F483704

General Info

Members Datasets Scaffolds Average Seq Length
857 346 1714 113

Family's Representative Sequence

Representative Sequence 3300048916|Ga0496113_1229272|Ga0496113_1229272_13_411
Length 132
Sequence MARQKGWTHLETLRHETEAGPRGRDLLPGTLDMLILKAVSLKPLHGYGVLLRIAQISKDVLEVPQGSLYPALYRLEHQGLIRAEWGESENKRRAKFYTLTAAGRKRLREETASWNRLVAAIASSLNATPDEV

Samples

Sample ID Description Type Environment
1 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
69 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
70 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
71 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
72 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
73 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
74 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
79 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
80 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
87 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
88 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
93 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
96 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
104 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
105 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
111 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
112 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
116 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
117 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
118 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
119 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
120 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
181 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
182 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
186 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
187 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
188 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
191 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
192 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
193 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
194 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
195 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
196 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
197 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
198 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
199 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
200 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
201 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
202 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
203 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
204 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
205 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
206 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
207 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
208 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
209 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
210 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
211 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
212 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
213 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
214 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
215 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
216 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
217 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
218 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
219 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
220 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
221 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
222 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
223 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
224 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
225 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
226 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
227 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
228 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
229 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
230 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
231 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
232 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
233 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
234 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
235 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
236 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
237 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
238 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
239 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
240 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
241 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
242 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
243 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
244 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
245 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
246 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
247 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
248 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
249 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
250 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
251 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
252 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
253 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
254 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
255 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
256 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
257 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
258 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
259 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
260 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
261 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
262 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
263 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
264 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
265 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
266 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
267 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
268 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
269 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
270 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
271 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
272 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
273 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
274 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
275 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
276 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
277 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
278 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
279 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
280 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
281 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
282 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
283 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
284 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
285 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
286 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
287 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
288 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
289 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
290 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
291 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
292 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
293 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
294 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
295 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
296 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
297 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
298 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
299 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
300 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
301 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
302 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
303 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
304 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
305 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
306 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
308 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
309 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
310 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
311 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
312 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
313 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
314 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
315 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
316 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
317 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
318 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
319 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
320 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
