F483636

General Info

Members Datasets Scaffolds Average Seq Length
855 275 853 263

Family's Representative Sequence

Representative Sequence 3300048910|Ga0496107_0174394|Ga0496107_0174394_283_1218
Length 311
Sequence MFIDSHAHIDGPEFDADREEVIERARAAGVSTILNVGTGDPHSGVFERAVELGKKYESVYTAIGTHPHDARLYDDQAEDKIKSLVQSERVIAWGEIGLDFHYDNSPRDVQVEVFKRQLRAARDCDLPVVIHTRKAEPETIEILKSDYAGAECRGVFHCFSGGMELAQRAIELGFMISFSGIVTFKKADELRAVAKQVPLDRLLIETDCPYLSPIPYRGKRNEPAYVVEVARCLAGIHGVDIEEIARLTTENFRKFFSRKGAKTQSSSRVYILPLRLCAFAGEMSLPAIQGLSTSTSSSSRELGRRRGVCGD

Samples

Sample ID Description Type Environment
1 2671180531 Gemmata sp. SH-PL17 Isolate Unclassified
2 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
3 3300001426 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 Metagenome Rhizosphere
4 3300001432 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
6 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
7 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
8 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
9 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
38 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
39 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
42 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
56 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
76 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
77 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
81 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
82 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
83 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
84 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
85 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
88 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
90 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
95 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
101 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
102 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
103 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
104 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
105 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
106 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
107 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
108 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
109 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
110 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
111 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
112 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
113 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
114 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
115 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
116 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
117 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
118 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
119 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
120 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
171 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
174 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
175 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
176 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
177 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
178 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
179 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
180 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
181 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
182 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
183 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
184 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
185 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
186 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
187 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
188 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
189 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
190 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
191 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
192 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
193 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
194 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
195 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
196 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
197 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
198 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
199 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
200 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
201 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
202 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
203 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
204 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
205 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
206 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
207 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
208 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
209 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
210 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
211 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
212 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
213 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
214 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
215 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
216 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
217 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
218 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
219 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
220 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
221 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
222 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
223 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
224 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
225 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
226 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
227 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
228 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
229 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
230 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
231 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
232 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
233 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
234 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
243 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
244 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
245 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
246 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
247 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
248 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
249 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
250 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
251 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
252 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
253 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
254 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
255 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
256 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
257 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
258 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
261 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
262 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
263 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
264 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
265 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
266 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
267 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
268 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
269 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
270 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
271 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
272 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
273 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
274 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
275 8007371054 Clostridium sp. YIM B02515 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.77
Metatranscriptomes 0
Isolates 0.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.23
Nodule 0
Rhizoplane 0.58
Rhizosphere 97.66
Stem 0
Stem Tuber 0
Unclassified 1.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNAas_1001219 3300000532 Bacteria 2298
2 JGI24030J14995_100170 3300001426 Unclassified 1773
3 JGI24034J14986_101130 3300001432 Unclassified 1563
4 JGI24748J21848_1000003 3300002074 Bacteria 323921
5 JGI24034J26672_10000005 3300002239 Bacteria 404185
6 JGI24751J29686_10000085 3300002459 Bacteria 52356
7 JGI25406J46586_10000438 3300003203 Bacteria 19276
8 JGI25406J46586_10006797 3300003203 Bacteria 5254
9 JGI25406J46586_10011063 3300003203 Unclassified 3966
10 Ga0065714_10064444 3300005288 Bacteria 94227
11 Ga0065704_10004769 3300005289 Bacteria 3560
12 Ga0065712_10010420 3300005290 Unclassified 3108
13 Ga0065712_10067736 3300005290 Bacteria 94196
14 Ga0065712_10125633 3300005290 Bacteria 1611
15 Ga0065712_10242113 3300005290 Bacteria 981
16 Ga0065715_10003956 3300005293 Bacteria 3758
17 Ga0065715_10014485 3300005293 Bacteria 2224
18 Ga0065715_10018531 3300005293 Bacteria 2202
