_1000007294 295
658 3300031824 Ga0307413_10039164 Ga0307413_100391642 295
659 3300031852 Ga0307410_10039295 Ga0307410_100392951 295
660 3300031995 Ga0307409_100328629 Ga0307409_1003286292 295
661 3300032002 Ga0307416_100052937 Ga0307416_1000529372 295
662 3300032002 Ga0307416_100380303 Ga0307416_1003803032 295
663 3300032005 Ga0307411_10031480 Ga0307411_100314803 295
664 3300032005 Ga0307411_10280585 Ga0307411_102805852 295
665 3300032126 Ga0307415_100125275 Ga0307415_1001252753 295
666 3300035695 Ga0373927_0262003 Ga0373927_0262003_17_913 295
667 3300035724 Ga0373933_0115504 Ga0373933_0115504_63_959 295
668 3300037068 Ga0373925_0027214 Ga0373925_0027214_1272_2168 295
669 3300039437 Ga0436365_0249810 Ga0436365_0249810_824_1720 295
670 3300039437 Ga0436365_0619540 Ga0436365_0619540_357_1253 295
671 3300039447 Ga0436361_0562316 Ga0436361_0562316_267_1163 295
672 3300039447 Ga0436361_0613315 Ga0436361_0613315_561_1457 295
673 3300046463 Ga0495653_0186830 Ga0495653_0186830_308_1204 295
674 3300046511 Ga0495608_0041909 Ga0495608_0041909_865_1761 295
675 3300046537 Ga0495598_0052575 Ga0495598_0052575_246_1142 295
676 3300046539 Ga0495621_0009589 Ga0495621_0009589_499_1395 295
677 3300046543 Ga0495645_0057531 Ga0495645_0057531_338_1234 295
678 3300046663 Ga0495635_0091773 Ga0495635_0091773_1023_1919 295
679 3300046678 Ga0495599_0001603 Ga0495599_0001603_2251_3147 295
680 3300047471 Ga0495684_0055761 Ga0495684_0055761_949_1845 295
681 3300048907 Ga0496104_0012365 Ga0496104_0012365_3677_4573 295
682 3300049588 Ga0501072_0247656 Ga0501072_0247656_473_1369 295
683 3300050496 nmdc:mga07m45_114720_c1 nmdc:mga07m45_114720_c1_144_1040 295
684 3300050508 nmdc:mga09592_56284_c1 nmdc:mga09592_56284_c1_2101_2994 295
685 3300050509 nmdc:mga0qj67_73707_c1 nmdc:mga0qj67_73707_c1_1346_2239 295
686 3300050510 nmdc:mga06r32_24270_c1 nmdc:mga06r32_24270_c1_2441_3334 295
687 3300053077 Ga0495601_0060165 Ga0495601_0060165_889_1785 295
688 iso_pu_bacteria 2547132512 2548849317 295
689 3300005329 Ga0070683_100001788 Ga0070683_10000178813 296
690 3300005331 Ga0070670_100000732 Ga0070670_10000073227 296
691 3300005331 Ga0070670_100328728 Ga0070670_1003287281 296
692 3300005333 Ga0070677_10057910 Ga0070677_100579102 296
693 3300005334 Ga0068869_100075504 Ga0068869_1000755044 296
694 3300005338 Ga0068868_100000144 Ga0068868_10000014421 296
695 3300005344 Ga0070661_100000601 Ga0070661_1000006015 296
696 3300005354 Ga0070675_100003810 Ga0070675_1000038107 296
697 3300005354 Ga0070675_100121920 Ga0070675_1001219201 296
698 3300005355 Ga0070671_100001156 Ga0070671_1000011562 296
699 3300005364 Ga0070673_100001686 Ga0070673_1000016866 296
700 3300005456 Ga0070678_100000019 Ga0070678_1000000195 296
701 3300005459 Ga0068867_100026778 Ga0068867_1000267782 296
702 3300005466 Ga0070685_10048220 Ga0070685_100482202 296
703 3300005468 Ga0070707_100012077 Ga0070707_1000120774 296
704 3300005530 Ga0070679_100092317 Ga0070679_1000923173 296
705 3300005535 Ga0070684_100057055 Ga0070684_1000570551 296
706 3300005539 Ga0068853_100116004 Ga0068853_1001160042 296
707 3300005543 Ga0070672_100000151 Ga0070672_10000015132 296
708 3300005545 Ga0070695_100112029 Ga0070695_1001120292 296
709 3300005546 Ga0070696_100156059 Ga0070696_1001560592 296
710 3300005549 Ga0070704_100209581 Ga0070704_1002095812 296
711 3300005564 Ga0070664_100000957 Ga0070664_1000009575 296
712 3300005564 Ga0070664_100083343 Ga0070664_1000833434 296
713 3300005578 Ga0068854_100003057 Ga0068854_10000305710 296
714 3300005578 Ga0068854_100122142 Ga0068854_1001221422 296
715 3300005616 Ga0068852_100000486 Ga0068852_10000048626 296
716 3300005618 Ga0068864_100019099 Ga0068864_1000190992 296
717 3300005618 Ga0068864_100020001 Ga0068864_1000200014 296
718 3300005719 Ga0068861_100132928 Ga0068861_1001329282 296
719 3300005834 Ga0068851_10012253 Ga0068851_100122532 296
720 3300005840 Ga0068870_10025360 Ga0068870_100253602 296
721 3300005841 Ga0068863_100138274 Ga0068863_1001382742 296
722 3300005841 Ga0068863_100438035 Ga0068863_1004380351 296
723 3300005844 Ga0068862_100084972 Ga0068862_1000849722 296