321 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
322 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
323 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
324 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
325 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
326 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
327 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
328 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
329 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
330 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
331 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
332 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
333 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
334 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
335 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
336 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
337 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
338 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
339 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
340 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
341 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
342 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
343 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
344 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
345 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
346 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.65
Metatranscriptomes 0.35
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.7
Nodule 0
Rhizoplane 2.57
Rhizosphere 95.33
Stem 0
Stem Tuber 0
Unclassified 25.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496113_1229272 3300048916 Unclassified 584
2 JGI25406J46586_10136701 3300003203 Unclassified 717
3 Ga0065704_10642450 3300005289 Bacteria 586
4 Ga0065704_10714912 3300005289 Bacteria 555
5 Ga0065712_10023227 3300005290 Unclassified 1861
6 Ga0065715_10100204 3300005293 Unclassified 3245
7 Ga0065715_10452221 3300005293 Unclassified 825
8 Ga0065707_10057089 3300005295 Bacteria 738
9 Ga0065707_10106673 3300005295 Unclassified 2586
10 Ga0065707_10512391 3300005295 Bacteria 746
11 Ga0070676_10081314 3300005328 Bacteria 1966
12 Ga0070676_10493399 3300005328 Bacteria 868
13 Ga0070690_100067802 3300005330 Bacteria 2313
14 Ga0070690_100675397 3300005330 Bacteria 791
15 Ga0070670_100344735 3300005331 Bacteria 1308
16 Ga0070670_100361179 3300005331 Bacteria 1277
17 Ga0070670_101622145 3300005331 Unclassified 595
18 Ga0068869_100104990 3300005334 Bacteria 2142
19 Ga0070666_10072832 3300005335 Bacteria 2339
20 Ga0070666_10127792 3300005335 Bacteria 1765
21 Ga0070666_10163084 3300005335 Bacteria 1558
22 Ga0070666_10290037 3300005335 Unclassified 1164
23 Ga0070680_100064423 3300005336 Bacteria 3004
24 Ga0070680_100408216 3300005336 Bacteria 1158
25 Ga0070680_101867175 3300005336 Bacteria 521
26 Ga0068868_100009734 3300005338 Bacteria 6934
27 Ga0068868_100128994 3300005338 Bacteria 2068
28 Ga0070689_100124184 3300005340 Bacteria 2064
29 Ga0070689_100245927 3300005340 Bacteria 1475
30 Ga0070687_100287124 3300005343 Bacteria 1038
31 Ga0070692_10013391 3300005345 Bacteria 3822
32 Ga0070668_100028193 3300005347 Unclassified 4264
33 Ga0070668_100470055 3300005347 Bacteria 1084
34 Ga0070669_100005284 3300005353 Bacteria 9324
35 Ga0070669_100006383 3300005353 Bacteria 8492
36 Ga0070675_100318647 3300005354 Bacteria 1373
37 Ga0070675_100776253 3300005354 Bacteria 875
38 Ga0070675_102071856 3300005354 Unclassified 524
39 Ga0070671_100018548 3300005355 Bacteria 5652
40 Ga0070674_100015060 3300005356 Unclassified 4820
41 Ga0070674_100153256 3300005356 Bacteria 1741
42 Ga0070674_100354327 3300005356 Unclassified 1186
43 Ga0070674_101519221 3300005356 Unclassified 602
44 Ga0070673_100105394 3300005364 Bacteria 2329
45 Ga0070673_100120304 3300005364 Bacteria 2190
46 Ga0070673_100140821 3300005364 Bacteria 2034
47 Ga0070673_100409303 3300005364 Unclassified 1214
48 Ga0070673_100472553 3300005364 Unclassified 1131
49 Ga0070673_101103225 3300005364 Unclassified 741
50 Ga0070673_101196935 3300005364 Unclassified 712
51 Ga0070673_102080572 3300005364 Unclassified 539
52 Ga0070688_100499098 3300005365 Bacteria 917
53 Ga0070659_101146179 3300005366 Bacteria 686
54 Ga0070667_100092483 3300005367 Unclassified 2602
55 Ga0070667_100206653 3300005367 Unclassified 1744
56 Ga0070667_101647969 3300005367 Unclassified 603
57 Ga0070703_10135063 3300005406 Bacteria 910
58 Ga0070709_10011645 3300005434 Bacteria 4908
59 Ga0070714_100088418 3300005435 Unclassified 2711
60 Ga0070713_100000984 3300005436 Bacteria 18251
61 Ga0070701_10044340 3300005438 Bacteria 2278
62 Ga0070701_11268647 3300005438 Bacteria 525
63 Ga0070705_100670169 3300005440 Bacteria 811
64 Ga0070705_100772111 3300005440 Bacteria 762
65 Ga0070700_100133688 3300005441 Bacteria 1677
66 Ga0070700_100180920 3300005441 Unclassified 1467
67 Ga0070700_100286601 3300005441 Bacteria 1196
68 Ga0070700_100615321 3300005441 Bacteria 853
69 Ga0070694_100042336 3300005444 Unclassified 3042
70 Ga0070694_100117752 3300005444 Unclassified 1902
71 Ga0070694_100600522 3300005444 Bacteria 886
72 Ga0070694_100854780 3300005444 Bacteria 749
73 Ga0070694_101191394 3300005444 Bacteria 638
74 Ga0070708_100505875 3300005445 Bacteria 1139
75 Ga0070708_100668120 3300005445 Bacteria 979
76 Ga0070663_100028077 3300005455 Bacteria 3827
77 Ga0070663_100246270 3300005455 Bacteria 1413
78 Ga0070678_100110805 3300005456 Unclassified 2147
79 Ga0070678_101053596 3300005456 Bacteria 749
80 Ga0070678_101618724 3300005456 Unclassified 608
81 Ga0070662_100024019 3300005457 Bacteria 4195
82 Ga0070662_100028892 3300005457 Bacteria 3865
83 Ga0070662_100578665 3300005457 Bacteria 943
84 Ga0070662_101362751 3300005457 Unclassified 611
85 Ga0068867_100040666 3300005459 Bacteria 3395
86 Ga0068867_100763470 3300005459 Bacteria 859
87 Ga0068867_102043338 3300005459 Bacteria 542
88 Ga0070685_10607946 3300005466 Bacteria 787
89 Ga0070706_100944460 3300005467 Bacteria 796
90 Ga0070706_101265809 3300005467 Unclassified 677
91 Ga0070707_100195471 3300005468 Bacteria 1972
92 Ga0070707_100820204 3300005468 Unclassified 894
93 Ga0070707_101632028 3300005468 Unclassified 612
94 Ga0070698_100000238 3300005471 Bacteria 54785
95 Ga0070698_100021808 3300005471 Bacteria 6708
96 Ga0070698_100115001 3300005471 Bacteria 2655
97 Ga0070698_101014660 3300005471 Unclassified 777
98 Ga0070698_101174334 3300005471 Bacteria 717
99 Ga0070698_101642769 3300005471 Unclassified 595
100 Ga0070699_100087646 3300005518 Unclassified 2717
101 Ga0070699_100215502 3300005518 Bacteria 1710
102 Ga0070699_101177112 3300005518 Bacteria 703
103 Ga0070699_101325639 3300005518 Bacteria 660
104 Ga0070679_100047987 3300005530 Bacteria 4255
105 Ga0070679_100914151 3300005530 Unclassified 821
106 Ga0070684_100036998 3300005535 Bacteria 4185
107 Ga0070684_100216420 3300005535 Unclassified 1747
108 Ga0070684_100988628 3300005535 Unclassified 790
109 Ga0070697_100035456 3300005536 Bacteria 4024
110 Ga0068853_100818465 3300005539 Unclassified 892
111 Ga0070672_100071910 3300005543 Bacteria 2753
112 Ga0070672_100093132 3300005543 Bacteria 2434
113 Ga0070672_100696032 3300005543 Bacteria 890
114 Ga0070672_102005757 3300005543 Bacteria 521
115 Ga0070686_100090221 3300005544 Bacteria 2049
116 Ga0070686_100613329 3300005544 Unclassified 859
117 Ga0070695_101128151 3300005545 Bacteria 643
118 Ga0070695_101173434 3300005545 Unclassified 631
119 Ga0070665_100007589 3300005548 Bacteria 11031
120 Ga0070665_100214915 3300005548 Bacteria 1924
121 Ga0070665_101101479 3300005548 Bacteria 806
122 Ga0070665_101411809 3300005548 Bacteria 705
123 Ga0070665_101724274 3300005548 Bacteria 633
124 Ga0070704_100172670 3300005549 Bacteria 1721
125 Ga0070704_101444757 3300005549 Bacteria 632
126 Ga0070704_101620405 3300005549 Bacteria 597
127 Ga0070704_101664050 3300005549 Unclassified 589
128 Ga0070704_101803218 3300005549 Unclassified 566
129 Ga0068855_101284384 3300005563 Bacteria 758
130 Ga0070664_100328624 3300005564 Bacteria 1387
131 Ga0070664_100870434 3300005564 Bacteria 844
132 Ga0068857_100004131 3300005577 Bacteria 12232
133 Ga0068856_100088658 3300005614 Bacteria 3076
134 Ga0070702_100608889 3300005615 Bacteria 820
135 Ga0070702_100866508 3300005615 Bacteria 704
136 Ga0068852_100736920 3300005616 Bacteria 997
137 Ga0068852_100954952 3300005616 Bacteria 875
138 Ga0068852_101549465 3300005616 Bacteria 685
139 Ga0068859_100119036 3300005617 Bacteria 2707
140 Ga0068859_100137407 3300005617 Unclassified 2518
141 Ga0068859_100642549 3300005617 Bacteria 1153
142 Ga0068859_100663383 3300005617 Bacteria 1135
143 Ga0068859_102066012 3300005617 Bacteria 629
144 Ga0068859_102744256 3300005617 Unclassified 541
145 Ga0068864_100346733 3300005618 Bacteria 1400
146 Ga0068864_100658302 3300005618 Bacteria 1020
147 Ga0068864_101631378 3300005618 Unclassified 649
148 Ga0068864_101739002 3300005618 Bacteria 629
149 Ga0068866_10053559 3300005718 Unclassified 2063
150 Ga0068866_10179852 3300005718 Unclassified 1248
151 Ga0068866_10346201 3300005718 Bacteria 943
152 Ga0068866_11097463 3300005718 Bacteria 570
153 Ga0068866_11300923 3300005718 Bacteria 528
154 Ga0068861_100028603 3300005719 Bacteria 4068
155 Ga0068861_100730047 3300005719 Bacteria 923
156 Ga0068861_100892895 3300005719 Bacteria 841
157 Ga0068870_10002997 3300005840 Bacteria 7113