19 Ga0065715_10090715 3300005293 Bacteria 6575
20 Ga0065715_10100860 3300005293 Bacteria 3260
21 Ga0065715_10122203 3300005293 Unclassified 2188
22 Ga0065715_10123337 3300005293 Unclassified 2168
23 Ga0065707_10001462 3300005295 Bacteria 11811
24 Ga0065707_10091531 3300005295 Bacteria 3926
25 Ga0065707_10096313 3300005295 Bacteria 3281
26 Ga0070658_10008799 3300005327 Bacteria 8113
27 Ga0070676_10061106 3300005328 Bacteria 2239
28 Ga0070690_100002320 3300005330 Bacteria 10217
29 Ga0070690_100081286 3300005330 Unclassified 2120
30 Ga0070690_100106789 3300005330 Bacteria 1863
31 Ga0070690_100115287 3300005330 Bacteria 1797
32 Ga0070670_100000057 3300005331 Bacteria 118540
33 Ga0070670_100026732 3300005331 Bacteria 4964
34 Ga0070670_100050310 3300005331 Bacteria 3581
35 Ga0070670_100088040 3300005331 Bacteria 2669
36 Ga0070670_100110634 3300005331 Bacteria 2367
37 Ga0070670_100128392 3300005331 Bacteria 2188
38 Ga0070670_100213711 3300005331 Bacteria 1677
39 Ga0068869_100013570 3300005334 Bacteria 5422
40 Ga0068869_100110724 3300005334 Bacteria 2089
41 Ga0068869_100129407 3300005334 Bacteria 1939
42 Ga0068869_100166919 3300005334 Bacteria 1717
43 Ga0068869_100183434 3300005334 Unclassified 1642
44 Ga0068869_100210339 3300005334 Bacteria 1537
45 Ga0068869_100214733 3300005334 Bacteria 1522
46 Ga0070666_10155874 3300005335 Bacteria 1595
47 Ga0070680_100004835 3300005336 Bacteria 10143
48 Ga0070680_100253433 3300005336 Bacteria 1488
49 Ga0070680_100319717 3300005336 Bacteria 1317
50 Ga0070680_100396025 3300005336 Bacteria 1177
51 Ga0070682_100000068 3300005337 Bacteria 96186
52 Ga0070682_100001206 3300005337 Bacteria 14741
53 Ga0068868_100052164 3300005338 Bacteria 3220
54 Ga0068868_100106440 3300005338 Bacteria 2275
55 Ga0070660_100233421 3300005339 Bacteria 1497
56 Ga0070689_100000292 3300005340 Bacteria 29087
57 Ga0070689_100030290 3300005340 Unclassified 4107
58 Ga0070689_100188181 3300005340 Bacteria 1680
59 Ga0070689_100477160 3300005340 Bacteria 1065
60 Ga0070687_100060679 3300005343 Unclassified 1996
61 Ga0070661_100029084 3300005344 Bacteria 3987
62 Ga0070661_100353317 3300005344 Bacteria 1154
63 Ga0070692_10002955 3300005345 Bacteria 6761
64 Ga0070692_10045813 3300005345 Bacteria 2257
65 Ga0070692_10065754 3300005345 Bacteria 1921
66 Ga0070668_100006439 3300005347 Bacteria 8707
67 Ga0070669_100002525 3300005353 Bacteria 13228
68 Ga0070669_100010925 3300005353 Bacteria 6447
69 Ga0070669_100047062 3300005353 Unclassified 3146
70 Ga0070669_100118096 3300005353 Bacteria 2020
71 Ga0070669_100122369 3300005353 Bacteria 1987
72 Ga0070675_100096163 3300005354 Bacteria 2488
73 Ga0070675_100112115 3300005354 Unclassified 2309
74 Ga0070675_100392041 3300005354 Unclassified 1237
75 Ga0070671_100005420 3300005355 Bacteria 10177
76 Ga0070671_100030391 3300005355 Bacteria 4457
77 Ga0070671_100331782 3300005355 Bacteria 1297
78 Ga0070671_100477977 3300005355 Bacteria 1070
79 Ga0070671_100557814 3300005355 Bacteria 988
80 Ga0070674_100541778 3300005356 Viruses 975
81 Ga0070673_100051706 3300005364 Bacteria 3220
82 Ga0070673_100192708 3300005364 Bacteria 1751
83 Ga0070673_100332014 3300005364 Bacteria 1345
84 Ga0070688_100131439 3300005365 Bacteria 1689
85 Ga0070659_100002999 3300005366 Bacteria 12012
86 Ga0070667_100067474 3300005367 Bacteria 3041
87 Ga0070667_100183140 3300005367 Unclassified 1853
88 Ga0070703_10000036 3300005406 Bacteria 65827
89 Ga0070701_10037404 3300005438 Bacteria 2450
90 Ga0070701_10248038 3300005438 Bacteria 1074
91 Ga0070701_10470917 3300005438 Unclassified 810
92 Ga0070705_100144075 3300005440 Bacteria 1572
93 Ga0070705_100256924 3300005440 Bacteria 1230
94 Ga0070705_100270300 3300005440 Bacteria 1203
95 Ga0070705_100420960 3300005440 Unclassified 994
96 Ga0070700_100000305 3300005441 Bacteria 25711
97 Ga0070700_100013026 3300005441 Bacteria 4663
98 Ga0070700_100013485 3300005441 Bacteria 4591
99 Ga0070700_100066109 3300005441 Unclassified 2294
100 Ga0070700_100111621 3300005441 Bacteria 1819
101 Ga0070700_100268723 3300005441 Unclassified 1231
102 Ga0070700_100483850 3300005441 Unclassified 949
103 Ga0070694_100003401 3300005444 Bacteria 9536
104 Ga0070694_100012648 3300005444 Bacteria 5254
105 Ga0070694_100025987 3300005444 Bacteria 3792
106 Ga0070694_100049475 3300005444 Bacteria 2831
107 Ga0070694_100053308 3300005444 Bacteria 2737
108 Ga0070694_100157885 3300005444 Bacteria 1662
109 Ga0070694_100650476 3300005444 Unclassified 853
110 Ga0070708_100000002 3300005445 Bacteria 195857
111 Ga0070708_100272617 3300005445 Bacteria 1592
112 Ga0070708_100313686 3300005445 Bacteria 1477
113 Ga0070708_100514079 3300005445 Unclassified 1129
114 Ga0070662_100122203 3300005457 Unclassified 1997
115 Ga0070681_10000041 3300005458 Bacteria 89178
116 Ga0070681_10018062 3300005458 Bacteria 7048
117 Ga0070681_10029594 3300005458 Bacteria 5499
118 Ga0070681_10056272 3300005458 Bacteria 3915
119 Ga0070681_10058592 3300005458 Bacteria 3831
120 Ga0070681_10408994 3300005458 Bacteria 1269
121 Ga0068867_100270907 3300005459 Bacteria 1388
122 Ga0068867_100513930 3300005459 Bacteria 1032
123 Ga0070706_100000002 3300005467 Bacteria 326510
124 Ga0070706_100005846 3300005467 Bacteria 11671
125 Ga0070706_100013151 3300005467 Bacteria 7658
126 Ga0070706_100018943 3300005467 Bacteria 6349
127 Ga0070706_100060029 3300005467 Bacteria 3510
128 Ga0070706_100065565 3300005467 Bacteria 3359
129 Ga0070706_100854147 3300005467 Bacteria 841
130 Ga0070707_100000167 3300005468 Bacteria 63391
131 Ga0070707_100003979 3300005468 Bacteria 13913
132 Ga0070707_100007291 3300005468 Bacteria 10269
133 Ga0070707_100021845 3300005468 Bacteria 6050
134 Ga0070707_100144200 3300005468 Bacteria 2318
135 Ga0070707_100276880 3300005468 Unclassified 1631
136 Ga0070707_100378087 3300005468 Bacteria 1376
137 Ga0070698_100000164 3300005471 Bacteria 61194
138 Ga0070698_100000916 3300005471 Bacteria 32268
139 Ga0070698_100002314 3300005471 Bacteria 21075
140 Ga0070698_100004907 3300005471 Bacteria 14674
141 Ga0070698_100010410 3300005471 Bacteria 9933
142 Ga0070698_100033807 3300005471 Bacteria 5297
143 Ga0070698_100033997 3300005471 Bacteria 5281
144 Ga0070698_100059613 3300005471 Unclassified 3854
145 Ga0070698_100071065 3300005471 Bacteria 3491
146 Ga0070698_100138191 3300005471 Bacteria 2389
147 Ga0070698_100874239 3300005471 Bacteria 844
148 Ga0070699_100000169 3300005518 Bacteria 63052
149 Ga0070699_100000483 3300005518 Bacteria 37967
150 Ga0070699_100059794 3300005518 Unclassified 3301
151 Ga0070699_100061167 3300005518 Bacteria 3264
152 Ga0070699_100136443 3300005518 Bacteria 2164
153 Ga0070699_100198725 3300005518 Bacteria 1782
154 Ga0070699_100310977 3300005518 Bacteria 1414
155 Ga0070679_100000074 3300005530 Bacteria 74890
156 Ga0070679_100014621 3300005530 Bacteria 7543
157 Ga0070697_100000071 3300005536 Bacteria 80945
158 Ga0070697_100006099 3300005536 Bacteria 9323
159 Ga0070697_100008492 3300005536 Bacteria 8015
160 Ga0070697_100013343 3300005536 Bacteria 6444
161 Ga0070697_100027095 3300005536 Bacteria 4583
162 Ga0070697_100051154 3300005536 Bacteria 3356
163 Ga0070697_100058589 3300005536 Bacteria 3135
164 Ga0070697_100203799 3300005536 Bacteria 1682
165 Ga0070697_100351578 3300005536 Bacteria 1273
166 Ga0070697_100656103 3300005536 Bacteria 924
167 Ga0068853_100009751 3300005539 Bacteria 7746
168 Ga0068853_100018350 3300005539 Bacteria 5790
169 Ga0068853_100033867 3300005539 Bacteria 4334
170 Ga0068853_100110758 3300005539 Bacteria 2438
171 Ga0070672_100406543 3300005543 Bacteria 1167
172 Ga0070686_100006607 3300005544 Bacteria 6455
173 Ga0070686_100009506 3300005544 Bacteria 5466
174 Ga0070686_100062493 3300005544 Bacteria 2410
175 Ga0070686_100459957 3300005544 Bacteria 980
176 Ga0070695_100094994 3300005545 Bacteria 1997
177 Ga0070695_100111012 3300005545 Bacteria 1861
178 Ga0070695_100374524 3300005545 Bacteria 1073
179 Ga0070695_100434657 3300005545 Bacteria 1002
180 Ga0070696_100014172 3300005546 Bacteria 5349
181 Ga0070696_100017420 3300005546 Bacteria 4848
182 Ga0070696_100133512 3300005546 Unclassified 1809
183 Ga0070696_100259934 3300005546 Bacteria 1316
184 Ga0070696_100282769 3300005546 Bacteria 1265
185 Ga0070693_100015794 3300005547 Bacteria 3895
186 Ga0070693_100204293 3300005547 Bacteria 1285
187 Ga0070704_100003508 3300005549 Bacteria 9009
188 Ga0070704_100035319 3300005549 Unclassified 3397
189 Ga0070704_100035616 3300005549 Unclassified 3384
190 Ga0070704_100092735 3300005549 Bacteria 2255
191 Ga0070704_100210472 3300005549 Bacteria 1575
192 Ga0070704_100367951 3300005549 Bacteria 1218
193 Ga0070704_100409901 3300005549 Bacteria 1158
194 Ga0070704_100504389 3300005549 Bacteria 1050
195 Ga0068855_100605770 3300005563 Bacteria 1181
196 Ga0070664_100000280 3300005564 Bacteria 36774
197 Ga0070664_100040842 3300005564 Bacteria 3913
198 Ga0070664_100524113 3300005564 Bacteria 1094
199 Ga0068857_100579234 3300005577 Bacteria 1059
200 Ga0068854_100056328 3300005578 Bacteria 2833
201 Ga0068854_100217479 3300005578 Bacteria 1510
202 Ga0068854_100234550 3300005578 Unclassified 1458
203 Ga0068854_100357432 3300005578 Bacteria 1197
204 Ga0068854_100666344 3300005578 Bacteria 895
205 Ga0070702_100002032 3300005615 Bacteria 8549
206 Ga0070702_100028198 3300005615 Archaea 3041
207 Ga0070702_100065890 3300005615 Bacteria 2123
208 Ga0068852_100140694 3300005616 Bacteria 2233
209 Ga0068852_100149455 3300005616 Bacteria 2171
210 Ga0068852_100313932 3300005616 Bacteria 1520
211 Ga0068852_100540037 3300005616 Bacteria 1165
212 Ga0068852_100643349 3300005616 Unclassified 1067
213 Ga0068859_100018658 3300005617 Bacteria 6973
214 Ga0068859_100026938 3300005617 Bacteria 5766