724 3300006237 Ga0097621_100000274 Ga0097621_10000027423 296
725 3300006358 Ga0068871_100000325 Ga0068871_10000032517 296
726 3300006358 Ga0068871_100067718 Ga0068871_1000677182 296
727 3300006881 Ga0068865_100084358 Ga0068865_1000843583 296
728 3300009094 Ga0111539_10116543 Ga0111539_101165433 296
729 3300009177 Ga0105248_10277813 Ga0105248_102778132 296
730 3300009553 Ga0105249_10065135 Ga0105249_100651354 296
731 3300013296 Ga0157374_10001008 Ga0157374_100010084 296
732 3300013306 Ga0163162_10010907 Ga0163162_100109074 296
733 3300013306 Ga0163162_10891621 Ga0163162_108916211 296
734 3300013308 Ga0157375_10021322 Ga0157375_100213225 296
735 3300014325 Ga0163163_10539677 Ga0163163_105396772 296
736 3300014745 Ga0157377_10009052 Ga0157377_100090524 296
737 3300014968 Ga0157379_10062548 Ga0157379_100625483 296
738 3300014969 Ga0157376_10006156 Ga0157376_100061566 296
739 3300014969 Ga0157376_10390925 Ga0157376_103909251 296
740 3300017792 Ga0163161_10045551 Ga0163161_100455513 296
741 3300025315 Ga0207697_10030079 Ga0207697_100300792 296
742 3300025893 Ga0207682_10001428 Ga0207682_100014285 296
743 3300025901 Ga0207688_10013311 Ga0207688_100133112 296
744 3300025907 Ga0207645_10016330 Ga0207645_100163302 296
745 3300025907 Ga0207645_10030020 Ga0207645_100300204 296
746 3300025908 Ga0207643_10030604 Ga0207643_100306043 296
747 3300025908 Ga0207643_10069315 Ga0207643_100693152 296
748 3300025918 Ga0207662_10007103 Ga0207662_100071032 296
749 3300025920 Ga0207649_10001372 Ga0207649_1000137211 296
750 3300025923 Ga0207681_10034573 Ga0207681_100345734 296
751 3300025925 Ga0207650_10000798 Ga0207650_1000079818 296
752 3300025925 Ga0207650_10221988 Ga0207650_102219881 296
753 3300025926 Ga0207659_10001152 Ga0207659_100011525 296
754 3300025926 Ga0207659_10220635 Ga0207659_102206352 296
755 3300025931 Ga0207644_10000221 Ga0207644_1000022119 296
756 3300025931 Ga0207644_10208437 Ga0207644_102084371 296
757 3300025933 Ga0207706_10038966 Ga0207706_100389662 296
758 3300025935 Ga0207709_10031534 Ga0207709_100315343 296
759 3300025940 Ga0207691_10000413 Ga0207691_1000041315 296
760 3300025940 Ga0207691_10099368 Ga0207691_100993682 296
761 3300025944 Ga0207661_10010056 Ga0207661_100100564 296
762 3300025945 Ga0207679_10004829 Ga0207679_100048296 296
763 3300025960 Ga0207651_10000142 Ga0207651_1000014218 296
764 3300025961 Ga0207712_10193422 Ga0207712_101934221 296
765 3300025986 Ga0207658_10159129 Ga0207658_101591293 296
766 3300026023 Ga0207677_10000329 Ga0207677_1000032918 296
767 3300026035 Ga0207703_10552185 Ga0207703_105521852 296
768 3300026075 Ga0207708_10004528 Ga0207708_100045283 296
769 3300026088 Ga0207641_10063307 Ga0207641_100633074 296
770 3300026088 Ga0207641_10079952 Ga0207641_100799522 296
771 3300026089 Ga0207648_10051621 Ga0207648_100516214 296
772 3300026095 Ga0207676_10010718 Ga0207676_100107185 296
773 3300026095 Ga0207676_10058014 Ga0207676_100580144 296
774 3300026116 Ga0207674_10106526 Ga0207674_101065262 296
775 3300026118 Ga0207675_100065116 Ga0207675_1000651162 296
776 3300026121 Ga0207683_10000588 Ga0207683_1000058823 296
777 3300026121 Ga0207683_10048815 Ga0207683_100488155 296
778 3300026142 Ga0207698_10000233 Ga0207698_1000023334 296
779 3300027360 Ga0209969_1000127 Ga0209969_10001273 296
780 3300027424 Ga0209984_1006607 Ga0209984_10066072 296
781 3300027471 Ga0209995_1000640 Ga0209995_10006404 296
782 3300027876 Ga0209974_10001161 Ga0209974_100011612 296
783 3300027907 Ga0207428_10070732 Ga0207428_100707322 296
784 3300027907 Ga0207428_10148371 Ga0207428_101483712 296
785 3300028380 Ga0268265_10262605 Ga0268265_102626052 296
786 3300028381 Ga0268264_10107933 Ga0268264_101079331 296
787 3300028577 Ga0265318_10009581 Ga0265318_100095812 296
788 3300031235 Ga0265330_10087583 Ga0265330_100875832 296
789 3300031238 Ga0265332_10082478 Ga0265332_100824782 296
790 3300031239 Ga0265328_10000785 Ga0265328_1000078516 296
791 3300031242 Ga0265329_10008649 Ga0265329_100086493 296
792 3300031250 Ga0265331_10000714 Ga0265331_1000071410 296
793 3300031344 Ga0265316_10086607 Ga0265316_100866073 296