158 Ga0068870_10380573 3300005840 Bacteria 913
159 Ga0068870_10396044 3300005840 Bacteria 897
160 Ga0068870_10496378 3300005840 Bacteria 813
161 Ga0068863_100006979 3300005841 Bacteria 11073
162 Ga0068863_100019803 3300005841 Bacteria 6435
163 Ga0068863_102053930 3300005841 Bacteria 582
164 Ga0068858_100153484 3300005842 Bacteria 2166
165 Ga0068858_101145419 3300005842 Bacteria 764
166 Ga0068860_100165865 3300005843 Unclassified 2132
167 Ga0068860_100445295 3300005843 Bacteria 1287
168 Ga0068860_101839888 3300005843 Bacteria 627
169 Ga0068860_102097815 3300005843 Unclassified 586
170 Ga0068862_100017064 3300005844 Bacteria 6041
171 Ga0068862_100097720 3300005844 Unclassified 2564
172 Ga0068862_100494380 3300005844 Bacteria 1160
173 Ga0068862_100600902 3300005844 Unclassified 1056
174 Ga0068862_100880204 3300005844 Bacteria 879
175 Ga0068862_100974213 3300005844 Bacteria 837
176 Ga0068862_101474840 3300005844 Unclassified 685
177 Ga0068862_102321972 3300005844 Unclassified 548
178 Ga0081455_10124530 3300005937 Bacteria 2025
179 Ga0081455_10362714 3300005937 Bacteria 1018
180 Ga0070717_10001261 3300006028 Bacteria 17281
181 Ga0070717_11148646 3300006028 Unclassified 707
182 Ga0075365_11015471 3300006038 Bacteria 584
183 Ga0075432_10372787 3300006058 Bacteria 610
184 Ga0075432_10556666 3300006058 Bacteria 519
185 Ga0070712_100048026 3300006175 Bacteria 2957
186 Ga0075367_10803573 3300006178 Bacteria 599
187 Ga0075366_10262113 3300006195 Bacteria 1055
188 Ga0097621_100013683 3300006237 Bacteria 6058
189 Ga0097621_100066402 3300006237 Bacteria 2971
190 Ga0097621_100091945 3300006237 Unclassified 2540
191 Ga0097621_100466356 3300006237 Bacteria 1140
192 Ga0068871_100026437 3300006358 Unclassified 4528
193 Ga0068871_100040158 3300006358 Bacteria 3747
194 Ga0068871_100739118 3300006358 Bacteria 904
195 Ga0068871_101276797 3300006358 Bacteria 690
196 Ga0068871_102171472 3300006358 Bacteria 529
197 Ga0075428_100001642 3300006844 Bacteria 23810
198 Ga0075428_100003873 3300006844 Bacteria 16445
199 Ga0075428_100044940 3300006844 Bacteria 4854
200 Ga0075428_100048325 3300006844 Bacteria 4670
201 Ga0075428_100150390 3300006844 Unclassified 2529
202 Ga0075428_100301083 3300006844 Bacteria 1724
203 Ga0075428_101005678 3300006844 Bacteria 882
204 Ga0075428_101416518 3300006844 Bacteria 729
205 Ga0075428_102127584 3300006844 Unclassified 580
206 Ga0075430_100003991 3300006846 Bacteria 12439
207 Ga0075430_100021102 3300006846 Bacteria 5538
208 Ga0075430_100031213 3300006846 Unclassified 4522
209 Ga0075430_100321942 3300006846 Bacteria 1278
210 Ga0075430_100373429 3300006846 Bacteria 1177
211 Ga0075430_100437225 3300006846 Bacteria 1080
212 Ga0075430_100790381 3300006846 Unclassified 782
213 Ga0075431_100003739 3300006847 Bacteria 14785
214 Ga0075431_100014413 3300006847 Bacteria 7996
215 Ga0075431_100015322 3300006847 Bacteria 7768
216 Ga0075431_100021364 3300006847 Bacteria 6619
217 Ga0075431_100023272 3300006847 Bacteria 6338
218 Ga0075431_100037311 3300006847 Bacteria 5008
219 Ga0075431_100049689 3300006847 Bacteria 4324
220 Ga0075431_100083510 3300006847 Bacteria 3297
221 Ga0075431_100114799 3300006847 Unclassified 2780
222 Ga0075431_100243540 3300006847 Bacteria 1828
223 Ga0075431_100357653 3300006847 Bacteria 1467
224 Ga0075431_100584414 3300006847 Unclassified 1102
225 Ga0075431_100586445 3300006847 Unclassified 1100
226 Ga0075431_100669930 3300006847 Bacteria 1017
227 Ga0075431_100892091 3300006847 Bacteria 859
228 Ga0075433_10063901 3300006852 Unclassified 3226
229 Ga0075433_10970539 3300006852 Bacteria 740
230 Ga0075434_100017947 3300006871 Bacteria 6827
231 Ga0075434_100023585 3300006871 Bacteria 5999
232 Ga0075434_100083397 3300006871 Bacteria 3194
233 Ga0075434_100696546 3300006871 Unclassified 1033
234 Ga0075429_100007692 3300006880 Bacteria 9354
235 Ga0075429_100178250 3300006880 Bacteria 1862
236 Ga0075429_100431036 3300006880 Bacteria 1155
237 Ga0075429_101095579 3300006880 Bacteria 696
238 Ga0068865_100011127 3300006881 Bacteria 5619
239 Ga0068865_100119430 3300006881 Bacteria 1957
240 Ga0068865_100140051 3300006881 Bacteria 1823
241 Ga0068865_101616053 3300006881 Bacteria 583
242 Ga0075436_100190628 3300006914 Bacteria 1450
243 Ga0075436_100209693 3300006914 Bacteria 1381
244 Ga0075436_100453957 3300006914 Bacteria 933
245 Ga0097620_100119038 3300006931 Bacteria 2707
246 Ga0097620_100137411 3300006931 Unclassified 2518
247 Ga0097620_100642589 3300006931 Bacteria 1153
248 Ga0097620_100663337 3300006931 Bacteria 1135
249 Ga0097620_102065446 3300006931 Bacteria 629
250 Ga0097620_102743250 3300006931 Unclassified 541
251 Ga0075435_100399809 3300007076 Unclassified 1181
252 Ga0075435_100540538 3300007076 Bacteria 1009
253 Ga0075435_100859682 3300007076 Bacteria 790
254 Ga0075435_101102933 3300007076 Bacteria 694
255 Ga0099794_10783261 3300007265 Bacteria 510
256 Ga0099795_10183727 3300007788 Unclassified 874
257 Ga0099795_10465590 3300007788 Unclassified 584
258 Ga0105240_10006585 3300009093 Bacteria 17053
259 Ga0105240_10083728 3300009093 Bacteria 3913
260 Ga0105240_10178568 3300009093 Unclassified 2508
261 Ga0105240_10486081 3300009093 Unclassified 1375
262 Ga0105240_12563982 3300009093 Unclassified 527
263 Ga0111539_10025915 3300009094 Bacteria 7178
264 Ga0111539_10031252 3300009094 Bacteria 6470
265 Ga0111539_10035103 3300009094 Bacteria 6072
266 Ga0111539_10077765 3300009094 Bacteria 3904
267 Ga0111539_10088028 3300009094 Bacteria 3649
268 Ga0111539_10091812 3300009094 Bacteria 3567
269 Ga0111539_10121241 3300009094 Bacteria 3064
270 Ga0111539_10153200 3300009094 Bacteria 2698
271 Ga0111539_10460197 3300009094 Bacteria 1481
272 Ga0111539_10591912 3300009094 Bacteria 1292
273 Ga0111539_10802483 3300009094 Bacteria 1095
274 Ga0111539_10889618 3300009094 Bacteria 1036
275 Ga0111539_10941043 3300009094 Bacteria 1005
276 Ga0111539_11268777 3300009094 Unclassified 855
277 Ga0111539_12580214 3300009094 Unclassified 589
278 Ga0111539_12843836 3300009094 Bacteria 560
279 Ga0105245_10004459 3300009098 Bacteria 12380
280 Ga0105245_10108876 3300009098 Unclassified 2574
281 Ga0105247_11559750 3300009101 Bacteria 541
282 Ga0114129_10000475 3300009147 Bacteria 48344
283 Ga0114129_10002018 3300009147 Bacteria 27827
284 Ga0114129_10005125 3300009147 Bacteria 18443
285 Ga0114129_10060747 3300009147 Bacteria 5284
286 Ga0114129_10062241 3300009147 Bacteria 5214
287 Ga0114129_10147547 3300009147 Unclassified 3221
288 Ga0114129_10176034 3300009147 Unclassified 2914
289 Ga0114129_10203653 3300009147 Bacteria 2679
290 Ga0114129_10211931 3300009147 Bacteria 2618
291 Ga0114129_10274055 3300009147 Bacteria 2256
292 Ga0114129_10322679 3300009147 Bacteria 2053
293 Ga0114129_10346359 3300009147 Bacteria 1969
294 Ga0114129_10405216 3300009147 Bacteria 1797
295 Ga0114129_10776177 3300009147 Bacteria 1225
296 Ga0114129_11628596 3300009147 Bacteria 789
297 Ga0114129_12011904 3300009147 Bacteria 698
298 Ga0114129_12087831 3300009147 Bacteria 684
299 Ga0114129_13135469 3300009147 Unclassified 539
300 Ga0105243_10155672 3300009148 Bacteria 1965
301 Ga0105243_10156136 3300009148 Bacteria 1962
302 Ga0105241_10474986 3300009174 Unclassified 1110
303 Ga0105241_10584682 3300009174 Bacteria 1007
304 Ga0105242_10002063 3300009176 Bacteria 15836
305 Ga0105242_10006467 3300009176 Bacteria 9026
306 Ga0105242_11903697 3300009176 Bacteria 635
307 Ga0105242_13263203 3300009176 Bacteria 504
308 Ga0105248_10010492 3300009177 Bacteria 10204
309 Ga0105248_10061620 3300009177 Bacteria 4212
310 Ga0105248_10572498 3300009177 Bacteria 1274
311 Ga0105248_13194739 3300009177 Bacteria 521
312 Ga0105237_10339631 3300009545 Bacteria 1506
313 Ga0105237_10429433 3300009545 Bacteria 1327
314 Ga0105237_10650554 3300009545 Unclassified 1061
315 Ga0105237_11319401 3300009545 Bacteria 728
316 Ga0105238_10103395 3300009551 Unclassified 2830
317 Ga0105238_10235507 3300009551 Unclassified 1808
318 Ga0105238_10536581 3300009551 Bacteria 1173
319 Ga0105238_11818091 3300009551 Unclassified 641
320 Ga0105249_10014937 3300009553 Bacteria 6868
321 Ga0105249_10096506 3300009553 Bacteria 2774
322 Ga0105249_10229183 3300009553 Unclassified 1832
323 Ga0105249_10958043 3300009553 Unclassified 924
324 Ga0105249_11486010 3300009553 Bacteria 750
325 Ga0099796_10233256 3300010159 Bacteria 758
326 Ga0105239_10272940 3300010375 Bacteria 1902
327 Ga0105239_10441597 3300010375 Unclassified 1475
328 Ga0105239_11675865 3300010375 Unclassified 736
329 Ga0157370_10047866 3300013104 Bacteria 4097
330 Ga0157369_10348691 3300013105 Bacteria 1538
331 Ga0157369_11479905 3300013105 Bacteria 691
332 Ga0157374_10014136 3300013296 Bacteria 6978
333 Ga0157374_10799965 3300013296 Bacteria 959
334 Ga0157374_10903237 3300013296 Bacteria 901
335 Ga0157378_10072918 3300013297 Unclassified 3086
336 Ga0157378_10076298 3300013297 Bacteria 3020
337 Ga0163162_10019071 3300013306 Bacteria 6728
338 Ga0163162_10121302 3300013306 Bacteria 2719
339 Ga0163162_10135859 3300013306 Bacteria 2570
340 Ga0163162_11845467 3300013306 Bacteria 691
341 Ga0157372_12932815 3300013307 Unclassified 546
342 Ga0157375_10262867 3300013308 Bacteria 1887
343 Ga0157375_10357046 3300013308 Bacteria 1627
344 Ga0163163_10908408 3300014325 Bacteria 944
345 Ga0157380_10002139 3300014326 Bacteria 13255
346 Ga0157380_10004396 3300014326 Bacteria 9772
347 Ga0157380_10096355 3300014326 Bacteria 2453
348 Ga0157380_10326750 3300014326 Unclassified 1424
349 Ga0157380_11433839 3300014326 Unclassified 742