215 Ga0068859_100033363 3300005617 Bacteria 5169
216 Ga0068859_100035651 3300005617 Bacteria 4992
217 Ga0068859_100045900 3300005617 Bacteria 4388
218 Ga0068859_100061173 3300005617 Bacteria 3794
219 Ga0068859_100103052 3300005617 Bacteria 2911
220 Ga0068859_100109989 3300005617 Bacteria 2817
221 Ga0068859_100119379 3300005617 Bacteria 2703
222 Ga0068859_100175866 3300005617 Bacteria 2222
223 Ga0068859_100179404 3300005617 Bacteria 2200
224 Ga0068859_100189302 3300005617 Bacteria 2142
225 Ga0068859_100195755 3300005617 Unclassified 2105
226 Ga0068859_100206524 3300005617 Unclassified 2049
227 Ga0068859_100261688 3300005617 Bacteria 1821
228 Ga0068859_100280038 3300005617 Bacteria 1760
229 Ga0068859_100457867 3300005617 Bacteria 1372
230 Ga0068859_100577644 3300005617 Bacteria 1218
231 Ga0068859_100810579 3300005617 Bacteria 1023
232 Ga0068864_100022935 3300005618 Bacteria 5237
233 Ga0068864_100033299 3300005618 Bacteria 4381
234 Ga0068864_100045602 3300005618 Unclassified 3760
235 Ga0068864_100207507 3300005618 Bacteria 1802
236 Ga0068864_100439737 3300005618 Bacteria 1246
237 Ga0068866_10053147 3300005718 Bacteria 2070
238 Ga0068866_10128428 3300005718 Bacteria 1438
239 Ga0068866_10137060 3300005718 Bacteria 1400
240 Ga0068861_100000717 3300005719 Bacteria 19814
241 Ga0068861_100029995 3300005719 Bacteria 3983
242 Ga0068861_100097003 3300005719 Bacteria 2337
243 Ga0068861_100121439 3300005719 Bacteria 2108
244 Ga0068861_100181743 3300005719 Bacteria 1751
245 Ga0068861_100211690 3300005719 Bacteria 1633
246 Ga0068861_100273294 3300005719 Bacteria 1452
247 Ga0068861_100741301 3300005719 Bacteria 917
248 Ga0068851_10095564 3300005834 Bacteria 1570
249 Ga0068870_10030552 3300005840 Bacteria 2723
250 Ga0068870_10178023 3300005840 Bacteria 1274
251 Ga0068870_10370093 3300005840 Bacteria 925
252 Ga0068863_100018375 3300005841 Bacteria 6691
253 Ga0068863_100037936 3300005841 Unclassified 4586
254 Ga0068863_100044808 3300005841 Unclassified 4198
255 Ga0068863_100046793 3300005841 Bacteria 4106
256 Ga0068863_100047679 3300005841 Bacteria 4063
257 Ga0068863_100061232 3300005841 Unclassified 3558
258 Ga0068863_100082478 3300005841 Bacteria 3047
259 Ga0068863_100362025 3300005841 Bacteria 1414
260 Ga0068863_100596828 3300005841 Bacteria 1093
261 Ga0068858_100000134 3300005842 Bacteria 77566
262 Ga0068858_100014863 3300005842 Bacteria 7323
263 Ga0068858_100027082 3300005842 Bacteria 5325
264 Ga0068858_100041991 3300005842 Bacteria 4240
265 Ga0068858_100056480 3300005842 Unclassified 3628
266 Ga0068858_100129545 3300005842 Unclassified 2365
267 Ga0068858_100138359 3300005842 Bacteria 2286
268 Ga0068858_100166619 3300005842 Bacteria 2076
269 Ga0068858_100175387 3300005842 Bacteria 2023
270 Ga0068858_100462773 3300005842 Bacteria 1223
271 Ga0068860_100006276 3300005843 Bacteria 11937
272 Ga0068860_100043714 3300005843 Bacteria 4272
273 Ga0068860_100107672 3300005843 Bacteria 2664
274 Ga0068860_100109223 3300005843 Bacteria 2643
275 Ga0068860_100112769 3300005843 Bacteria 2600
276 Ga0068860_100191474 3300005843 Unclassified 1979
277 Ga0068860_100234441 3300005843 Unclassified 1784
278 Ga0068860_100236824 3300005843 Bacteria 1775
279 Ga0068860_100272955 3300005843 Bacteria 1651
280 Ga0068860_100543992 3300005843 Bacteria 1163
281 Ga0068862_100101196 3300005844 Unclassified 2521
282 Ga0068862_100118142 3300005844 Bacteria 2334
283 Ga0068862_100209752 3300005844 Bacteria 1760
284 Ga0081539_10000731 3300005985 Bacteria 65764
285 Ga0081539_10000931 3300005985 Bacteria 54965
286 Ga0081539_10002625 3300005985 Bacteria 24575
287 Ga0081539_10006502 3300005985 Bacteria 11175
288 Ga0070715_10000018 3300006163 Bacteria 124487
289 Ga0070716_100000017 3300006173 Bacteria 88957
290 Ga0070716_100033150 3300006173 Bacteria 2823
291 Ga0070716_100298041 3300006173 Bacteria 1120
292 Ga0097621_100001570 3300006237 Bacteria 15609
293 Ga0097621_100003941 3300006237 Bacteria 10284
294 Ga0097621_100025494 3300006237 Bacteria 4627
295 Ga0097621_100074871 3300006237 Bacteria 2805
296 Ga0097621_100235129 3300006237 Bacteria 1600
297 Ga0068871_100001715 3300006358 Bacteria 14742
298 Ga0068871_100003493 3300006358 Bacteria 10806
299 Ga0068871_100004902 3300006358 Bacteria 9349
300 Ga0068871_100458521 3300006358 Bacteria 1144
301 Ga0075428_100308669 3300006844 Bacteria 1700
302 Ga0075428_100401259 3300006844 Bacteria 1469
303 Ga0075428_100506546 3300006844 Bacteria 1291
304 Ga0075428_100529982 3300006844 Bacteria 1259
305 Ga0075428_100654440 3300006844 Bacteria 1120
306 Ga0075430_100050628 3300006846 Bacteria 3501
307 Ga0075430_100164322 3300006846 Unclassified 1847
308 Ga0075431_100231300 3300006847 Bacteria 1883
309 Ga0075433_10023132 3300006852 Bacteria 5227
310 Ga0075433_10178463 3300006852 Bacteria 1889
311 Ga0075433_10238450 3300006852 Bacteria 1614
312 Ga0075433_10312900 3300006852 Unclassified 1390
313 Ga0075433_10603420 3300006852 Bacteria 964
314 Ga0075434_100195837 3300006871 Bacteria 2041
315 Ga0075434_100240066 3300006871 Unclassified 1832
316 Ga0075434_100252270 3300006871 Bacteria 1784
317 Ga0075434_100398827 3300006871 Bacteria 1397
318 Ga0075434_100479746 3300006871 Bacteria 1265
319 Ga0075429_100116667 3300006880 Bacteria 2333
320 Ga0075429_100307330 3300006880 Bacteria 1388
321 Ga0068865_100030118 3300006881 Bacteria 3607
322 Ga0068865_100031323 3300006881 Bacteria 3545
323 Ga0068865_100080047 3300006881 Bacteria 2342
324 Ga0075436_100000011 3300006914 Bacteria 208094
325 Ga0075436_100325661 3300006914 Bacteria 1104
326 Ga0075436_100386850 3300006914 Bacteria 1012
327 Ga0097620_100018658 3300006931 Bacteria 6973
328 Ga0097620_100026938 3300006931 Bacteria 5766
329 Ga0097620_100033364 3300006931 Bacteria 5169
330 Ga0097620_100035652 3300006931 Bacteria 4992
331 Ga0097620_100045900 3300006931 Bacteria 4388
332 Ga0097620_100061173 3300006931 Bacteria 3794
333 Ga0097620_100103046 3300006931 Bacteria 2911
334 Ga0097620_100109983 3300006931 Bacteria 2817
335 Ga0097620_100119364 3300006931 Bacteria 2703
336 Ga0097620_100175870 3300006931 Bacteria 2222
337 Ga0097620_100179393 3300006931 Bacteria 2200
338 Ga0097620_100189300 3300006931 Bacteria 2142
339 Ga0097620_100195762 3300006931 Unclassified 2105
340 Ga0097620_100206534 3300006931 Unclassified 2049
341 Ga0097620_100261674 3300006931 Bacteria 1821
342 Ga0097620_100280047 3300006931 Bacteria 1760
343 Ga0097620_100457887 3300006931 Bacteria 1372
344 Ga0097620_100577642 3300006931 Bacteria 1218
345 Ga0097620_100810591 3300006931 Bacteria 1023
346 Ga0075435_100009513 3300007076 Bacteria 7043
347 Ga0099794_10027450 3300007265 Unclassified 2639
348 Ga0105240_10041387 3300009093 Bacteria 5881
349 Ga0111539_10001784 3300009094 Bacteria 28601
350 Ga0111539_10098886 3300009094 Bacteria 3427
351 Ga0111539_10131725 3300009094 Bacteria 2928
352 Ga0111539_10179811 3300009094 Bacteria 2471
353 Ga0105245_10094357 3300009098 Bacteria 2758
354 Ga0105245_10187351 3300009098 Bacteria 1980
355 Ga0105245_10342591 3300009098 Bacteria 1479
356 Ga0105245_10886819 3300009098 Bacteria 933
357 Ga0105247_10000022 3300009101 Bacteria 219796
358 Ga0105247_10003696 3300009101 Bacteria 9931
359 Ga0105247_10041404 3300009101 Unclassified 2819
360 Ga0105247_10042199 3300009101 Bacteria 2793
361 Ga0105247_10056432 3300009101 Unclassified 2425
362 Ga0105247_10416345 3300009101 Bacteria 961
363 Ga0114129_10077095 3300009147 Bacteria 4638
364 Ga0114129_10128631 3300009147 Bacteria 3481
365 Ga0114129_10169017 3300009147 Bacteria 2982
366 Ga0114129_10198008 3300009147 Unclassified 2723
367 Ga0114129_10273284 3300009147 Bacteria 2260
368 Ga0114129_10399162 3300009147 Bacteria 1812
369 Ga0114129_10489936 3300009147 Bacteria 1607
370 Ga0105243_10000102 3300009148 Bacteria 97833
371 Ga0105243_10000207 3300009148 Bacteria 68914
372 Ga0105243_10040911 3300009148 Unclassified 3623
373 Ga0105243_10110958 3300009148 Unclassified 2295
374 Ga0105243_10219470 3300009148 Bacteria 1680
375 Ga0105243_10231840 3300009148 Unclassified 1638
376 Ga0105243_10311564 3300009148 Bacteria 1430
377 Ga0105243_10704469 3300009148 Bacteria 985
378 Ga0105241_10019871 3300009174 Unclassified 4957
379 Ga0105241_10779524 3300009174 Bacteria 879
380 Ga0105242_10000279 3300009176 Bacteria 40655
381 Ga0105242_10000807 3300009176 Bacteria 24281
382 Ga0105242_10005822 3300009176 Bacteria 9493
383 Ga0105242_10108836 3300009176 Bacteria 2359
384 Ga0105242_10155864 3300009176 Bacteria 1995
385 Ga0105248_10004786 3300009177 Bacteria 14983
386 Ga0105248_10013500 3300009177 Bacteria 8993
387 Ga0105248_10116314 3300009177 Unclassified 3016
388 Ga0105248_10130327 3300009177 Bacteria 2837
389 Ga0105248_10190150 3300009177 Bacteria 2313
390 Ga0105248_10312045 3300009177 Bacteria 1771
391 Ga0105248_10437898 3300009177 Bacteria 1472
392 Ga0105248_10526596 3300009177 Bacteria 1333
393 Ga0105248_10787017 3300009177 Bacteria 1073
394 Ga0105248_10879568 3300009177 Unclassified 1012
395 Ga0105237_10034027 3300009545 Bacteria 5161
396 Ga0105237_10073202 3300009545 Bacteria 3419
397 Ga0105237_10322546 3300009545 Bacteria 1548
398 Ga0105238_10009968 3300009551 Bacteria 9527
399 Ga0105238_10013272 3300009551 Bacteria 8313
400 Ga0105249_10000254 3300009553 Bacteria 58502
401 Ga0105249_10074481 3300009553 Bacteria 3142
402 Ga0105249_10159769 3300009553 Bacteria 2177
403 Ga0105249_10180798 3300009553 Bacteria 2052
404 Ga0105249_10192297 3300009553 Bacteria 1992
405 Ga0105249_10487386 3300009553 Bacteria 1276
406 Ga0105249_10679044 3300009553 Unclassified 1089
407 Ga0105239_10135754 3300010375 Bacteria 2739
408 Ga0105239_10352157 3300010375 Unclassified 1662