794 3300031711 Ga0265314_10000166 Ga0265314_1000016645 296
795 3300042436 Ga0439435_0054433 Ga0439435_0054433_96_995 296
796 3300046525 Ga0495663_0033232 Ga0495663_0033232_549_1448 296
797 3300048903 Ga0496100_0152030 Ga0496100_0152030_186_1085 296
798 3300048904 Ga0496101_0221092 Ga0496101_0221092_14_913 296
799 3300048907 Ga0496104_0241154 Ga0496104_0241154_166_1065 296
800 3300048911 Ga0496108_0027226 Ga0496108_0027226_3643_4542 296
801 3300048912 Ga0496109_0063121 Ga0496109_0063121_1190_2089 296
802 3300048913 Ga0496110_0002718 Ga0496110_0002718_6216_7115 296
803 3300048917 Ga0496114_0005749 Ga0496114_0005749_1175_2074 296
804 3300049591 Ga0501075_0097371 Ga0501075_0097371_292_1191 296
805 3300049743 Ga0501081_0067272 Ga0501081_0067272_673_1572 296
806 3300050511 nmdc:mga08y16_252870_c1 nmdc:mga08y16_252870_c1_392_1291 296
807 3300005518 Ga0070699_100050568 Ga0070699_1000505683 297
808 3300005546 Ga0070696_100028401 Ga0070696_1000284014 297
809 3300005615 Ga0070702_100102043 Ga0070702_1001020432 297
810 3300031711 Ga0265314_10165093 Ga0265314_101650932 297
811 3300041512 Ga0451853_3251761 Ga0451853_3251761_286_1191 297
812 3300042436 Ga0439435_0035526 Ga0439435_0035526_356_1258 297
813 3300046528 Ga0495642_0047329 Ga0495642_0047329_104_1009 298
814 3300046537 Ga0495598_0020872 Ga0495598_0020872_216_1121 298
815 3300046684 Ga0495669_0013709 Ga0495669_0013709_1975_2880 298
816 3300049592 Ga0501076_0000441 Ga0501076_0000441_25273_26178 298
817 3300050511 nmdc:mga08y16_45483_c1 nmdc:mga08y16_45483_c1_258_1163 298
818 3300005546 Ga0070696_100393929 Ga0070696_1003939291 299
819 3300006844 Ga0075428_100001689 Ga0075428_10000168917 299
820 3300006844 Ga0075428_100011896 Ga0075428_1000118962 299
821 3300009094 Ga0111539_10000486 Ga0111539_1000048617 299
822 3300009094 Ga0111539_10001478 Ga0111539_1000147819 299
823 3300009094 Ga0111539_10009420 Ga0111539_1000942012 299
824 3300014326 Ga0157380_10237716 Ga0157380_102377162 299
825 3300027907 Ga0207428_10002833 Ga0207428_1000283313 299
826 3300027907 Ga0207428_10008728 Ga0207428_100087285 299
827 3300031238 Ga0265332_10000004 Ga0265332_10000004237 299
828 3300035242 Ga0373962_0020448 Ga0373962_0020448_130_1038 299
829 3300049577 Ga0501041_0059554 Ga0501041_0059554_1346_2254 299
830 3300049579 Ga0501043_0076663 Ga0501043_0076663_1461_2369 299
831 3300050511 nmdc:mga08y16_16326_c1 nmdc:mga08y16_16326_c1_5068_5985 299
832 3300050511 nmdc:mga08y16_6277_c1 nmdc:mga08y16_6277_c1_385_1293 299
833 3300050511 nmdc:mga08y16_78634_c1 nmdc:mga08y16_78634_c1_1806_2714 299
834 3300005441 Ga0070700_100185410 Ga0070700_1001854102 300
835 3300005617 Ga0068859_100056838 Ga0068859_1000568383 300
836 3300006931 Ga0097620_100056838 Ga0097620_1000568383 300
837 3300025925 Ga0207650_10024454 Ga0207650_100244543 300
838 3300031911 Ga0307412_10487569 Ga0307412_104875692 300
839 3300049571 Ga0501034_0004775 Ga0501034_0004775_4879_5826 300
840 3300050512 nmdc:mga0n895_521502_c1 nmdc:mga0n895_521502_c1_12_926 300
841 3300050514 nmdc:mga08x19_4020_c1 nmdc:mga08x19_4020_c1_3090_4004 300
842 3300006871 Ga0075434_100635771 Ga0075434_1006357712 301
843 3300009176 Ga0105242_10014784 Ga0105242_100147843 301
844 3300009177 Ga0105248_10048319 Ga0105248_100483192 301
845 3300009551 Ga0105238_10140287 Ga0105238_101402871 301
846 3300010375 Ga0105239_10594107 Ga0105239_105941072 301
847 3300013306 Ga0163162_10108759 Ga0163162_101087593 301
848 3300014968 Ga0157379_10014692 Ga0157379_100146922 301
849 3300025935 Ga0207709_10038494 Ga0207709_100384942 301
850 3300026121 Ga0207683_10107331 Ga0207683_101073312 301
851 3300034816 Ga0373930_0020118 Ga0373930_0020118_272_1186 301
852 3300009093 Ga0105240_10032013 Ga0105240_100320138 302
853 3300009545 Ga0105237_10049334 Ga0105237_100493344 302
854 3300003763 Ga0055529_1001152 Ga0055529_10011524 306
855 3300025272 Ga0209455_1001983 Ga0209455_10019835 306
856 3300049822 Ga0501035_0011429 Ga0501035_0011429_1251_2171 306
857 3300049822 Ga0501035_0013582 Ga0501035_0013582_692_1612 306
858 3300049823 Ga0501044_0000126 Ga0501044_0000126_85070_85990 306