350 Ga0157380_11749714 3300014326 Bacteria 680
351 Ga0157380_11788233 3300014326 Unclassified 673
352 Ga0157380_11861403 3300014326 Unclassified 662
353 Ga0157380_11977481 3300014326 Bacteria 644
354 Ga0157377_10343449 3300014745 Unclassified 999
355 Ga0157377_10465874 3300014745 Unclassified 876
356 Ga0157379_10461450 3300014968 Bacteria 1174
357 Ga0157379_11817319 3300014968 Bacteria 599
358 Ga0157376_10072399 3300014969 Bacteria 2932
359 Ga0157376_10127938 3300014969 Bacteria 2262
360 Ga0157376_10128352 3300014969 Bacteria 2259
361 Ga0157376_10152027 3300014969 Bacteria 2088
362 Ga0157376_13116230 3300014969 Bacteria 502
363 Ga0163161_10143017 3300017792 Bacteria 1812
364 Ga0213874_10384384 3300021377 Unclassified 543
365 Ga0213875_10022935 3300021388 Unclassified 2985
366 Ga0213875_10064776 3300021388 Unclassified 1708
367 Ga0224572_1008460 3300024225 Bacteria 1903
368 Ga0228598_1000221 3300024227 Bacteria 10736
369 Ga0228598_1018031 3300024227 Bacteria 1393
370 Ga0207653_10005237 3300025885 Unclassified 4052
371 Ga0207653_10283069 3300025885 Bacteria 640
372 Ga0207682_10260246 3300025893 Bacteria 809
373 Ga0207642_10192102 3300025899 Bacteria 1121
374 Ga0207642_10296031 3300025899 Unclassified 936
375 Ga0207642_10540854 3300025899 Unclassified 718
376 Ga0207688_10561403 3300025901 Bacteria 718
377 Ga0207688_11009535 3300025901 Bacteria 526
378 Ga0207680_10257245 3300025903 Bacteria 1207
379 Ga0207680_10301893 3300025903 Bacteria 1116
380 Ga0207680_10566030 3300025903 Bacteria 812
381 Ga0207680_10597152 3300025903 Bacteria 789
382 Ga0207647_10603924 3300025904 Bacteria 605
383 Ga0207699_10008701 3300025906 Bacteria 5021
384 Ga0207699_11215301 3300025906 Bacteria 558
385 Ga0207645_10461539 3300025907 Unclassified 858
386 Ga0207645_10864721 3300025907 Unclassified 614
387 Ga0207643_10004727 3300025908 Bacteria 7306
388 Ga0207643_10335471 3300025908 Unclassified 947
389 Ga0207684_10010261 3300025910 Bacteria 8245
390 Ga0207654_10539761 3300025911 Unclassified 827
391 Ga0207707_10043545 3300025912 Unclassified 3916
392 Ga0207695_10008107 3300025913 Bacteria 13205
393 Ga0207695_10127599 3300025913 Unclassified 2504
394 Ga0207695_10283634 3300025913 Unclassified 1550
395 Ga0207671_10684696 3300025914 Bacteria 816
396 Ga0207671_10852895 3300025914 Bacteria 721
397 Ga0207693_10018667 3300025915 Bacteria 5520
398 Ga0207693_10033098 3300025915 Bacteria 4080
399 Ga0207660_10112146 3300025917 Bacteria 2054
400 Ga0207660_10368422 3300025917 Bacteria 1153
401 Ga0207660_10476249 3300025917 Bacteria 1011
402 Ga0207660_10707252 3300025917 Bacteria 822
403 Ga0207662_10319879 3300025918 Bacteria 1036
404 Ga0207657_10783172 3300025919 Unclassified 738
405 Ga0207652_10003342 3300025921 Bacteria 13260
406 Ga0207652_10067659 3300025921 Bacteria 3098
407 Ga0207646_10070689 3300025922 Bacteria 3117
408 Ga0207646_10179557 3300025922 Bacteria 1912
409 Ga0207646_10826377 3300025922 Unclassified 824
410 Ga0207646_10971529 3300025922 Bacteria 751
411 Ga0207646_11211925 3300025922 Unclassified 661
412 Ga0207681_10016752 3300025923 Bacteria 4592
413 Ga0207681_10450131 3300025923 Bacteria 1047
414 Ga0207694_10331957 3300025924 Bacteria 1256
415 Ga0207694_10552856 3300025924 Unclassified 966
416 Ga0207694_10906804 3300025924 Bacteria 745
417 Ga0207650_10178188 3300025925 Bacteria 1693
418 Ga0207650_10282115 3300025925 Bacteria 1353
419 Ga0207659_10362998 3300025926 Bacteria 1204
420 Ga0207659_10404116 3300025926 Bacteria 1143
421 Ga0207687_10025569 3300025927 Bacteria 3951
422 Ga0207687_11325758 3300025927 Bacteria 619
423 Ga0207700_10004094 3300025928 Bacteria 8549
424 Ga0207700_11993561 3300025928 Unclassified 507
425 Ga0207664_10988903 3300025929 Unclassified 754
426 Ga0207644_10564520 3300025931 Unclassified 943
427 Ga0207644_11040548 3300025931 Unclassified 688
428 Ga0207690_10329590 3300025932 Bacteria 1202
429 Ga0207690_11207045 3300025932 Unclassified 632
430 Ga0207706_10038680 3300025933 Bacteria 4231
431 Ga0207706_10134347 3300025933 Bacteria 2176
432 Ga0207686_10003179 3300025934 Bacteria 8839
433 Ga0207686_10015972 3300025934 Bacteria 4207
434 Ga0207686_10043827 3300025934 Bacteria 2744
435 Ga0207709_10356890 3300025935 Bacteria 1105
436 Ga0207670_10122035 3300025936 Bacteria 1896
437 Ga0207670_10156388 3300025936 Bacteria 1698
438 Ga0207670_10233890 3300025936 Unclassified 1412
439 Ga0207670_10361684 3300025936 Bacteria 1152
440 Ga0207669_10033883 3300025937 Bacteria 2888
441 Ga0207669_10276238 3300025937 Bacteria 1265
442 Ga0207669_11047772 3300025937 Bacteria 687
443 Ga0207704_10005584 3300025938 Bacteria 5800
444 Ga0207704_10022900 3300025938 Bacteria 3357
445 Ga0207704_10078928 3300025938 Bacteria 2119
446 Ga0207704_10089986 3300025938 Bacteria 2013
447 Ga0207704_11624562 3300025938 Unclassified 555
448 Ga0207704_11963846 3300025938 Bacteria 503
449 Ga0207665_10089816 3300025939 Bacteria 2128
450 Ga0207665_10186382 3300025939 Bacteria 1505
451 Ga0207691_10057005 3300025940 Bacteria 3557
452 Ga0207691_10237883 3300025940 Bacteria 1575
453 Ga0207691_11421405 3300025940 Unclassified 569
454 Ga0207711_10128111 3300025941 Bacteria 2273
455 Ga0207711_10374652 3300025941 Unclassified 1320
456 Ga0207711_10495232 3300025941 Bacteria 1139
457 Ga0207711_12107669 3300025941 Bacteria 506
458 Ga0207689_10075041 3300025942 Bacteria 2779
459 Ga0207689_10420663 3300025942 Bacteria 1115
460 Ga0207661_10483169 3300025944 Bacteria 1131
461 Ga0207679_10323265 3300025945 Unclassified 1336
462 Ga0207679_10859360 3300025945 Bacteria 829
463 Ga0207679_10925617 3300025945 Bacteria 798
464 Ga0207679_11079783 3300025945 Unclassified 736
465 Ga0207679_11996037 3300025945 Unclassified 528
466 Ga0207667_11813841 3300025949 Unclassified 574
467 Ga0207651_10081729 3300025960 Bacteria 2330
468 Ga0207651_10093944 3300025960 Bacteria 2204
469 Ga0207651_10100365 3300025960 Bacteria 2146
470 Ga0207651_10380079 3300025960 Bacteria 1197
471 Ga0207651_10644256 3300025960 Bacteria 930
472 Ga0207651_11067368 3300025960 Bacteria 723
473 Ga0207651_11117679 3300025960 Unclassified 706
474 Ga0207651_11876070 3300025960 Unclassified 539
475 Ga0207712_10005262 3300025961 Bacteria 8184
476 Ga0207712_10143554 3300025961 Bacteria 1835
477 Ga0207712_10234933 3300025961 Bacteria 1474
478 Ga0207668_10018615 3300025972 Unclassified 4375
479 Ga0207668_10630702 3300025972 Bacteria 936
480 Ga0207668_11765256 3300025972 Bacteria 558
481 Ga0207658_10098943 3300025986 Bacteria 2280
482 Ga0207658_10380675 3300025986 Bacteria 1236
483 Ga0207658_11047431 3300025986 Bacteria 745
484 Ga0207658_11120347 3300025986 Unclassified 719
485 Ga0207677_10004334 3300026023 Bacteria 7601
486 Ga0207677_10255156 3300026023 Bacteria 1426
487 Ga0207677_11187650 3300026023 Unclassified 698
488 Ga0207703_10016768 3300026035 Bacteria 5715
489 Ga0207703_10030150 3300026035 Bacteria 4285
490 Ga0207639_10061327 3300026041 Bacteria 2904
491 Ga0207678_10102861 3300026067 Unclassified 2438
492 Ga0207678_10189235 3300026067 Bacteria 1759
493 Ga0207708_10083637 3300026075 Bacteria 2454
494 Ga0207708_10185780 3300026075 Bacteria 1652
495 Ga0207708_10231926 3300026075 Unclassified 1482
496 Ga0207708_10301301 3300026075 Bacteria 1304
497 Ga0207702_10102060 3300026078 Bacteria 2534
498 Ga0207702_10623832 3300026078 Bacteria 1059
499 Ga0207702_11400213 3300026078 Unclassified 693
500 Ga0207702_11488125 3300026078 Bacteria 671
501 Ga0207641_10014705 3300026088 Bacteria 6417
502 Ga0207641_10015045 3300026088 Bacteria 6340
503 Ga0207641_10979797 3300026088 Unclassified 842
504 Ga0207641_11761994 3300026088 Bacteria 621
505 Ga0207641_11788476 3300026088 Bacteria 616
506 Ga0207648_10035096 3300026089 Unclassified 4420
507 Ga0207648_10061371 3300026089 Bacteria 3278
508 Ga0207648_10178625 3300026089 Bacteria 1878
509 Ga0207648_10263325 3300026089 Bacteria 1539
510 Ga0207648_10311292 3300026089 Bacteria 1414
511 Ga0207648_10312467 3300026089 Bacteria 1411
512 Ga0207648_10478020 3300026089 Bacteria 1138
513 Ga0207648_10597728 3300026089 Bacteria 1017
514 Ga0207648_11383505 3300026089 Bacteria 661
515 Ga0207648_11561089 3300026089 Unclassified 620
516 Ga0207676_10155912 3300026095 Bacteria 1973
517 Ga0207676_10760800 3300026095 Unclassified 943
518 Ga0207676_11049999 3300026095 Bacteria 804
519 Ga0207674_10003729 3300026116 Bacteria 18600
520 Ga0207674_11491769 3300026116 Unclassified 645
521 Ga0207675_100045463 3300026118 Bacteria 4101
522 Ga0207675_100228288 3300026118 Bacteria 1795
523 Ga0207675_100544854 3300026118 Bacteria 1159
524 Ga0207675_100577773 3300026118 Bacteria 1125
525 Ga0207675_101433610 3300026118 Bacteria 711
526 Ga0207683_10041629 3300026121 Bacteria 4012
527 Ga0207683_10778049 3300026121 Bacteria 888
528 Ga0207683_11508070 3300026121 Bacteria 621
529 Ga0207698_11173819 3300026142 Bacteria 781
530 Ga0207698_11965179 3300026142 Bacteria 599
531 Ga0209588_1192517 3300027671 Unclassified 637
532 Ga0207428_10014613 3300027907 Bacteria 6806
533 Ga0207428_10018353 3300027907 Bacteria 5978
534 Ga0207428_10038622 3300027907 Bacteria 3880
535 Ga0207428_10039387 3300027907 Bacteria 3838
536 Ga0207428_10307407 3300027907 Bacteria 1173
537 Ga0207428_10380723 3300027907 Bacteria 1035
538 Ga0207428_10407677 3300027907 Bacteria 995
539 Ga0207428_10659107 3300027907 Bacteria 751
540 Ga0207428_10728957 3300027907 Unclassified 708
541 Ga0265354_1000056 3300028016 Bacteria 18570
542 Ga0268266_10025394 3300028379 Bacteria 5040
543 Ga0268266_10041106 3300028379 Bacteria 3943