409 Ga0105239_10601699 3300010375 Bacteria 1254
410 Ga0105246_10012997 3300011119 Bacteria 5210
411 Ga0105246_10186646 3300011119 Viruses 1601
412 Ga0105246_10253604 3300011119 Bacteria 1398
413 Ga0157373_10004608 3300013100 Bacteria 10368
414 Ga0157373_10172215 3300013100 Bacteria 1523
415 Ga0157373_10222501 3300013100 Unclassified 1332
416 Ga0157371_10557392 3300013102 Unclassified 850
417 Ga0157369_10365050 3300013105 Unclassified 1499
418 Ga0157374_10037875 3300013296 Bacteria 4430
419 Ga0157374_10173327 3300013296 Bacteria 2105
420 Ga0157378_10000191 3300013297 Bacteria 59071
421 Ga0157378_10009723 3300013297 Bacteria 8377
422 Ga0157378_10014643 3300013297 Bacteria 6867
423 Ga0157378_10024594 3300013297 Bacteria 5302
424 Ga0157378_10033984 3300013297 Bacteria 4510
425 Ga0157378_10085582 3300013297 Bacteria 2856
426 Ga0157378_10092551 3300013297 Unclassified 2751
427 Ga0157378_10147662 3300013297 Bacteria 2188
428 Ga0157378_10231787 3300013297 Bacteria 1760
429 Ga0157378_10260632 3300013297 Bacteria 1663
430 Ga0157378_10306078 3300013297 Bacteria 1540
431 Ga0157378_10505085 3300013297 Unclassified 1208
432 Ga0157378_10818482 3300013297 Bacteria 958
433 Ga0163162_10000179 3300013306 Bacteria 58502
434 Ga0163162_10012064 3300013306 Bacteria 8429
435 Ga0163162_10015538 3300013306 Bacteria 7438
436 Ga0163162_10038965 3300013306 Unclassified 4745
437 Ga0163162_10042270 3300013306 Unclassified 4561
438 Ga0163162_10075719 3300013306 Bacteria 3426
439 Ga0163162_10082924 3300013306 Bacteria 3279
440 Ga0163162_10124137 3300013306 Unclassified 2687
441 Ga0163162_10238326 3300013306 Bacteria 1950
442 Ga0163162_10320613 3300013306 Bacteria 1682
443 Ga0163162_10440929 3300013306 Bacteria 1434
444 Ga0163162_10555069 3300013306 Bacteria 1277
445 Ga0163162_10594381 3300013306 Bacteria 1233
446 Ga0157372_10043475 3300013307 Unclassified 4974
447 Ga0157372_10044452 3300013307 Bacteria 4922
448 Ga0157372_10108256 3300013307 Bacteria 3180
449 Ga0157375_10004435 3300013308 Bacteria 12188
450 Ga0157375_10021549 3300013308 Bacteria 5912
451 Ga0157375_10023277 3300013308 Bacteria 5713
452 Ga0157375_10066328 3300013308 Bacteria 3603
453 Ga0157375_10093322 3300013308 Unclassified 3076
454 Ga0157375_10463376 3300013308 Bacteria 1433
455 Ga0157375_10633756 3300013308 Bacteria 1226
456 Ga0163163_10000184 3300014325 Bacteria 64203
457 Ga0163163_10004533 3300014325 Bacteria 11860
458 Ga0163163_10005720 3300014325 Bacteria 10783
459 Ga0163163_10012406 3300014325 Bacteria 7762
460 Ga0163163_10024208 3300014325 Bacteria 5776
461 Ga0163163_10104265 3300014325 Unclassified 2861
462 Ga0163163_10204687 3300014325 Unclassified 2022
463 Ga0163163_10633934 3300014325 Bacteria 1132
464 Ga0157380_10000627 3300014326 Bacteria 21695
465 Ga0157380_10003949 3300014326 Bacteria 10238
466 Ga0157380_10006388 3300014326 Bacteria 8297
467 Ga0157380_10016724 3300014326 Bacteria 5417
468 Ga0157380_10047258 3300014326 Bacteria 3385
469 Ga0157380_11016156 3300014326 Bacteria 863
470 Ga0157377_10109087 3300014745 Bacteria 1661
471 Ga0157377_10355611 3300014745 Bacteria 984
472 Ga0157379_10049363 3300014968 Bacteria 3758
473 Ga0157379_10090990 3300014968 Unclassified 2737
474 Ga0157379_10396728 3300014968 Bacteria 1268
475 Ga0157376_10015880 3300014969 Bacteria 5701
476 Ga0157376_10038847 3300014969 Unclassified 3876
477 Ga0157376_10566630 3300014969 Bacteria 1126
478 Ga0163161_10022258 3300017792 Bacteria 4461
479 Ga0163161_10118375 3300017792 Bacteria 1988
480 Ga0163161_10174222 3300017792 Bacteria 1646
481 Ga0163161_10343028 3300017792 Unclassified 1185
482 Ga0213876_10000043 3300021384 Bacteria 162257
483 Ga0213876_10000228 3300021384 Bacteria 55016
484 Ga0213876_10001953 3300021384 Bacteria 12347
485 Ga0207672_1000046 3300025223 Bacteria 16046
486 Ga0207653_10000008 3300025885 Bacteria 197323
487 Ga0207642_10040653 3300025899 Bacteria 2030
488 Ga0207642_10136482 3300025899 Unclassified 1287
489 Ga0207710_10000001 3300025900 Bacteria 1797433
490 Ga0207710_10009002 3300025900 Bacteria 4202
491 Ga0207647_10006088 3300025904 Bacteria 8792
492 Ga0207685_10000022 3300025905 Bacteria 125184
493 Ga0207643_10009459 3300025908 Bacteria 5235
494 Ga0207643_10035314 3300025908 Bacteria 2803
495 Ga0207705_10026077 3300025909 Bacteria 4171
496 Ga0207684_10000076 3300025910 Bacteria 183107
497 Ga0207684_10010598 3300025910 Bacteria 8103
498 Ga0207684_10014326 3300025910 Bacteria 6839
499 Ga0207684_10080999 3300025910 Bacteria 2762
500 Ga0207684_10090064 3300025910 Bacteria 2614
501 Ga0207684_10161537 3300025910 Bacteria 1929
502 Ga0207684_10722182 3300025910 Bacteria 846
503 Ga0207654_10475760 3300025911 Bacteria 879
504 Ga0207707_10000077 3300025912 Bacteria 100255
505 Ga0207707_10010071 3300025912 Bacteria 8201
506 Ga0207707_10017193 3300025912 Bacteria 6303
507 Ga0207707_10027372 3300025912 Bacteria 4987
508 Ga0207707_10310225 3300025912 Bacteria 1363
509 Ga0207695_10097543 3300025913 Unclassified 2940
510 Ga0207671_10002740 3300025914 Bacteria 18427
511 Ga0207671_10088224 3300025914 Bacteria 2333
512 Ga0207671_10415242 3300025914 Bacteria 1071
513 Ga0207662_10025954 3300025918 Bacteria 3377
514 Ga0207662_10071936 3300025918 Bacteria 2095
515 Ga0207662_10081775 3300025918 Bacteria 1972
516 Ga0207652_10000096 3300025921 Bacteria 96047
517 Ga0207652_10081877 3300025921 Bacteria 2824
518 Ga0207652_10247382 3300025921 Bacteria 1608
519 Ga0207646_10001426 3300025922 Bacteria 29683
520 Ga0207646_10005266 3300025922 Bacteria 13641
521 Ga0207646_10022181 3300025922 Bacteria 5854
522 Ga0207646_10226111 3300025922 Bacteria 1690
523 Ga0207646_10263093 3300025922 Bacteria 1559
524 Ga0207646_10278437 3300025922 Bacteria 1512
525 Ga0207646_10329243 3300025922 Bacteria 1380
526 Ga0207681_10007662 3300025923 Bacteria 6616
527 Ga0207681_10055772 3300025923 Unclassified 2693
528 Ga0207681_10063593 3300025923 Unclassified 2545
529 Ga0207681_10078357 3300025923 Bacteria 2325
530 Ga0207681_10091343 3300025923 Unclassified 2175
531 Ga0207694_10015740 3300025924 Bacteria 5706
532 Ga0207650_10000027 3300025925 Bacteria 257466
533 Ga0207650_10000623 3300025925 Bacteria 28245
534 Ga0207650_10027728 3300025925 Unclassified 4056
535 Ga0207650_10072198 3300025925 Bacteria 2598
536 Ga0207650_10162273 3300025925 Unclassified 1771
537 Ga0207650_10413232 3300025925 Unclassified 1118
538 Ga0207650_10546565 3300025925 Unclassified 971
539 Ga0207659_10064987 3300025926 Unclassified 2643
540 Ga0207659_10080003 3300025926 Bacteria 2413
541 Ga0207659_10098422 3300025926 Unclassified 2200
542 Ga0207659_10369162 3300025926 Bacteria 1194
543 Ga0207687_10026530 3300025927 Unclassified 3880
544 Ga0207687_10153793 3300025927 Unclassified 1758
545 Ga0207644_10002044 3300025931 Bacteria 13063
546 Ga0207644_10020094 3300025931 Bacteria 4538
547 Ga0207644_10025578 3300025931 Bacteria 4059
548 Ga0207644_10099520 3300025931 Bacteria 2182
549 Ga0207644_10229957 3300025931 Bacteria 1473
550 Ga0207686_10000062 3300025934 Bacteria 97842
551 Ga0207686_10001492 3300025934 Bacteria 13197
552 Ga0207686_10007557 3300025934 Bacteria 5853
553 Ga0207709_10000091 3300025935 Bacteria 144622
554 Ga0207709_10022753 3300025935 Unclassified 3558
555 Ga0207709_10120115 3300025935 Bacteria 1773
556 Ga0207670_10041254 3300025936 Bacteria 3034
557 Ga0207670_10402796 3300025936 Bacteria 1094
558 Ga0207704_10031813 3300025938 Bacteria 2978
559 Ga0207704_10117842 3300025938 Bacteria 1810
560 Ga0207665_10000033 3300025939 Bacteria 89014
561 Ga0207665_10036012 3300025939 Bacteria 3288
562 Ga0207665_10308283 3300025939 Bacteria 1185
563 Ga0207665_10315161 3300025939 Bacteria 1172
564 Ga0207691_10023812 3300025940 Bacteria 5763
565 Ga0207691_10044279 3300025940 Bacteria 4097
566 Ga0207691_10264776 3300025940 Bacteria 1481
567 Ga0207711_10004896 3300025941 Bacteria 11367
568 Ga0207711_10009657 3300025941 Bacteria 8039
569 Ga0207711_10044876 3300025941 Bacteria 3775
570 Ga0207711_10054024 3300025941 Unclassified 3445
571 Ga0207711_10208386 3300025941 Unclassified 1785
572 Ga0207711_10223831 3300025941 Bacteria 1722
573 Ga0207711_10658746 3300025941 Unclassified 977
574 Ga0207711_10728045 3300025941 Unclassified 925
575 Ga0207689_10006262 3300025942 Bacteria 10547
576 Ga0207689_10011390 3300025942 Bacteria 7621
577 Ga0207689_10045330 3300025942 Bacteria 3636
578 Ga0207689_10051986 3300025942 Unclassified 3377
579 Ga0207689_10088648 3300025942 Bacteria 2541
580 Ga0207689_10148650 3300025942 Bacteria 1931
581 Ga0207689_10202658 3300025942 Unclassified 1638
582 Ga0207689_10318756 3300025942 Bacteria 1290
583 Ga0207679_10055065 3300025945 Bacteria 2931
584 Ga0207667_10549017 3300025949 Bacteria 1169
585 Ga0207651_10043386 3300025960 Bacteria 3001
586 Ga0207651_10070141 3300025960 Bacteria 2478
587 Ga0207651_10107459 3300025960 Unclassified 2086
588 Ga0207651_10395093 3300025960 Unclassified 1175
589 Ga0207712_10000781 3300025961 Bacteria 23731
590 Ga0207712_10015035 3300025961 Bacteria 4987
591 Ga0207712_10016341 3300025961 Bacteria 4803
592 Ga0207712_10046975 3300025961 Bacteria 2995
593 Ga0207712_10170114 3300025961 Bacteria 1702
594 Ga0207668_10010711 3300025972 Bacteria 5549
595 Ga0207640_10135686 3300025981 Bacteria 1786
596 Ga0207640_10213101 3300025981 Bacteria 1473
597 Ga0207640_10223310 3300025981 Unclassified 1444
598 Ga0207640_10234924 3300025981 Bacteria 1413
599 Ga0207658_10023337 3300025986 Bacteria 4318
600 Ga0207658_10125671 3300025986 Unclassified 2052
601 Ga0207658_10277046 3300025986 Unclassified 1436
602 Ga0207677_10370550 3300026023 Bacteria 1206
603 Ga0207703_10000481 3300026035 Bacteria 41719
604 Ga0207703_10006636 3300026035 Bacteria 9232