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00348

polyprenyl_synt

Polyprenyl synthetase

49

294

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
7lbj-assembly1.cif.gz_B crystal structure of octaprenyl diphosphate synthase from stenotrophomonas maltophilia 0.9723 12 306
7lbj-assembly1.cif.gz_B crystal structure of octaprenyl diphosphate synthase from stenotrophomonas maltophilia 0.9619 12 306
7lbj-assembly1.cif.gz_A crystal structure of octaprenyl diphosphate synthase from stenotrophomonas maltophilia 0.9607 10 306
7my7-assembly2.cif.gz_CCC se-crte n-term his-tag structure 0.9579 12 230
7lbj-assembly1.cif.gz_A crystal structure of octaprenyl diphosphate synthase from stenotrophomonas maltophilia 0.9573 10 306
ID Description Score Start End Superfamily
5aypA00 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.9521 12 304 1.10.600.10
3zcdA00 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.9435 13 304 1.10.600.10
5aypA00 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.9413 12 304 1.10.600.10
4kkmB00 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.9377 13 301 1.10.600.10
af_A0A0P0V0B7_118_416_1.10.600.10 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.9326 9 306 1.10.600.10
ID Description Score Start End GO Terms
AF-A0A3E0MXZ8-F1-model_v4 Polyprenyl synthetase family protein 0.989 119 306 GO:0004659
GO:0008299
AF-A0A353NCF4-F1-model_v4 Farnesyl-diphosphate synthase 0.9887 86 306 GO:0004659
GO:0005737
GO:0008299
AF-A0A3C1XTI3-F1-model_v4 Geranyl transferase 0.988 72 306 GO:0004659
GO:0005737
GO:0008299
AF-A0A357NMF4-F1-model_v4 deleted 0.9862 11 265
AF-A0A5N0KNE7-F1-model_v4 deleted 0.9851 11 306

Feature Viewer

pLDDT pTM Quality
91.62 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map