544 Ga0268266_10063133 3300028379 Bacteria 3198
545 Ga0268266_10225522 3300028379 Bacteria 1724
546 Ga0268266_10232792 3300028379 Bacteria 1697
547 Ga0268266_11581577 3300028379 Bacteria 631
548 Ga0268265_10008371 3300028380 Bacteria 6984
549 Ga0268265_10012041 3300028380 Bacteria 5855
550 Ga0268265_10100853 3300028380 Unclassified 2331
551 Ga0268265_10726375 3300028380 Bacteria 962
552 Ga0268265_11101852 3300028380 Bacteria 788
553 Ga0268265_11534453 3300028380 Unclassified 670
554 Ga0268265_12386902 3300028380 Bacteria 535
555 Ga0268264_10192806 3300028381 Unclassified 1859
556 Ga0268264_10410531 3300028381 Bacteria 1304
557 Ga0268264_10415256 3300028381 Bacteria 1297
558 Ga0268264_11061023 3300028381 Bacteria 818
559 Ga0265318_10056220 3300028577 Bacteria 1471
560 Ga0265338_10003416 3300028800 Bacteria 22400
561 Ga0265770_1113820 3300030878 Unclassified 563
562 Ga0265765_1001337 3300030879 Bacteria 2252
563 Ga0265760_10027081 3300031090 Bacteria 1679
564 Ga0265330_10014540 3300031235 Unclassified 3652
565 Ga0265332_10263149 3300031238 Unclassified 713
566 Ga0265325_10016460 3300031241 Unclassified 4134
567 Ga0265325_10289117 3300031241 Unclassified 734
568 Ga0265329_10154169 3300031242 Unclassified 745
569 Ga0265339_10021718 3300031249 Bacteria 3729
570 Ga0265316_10029729 3300031344 Bacteria 4488
571 Ga0307408_100610662 3300031548 Unclassified 970
572 Ga0307408_101502788 3300031548 Bacteria 637
573 Ga0265313_10030016 3300031595 Bacteria 2805
574 Ga0307508_10032965 3300031616 Bacteria 4677
575 Ga0265314_10001091 3300031711 Bacteria 31369
576 Ga0265342_10010821 3300031712 Bacteria 6282
577 Ga0307405_11772931 3300031731 Unclassified 548
578 Ga0307410_10542543 3300031852 Bacteria 963
579 Ga0307410_10871488 3300031852 Bacteria 770
580 Ga0307410_11056324 3300031852 Bacteria 702
581 Ga0307407_10361524 3300031903 Bacteria 1031
582 Ga0307412_10458022 3300031911 Bacteria 1052
583 Ga0307416_100864757 3300032002 Bacteria 1003
584 Ga0307416_101103587 3300032002 Bacteria 898
585 Ga0307416_103679878 3300032002 Bacteria 513
586 Ga0307415_100517113 3300032126 Bacteria 1047
587 Ga0307415_100664159 3300032126 Bacteria 936
588 Ga0307415_100876962 3300032126 Unclassified 825
589 Ga0316214_1056543 3300033545 Bacteria 572
590 Ga0316212_1001532 3300033547 Bacteria 3162
591 Ga0373929_0200166 3300035085 Bacteria 559
592 Ga0373934_0121887 3300035086 Bacteria 1061
593 Ga0373949_0070301 3300035090 Unclassified 916
594 Ga0373939_0088960 3300035114 Unclassified 1040
595 Ga0373941_0192029 3300035115 Bacteria 772
596 Ga0373945_0080026 3300035116 Unclassified 1250
597 Ga0373954_0299440 3300035118 Bacteria 793
598 Ga0373943_0054424 3300035170 Bacteria 1979
599 Ga0373946_0007168 3300035171 Bacteria 4073
600 Ga0373955_0150161 3300035172 Bacteria 1371
601 Ga0373961_0204540 3300035241 Bacteria 698
602 Ga0373962_0148328 3300035242 Bacteria 766
603 Ga0373924_0000219 3300035410 Bacteria 17260
604 Ga0373931_0115531 3300035691 Bacteria 1528
605 Ga0373931_0591863 3300035691 Bacteria 724
606 Ga0373935_0039004 3300035692 Bacteria 2976
607 Ga0373927_0009349 3300035695 Bacteria 6576
608 Ga0373947_0001718 3300035725 Bacteria 13397
609 Ga0373937_0226807 3300036401 Bacteria 1759
610 Ga0373937_0486377 3300036401 Bacteria 1172
611 Ga0373937_1012101 3300036401 Unclassified 780
612 Ga0373925_0002188 3300037068 Bacteria 15911
613 Ga0373925_0038535 3300037068 Unclassified 3534
614 Ga0373925_0539181 3300037068 Bacteria 959
615 Ga0395900_0133452 3300037418 Unclassified 2544
616 Ga0395900_1203350 3300037418 Bacteria 673
617 Ga0395898_0215393 3300037466 Unclassified 1832
618 Ga0395898_0420496 3300037466 Unclassified 1274
619 Ga0395898_1151786 3300037466 Unclassified 708
620 Ga0395905_0918777 3300037471 Unclassified 778
621 Ga0436364_0085669 3300037853 Bacteria 3513
622 Ga0436364_0251712 3300037853 Bacteria 4000
623 Ga0395901_0413178 3300038443 Unclassified 1385
624 Ga0395901_0533755 3300038443 Bacteria 1191
625 Ga0436360_0189030 3300039438 Unclassified 510
626 Ga0436363_1055472 3300039450 Unclassified 2187
627 Ga0436362_0820201 3300039453 Unclassified 633
628 Ga0439439_0212434 3300041406 Unclassified 565
629 Ga0451797_0833949 3300041453 Bacteria 1155
630 Ga0451849_0684501 3300041505 Bacteria 1626
631 Ga0451849_1201735 3300041505 Unclassified 504
632 Ga0439441_069909 3300042001 Bacteria 752
633 Ga0450923_006154 3300042125 Bacteria 1975
634 Ga0450923_041854 3300042125 Bacteria 965
635 Ga0439434_0230857 3300042435 Bacteria 630
636 Ga0439435_0004929 3300042436 Unclassified 2905
637 Ga0439444_0005463 3300042437 Unclassified 1885
638 Ga0439444_0076688 3300042437 Unclassified 725
639 Ga0439464_0015039 3300042439 Bacteria 2086
640 Ga0439440_0129114 3300042993 Unclassified 710
641 Ga0439440_0193626 3300042993 Bacteria 600
642 Ga0466963_0726645 3300044694 Bacteria 700
643 Ga0451576_0568071 3300045051 Bacteria 1192
644 Ga0495592_0720071 3300046454 Bacteria 599
645 Ga0495651_0003175 3300046462 Bacteria 12629
646 Ga0495651_0176248 3300046462 Unclassified 1518
647 Ga0495653_0233317 3300046463 Bacteria 1230
648 Ga0495580_0017457 3300046472 Bacteria 5367
649 Ga0495582_0269470 3300046473 Unclassified 977
650 Ga0495639_0616557 3300046475 Unclassified 558
651 Ga0495639_0705716 3300046475 Unclassified 521
652 Ga0495662_0119985 3300046476 Unclassified 1291
653 Ga0495664_0149113 3300046477 Bacteria 1419
654 Ga0495664_0309429 3300046477 Bacteria 953
655 Ga0495608_0082910 3300046511 Bacteria 2082
656 Ga0495628_0453745 3300046516 Unclassified 931
657 Ga0495628_0933911 3300046516 Bacteria 600
658 Ga0495630_0108610 3300046517 Bacteria 2102
659 Ga0495663_0168150 3300046525 Bacteria 755
660 Ga0495652_0153845 3300046529 Bacteria 1793
661 Ga0495640_0396698 3300046533 Unclassified 847
662 Ga0495586_0600937 3300046535 Unclassified 636
663 Ga0495587_0009342 3300046536 Bacteria 6286
664 Ga0495587_0368408 3300046536 Unclassified 800
665 Ga0495609_0421438 3300046538 Unclassified 533
666 Ga0495621_0020877 3300046539 Bacteria 2154
667 Ga0495621_0424520 3300046539 Bacteria 566
668 Ga0495645_0022839 3300046543 Unclassified 4527
669 Ga0495667_0031922 3300046559 Bacteria 3532
670 Ga0495667_0231597 3300046559 Bacteria 1178
671 Ga0495656_0752063 3300046615 Bacteria 526
672 Ga0495634_0349243 3300046642 Unclassified 886
673 Ga0495635_0359814 3300046663 Bacteria 970
674 Ga0495659_0379795 3300046664 Unclassified 607
675 Ga0495657_0205384 3300046675 Bacteria 1199
676 Ga0495623_0009820 3300046679 Bacteria 6201
677 Ga0495623_0231779 3300046679 Bacteria 1047
678 Ga0495658_0038237 3300046683 Bacteria 2657
679 Ga0495658_0579027 3300046683 Bacteria 719
680 Ga0495613_0145431 3300046689 Unclassified 1692
681 Ga0495613_0247806 3300046689 Bacteria 1244
682 Ga0495613_0452830 3300046689 Bacteria 869
683 Ga0495624_0042735 3300046690 Bacteria 2896
684 Ga0495670_0754917 3300046691 Unclassified 531
685 Ga0495600_0081719 3300046809 Bacteria 2109
686 Ga0495600_0166865 3300046809 Bacteria 1422
687 Ga0495581_0675106 3300047315 Unclassified 596
688 Ga0495581_0793421 3300047315 Bacteria 543
689 Ga0495604_0445054 3300047317 Bacteria 847
690 Ga0495674_0007011 3300047319 Bacteria 10782
691 Ga0495674_0256213 3300047319 Bacteria 1438
692 Ga0495676_0781522 3300047321 Bacteria 615
693 Ga0495675_0020252 3300047444 Bacteria 4229
694 Ga0495675_0067202 3300047444 Bacteria 2265
695 Ga0495677_0240559 3300047445 Bacteria 707
696 Ga0495684_0003613 3300047471 Bacteria 12050
697 Ga0495684_0063503 3300047471 Bacteria 2807
698 Ga0495684_0581189 3300047471 Unclassified 758
699 Ga0495684_0860489 3300047471 Unclassified 587
700 Ga0495602_0054725 3300048088 Bacteria 3520
701 Ga0495602_0286138 3300048088 Unclassified 1212
702 Ga0495615_0001110 3300048090 Bacteria 3864
703 Ga0496100_1253292 3300048903 Bacteria 585
704 Ga0496101_0155456 3300048904 Bacteria 1752
705 Ga0496101_0341763 3300048904 Bacteria 1176
706 Ga0496104_0015483 3300048907 Bacteria 6905
707 Ga0496105_0013295 3300048908 Bacteria 6532
708 Ga0496105_0238555 3300048908 Bacteria 1476
709 Ga0496105_0896002 3300048908 Bacteria 669
710 Ga0496108_0857600 3300048911 Bacteria 781
711 Ga0496109_0488912 3300048912 Unclassified 1162
712 Ga0496109_0905085 3300048912 Unclassified 820
713 Ga0496110_0979188 3300048913 Bacteria 753
714 Ga0496110_0984321 3300048913 Bacteria 751
715 Ga0496111_0150348 3300048914 Bacteria 1727
716 Ga0496112_0041385 3300048915 Bacteria 4509
717 Ga0496112_0173565 3300048915 Bacteria 2121
718 Ga0496113_0000361 3300048916 Bacteria 21794
719 Ga0496114_0000022 3300048917 Bacteria 219236
720 Ga0496114_0558106 3300048917 Bacteria 1011
721 Ga0496114_1195425 3300048917 Unclassified 646
722 Ga0496115_0666179 3300048918 Bacteria 821
723 Ga0496126_0033784 3300048929 Bacteria 4811
724 Ga0501031_0244791 3300049568 Bacteria 1165
725 Ga0501033_0005365 3300049570 Bacteria 10157
726 Ga0501034_0092686 3300049571 Bacteria 3017
727 Ga0501034_0214652 3300049571 Bacteria 1878
728 Ga0501036_0014783 3300049572 Bacteria 6510
729 Ga0501036_0240450 3300049572 Bacteria 1518
730 Ga0501037_0016345 3300049573 Bacteria 5460
731 Ga0501037_0065947 3300049573 Bacteria 2637
732 Ga0501038_0010563 3300049574 Bacteria 8443
733 Ga0501038_0027902 3300049574 Bacteria 5017
734 Ga0501038_0365576 3300049574 Bacteria 1121
735 Ga0501040_0375334 3300049576 Bacteria 1020
736 Ga0501041_1023137 3300049577 Bacteria 532
737 Ga0501042_0290731 3300049578 Bacteria 1180
738 Ga0501043_0002920 3300049579 Bacteria 14265
739 Ga0501043_0716380 3300049579 Bacteria 730