605 Ga0207703_10015662 3300026035 Bacteria 5913
606 Ga0207703_10032728 3300026035 Bacteria 4116
607 Ga0207703_10055950 3300026035 Bacteria 3211
608 Ga0207703_10059809 3300026035 Unclassified 3113
609 Ga0207703_10132078 3300026035 Bacteria 2157
610 Ga0207703_10234759 3300026035 Unclassified 1646
611 Ga0207703_10249011 3300026035 Bacteria 1600
612 Ga0207703_10396280 3300026035 Bacteria 1280
613 Ga0207703_10580467 3300026035 Bacteria 1059
614 Ga0207703_10708570 3300026035 Bacteria 957
615 Ga0207639_10025126 3300026041 Bacteria 4319
616 Ga0207639_10038113 3300026041 Unclassified 3574
617 Ga0207639_10058152 3300026041 Bacteria 2972
618 Ga0207639_10153298 3300026041 Bacteria 1933
619 Ga0207678_10140884 3300026067 Bacteria 2058
620 Ga0207708_10000235 3300026075 Bacteria 43719
621 Ga0207708_10015082 3300026075 Bacteria 5792
622 Ga0207708_10022826 3300026075 Bacteria 4726
623 Ga0207708_10039853 3300026075 Bacteria 3580
624 Ga0207708_10058415 3300026075 Bacteria 2943
625 Ga0207708_10088520 3300026075 Unclassified 2385
626 Ga0207708_10186795 3300026075 Unclassified 1647
627 Ga0207708_10522704 3300026075 Unclassified 997
628 Ga0207641_10005244 3300026088 Bacteria 11081
629 Ga0207641_10062794 3300026088 Unclassified 3171
630 Ga0207641_10108890 3300026088 Bacteria 2453
631 Ga0207641_10124678 3300026088 Unclassified 2304
632 Ga0207641_10157747 3300026088 Bacteria 2060
633 Ga0207641_10317875 3300026088 Bacteria 1475
634 Ga0207641_10561598 3300026088 Bacteria 1114
635 Ga0207648_10009383 3300026089 Bacteria 9372
636 Ga0207648_10102424 3300026089 Bacteria 2509
637 Ga0207648_10135270 3300026089 Bacteria 2171
638 Ga0207648_10145571 3300026089 Unclassified 2090
639 Ga0207648_10428139 3300026089 Bacteria 1202
640 Ga0207676_10001919 3300026095 Bacteria 15191
641 Ga0207676_10006195 3300026095 Bacteria 8447
642 Ga0207676_10076835 3300026095 Bacteria 2699
643 Ga0207676_10390477 3300026095 Bacteria 1298
644 Ga0207676_10469703 3300026095 Bacteria 1189
645 Ga0207676_10528971 3300026095 Bacteria 1123
646 Ga0207676_10558310 3300026095 Bacteria 1095
647 Ga0207676_10578753 3300026095 Unclassified 1076
648 Ga0207674_10000525 3300026116 Bacteria 50323
649 Ga0207674_10017630 3300026116 Bacteria 7787
650 Ga0207674_10814648 3300026116 Unclassified 901
651 Ga0207675_100001552 3300026118 Bacteria 22994
652 Ga0207675_100005444 3300026118 Bacteria 12201
653 Ga0207675_100007761 3300026118 Bacteria 10124
654 Ga0207675_100017262 3300026118 Bacteria 6739
655 Ga0207675_100068607 3300026118 Bacteria 3314
656 Ga0207675_100137966 3300026118 Bacteria 2315
657 Ga0207675_100160160 3300026118 Bacteria 2146
658 Ga0207675_100229015 3300026118 Unclassified 1792
659 Ga0207675_100447042 3300026118 Bacteria 1280
660 Ga0207683_10370001 3300026121 Bacteria 1317
661 Ga0207698_10108223 3300026142 Bacteria 2323
662 Ga0207698_10826949 3300026142 Unclassified 930
663 Ga0209588_1009760 3300027671 Unclassified 2873
664 Ga0207428_10004899 3300027907 Bacteria 12612
665 Ga0207428_10005514 3300027907 Bacteria 11787
666 Ga0207428_10071821 3300027907 Unclassified 2718
667 Ga0207428_10126437 3300027907 Unclassified 1957
668 Ga0268265_10003630 3300028380 Bacteria 11011
669 Ga0268265_10158559 3300028380 Bacteria 1918
670 Ga0268264_10005319 3300028381 Bacteria 10904
671 Ga0268264_10006931 3300028381 Bacteria 9507
672 Ga0268264_10019417 3300028381 Bacteria 5555
673 Ga0268264_10182889 3300028381 Bacteria 1905
674 Ga0268264_10303390 3300028381 Unclassified 1504
675 Ga0268264_10317935 3300028381 Unclassified 1471
676 Ga0268264_10351722 3300028381 Bacteria 1403
677 Ga0268264_10351733 3300028381 Unclassified 1403
678 Ga0268264_10381543 3300028381 Bacteria 1350
679 Ga0268264_10530989 3300028381 Bacteria 1151
680 Ga0307408_100008854 3300031548 Bacteria 6647
681 Ga0307408_100190798 3300031548 Unclassified 1650
682 Ga0316575_10005290 3300031665 Unclassified 4594
683 Ga0316575_10042085 3300031665 Bacteria 1808
684 Ga0316579_10001197 3300031691 Bacteria 9294
685 Ga0316579_10018294 3300031691 Bacteria 3082
686 Ga0316576_10012005 3300031727 Bacteria 5705
687 Ga0316576_10119069 3300031727 Bacteria 1982
688 Ga0316578_10110200 3300031728 Bacteria 1653
689 Ga0307405_10004255 3300031731 Bacteria 6736
690 Ga0307405_10098022 3300031731 Bacteria 1959
691 Ga0307405_10298622 3300031731 Bacteria 1221
692 Ga0307405_10549987 3300031731 Bacteria 934
693 Ga0316577_10000549 3300031733 Bacteria 15247
694 Ga0316577_10002288 3300031733 Bacteria 9440
695 Ga0316577_10136729 3300031733 Bacteria 1380
696 Ga0316577_10152392 3300031733 Bacteria 1303
697 Ga0307413_10018801 3300031824 Bacteria 3634
698 Ga0307413_10172345 3300031824 Bacteria 1533
699 Ga0307410_10013140 3300031852 Bacteria 4818
700 Ga0307410_10017066 3300031852 Bacteria 4348
701 Ga0307410_10250672 3300031852 Bacteria 1376
702 Ga0307406_10011489 3300031901 Bacteria 5029
703 Ga0307406_10014727 3300031901 Bacteria 4505
704 Ga0307407_10007946 3300031903 Bacteria 4835
705 Ga0307412_10052512 3300031911 Bacteria 2699
706 Ga0307412_10056920 3300031911 Unclassified 2608
707 Ga0307412_10085572 3300031911 Bacteria 2191
708 Ga0307409_100006264 3300031995 Bacteria 6969
709 Ga0307416_100004832 3300032002 Bacteria 8196
710 Ga0307416_100015918 3300032002 Bacteria 5210
711 Ga0307416_100197179 3300032002 Bacteria 1906
712 Ga0307414_10011752 3300032004 Bacteria 5150
713 Ga0307414_10049325 3300032004 Bacteria 2910
714 Ga0307414_10357272 3300032004 Bacteria 1256
715 Ga0307411_10006971 3300032005 Bacteria 5707
716 Ga0307411_10021834 3300032005 Bacteria 3756
717 Ga0307411_10120851 3300032005 Bacteria 1895
718 Ga0307411_10181296 3300032005 Bacteria 1599
719 Ga0307415_100009335 3300032126 Bacteria 5492
720 Ga0307415_100016598 3300032126 Bacteria 4393
721 Ga0373940_0035690 3300035088 Bacteria 1347
722 Ga0373951_0003754 3300035091 Bacteria 3662
723 Ga0373923_0056380 3300035111 Unclassified 1659
724 Ga0373953_0055114 3300035117 Bacteria 1614
725 Ga0373954_0038225 3300035118 Bacteria 2232
726 Ga0373946_0062419 3300035171 Bacteria 1589
727 Ga0373955_0107694 3300035172 Bacteria 1608
728 Ga0373942_0024221 3300035207 Bacteria 1555
729 Ga0373962_0065149 3300035242 Bacteria 1078
730 Ga0316574_0008749 3300035398 Bacteria 5638
731 Ga0373931_0066568 3300035691 Bacteria 1955
732 Ga0373937_0089715 3300036401 Unclassified 2847
733 Ga0316582_0001214 3300036647 Bacteria 11069
734 Ga0316582_0073512 3300036647 Bacteria 2218
735 Ga0316582_0330660 3300036647 Bacteria 1048
736 Ga0316584_0013247 3300036712 Bacteria 5833
737 Ga0316584_0060282 3300036712 Unclassified 2842
738 Ga0316584_0116022 3300036712 Bacteria 2003
739 Ga0316584_0223988 3300036712 Bacteria 1380
740 Ga0316584_0302427 3300036712 Bacteria 1158
741 Ga0395900_0215130 3300037418 Bacteria 1940
742 Ga0395900_0550889 3300037418 Unclassified 1098
743 Ga0395900_0649130 3300037418 Bacteria 992
744 Ga0395898_0321229 3300037466 Bacteria 1477
745 Ga0395905_0029319 3300037471 Bacteria 5185
746 Ga0316581_0016790 3300037588 Bacteria 2105
747 Ga0436364_0009890 3300037853 Bacteria 6277
748 Ga0436364_1116912 3300037853 Unclassified 3325
749 Ga0242420_004415 3300038996 Unclassified 2126
750 Ga0242420_004617 3300038996 Bacteria 2091
751 Ga0436365_0013216 3300039437 Bacteria 44926
752 Ga0436365_0421852 3300039437 Bacteria 162876
753 Ga0436365_0629287 3300039437 Bacteria 1502
754 Ga0436365_1045327 3300039437 Bacteria 3173
755 Ga0436365_1090258 3300039437 Bacteria 7647
756 Ga0436363_1633109 3300039450 Bacteria 2021
757 Ga0439446_0011230 3300042156 Bacteria 2429
758 Ga0439458_0005147 3300042157 Bacteria 2949
759 Ga0439434_0022033 3300042435 Bacteria 1915
760 Ga0453683_0026879 3300044673 Unclassified 3653
761 Ga0453684_0027150 3300044712 Bacteria 8226
762 Ga0453684_0263576 3300044712 Unclassified 1973
763 Ga0466960_0034289 3300044901 Bacteria 2364
764 Ga0451576_0042739 3300045051 Unclassified 4784
765 Ga0466967_0576198 3300045976 Bacteria 1109
766 Ga0495639_0123655 3300046475 Bacteria 1235
767 Ga0495664_0285310 3300046477 Bacteria 997
768 Ga0495628_0039307 3300046516 Bacteria 3784
769 Ga0495630_0011870 3300046517 Bacteria 6315
770 Ga0495663_0000433 3300046525 Bacteria 15293
771 Ga0495586_0019771 3300046535 Bacteria 3586
772 Ga0495598_0002150 3300046537 Bacteria 4026
773 Ga0495621_0002053 3300046539 Bacteria 5328
774 Ga0495672_0093934 3300047320 Bacteria 1641
775 Ga0496102_0549527 3300048905 Unclassified 1078
776 Ga0496107_0174394 3300048910 Bacteria 1596
777 Ga0496110_0183546 3300048913 Bacteria 1900
778 Ga0496112_0241295 3300048915 Bacteria 1760
779 Ga0496112_0451177 3300048915 Bacteria 1224
780 Ga0501301_001508 3300049524 Bacteria 1476
781 Ga0501032_0080857 3300049569 Bacteria 2162
782 Ga0501036_0318046 3300049572 Bacteria 1301
783 Ga0501037_0010158 3300049573 Bacteria 6907
784 Ga0501038_0003660 3300049574 Bacteria 14324
785 Ga0501038_0109470 3300049574 Bacteria 2289
786 Ga0501041_0148003 3300049577 Bacteria 1465
787 Ga0501042_0010054 3300049578 Bacteria 6326
788 Ga0501042_0014097 3300049578 Bacteria 5451
789 Ga0501046_0059421 3300049580 Bacteria 2995
790 Ga0501046_0118778 3300049580 Bacteria 2013
791 Ga0501047_0140121 3300049581 Bacteria 2297
792 Ga0501070_0110124 3300049586 Bacteria 2276
793 Ga0501071_0267084 3300049587 Bacteria 1293
794 Ga0501076_0146395 3300049592 Bacteria 1921
795 Ga0501076_0252035 3300049592 Bacteria 1445
796 Ga0501202_013011 3300049652 Bacteria 1579
797 Ga0501217_005217 3300049661 Bacteria 2708
798 Ga0501223_005137 3300049663 Bacteria 2764
799 Ga0501223_010856 3300049663 Bacteria 1829
800 Ga0501224_009207 3300049664 Bacteria 1443
801 Ga0501227_000507 3300049665 Bacteria 8353
802 Ga0501230_021618 3300049667 Bacteria 1129