740 Ga0501043_0815943 3300049579 Bacteria 674
741 Ga0501046_0026896 3300049580 Bacteria 4698
742 Ga0501046_0035788 3300049580 Bacteria 3999
743 Ga0501046_0401181 3300049580 Bacteria 990
744 Ga0501047_0045703 3300049581 Bacteria 4233
745 Ga0501047_0273979 3300049581 Bacteria 1533
746 Ga0501048_0007323 3300049582 Bacteria 8367
747 Ga0501048_0037699 3300049582 Bacteria 3471
748 Ga0501067_0004716 3300049583 Bacteria 7546
749 Ga0501068_0008337 3300049584 Bacteria 5763
750 Ga0501069_0074707 3300049585 Bacteria 1902
751 Ga0501070_0013924 3300049586 Bacteria 6770
752 Ga0501070_0093098 3300049586 Bacteria 2493
753 Ga0501071_0173430 3300049587 Bacteria 1615
754 Ga0501072_0395966 3300049588 Unclassified 1096
755 Ga0501073_0027819 3300049589 Bacteria 4040
756 Ga0501073_0531179 3300049589 Bacteria 813
757 Ga0501074_0011783 3300049590 Bacteria 6356
758 Ga0501074_0171854 3300049590 Bacteria 1547
759 Ga0501074_0638612 3300049590 Unclassified 752
760 Ga0501075_0135225 3300049591 Unclassified 1878
761 Ga0501075_0276882 3300049591 Bacteria 1279
762 Ga0501075_1148072 3300049591 Bacteria 590
763 Ga0501076_0035782 3300049592 Bacteria 3886
764 Ga0501076_0369856 3300049592 Unclassified 1178
765 Ga0501076_0536435 3300049592 Bacteria 965
766 Ga0501076_0922451 3300049592 Bacteria 720
767 Ga0501077_0827687 3300049593 Unclassified 595
768 Ga0501079_0003236 3300049741 Bacteria 11926
769 Ga0501079_0007444 3300049741 Bacteria 8283
770 Ga0501079_0479685 3300049741 Unclassified 977
771 Ga0501080_0031509 3300049742 Bacteria 4939
772 Ga0501080_0667818 3300049742 Bacteria 918
773 Ga0501081_0578291 3300049743 Unclassified 840
774 Ga0501081_0966996 3300049743 Bacteria 643
775 Ga0501083_0038868 3300049744 Bacteria 3233
776 Ga0501083_0317309 3300049744 Bacteria 1013
777 Ga0501035_0004565 3300049822 Bacteria 13136
778 Ga0501035_0044536 3300049822 Bacteria 3995
779 Ga0501044_0064579 3300049823 Bacteria 3736
780 Ga0501044_0207064 3300049823 Bacteria 1917
781 nmdc:mga06z11_1017781_c1 3300050494 Bacteria 505
782 nmdc:mga05p37_1241631_c1 3300050507 Unclassified 766
783 nmdc:mga05p37_2128748_c1 3300050507 Unclassified 524
784 nmdc:mga05p37_230907_c1 3300050507 Unclassified 2229
785 nmdc:mga05p37_27_c1 3300050507 Bacteria 115422
786 nmdc:mga05p37_332280_c1 3300050507 Bacteria 1795
787 nmdc:mga05p37_34532_c1 3300050507 Bacteria 6194
788 nmdc:mga05p37_5252_c1 3300050507 Bacteria 15201
789 nmdc:mga05p37_637047_c1 3300050507 Bacteria 1196
790 nmdc:mga05p37_680786_c1 3300050507 Bacteria 1146
791 nmdc:mga05p37_705374_c1 3300050507 Unclassified 1120
792 nmdc:mga05p37_7353_c1 3300050507 Bacteria 12986
793 nmdc:mga09592_13069_c1 3300050508 Bacteria 6777
794 nmdc:mga09592_418527_c1 3300050508 Bacteria 1158
795 nmdc:mga09592_606597_c1 3300050508 Bacteria 937
796 nmdc:mga0qj67_162144_c1 3300050509 Bacteria 1815
797 nmdc:mga0qj67_16868_c1 3300050509 Bacteria 5546
798 nmdc:mga0qj67_178772_c1 3300050509 Bacteria 1723
799 nmdc:mga0qj67_67061_c1 3300050509 Bacteria 2859
800 nmdc:mga0qj67_9400_c1 3300050509 Bacteria 7272
801 nmdc:mga06r32_176577_c1 3300050510 Bacteria 2120
802 nmdc:mga06r32_218820_c1 3300050510 Bacteria 1892
803 nmdc:mga06r32_30869_c1 3300050510 Bacteria 5029
804 nmdc:mga06r32_5119_c1 3300050510 Bacteria 11793
805 nmdc:mga06r32_51305_c1 3300050510 Bacteria 1441
806 nmdc:mga06r32_561134_c1 3300050510 Bacteria 1115
807 nmdc:mga06r32_659_c1 3300050510 Bacteria 30163
808 nmdc:mga06r32_662782_c1 3300050510 Unclassified 1011
809 nmdc:mga06r32_72791_c1 3300050510 Bacteria 3327
810 nmdc:mga06r32_75753_c1 3300050510 Unclassified 3266
811 nmdc:mga06r32_83851_c1 3300050510 Bacteria 3106
812 nmdc:mga06r32_911928_c1 3300050510 Bacteria 835
813 nmdc:mga06r32_97460_c1 3300050510 Unclassified 2882
814 nmdc:mga06r32_99272_c1 3300050510 Bacteria 2855
815 nmdc:mga08y16_1013451_c1 3300050511 Bacteria 810
816 nmdc:mga08y16_111355_c1 3300050511 Bacteria 2850
817 nmdc:mga08y16_17461_c1 3300050511 Bacteria 7557
818 nmdc:mga08y16_17487_c1 3300050511 Bacteria 7550
819 nmdc:mga08y16_264572_c1 3300050511 Bacteria 1776
820 nmdc:mga08y16_28483_c1 3300050511 Bacteria 5889
821 nmdc:mga08y16_333227_c1 3300050511 Bacteria 1561
822 nmdc:mga08y16_361702_c1 3300050511 Bacteria 1490
823 nmdc:mga08y16_383625_c1 3300050511 Unclassified 1440
824 nmdc:mga08y16_49182_c1 3300050511 Bacteria 4413
825 nmdc:mga08y16_525336_c1 3300050511 Unclassified 1200
826 nmdc:mga08y16_544826_c1 3300050511 Unclassified 1175
827 nmdc:mga08y16_722304_c1 3300050511 Bacteria 994
828 nmdc:mga08y16_859744_c1 3300050511 Unclassified 896
829 nmdc:mga08y16_890765_c1 3300050511 Bacteria 877
830 nmdc:mga08y16_96148_c1 3300050511 Bacteria 3085
831 nmdc:mga0n895_115539_c1 3300050512 Bacteria 2702
832 nmdc:mga0n895_160600_c1 3300050512 Bacteria 2279
833 nmdc:mga0n895_500871_c1 3300050512 Unclassified 1224
834 nmdc:mga0rr50_1496414_c1 3300050513 Bacteria 571
835 nmdc:mga0rr50_63481_c1 3300050513 Unclassified 2790
836 nmdc:mga0rr50_772292_c1 3300050513 Bacteria 820
837 nmdc:mga0rr50_982408_c1 3300050513 Bacteria 719
838 nmdc:mga08x19_1079515_c1 3300050514 Bacteria 570
839 nmdc:mga08x19_109673_c1 3300050514 Bacteria 1840
840 nmdc:mga08x19_470481_c1 3300050514 Bacteria 886
841 nmdc:mga08x19_69310_c1 3300050514 Bacteria 2297
842 nmdc:mga0a205_185789_c1 3300050515 Bacteria 1971
843 nmdc:mga0a205_416681_c1 3300050515 Bacteria 1205
844 nmdc:mga0a205_68853_c1 3300050515 Bacteria 3418
845 nmdc:mga0a205_78427_c1 3300050515 Bacteria 3191
846 Ga0495601_0050306 3300053077 Bacteria 2628
847 Ga0495619_0087939 3300053085 Bacteria 2101
848 Ga0500651_0079195 3300053093 Bacteria 2037
849 Ga0500604_0041853 3300053151 Bacteria 1387
850 Ga0501084_0239427 3300054114 Unclassified 1532
851 Ga0501084_0285328 3300054114 Bacteria 1394
852 Ga0501082_0013746 3300060353 Bacteria 6958
853 Ga0501082_0112208 3300060353 Bacteria 2360
854 Ga0501082_0532603 3300060353 Bacteria 1027
855 Ga0501082_1405046 3300060353 Bacteria 609
856 Ga0530510_0436914 3300061734 Bacteria 989
857 Ga0530510_0524471 3300061734 Unclassified 899
858 Ga0496113_1229272
859 JGI25406J46586_10136701
860 Ga0065704_10642450
861 Ga0065704_10714912
862 Ga0065712_10023227
863 Ga0065715_10100204
864 Ga0065715_10452221
865 Ga0065707_10057089
866 Ga0065707_10106673
867 Ga0065707_10512391
868 Ga0070676_10081314
869 Ga0070676_10493399
870 Ga0070690_100067802
871 Ga0070690_100675397
872 Ga0070670_100344735
873 Ga0070670_100361179
874 Ga0070670_101622145
875 Ga0068869_100104990
876 Ga0070666_10072832
877 Ga0070666_10127792
878 Ga0070666_10163084
879 Ga0070666_10290037
880 Ga0070680_100064423
881 Ga0070680_100408216
882 Ga0070680_101867175
883 Ga0068868_100009734
884 Ga0068868_100128994
885 Ga0070689_100124184
886 Ga0070689_100245927
887 Ga0070687_100287124
888 Ga0070692_10013391
889 Ga0070668_100028193
890 Ga0070668_100470055
891 Ga0070669_100005284
892 Ga0070669_100006383
893 Ga0070675_100318647
894 Ga0070675_100776253
895 Ga0070675_102071856
896 Ga0070671_100018548
897 Ga0070674_100015060
898 Ga0070674_100153256
899 Ga0070674_100354327
900 Ga0070674_101519221
901 Ga0070673_100105394
902 Ga0070673_100120304
903 Ga0070673_100140821
904 Ga0070673_100409303
905 Ga0070673_100472553
906 Ga0070673_101103225
907 Ga0070673_101196935
908 Ga0070673_102080572
909 Ga0070688_100499098
910 Ga0070659_101146179
911 Ga0070667_100092483
912 Ga0070667_100206653
913 Ga0070667_101647969
914 Ga0070703_10135063
915 Ga0070709_10011645
916 Ga0070714_100088418
917 Ga0070713_100000984
918 Ga0070701_10044340
919 Ga0070701_11268647
920 Ga0070705_100670169
921 Ga0070705_100772111
922 Ga0070700_100133688
923 Ga0070700_100180920
924 Ga0070700_100286601
925 Ga0070700_100615321
926 Ga0070694_100042336
927 Ga0070694_100117752
928 Ga0070694_100600522
929 Ga0070694_100854780
930 Ga0070694_101191394
931 Ga0070708_100505875
932 Ga0070708_100668120
933 Ga0070663_100028077
934 Ga0070663_100246270
935 Ga0070678_100110805
936 Ga0070678_101053596
937 Ga0070678_101618724
938 Ga0070662_100024019
939 Ga0070662_100028892
940 Ga0070662_100578665
941 Ga0070662_101362751
942 Ga0068867_100040666
943 Ga0068867_100763470
944 Ga0068867_102043338
945 Ga0070685_10607946
946 Ga0070706_100944460
947 Ga0070706_101265809
948 Ga0070707_100195471
949 Ga0070707_100820204
950 Ga0070707_101632028
951 Ga0070698_100000238
952 Ga0070698_100021808
953 Ga0070698_100115001
954 Ga0070698_101014660
955 Ga0070698_101174334
956 Ga0070698_101642769
957 Ga0070699_100087646
958 Ga0070699_100215502
959 Ga0070699_101177112
960 Ga0070699_101325639
961 Ga0070679_100047987
962 Ga0070679_100914151
963 Ga0070684_100036998
964 Ga0070684_100216420
965 Ga0070684_100988628
966 Ga0070697_100035456
967 Ga0068853_100818465
968 Ga0070672_100071910
969 Ga0070672_100093132
970 Ga0070672_100696032
971 Ga0070672_102005757
972 Ga0070686_100090221
973 Ga0070686_100613329
974 Ga0070695_101128151
975 Ga0070695_101173434
976 Ga0070665_100007589
977 Ga0070665_100214915
978 Ga0070665_101101479
979 Ga0070665_101411809
980 Ga0070665_101724274
981 Ga0070704_100172670
982 Ga0070704_101444757
983 Ga0070704_101620405
984 Ga0070704_101664050
985 Ga0070704_101803218
986 Ga0068855_101284384
987 Ga0070664_100328624
988 Ga0070664_100870434
989 Ga0068857_100004131
990 Ga0068856_100088658
991 Ga0070702_100608889
992 Ga0070702_100866508
993 Ga0068852_100736920
994 Ga0068852_100954952
995 Ga0068852_101549465
996 Ga0068859_100119036
997 Ga0068859_100137407
998 Ga0068859_100642549
999 Ga0068859_100663383
1000 Ga0068859_102066012
1001 Ga0068859_102744256
1002 Ga0068864_100346733
1003 Ga0068864_100658302
1004 Ga0068864_101631378
1005 Ga0068864_101739002
1006 Ga0068866_10053559
1007 Ga0068866_10179852
1008 Ga0068866_10346201
1009 Ga0068866_11097463
1010 Ga0068866_11300923
1011 Ga0068861_100028603
1012 Ga0068861_100730047
1013 Ga0068861_100892895
1014 Ga0068870_10002997
1015 Ga0068870_10380573
1016 Ga0068870_10396044
1017 Ga0068870_10496378
1018 Ga0068863_100006979
1019 Ga0068863_100019803
1020 Ga0068863_102053930
1021 Ga0068858_100153484
1022 Ga0068858_101145419
1023 Ga0068860_100165865
1024 Ga0068860_100445295
1025 Ga0068860_101839888
1026 Ga0068860_102097815
1027 Ga0068862_100017064
1028 Ga0068862_100097720
1029 Ga0068862_100494380
1030 Ga0068862_100600902
1031 Ga0068862_100880204
1032 Ga0068862_100974213
1033 Ga0068862_101474840
1034 Ga0068862_102321972
1035 Ga0081455_10124530
1036 Ga0081455_10362714
1037 Ga0070717_10001261
1038 Ga0070717_11148646
1039 Ga0075365_11015471
1040 Ga0075432_10372787
1041 Ga0075432_10556666
1042 Ga0070712_100048026
1043 Ga0075367_10803573
1044 Ga0075366_10262113
1045 Ga0097621_100013683
1046 Ga0097621_100066402
1047 Ga0097621_100091945
1048 Ga0097621_100466356
1049 Ga0068871_100026437
1050 Ga0068871_100040158
1051 Ga0068871_100739118
1052 Ga0068871_101276797
1053 Ga0068871_102171472
1054 Ga0075428_100001642
1055 Ga0075428_100003873
1056 Ga0075428_100044940
1057 Ga0075428_100048325
1058 Ga0075428_100150390
1059 Ga0075428_100301083
1060 Ga0075428_101005678
1061 Ga0075428_101416518
1062 Ga0075428_102127584
1063 Ga0075430_100003991
1064 Ga0075430_100021102
1065 Ga0075430_100031213
1066 Ga0075430_100321942
1067 Ga0075430_100373429
1068 Ga0075430_100437225
1069 Ga0075430_100790381
1070 Ga0075431_100003739
1071 Ga0075431_100014413
1072 Ga0075431_100015322
1073 Ga0075431_100021364
1074 Ga0075431_100023272
1075 Ga0075431_100037311
1076 Ga0075431_100049689
1077 Ga0075431_100083510
1078 Ga0075431_100114799
1079 Ga0075431_100243540
1080 Ga0075431_100357653
1081 Ga0075431_100584414
1082 Ga0075431_100586445
1083 Ga0075431_100669930
1084 Ga0075431_100892091
1085 Ga0075433_10063901
1086 Ga0075433_10970539
1087 Ga0075434_100017947
1088 Ga0075434_100023585
1089 Ga0075434_100083397
1090 Ga0075434_100696546
1091 Ga0075429_100007692
1092 Ga0075429_100178250
1093 Ga0075429_100431036
1094 Ga0075429_101095579
1095 Ga0068865_100011127
1096 Ga0068865_100119430
1097 Ga0068865_100140051
1098 Ga0068865_101616053
1099 Ga0075436_100190628
1100 Ga0075436_100209693
1101 Ga0075436_100453957
1102 Ga0097620_100119038
1103 Ga0097620_100137411
1104 Ga0097620_100642589
1105 Ga0097620_100663337
1106 Ga0097620_102065446
1107 Ga0097620_102743250
1108 Ga0075435_100399809
1109 Ga0075435_100540538
1110 Ga0075435_100859682
1111 Ga0075435_101102933
1112 Ga0099794_10783261
1113 Ga0099795_10183727
1114 Ga0099795_10465590
1115 Ga0105240_10006585
1116 Ga0105240_10083728
1117 Ga0105240_10178568
1118 Ga0105240_10486081
1119 Ga0105240_12563982
1120 Ga0111539_10025915
1121 Ga0111539_10031252
1122 Ga0111539_10035103
1123 Ga0111539_10077765
1124 Ga0111539_10088028
1125 Ga0111539_10091812
1126 Ga0111539_10121241
1127 Ga0111539_10153200
1128 Ga0111539_10460197
1129 Ga0111539_10591912
1130 Ga0111539_10802483
1131 Ga0111539_10889618
1132 Ga0111539_10941043
1133 Ga0111539_11268777
1134 Ga0111539_12580214
1135 Ga0111539_12843836
1136 Ga0105245_10004459
1137 Ga0105245_10108876
1138 Ga0105247_11559750
1139 Ga0114129_10000475
1140 Ga0114129_10002018
1141 Ga0114129_10005125
1142 Ga0114129_10060747
1143 Ga0114129_10062241
1144 Ga0114129_10147547
1145 Ga0114129_10176034
1146 Ga0114129_10203653
1147 Ga0114129_10211931
1148 Ga0114129_10274055
1149 Ga0114129_10322679
1150 Ga0114129_10346359
1151 Ga0114129_10405216
1152 Ga0114129_10776177
1153 Ga0114129_11628596
1154 Ga0114129_12011904
1155 Ga0114129_12087831
1156 Ga0114129_13135469
1157 Ga0105243_10155672
1158 Ga0105243_10156136
1159 Ga0105241_10474986
1160 Ga0105241_10584682
1161 Ga0105242_10002063
1162 Ga0105242_10006467
1163 Ga0105242_11903697
1164 Ga0105242_13263203
1165 Ga0105248_10010492
1166 Ga0105248_10061620
1167 Ga0105248_10572498
1168 Ga0105248_13194739
1169 Ga0105237_10339631
1170 Ga0105237_10429433
1171 Ga0105237_10650554
1172 Ga0105237_11319401
1173 Ga0105238_10103395
1174 Ga0105238_10235507
1175 Ga0105238_10536581
1176 Ga0105238_11818091
1177 Ga0105249_10014937
1178 Ga0105249_10096506
1179 Ga0105249_10229183
1180 Ga0105249_10958043
1181 Ga0105249_11486010
1182 Ga0099796_10233256
1183 Ga0105239_10272940
1184 Ga0105239_10441597
1185 Ga0105239_11675865
1186 Ga0157370_10047866
1187 Ga0157369_10348691
1188 Ga0157369_11479905
1189 Ga0157374_10014136
1190 Ga0157374_10799965
1191 Ga0157374_10903237
1192 Ga0157378_10072918
1193 Ga0157378_10076298
1194 Ga0163162_10019071
1195 Ga0163162_10121302
1196 Ga0163162_10135859
1197 Ga0163162_11845467
1198 Ga0157372_12932815
1199 Ga0157375_10262867
1200 Ga0157375_10357046
1201 Ga0163163_10908408
1202 Ga0157380_10002139
1203 Ga0157380_10004396
1204 Ga0157380_10096355
1205 Ga0157380_10326750
1206 Ga0157380_11433839
1207 Ga0157380_11749714
1208 Ga0157380_11788233
1209 Ga0157380_11861403
1210 Ga0157380_11977481
1211 Ga0157377_10343449
1212 Ga0157377_10465874
1213 Ga0157379_10461450
1214 Ga0157379_11817319
1215 Ga0157376_10072399
1216 Ga0157376_10127938
1217 Ga0157376_10128352
1218 Ga0157376_10152027
1219 Ga0157376_13116230
1220 Ga0163161_10143017
1221 Ga0213874_10384384
1222 Ga0213875_10022935
1223 Ga0213875_10064776
1224 Ga0224572_1008460
1225 Ga0228598_1000221
1226 Ga0228598_1018031
1227 Ga0207653_10005237
1228 Ga0207653_10283069
1229 Ga0207682_10260246
1230 Ga0207642_10192102
1231 Ga0207642_10296031
1232 Ga0207642_10540854
1233 Ga0207688_10561403
1234 Ga0207688_11009535
1235 Ga0207680_10257245
1236 Ga0207680_10301893
1237 Ga0207680_10566030
1238 Ga0207680_10597152
1239 Ga0207647_10603924
1240 Ga0207699_10008701
1241 Ga0207699_11215301
1242 Ga0207645_10461539
1243 Ga0207645_10864721
1244 Ga0207643_10004727
1245 Ga0207643_10335471
1246 Ga0207684_10010261
1247 Ga0207654_10539761
1248 Ga0207707_10043545
1249 Ga0207695_10008107
1250 Ga0207695_10127599
1251 Ga0207695_10283634
1252 Ga0207671_10684696
1253 Ga0207671_10852895
1254 Ga0207693_10018667
1255 Ga0207693_10033098
1256 Ga0207660_10112146
1257 Ga0207660_10368422
1258 Ga0207660_10476249
1259 Ga0207660_10707252
1260 Ga0207662_10319879
1261 Ga0207657_10783172
1262 Ga0207652_10003342
1263 Ga0207652_10067659
1264 Ga0207646_10070689
1265 Ga0207646_10179557
1266 Ga0207646_10826377
1267 Ga0207646_10971529
1268 Ga0207646_11211925
1269 Ga0207681_10016752
1270 Ga0207681_10450131
1271 Ga0207694_10331957
1272 Ga0207694_10552856
1273 Ga0207694_10906804
1274 Ga0207650_10178188
1275 Ga0207650_10282115
1276 Ga0207659_10362998
1277 Ga0207659_10404116
1278 Ga0207687_10025569
1279 Ga0207687_11325758
1280 Ga0207700_10004094
1281 Ga0207700_11993561
1282 Ga0207664_10988903
1283 Ga0207644_10564520
1284 Ga0207644_11040548
1285 Ga0207690_10329590
1286 Ga0207690_11207045
1287 Ga0207706_10038680
1288 Ga0207706_10134347
1289 Ga0207686_10003179
1290 Ga0207686_10015972
1291 Ga0207686_10043827
1292 Ga0207709_10356890
1293 Ga0207670_10122035
1294 Ga0207670_10156388
1295 Ga0207670_10233890
1296 Ga0207670_10361684
1297 Ga0207669_10033883
1298 Ga0207669_10276238
1299 Ga0207669_11047772
1300 Ga0207704_10005584
1301 Ga0207704_10022900
1302 Ga0207704_10078928
1303 Ga0207704_10089986
1304 Ga0207704_11624562
1305 Ga0207704_11963846
1306 Ga0207665_10089816
1307 Ga0207665_10186382
1308 Ga0207691_10057005
1309 Ga0207691_10237883
1310 Ga0207691_11421405
1311 Ga0207711_10128111
1312 Ga0207711_10374652
1313 Ga0207711_10495232
1314 Ga0207711_12107669
1315 Ga0207689_10075041
1316 Ga0207689_10420663
1317 Ga0207661_10483169
1318 Ga0207679_10323265
1319 Ga0207679_10859360
1320 Ga0207679_10925617
1321 Ga0207679_11079783
1322 Ga0207679_11996037
1323 Ga0207667_11813841
1324 Ga0207651_10081729
1325 Ga0207651_10093944
1326 Ga0207651_10100365
1327 Ga0207651_10380079
1328 Ga0207651_10644256
1329 Ga0207651_11067368
1330 Ga0207651_11117679
1331 Ga0207651_11876070
1332 Ga0207712_10005262
1333 Ga0207712_10143554
1334 Ga0207712_10234933
1335 Ga0207668_10018615
1336 Ga0207668_10630702
1337 Ga0207668_11765256
1338 Ga0207658_10098943
1339 Ga0207658_10380675
1340 Ga0207658_11047431
1341 Ga0207658_11120347
1342 Ga0207677_10004334
1343 Ga0207677_10255156
1344 Ga0207677_11187650
1345 Ga0207703_10016768
1346 Ga0207703_10030150
1347 Ga0207639_10061327
1348 Ga0207678_10102861
1349 Ga0207678_10189235
1350 Ga0207708_10083637
1351 Ga0207708_10185780
1352 Ga0207708_10231926
1353 Ga0207708_10301301
1354 Ga0207702_10102060
1355 Ga0207702_10623832
1356 Ga0207702_11400213
1357 Ga0207702_11488125
1358 Ga0207641_10014705
1359 Ga0207641_10015045
1360 Ga0207641_10979797
1361 Ga0207641_11761994
1362 Ga0207641_11788476
1363 Ga0207648_10035096
1364 Ga0207648_10061371
1365 Ga0207648_10178625
1366 Ga0207648_10263325
1367 Ga0207648_10311292
1368 Ga0207648_10312467
1369 Ga0207648_10478020
1370 Ga0207648_10597728
1371 Ga0207648_11383505
1372 Ga0207648_11561089
1373 Ga0207676_10155912
1374 Ga0207676_10760800
1375 Ga0207676_11049999
1376 Ga0207674_10003729
1377 Ga0207674_11491769
1378 Ga0207675_100045463
1379 Ga0207675_100228288
1380 Ga0207675_100544854
1381 Ga0207675_100577773
1382 Ga0207675_101433610
1383 Ga0207683_10041629
1384 Ga0207683_10778049
1385 Ga0207683_11508070
1386 Ga0207698_11173819
1387 Ga0207698_11965179
1388 Ga0209588_1192517
1389 Ga0207428_10014613
1390 Ga0207428_10018353
1391 Ga0207428_10038622