803 Ga0501233_001430 3300049668 Bacteria 4069
804 Ga0501235_002582 3300049669 Bacteria 3897
805 Ga0501235_012582 3300049669 Bacteria 1861
806 Ga0501243_008153 3300049675 Bacteria 1611
807 Ga0501249_015253 3300049679 Bacteria 1643
808 Ga0501259_011652 3300049688 Bacteria 1457
809 Ga0501221_010336 3300049704 Bacteria 1656
810 Ga0501225_0000353 3300049705 Bacteria 14561
811 Ga0501225_0002065 3300049705 Bacteria 6245
812 Ga0501225_0022930 3300049705 Bacteria 1722
813 Ga0501035_0020836 3300049822 Bacteria 6024
814 Ga0501035_0337233 3300049822 Bacteria 1264
815 Ga0501035_0432760 3300049822 Bacteria 1091
816 Ga0501044_0614665 3300049823 Bacteria 979
817 Ga0501212_007983 3300049851 Bacteria 1462
818 Ga0501226_000515 3300049853 Bacteria 5378
819 nmdc:mga05p37_1014518_c1 3300050507 Unclassified 880
820 nmdc:mga05p37_13138_c2 3300050507 Bacteria 4705
821 nmdc:mga05p37_157730_c2 3300050507 Bacteria 2350
822 nmdc:mga05p37_166487_c1 3300050507 Bacteria 2690
823 nmdc:mga05p37_318323_c1 3300050507 Bacteria 1842
824 nmdc:mga05p37_522911_c1 3300050507 Unclassified 1357
825 nmdc:mga05p37_65876_c2 3300050507 Bacteria 3919
826 nmdc:mga05p37_688926_c1 3300050507 Bacteria 1137
827 nmdc:mga09592_122616_c1 3300050508 Bacteria 2233
828 nmdc:mga09592_134411_c1 3300050508 Bacteria 2130
829 nmdc:mga09592_234598_c1 3300050508 Bacteria 1589
830 nmdc:mga09592_288863_c1 3300050508 Bacteria 1422
831 nmdc:mga0qj67_256728_c1 3300050509 Unclassified 1418
832 nmdc:mga0qj67_54043_c1 3300050509 Bacteria 3180
833 nmdc:mga06r32_207775_c1 3300050510 Bacteria 1946
834 nmdc:mga08y16_161298_c1 3300050511 Bacteria 2330
835 nmdc:mga08y16_321939_c1 3300050511 Unclassified 1592
836 nmdc:mga08y16_3544_c1 3300050511 Bacteria 16207
837 nmdc:mga0n895_145294_c1 3300050512 Bacteria 2401
838 nmdc:mga0n895_439170_c1 3300050512 Bacteria 1318
839 nmdc:mga0n895_603749_c1 3300050512 Bacteria 1099
840 nmdc:mga0n895_785299_c1 3300050512 Bacteria 943
841 nmdc:mga0rr50_492596_c1 3300050513 Bacteria 1041
842 nmdc:mga0rr50_9855_c1 3300050513 Bacteria 6036
843 nmdc:mga08x19_13_c1 3300050514 Bacteria 366166
844 nmdc:mga0a205_175950_c1 3300050515 Bacteria 2035
845 nmdc:mga0a205_198585_c1 3300050515 Bacteria 1897
846 nmdc:mga0a205_214547_c1 3300050515 Bacteria 1812
847 nmdc:mga0a205_22311_c1 3300050515 Bacteria 5994
848 nmdc:mga0a205_49266_c1 3300050515 Unclassified 4066
849 nmdc:mga0a205_519849_c1 3300050515 Bacteria 1047
850 Ga0500577_0000869 3300053142 Bacteria 7811
851 Ga0500616_0003139 3300053153 Bacteria 12913
852 Ga0501084_0490654 3300054114 Unclassified 1038
853 Ga0530510_0032439 3300061734 Bacteria 3758

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025942 Ga0207689_10318756 Ga0207689_103187562 215
2 3300048913 Ga0496110_0183546 Ga0496110_0183546_16_684 216
3 3300005438 Ga0070701_10470917 Ga0070701_104709171 218
4 3300005468 Ga0070707_100021845 Ga0070707_1000218453 227
5 3300036647 Ga0316582_0073512 Ga0316582_0073512_1478_2206 227
6 3300005471 Ga0070698_100033807 Ga0070698_1000338073 228
7 3300035242 Ga0373962_0065149 Ga0373962_0065149_363_1055 229
8 3300026118 Ga0207675_100137966 Ga0207675_1001379663 230
9 3300006852 Ga0075433_10178463 Ga0075433_101784632 233
10 3300050515 nmdc:mga0a205_198585_c1 nmdc:mga0a205_198585_c1_947_1708 233
11 3300025941 Ga0207711_10728045 Ga0207711_107280451 238
12 3300005336 Ga0070680_100396025 Ga0070680_1003960252 240
13 3300009094 Ga0111539_10098886 Ga0111539_100988863 242
14 3300044712 Ga0453684_0027150 Ga0453684_0027150_3069_3944 242
15 iso_pu_bacteria 2671180531 2673166608 244
16 3300013105 Ga0157369_10365050 Ga0157369_103650502 245
17 3300049580 Ga0501046_0059421 Ga0501046_0059421_2227_2985 246
18 iso_pu_bacteria 8007371054 8007374521 246
19 3300031665 Ga0316575_10005290 Ga0316575_100052904 247
20 3300037853 Ga0436364_1116912 Ga0436364_1116912_786_1553 248
21 3300049580 Ga0501046_0118778 Ga0501046_0118778_432_1202 248
22 3300049581 Ga0501047_0140121 Ga0501047_0140121_1086_1856 248
23 3300049586 Ga0501070_0110124 Ga0501070_0110124_244_1014 248
24 3300049592 Ga0501076_0252035 Ga0501076_0252035_464_1234 248
25 3300049822 Ga0501035_0432760 Ga0501035_0432760_176_946 248
26 3300006844 Ga0075428_100654440 Ga0075428_1006544402 249
27 3300049823 Ga0501044_0614665 Ga0501044_0614665_36_815 249
28 3300003203 JGI25406J46586_10006797 JGI25406J46586_100067974 250
29 3300005340 Ga0070689_100188181 Ga0070689_1001881812 250
30 3300005441 Ga0070700_100483850 Ga0070700_1004838501 250
31 3300005471 Ga0070698_100874239 Ga0070698_1008742391 250
32 3300005536 Ga0070697_100051154 Ga0070697_1000511544 250
33 3300005544 Ga0070686_100062493 Ga0070686_1000624933 250
34 3300005718 Ga0068866_10137060 Ga0068866_101370602 250
35 3300005719 Ga0068861_100273294 Ga0068861_1002732941 250
36 3300005985 Ga0081539_10002625 Ga0081539_1000262518 250
37 3300006844 Ga0075428_100308669 Ga0075428_1003086692 250
38 3300006844 Ga0075428_100506546 Ga0075428_1005065461 250
39 3300006914 Ga0075436_100325661 Ga0075436_1003256611 250
40 3300013306 Ga0163162_10555069 Ga0163162_105550692 250
41 3300014325 Ga0163163_10633934 Ga0163163_106339341 250
42 3300017792 Ga0163161_10118375 Ga0163161_101183752 250
43 3300025910 Ga0207684_10090064 Ga0207684_100900642 250
44 3300026075 Ga0207708_10186795 Ga0207708_101867952 250
45 3300027907 Ga0207428_10071821 Ga0207428_100718212 250
46 3300027907 Ga0207428_10126437 Ga0207428_101264373 250
47 3300028381 Ga0268264_10530989 Ga0268264_105309892 250
48 3300035118 Ga0373954_0038225 Ga0373954_0038225_810_1565 250
49 3300035171 Ga0373946_0062419 Ga0373946_0062419_132_887 250
50 3300035172 Ga0373955_0107694 Ga0373955_0107694_635_1390 250
51 3300035691 Ga0373931_0066568 Ga0373931_0066568_1176_1931 250
52 3300046475 Ga0495639_0123655 Ga0495639_0123655_409_1164 250
53 3300046477 Ga0495664_0285310 Ga0495664_0285310_28_783 250
54 3300046516 Ga0495628_0039307 Ga0495628_0039307_511_1266 250
55 3300046517 Ga0495630_0011870 Ga0495630_0011870_4727_5482 250
56 3300046535 Ga0495586_0019771 Ga0495586_0019771_297_1052 250
57 3300050507 nmdc:mga05p37_1014518_c1 nmdc:mga05p37_1014518_c1_84_857 250
58 3300050511 nmdc:mga08y16_321939_c1 nmdc:mga08y16_321939_c1_53_817 250
59 3300026089 Ga0207648_10135270 Ga0207648_101352703 251
60 3300044901 Ga0466960_0034289 Ga0466960_0034289_1180_1962 251
61 3300045976 Ga0466967_0576198 Ga0466967_0576198_45_827 251
62 3300005445 Ga0070708_100313686 Ga0070708_1003136862 252
63 3300006846 Ga0075430_100050628 Ga0075430_1000506282 252
64 3300006847 Ga0075431_100231300 Ga0075431_1002313003 252
65 3300037853 Ga0436364_0009890 Ga0436364_0009890_4070_4876 252
66 3300005295 Ga0065707_10096313 Ga0065707_100963134 253
67 3300005458 Ga0070681_10058592 Ga0070681_100585922 253
68 3300035111 Ga0373923_0056380 Ga0373923_0056380_786_1583 253
69 3300049578 Ga0501042_0010054 Ga0501042_0010054_1011_1778 253
70 3300049587 Ga0501071_0267084 Ga0501071_0267084_328_1095 253
71 3300049822 Ga0501035_0337233 Ga0501035_0337233_300_1067 253
72 3300005615 Ga0070702_100065890 Ga0070702_1000658902 254
73 3300005617 Ga0068859_100577644 Ga0068859_1005776442 254
74 3300006931 Ga0097620_100577642 Ga0097620_1005776422 254
75 3300026118 Ga0207675_100447042 Ga0207675_1004470422 254
76 3300038996 Ga0242420_004617 Ga0242420_004617_38_802 254
77 3300049569 Ga0501032_0080857 Ga0501032_0080857_120_902 254
78 3300049572 Ga0501036_0318046 Ga0501036_0318046_359_1141 254
79 3300049573 Ga0501037_0010158 Ga0501037_0010158_4852_5634 254
80 3300049574 Ga0501038_0109470 Ga0501038_0109470_39_821 254
81 3300049577 Ga0501041_0148003 Ga0501041_0148003_224_1006 254
82 3300049578 Ga0501042_0014097 Ga0501042_0014097_3064_3846 254
83 3300049592 Ga0501076_0146395 Ga0501076_0146395_1113_1895 254
84 3300049822 Ga0501035_0020836 Ga0501035_0020836_1451_2233 254
85 3300005293 Ga0065715_10014485 Ga0065715_100144853 255
86 3300005334 Ga0068869_100166919 Ga0068869_1001669192 255
87 3300005343 Ga0070687_100060679 Ga0070687_1000606792 255
88 3300005353 Ga0070669_100002525 Ga0070669_1000025255 255
89 3300005353 Ga0070669_100047062 Ga0070669_1000470623 255
90 3300005364 Ga0070673_100332014 Ga0070673_1003320142 255
91 3300005441 Ga0070700_100111621 Ga0070700_1001116212 255
92 3300005616 Ga0068852_100149455 Ga0068852_1001494552 255
93 3300005617 Ga0068859_100018658 Ga0068859_1000186583 255
94 3300005617 Ga0068859_100119379 Ga0068859_1001193792 255
95 3300005617 Ga0068859_100261688 Ga0068859_1002616882 255
96 3300005719 Ga0068861_100097003 Ga0068861_1000970032 255
97 3300005842 Ga0068858_100138359 Ga0068858_1001383592 255
98 3300005842 Ga0068858_100175387 Ga0068858_1001753872 255
99 3300005843 Ga0068860_100112769 Ga0068860_1001127692 255
100 3300005843 Ga0068860_100234441 Ga0068860_1002344412 255
101 3300005843 Ga0068860_100272955 Ga0068860_1002729551 255
102 3300006931 Ga0097620_100018658 Ga0097620_1000186585 255
103 3300006931 Ga0097620_100119364 Ga0097620_1001193642 255
104 3300006931 Ga0097620_100261674 Ga0097620_1002616742 255
105 3300009101 Ga0105247_10041404 Ga0105247_100414043 255
106 3300009177 Ga0105248_10190150 Ga0105248_101901502 255
107 3300009553 Ga0105249_10487386 Ga0105249_104873862 255
108 3300014326 Ga0157380_10016724 Ga0157380_100167243 255
109 3300014326 Ga0157380_11016156 Ga0157380_110161561 255
110 3300014745 Ga0157377_10109087 Ga0157377_101090872 255
111 3300014968 Ga0157379_10049363 Ga0157379_100493632 255
112 3300014968 Ga0157379_10396728 Ga0157379_103967282 255
113 3300025918 Ga0207662_10071936 Ga0207662_100719362 255
114 3300025922 Ga0207646_10263093 Ga0207646_102630932 255
115 3300025923 Ga0207681_10055772 Ga0207681_100557722 255
116 3300025923 Ga0207681_10063593 Ga0207681_100635932 255
117 3300025926 Ga0207659_10064987 Ga0207659_100649873 255
118 3300025942 Ga0207689_10148650 Ga0207689_101486502 255
119 3300025981 Ga0207640_10234924 Ga0207640_102349242 255
120 3300026035 Ga0207703_10132078 Ga0207703_101320783 255
121 3300026035 Ga0207703_10249011 Ga0207703_102490112 255
122 3300026035 Ga0207703_10708570 Ga0207703_107085701 255
123 3300026075 Ga0207708_10058415 Ga0207708_100584152 255
124 3300026118 Ga0207675_100068607 Ga0207675_1000686072 255
125 3300026142 Ga0207698_10108223 Ga0207698_101082232 255
126 3300028381 Ga0268264_10182889 Ga0268264_101828892 255
127 3300028381 Ga0268264_10351722 Ga0268264_103517221 255
128 3300031733 Ga0316577_10136729 Ga0316577_101367292 255
129 3300036647 Ga0316582_0001214 Ga0316582_0001214_10091_10903 255
130 3300048915 Ga0496112_0451177 Ga0496112_0451177_206_973 255
131 3300053153 Ga0500616_0003139 Ga0500616_0003139_5793_6605 255
132 3300021384 Ga0213876_10001953 Ga0213876_100019537 256
133 3300026116 Ga0207674_10814648 Ga0207674_108146481 256
134 3300031665 Ga0316575_10042085 Ga0316575_100420852 256
135 3300031691 Ga0316579_10001197 Ga0316579_100011974 256
136 3300031691 Ga0316579_10018294 Ga0316579_100182942 256
137 3300031727 Ga0316576_10012005 Ga0316576_100120053 256
138 3300031727 Ga0316576_10119069 Ga0316576_101190692 256
139 3300031728 Ga0316578_10110200 Ga0316578_101102002 256
140 3300031733 Ga0316577_10000549 Ga0316577_1000054915 256
141 3300031733 Ga0316577_10002288 Ga0316577_100022888 256
142 3300031733 Ga0316577_10152392 Ga0316577_101523922 256
143 3300035398 Ga0316574_0008749 Ga0316574_0008749_4361_5179 256
144 3300036647 Ga0316582_0330660 Ga0316582_0330660_131_949 256
145 3300036712 Ga0316584_0013247 Ga0316584_0013247_1812_2657 256
146 3300036712 Ga0316584_0060282 Ga0316584_0060282_321_1139 256
147 3300036712 Ga0316584_0116022 Ga0316584_0116022_777_1571 256
148 3300036712 Ga0316584_0223988 Ga0316584_0223988_22_840 256
149 3300036712 Ga0316584_0302427 Ga0316584_0302427_132_926 256
150 3300037588 Ga0316581_0016790 Ga0316581_0016790_1167_1985 256
151 3300039437 Ga0436365_0629287 Ga0436365_0629287_232_1095 256
152 3300039437 Ga0436365_1045327 Ga0436365_1045327_1723_2553 256
153 3300039437 Ga0436365_1090258 Ga0436365_1090258_1552_2382 256
154 3300039450 Ga0436363_1633109 Ga0436363_1633109_732_1595 256
155 3300005293 Ga0065715_10018531 Ga0065715_100185313 257
156 3300005293 Ga0065715_10100860 Ga0065715_101008602 257
157 3300005295 Ga0065707_10001462 Ga0065707_100014627 257
158 3300005328 Ga0070676_10061106 Ga0070676_100611061 257
159 3300005330 Ga0070690_100115287 Ga0070690_1001152871 257
160 3300005334 Ga0068869_100210339 Ga0068869_1002103391 257
161 3300005353 Ga0070669_100122369 Ga0070669_1001223691 257
162 3300005354 Ga0070675_100096163 Ga0070675_1000961632 257
163 3300005355 Ga0070671_100331782 Ga0070671_1003317822 257
164 3300005365 Ga0070688_100131439 Ga0070688_1001314392 257
165 3300005438 Ga0070701_10248038 Ga0070701_102480381 257
166 3300005440 Ga0070705_100256924 Ga0070705_1002569241 257
167 3300005440 Ga0070705_100270300 Ga0070705_1002703001 257
168 3300005441 Ga0070700_100268723 Ga0070700_1002687232 257
169 3300005467 Ga0070706_100060029 Ga0070706_1000600292 257
170 3300005468 Ga0070707_100003979 Ga0070707_10000397912 257
171 3300005471 Ga0070698_100071065 Ga0070698_1000710652 257
172 3300005518 Ga0070699_100136443 Ga0070699_1001364432 257
173 3300005536 Ga0070697_100027095 Ga0070697_1000270953 257
174 3300005539 Ga0068853_100033867 Ga0068853_1000338672 257
175 3300005543 Ga0070672_100406543 Ga0070672_1004065431 257
176 3300005544 Ga0070686_100459957 Ga0070686_1004599571 257
177 3300005545 Ga0070695_100094994 Ga0070695_1000949942 257
178 3300005545 Ga0070695_100374524 Ga0070695_1003745241 257
179 3300005549 Ga0070704_100504389 Ga0070704_1005043891 257
180 3300005615 Ga0070702_100002032 Ga0070702_1000020325 257
181 3300005617 Ga0068859_100033363 Ga0068859_1000333632 257
182 3300005618 Ga0068864_100022935 Ga0068864_1000229355 257
183 3300005840 Ga0068870_10178023 Ga0068870_101780232 257
184 3300005841 Ga0068863_100047679 Ga0068863_1000476792 257
185 3300005842 Ga0068858_100027082 Ga0068858_1000270826 257
186 3300005843 Ga0068860_100043714 Ga0068860_1000437144 257
187 3300005843 Ga0068860_100109223 Ga0068860_1001092232 257
188 3300006237 Ga0097621_100074871 Ga0097621_1000748712 257
189 3300006358 Ga0068871_100001715 Ga0068871_1000017157 257
190 3300006881 Ga0068865_100031323 Ga0068865_1000313231 257
191 3300006931 Ga0097620_100033364 Ga0097620_1000333642 257
192 3300009094 Ga0111539_10001784 Ga0111539_100017848 257
193 3300009098 Ga0105245_10187351 Ga0105245_101873512 257
194 3300009101 Ga0105247_10416345 Ga0105247_104163451 257
195 3300009148 Ga0105243_10040911 Ga0105243_100409113 257
196 3300009148 Ga0105243_10110958 Ga0105243_101109582 257
197 3300009176 Ga0105242_10155864 Ga0105242_101558641 257
198 3300009177 Ga0105248_10312045 Ga0105248_103120452 257
199 3300009177 Ga0105248_10879568 Ga0105248_108795681 257
200 3300009551 Ga0105238_10009968 Ga0105238_100099686 257
201 3300013297 Ga0157378_10092551 Ga0157378_100925513 257
202 3300013297 Ga0157378_10306078 Ga0157378_103060782 257
203 3300013306 Ga0163162_10012064 Ga0163162_100120643 257
204 3300013308 Ga0157375_10633756 Ga0157375_106337561 257
205 3300014745 Ga0157377_10355611 Ga0157377_103556111 257
206 3300014969 Ga0157376_10566630 Ga0157376_105666301 257
207 3300025899 Ga0207642_10040653 Ga0207642_100406531 257
208 3300025904 Ga0207647_10006088 Ga0207647_100060887 257
209 3300025910 Ga0207684_10010598 Ga0207684_100105983 257
210 3300025922 Ga0207646_10005266 Ga0207646_1000526613 257
211 3300025925 Ga0207650_10162273 Ga0207650_101622732 257
212 3300025926 Ga0207659_10080003 Ga0207659_100800032 257
213 3300025926 Ga0207659_10369162 Ga0207659_103691622 257
214 3300025927 Ga0207687_10026530 Ga0207687_100265301 257
215 3300025931 Ga0207644_10099520 Ga0207644_100995201 257
216 3300025935 Ga0207709_10022753 Ga0207709_100227533 257
217 3300025936 Ga0207670_10402796 Ga0207670_104027962 257
218 3300025938 Ga0207704_10031813 Ga0207704_100318131 257
219 3300025940 Ga0207691_10044279 Ga0207691_100442795 257
220 3300025941 Ga0207711_10208386 Ga0207711_102083862 257
221 3300025942 Ga0207689_10011390 Ga0207689_100113905 257
222 3300025961 Ga0207712_10046975 Ga0207712_100469752 257
223 3300026023 Ga0207677_10370550 Ga0207677_103705502 257
224 3300026035 Ga0207703_10032728 Ga0207703_100327283 257
225 3300026041 Ga0207639_10025126 Ga0207639_100251265 257
226 3300026088 Ga0207641_10108890 Ga0207641_101088902 257
227 3300026088 Ga0207641_10561598 Ga0207641_105615981 257
228 3300026089 Ga0207648_10009383 Ga0207648_100093835 257
229 3300026095 Ga0207676_10390477 Ga0207676_103904771 257
230 3300026116 Ga0207674_10017630 Ga0207674_100176303 257
231 3300026118 Ga0207675_100005444 Ga0207675_1000054441 257
232 3300026121 Ga0207683_10370001 Ga0207683_103700012 257
233 3300027907 Ga0207428_10004899 Ga0207428_100048999 257
234 3300050511 nmdc:mga08y16_3544_c1 nmdc:mga08y16_3544_c1_5500_6273 257
235 3300002459 JGI24751J29686_10000085 JGI24751J29686_1000008548 258
236 3300003203 JGI25406J46586_10011063 JGI25406J46586_100110632 258
237 3300005289 Ga0065704_10004769 Ga0065704_100047692 258
238 3300005290 Ga0065712_10010420 Ga0065712_100104202 258
239 3300005290 Ga0065712_10125633 Ga0065712_101256332 258
240 3300005293 Ga0065715_10003956 Ga0065715_100039563 258
241 3300005293 Ga0065715_10122203 Ga0065715_101222033 258
242 3300005293 Ga0065715_10123337 Ga0065715_101233371 258
243 3300005295 Ga0065707_10091531 Ga0065707_100915313 258
244 3300005330 Ga0070690_100106789 Ga0070690_1001067892 258
245 3300005331 Ga0070670_100000057 Ga0070670_100000057106 258
246 3300005331 Ga0070670_100026732 Ga0070670_1000267324 258
247 3300005331 Ga0070670_100050310 Ga0070670_1000503103 258
248 3300005331 Ga0070670_100110634 Ga0070670_1001106342 258
249 3300005331 Ga0070670_100213711 Ga0070670_1002137112 258
250 3300005334 Ga0068869_100110724 Ga0068869_1001107242 258
251 3300005334 Ga0068869_100214733 Ga0068869_1002147331 258
252 3300005335 Ga0070666_10155874 Ga0070666_101558742 258
253 3300005336 Ga0070680_100319717 Ga0070680_1003197171 258
254 3300005337 Ga0070682_100001206 Ga0070682_10000120610 258
255 3300005338 Ga0068868_100106440 Ga0068868_1001064402 258
256 3300005339 Ga0070660_100233421 Ga0070660_1002334212 258
257 3300005340 Ga0070689_100030290 Ga0070689_1000302902 258
258 3300005344 Ga0070661_100029084 Ga0070661_1000290843 258
259 3300005344 Ga0070661_100353317 Ga0070661_1003533172 258
260 3300005345 Ga0070692_10002955 Ga0070692_100029554 258
261 3300005345 Ga0070692_10065754 Ga0070692_100657542 258
262 3300005353 Ga0070669_100010925 Ga0070669_1000109252 258
263 3300005353 Ga0070669_100118096 Ga0070669_1001180961 258
264 3300005354 Ga0070675_100112115 Ga0070675_1001121153 258
265 3300005355 Ga0070671_100477977 Ga0070671_1004779771 258
266 3300005356 Ga0070674_100541778 Ga0070674_1005417781 258
267 3300005364 Ga0070673_100051706 Ga0070673_1000517061 258
268 3300005366 Ga0070659_100002999 Ga0070659_1000029996 258
269 3300005367 Ga0070667_100067474 Ga0070667_1000674742 258
270 3300005367 Ga0070667_100183140 Ga0070667_1001831402 258
271 3300005441 Ga0070700_100013026 Ga0070700_1000130263 258
272 3300005444 Ga0070694_100025987 Ga0070694_1000259871 258
273 3300005444 Ga0070694_100049475 Ga0070694_1000494752 258
274 3300005444 Ga0070694_100157885 Ga0070694_1001578853 258
275 3300005445 Ga0070708_100514079 Ga0070708_1005140792 258
276 3300005458 Ga0070681_10018062 Ga0070681_100180621 258
277 3300005459 Ga0068867_100270907 Ga0068867_1002709071 258