1392 Ga0207428_10039387
1393 Ga0207428_10307407
1394 Ga0207428_10380723
1395 Ga0207428_10407677
1396 Ga0207428_10659107
1397 Ga0207428_10728957
1398 Ga0265354_1000056
1399 Ga0268266_10025394
1400 Ga0268266_10041106
1401 Ga0268266_10063133
1402 Ga0268266_10225522
1403 Ga0268266_10232792
1404 Ga0268266_11581577
1405 Ga0268265_10008371
1406 Ga0268265_10012041
1407 Ga0268265_10100853
1408 Ga0268265_10726375
1409 Ga0268265_11101852
1410 Ga0268265_11534453
1411 Ga0268265_12386902
1412 Ga0268264_10192806
1413 Ga0268264_10410531
1414 Ga0268264_10415256
1415 Ga0268264_11061023
1416 Ga0265318_10056220
1417 Ga0265338_10003416
1418 Ga0265770_1113820
1419 Ga0265765_1001337
1420 Ga0265760_10027081
1421 Ga0265330_10014540
1422 Ga0265332_10263149
1423 Ga0265325_10016460
1424 Ga0265325_10289117
1425 Ga0265329_10154169
1426 Ga0265339_10021718
1427 Ga0265316_10029729
1428 Ga0307408_100610662
1429 Ga0307408_101502788
1430 Ga0265313_10030016
1431 Ga0307508_10032965
1432 Ga0265314_10001091
1433 Ga0265342_10010821
1434 Ga0307405_11772931
1435 Ga0307410_10542543
1436 Ga0307410_10871488
1437 Ga0307410_11056324
1438 Ga0307407_10361524
1439 Ga0307412_10458022
1440 Ga0307416_100864757
1441 Ga0307416_101103587
1442 Ga0307416_103679878
1443 Ga0307415_100517113
1444 Ga0307415_100664159
1445 Ga0307415_100876962
1446 Ga0316214_1056543
1447 Ga0316212_1001532
1448 Ga0373929_0200166
1449 Ga0373934_0121887
1450 Ga0373949_0070301
1451 Ga0373939_0088960
1452 Ga0373941_0192029
1453 Ga0373945_0080026
1454 Ga0373954_0299440
1455 Ga0373943_0054424
1456 Ga0373946_0007168
1457 Ga0373955_0150161
1458 Ga0373961_0204540
1459 Ga0373962_0148328
1460 Ga0373924_0000219
1461 Ga0373931_0115531
1462 Ga0373931_0591863
1463 Ga0373935_0039004
1464 Ga0373927_0009349
1465 Ga0373947_0001718
1466 Ga0373937_0226807
1467 Ga0373937_0486377
1468 Ga0373937_1012101
1469 Ga0373925_0002188
1470 Ga0373925_0038535
1471 Ga0373925_0539181
1472 Ga0395900_0133452
1473 Ga0395900_1203350
1474 Ga0395898_0215393
1475 Ga0395898_0420496
1476 Ga0395898_1151786
1477 Ga0395905_0918777
1478 Ga0436364_0085669
1479 Ga0436364_0251712
1480 Ga0395901_0413178
1481 Ga0395901_0533755
1482 Ga0436360_0189030
1483 Ga0436363_1055472
1484 Ga0436362_0820201
1485 Ga0439439_0212434
1486 Ga0451797_0833949
1487 Ga0451849_0684501
1488 Ga0451849_1201735
1489 Ga0439441_069909
1490 Ga0450923_006154
1491 Ga0450923_041854
1492 Ga0439434_0230857
1493 Ga0439435_0004929
1494 Ga0439444_0005463
1495 Ga0439444_0076688
1496 Ga0439464_0015039
1497 Ga0439440_0129114
1498 Ga0439440_0193626
1499 Ga0466963_0726645
1500 Ga0451576_0568071
1501 Ga0495592_0720071
1502 Ga0495651_0003175
1503 Ga0495651_0176248
1504 Ga0495653_0233317
1505 Ga0495580_0017457
1506 Ga0495582_0269470
1507 Ga0495639_0616557
1508 Ga0495639_0705716
1509 Ga0495662_0119985
1510 Ga0495664_0149113
1511 Ga0495664_0309429
1512 Ga0495608_0082910
1513 Ga0495628_0453745
1514 Ga0495628_0933911
1515 Ga0495630_0108610
1516 Ga0495663_0168150
1517 Ga0495652_0153845
1518 Ga0495640_0396698
1519 Ga0495586_0600937
1520 Ga0495587_0009342
1521 Ga0495587_0368408
1522 Ga0495609_0421438
1523 Ga0495621_0020877
1524 Ga0495621_0424520
1525 Ga0495645_0022839
1526 Ga0495667_0031922
1527 Ga0495667_0231597
1528 Ga0495656_0752063
1529 Ga0495634_0349243
1530 Ga0495635_0359814
1531 Ga0495659_0379795
1532 Ga0495657_0205384
1533 Ga0495623_0009820
1534 Ga0495623_0231779
1535 Ga0495658_0038237
1536 Ga0495658_0579027
1537 Ga0495613_0145431
1538 Ga0495613_0247806
1539 Ga0495613_0452830
1540 Ga0495624_0042735
1541 Ga0495670_0754917
1542 Ga0495600_0081719
1543 Ga0495600_0166865
1544 Ga0495581_0675106
1545 Ga0495581_0793421
1546 Ga0495604_0445054
1547 Ga0495674_0007011
1548 Ga0495674_0256213
1549 Ga0495676_0781522
1550 Ga0495675_0020252
1551 Ga0495675_0067202
1552 Ga0495677_0240559
1553 Ga0495684_0003613
1554 Ga0495684_0063503
1555 Ga0495684_0581189
1556 Ga0495684_0860489
1557 Ga0495602_0054725
1558 Ga0495602_0286138
1559 Ga0495615_0001110
1560 Ga0496100_1253292
1561 Ga0496101_0155456
1562 Ga0496101_0341763
1563 Ga0496104_0015483
1564 Ga0496105_0013295
1565 Ga0496105_0238555
1566 Ga0496105_0896002
1567 Ga0496108_0857600
1568 Ga0496109_0488912
1569 Ga0496109_0905085
1570 Ga0496110_0979188
1571 Ga0496110_0984321
1572 Ga0496111_0150348
1573 Ga0496112_0041385
1574 Ga0496112_0173565
1575 Ga0496113_0000361
1576 Ga0496114_0000022
1577 Ga0496114_0558106
1578 Ga0496114_1195425
1579 Ga0496115_0666179
1580 Ga0496126_0033784
1581 Ga0501031_0244791
1582 Ga0501033_0005365
1583 Ga0501034_0092686
1584 Ga0501034_0214652
1585 Ga0501036_0014783
1586 Ga0501036_0240450
1587 Ga0501037_0016345
1588 Ga0501037_0065947
1589 Ga0501038_0010563
1590 Ga0501038_0027902
1591 Ga0501038_0365576
1592 Ga0501040_0375334
1593 Ga0501041_1023137
1594 Ga0501042_0290731
1595 Ga0501043_0002920
1596 Ga0501043_0716380
1597 Ga0501043_0815943
1598 Ga0501046_0026896
1599 Ga0501046_0035788
1600 Ga0501046_0401181
1601 Ga0501047_0045703
1602 Ga0501047_0273979
1603 Ga0501048_0007323
1604 Ga0501048_0037699
1605 Ga0501067_0004716
1606 Ga0501068_0008337
1607 Ga0501069_0074707
1608 Ga0501070_0013924
1609 Ga0501070_0093098
1610 Ga0501071_0173430
1611 Ga0501072_0395966
1612 Ga0501073_0027819
1613 Ga0501073_0531179
1614 Ga0501074_0011783
1615 Ga0501074_0171854
1616 Ga0501074_0638612
1617 Ga0501075_0135225
1618 Ga0501075_0276882
1619 Ga0501075_1148072
1620 Ga0501076_0035782
1621 Ga0501076_0369856
1622 Ga0501076_0536435
1623 Ga0501076_0922451
1624 Ga0501077_0827687
1625 Ga0501079_0003236
1626 Ga0501079_0007444
1627 Ga0501079_0479685
1628 Ga0501080_0031509
1629 Ga0501080_0667818
1630 Ga0501081_0578291
1631 Ga0501081_0966996
1632 Ga0501083_0038868
1633 Ga0501083_0317309
1634 Ga0501035_0004565
1635 Ga0501035_0044536
1636 Ga0501044_0064579
1637 Ga0501044_0207064
1638 nmdc:mga06z11_1017781_c1
1639 nmdc:mga05p37_1241631_c1
1640 nmdc:mga05p37_2128748_c1
1641 nmdc:mga05p37_230907_c1
1642 nmdc:mga05p37_27_c1
1643 nmdc:mga05p37_332280_c1
1644 nmdc:mga05p37_34532_c1
1645 nmdc:mga05p37_5252_c1
1646 nmdc:mga05p37_637047_c1
1647 nmdc:mga05p37_680786_c1
1648 nmdc:mga05p37_705374_c1
1649 nmdc:mga05p37_7353_c1
1650 nmdc:mga09592_13069_c1
1651 nmdc:mga09592_418527_c1
1652 nmdc:mga09592_606597_c1
1653 nmdc:mga0qj67_162144_c1
1654 nmdc:mga0qj67_16868_c1
1655 nmdc:mga0qj67_178772_c1
1656 nmdc:mga0qj67_67061_c1
1657 nmdc:mga0qj67_9400_c1
1658 nmdc:mga06r32_176577_c1
1659 nmdc:mga06r32_218820_c1
1660 nmdc:mga06r32_30869_c1
1661 nmdc:mga06r32_5119_c1
1662 nmdc:mga06r32_51305_c1
1663 nmdc:mga06r32_561134_c1
1664 nmdc:mga06r32_659_c1
1665 nmdc:mga06r32_662782_c1
1666 nmdc:mga06r32_72791_c1
1667 nmdc:mga06r32_75753_c1
1668 nmdc:mga06r32_83851_c1
1669 nmdc:mga06r32_911928_c1
1670 nmdc:mga06r32_97460_c1
1671 nmdc:mga06r32_99272_c1
1672 nmdc:mga08y16_1013451_c1
1673 nmdc:mga08y16_111355_c1
1674 nmdc:mga08y16_17461_c1
1675 nmdc:mga08y16_17487_c1
1676 nmdc:mga08y16_264572_c1
1677 nmdc:mga08y16_28483_c1
1678 nmdc:mga08y16_333227_c1
1679 nmdc:mga08y16_361702_c1
1680 nmdc:mga08y16_383625_c1
1681 nmdc:mga08y16_49182_c1
1682 nmdc:mga08y16_525336_c1
1683 nmdc:mga08y16_544826_c1
1684 nmdc:mga08y16_722304_c1
1685 nmdc:mga08y16_859744_c1
1686 nmdc:mga08y16_890765_c1
1687 nmdc:mga08y16_96148_c1
1688 nmdc:mga0n895_115539_c1
1689 nmdc:mga0n895_160600_c1
1690 nmdc:mga0n895_500871_c1
1691 nmdc:mga0rr50_1496414_c1
1692 nmdc:mga0rr50_63481_c1
1693 nmdc:mga0rr50_772292_c1
1694 nmdc:mga0rr50_982408_c1
1695 nmdc:mga08x19_1079515_c1
1696 nmdc:mga08x19_109673_c1
1697 nmdc:mga08x19_470481_c1
1698 nmdc:mga08x19_69310_c1
1699 nmdc:mga0a205_185789_c1
1700 nmdc:mga0a205_416681_c1
1701 nmdc:mga0a205_68853_c1
1702 nmdc:mga0a205_78427_c1
1703 Ga0495601_0050306
1704 Ga0495619_0087939
1705 Ga0500651_0079195
1706 Ga0500604_0041853
1707 Ga0501084_0239427
1708 Ga0501084_0285328
1709 Ga0501082_0013746
1710 Ga0501082_0112208
1711 Ga0501082_0532603
1712 Ga0501082_1405046
1713 Ga0530510_0436914
1714 Ga0530510_0524471

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03551

PadR

Transcriptional regulator PadR-like family

35

109

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hhh-assembly1.cif.gz_B crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.9273 12 109
3l7w-assembly1.cif.gz_A-2 the crystal structure of smu.1704 from streptococcus mutans ua159 0.9112 9 115
1xma-assembly1.cif.gz_A structure of a transcriptional regulator from clostridium thermocellum cth-833 0.908 12 106
3hhh-assembly1.cif.gz_A crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.9035 8 110
1xma-assembly1.cif.gz_B-2 structure of a transcriptional regulator from clostridium thermocellum cth-833 0.9015 7 106
ID Description Score Start End Superfamily
1xmaA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.908 12 106 1.10.10.10
af_I6X7F9_1_101_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9076 11 110 1.10.10.10
af_Q2FUS4_1_110_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8972 11 112 1.10.10.10
3l7wA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8924 9 109 1.10.10.10
5zqhA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8907 8 109 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7G8BQN0-F1-model_v4 PadR family transcriptional regulator 1.001 17 115
AF-A0A2V8CXJ2-F1-model_v4 PadR family transcriptional regulator 0.9949 19 115
AF-A0A0S7Z938-F1-model_v4 PadR family transcriptional regulator 0.9864 8 115
AF-A0A428MPC9-F1-model_v4 PadR family transcriptional regulator 0.9828 8 115
AF-A0A2E8EBH7-F1-model_v4 PadR family transcriptional regulator 0.9821 11 111

Map