278 3300005459 Ga0068867_100513930 Ga0068867_1005139302 258
279 3300005467 Ga0070706_100854147 Ga0070706_1008541471 258
280 3300005471 Ga0070698_100000916 Ga0070698_10000091612 258
281 3300005471 Ga0070698_100004907 Ga0070698_10000490716 258
282 3300005518 Ga0070699_100310977 Ga0070699_1003109772 258
283 3300005530 Ga0070679_100014621 Ga0070679_1000146215 258
284 3300005536 Ga0070697_100006099 Ga0070697_1000060994 258
285 3300005536 Ga0070697_100058589 Ga0070697_1000585893 258
286 3300005539 Ga0068853_100009751 Ga0068853_1000097513 258
287 3300005539 Ga0068853_100110758 Ga0068853_1001107582 258
288 3300005544 Ga0070686_100009506 Ga0070686_1000095061 258
289 3300005545 Ga0070695_100111012 Ga0070695_1001110122 258
290 3300005546 Ga0070696_100282769 Ga0070696_1002827692 258
291 3300005547 Ga0070693_100015794 Ga0070693_1000157942 258
292 3300005549 Ga0070704_100035319 Ga0070704_1000353192 258
293 3300005549 Ga0070704_100409901 Ga0070704_1004099012 258
294 3300005563 Ga0068855_100605770 Ga0068855_1006057702 258
295 3300005564 Ga0070664_100000280 Ga0070664_10000028036 258
296 3300005564 Ga0070664_100040842 Ga0070664_1000408422 258
297 3300005578 Ga0068854_100217479 Ga0068854_1002174791 258
298 3300005578 Ga0068854_100666344 Ga0068854_1006663441 258
299 3300005616 Ga0068852_100140694 Ga0068852_1001406942 258
300 3300005616 Ga0068852_100540037 Ga0068852_1005400371 258
301 3300005616 Ga0068852_100643349 Ga0068852_1006433491 258
302 3300005617 Ga0068859_100026938 Ga0068859_1000269387 258
303 3300005617 Ga0068859_100061173 Ga0068859_1000611732 258
304 3300005617 Ga0068859_100109989 Ga0068859_1001099893 258
305 3300005617 Ga0068859_100189302 Ga0068859_1001893022 258
306 3300005617 Ga0068859_100195755 Ga0068859_1001957552 258
307 3300005617 Ga0068859_100206524 Ga0068859_1002065242 258
308 3300005617 Ga0068859_100280038 Ga0068859_1002800381 258
309 3300005617 Ga0068859_100457867 Ga0068859_1004578672 258
310 3300005618 Ga0068864_100033299 Ga0068864_1000332992 258
311 3300005618 Ga0068864_100045602 Ga0068864_1000456022 258
312 3300005718 Ga0068866_10128428 Ga0068866_101284281 258
313 3300005719 Ga0068861_100121439 Ga0068861_1001214393 258
314 3300005719 Ga0068861_100181743 Ga0068861_1001817433 258
315 3300005719 Ga0068861_100211690 Ga0068861_1002116902 258
316 3300005719 Ga0068861_100741301 Ga0068861_1007413011 258
317 3300005834 Ga0068851_10095564 Ga0068851_100955641 258
318 3300005840 Ga0068870_10030552 Ga0068870_100305522 258
319 3300005841 Ga0068863_100018375 Ga0068863_1000183752 258
320 3300005841 Ga0068863_100037936 Ga0068863_1000379362 258
321 3300005841 Ga0068863_100044808 Ga0068863_1000448085 258
322 3300005841 Ga0068863_100596828 Ga0068863_1005968282 258
323 3300005842 Ga0068858_100014863 Ga0068858_1000148631 258
324 3300005842 Ga0068858_100056480 Ga0068858_1000564802 258
325 3300005842 Ga0068858_100166619 Ga0068858_1001666193 258
326 3300005843 Ga0068860_100107672 Ga0068860_1001076723 258
327 3300005843 Ga0068860_100236824 Ga0068860_1002368242 258
328 3300005844 Ga0068862_100209752 Ga0068862_1002097522 258
329 3300005985 Ga0081539_10000931 Ga0081539_1000093143 258
330 3300006237 Ga0097621_100001570 Ga0097621_10000157011 258
331 3300006237 Ga0097621_100025494 Ga0097621_1000254942 258
332 3300006237 Ga0097621_100235129 Ga0097621_1002351292 258
333 3300006358 Ga0068871_100004902 Ga0068871_1000049025 258
334 3300006358 Ga0068871_100458521 Ga0068871_1004585211 258
335 3300006844 Ga0075428_100401259 Ga0075428_1004012592 258
336 3300006846 Ga0075430_100164322 Ga0075430_1001643222 258
337 3300006852 Ga0075433_10603420 Ga0075433_106034201 258
338 3300006871 Ga0075434_100252270 Ga0075434_1002522701 258
339 3300006880 Ga0075429_100116667 Ga0075429_1001166672 258
340 3300006880 Ga0075429_100307330 Ga0075429_1003073301 258
341 3300006931 Ga0097620_100026938 Ga0097620_1000269387 258
342 3300006931 Ga0097620_100061173 Ga0097620_1000611732 258
343 3300006931 Ga0097620_100109983 Ga0097620_1001099833 258
344 3300006931 Ga0097620_100189300 Ga0097620_1001893002 258
345 3300006931 Ga0097620_100195762 Ga0097620_1001957622 258
346 3300006931 Ga0097620_100206534 Ga0097620_1002065343 258
347 3300006931 Ga0097620_100280047 Ga0097620_1002800471 258
348 3300006931 Ga0097620_100457887 Ga0097620_1004578872 258
349 3300009093 Ga0105240_10041387 Ga0105240_100413873 258
350 3300009094 Ga0111539_10131725 Ga0111539_101317251 258
351 3300009098 Ga0105245_10342591 Ga0105245_103425911 258
352 3300009098 Ga0105245_10886819 Ga0105245_108868191 258
353 3300009101 Ga0105247_10042199 Ga0105247_100421993 258
354 3300009147 Ga0114129_10077095 Ga0114129_100770955 258
355 3300009147 Ga0114129_10273284 Ga0114129_102732843 258
356 3300009148 Ga0105243_10311564 Ga0105243_103115642 258
357 3300009148 Ga0105243_10704469 Ga0105243_107044691 258
358 3300009176 Ga0105242_10000807 Ga0105242_1000080714 258
359 3300009176 Ga0105242_10108836 Ga0105242_101088362 258
360 3300009177 Ga0105248_10013500 Ga0105248_100135003 258
361 3300009177 Ga0105248_10130327 Ga0105248_101303272 258
362 3300009177 Ga0105248_10437898 Ga0105248_104378981 258
363 3300009177 Ga0105248_10526596 Ga0105248_105265962 258
364 3300009177 Ga0105248_10787017 Ga0105248_107870172 258
365 3300009545 Ga0105237_10034027 Ga0105237_100340272 258
366 3300009545 Ga0105237_10073202 Ga0105237_100732022 258
367 3300009545 Ga0105237_10322546 Ga0105237_103225462 258
368 3300009551 Ga0105238_10013272 Ga0105238_100132727 258
369 3300009553 Ga0105249_10074481 Ga0105249_100744812 258
370 3300009553 Ga0105249_10159769 Ga0105249_101597692 258
371 3300009553 Ga0105249_10192297 Ga0105249_101922972 258
372 3300010375 Ga0105239_10352157 Ga0105239_103521572 258
373 3300011119 Ga0105246_10012997 Ga0105246_100129973 258
374 3300011119 Ga0105246_10186646 Ga0105246_101866462 258
375 3300013100 Ga0157373_10004608 Ga0157373_100046089 258
376 3300013102 Ga0157371_10557392 Ga0157371_105573921 258
377 3300013297 Ga0157378_10009723 Ga0157378_100097235 258
378 3300013297 Ga0157378_10014643 Ga0157378_100146432 258
379 3300013297 Ga0157378_10033984 Ga0157378_100339845 258
380 3300013297 Ga0157378_10231787 Ga0157378_102317873 258
381 3300013297 Ga0157378_10260632 Ga0157378_102606322 258
382 3300013306 Ga0163162_10015538 Ga0163162_100155384 258
383 3300013306 Ga0163162_10038965 Ga0163162_100389655 258
384 3300013306 Ga0163162_10320613 Ga0163162_103206132 258
385 3300013306 Ga0163162_10440929 Ga0163162_104409292 258
386 3300013306 Ga0163162_10594381 Ga0163162_105943812 258
387 3300013307 Ga0157372_10043475 Ga0157372_100434755 258
388 3300013307 Ga0157372_10108256 Ga0157372_101082563 258
389 3300013308 Ga0157375_10023277 Ga0157375_100232776 258
390 3300013308 Ga0157375_10066328 Ga0157375_100663285 258
391 3300013308 Ga0157375_10463376 Ga0157375_104633762 258
392 3300014325 Ga0163163_10000184 Ga0163163_1000018462 258
393 3300014325 Ga0163163_10004533 Ga0163163_100045335 258
394 3300014325 Ga0163163_10005720 Ga0163163_100057207 258
395 3300014325 Ga0163163_10024208 Ga0163163_100242086 258
396 3300014325 Ga0163163_10204687 Ga0163163_102046872 258
397 3300014326 Ga0157380_10006388 Ga0157380_100063885 258
398 3300014969 Ga0157376_10015880 Ga0157376_100158806 258
399 3300017792 Ga0163161_10022258 Ga0163161_100222582 258
400 3300017792 Ga0163161_10174222 Ga0163161_101742222 258
401 3300021384 Ga0213876_10000043 Ga0213876_100000433 258
402 3300025900 Ga0207710_10009002 Ga0207710_100090024 258
403 3300025908 Ga0207643_10035314 Ga0207643_100353142 258
404 3300025910 Ga0207684_10722182 Ga0207684_107221821 258
405 3300025912 Ga0207707_10310225 Ga0207707_103102251 258
406 3300025913 Ga0207695_10097543 Ga0207695_100975434 258
407 3300025914 Ga0207671_10002740 Ga0207671_100027403 258
408 3300025914 Ga0207671_10088224 Ga0207671_100882242 258
409 3300025914 Ga0207671_10415242 Ga0207671_104152422 258
410 3300025918 Ga0207662_10025954 Ga0207662_100259545 258
411 3300025918 Ga0207662_10081775 Ga0207662_100817753 258
412 3300025921 Ga0207652_10081877 Ga0207652_100818773 258
413 3300025922 Ga0207646_10226111 Ga0207646_102261112 258
414 3300025923 Ga0207681_10007662 Ga0207681_100076626 258
415 3300025923 Ga0207681_10078357 Ga0207681_100783573 258
416 3300025924 Ga0207694_10015740 Ga0207694_100157405 258
417 3300025925 Ga0207650_10000027 Ga0207650_100000273 258
418 3300025925 Ga0207650_10000623 Ga0207650_100006234 258
419 3300025925 Ga0207650_10072198 Ga0207650_100721982 258
420 3300025925 Ga0207650_10546565 Ga0207650_105465652 258
421 3300025926 Ga0207659_10098422 Ga0207659_100984222 258
422 3300025931 Ga0207644_10020094 Ga0207644_100200942 258
423 3300025931 Ga0207644_10229957 Ga0207644_102299572 258
424 3300025934 Ga0207686_10001492 Ga0207686_100014925 258
425 3300025935 Ga0207709_10120115 Ga0207709_101201152 258
426 3300025940 Ga0207691_10023812 Ga0207691_100238125 258
427 3300025941 Ga0207711_10009657 Ga0207711_100096575 258
428 3300025941 Ga0207711_10054024 Ga0207711_100540242 258
429 3300025941 Ga0207711_10658746 Ga0207711_106587461 258
430 3300025942 Ga0207689_10045330 Ga0207689_100453304 258
431 3300025942 Ga0207689_10202658 Ga0207689_102026582 258
432 3300025945 Ga0207679_10055065 Ga0207679_100550652 258
433 3300025949 Ga0207667_10549017 Ga0207667_105490172 258
434 3300025960 Ga0207651_10043386 Ga0207651_100433862 258
435 3300025960 Ga0207651_10107459 Ga0207651_101074593 258
436 3300025960 Ga0207651_10395093 Ga0207651_103950932 258
437 3300025961 Ga0207712_10016341 Ga0207712_100163412 258
438 3300025961 Ga0207712_10170114 Ga0207712_101701143 258
439 3300025981 Ga0207640_10213101 Ga0207640_102131012 258
440 3300025986 Ga0207658_10023337 Ga0207658_100233372 258
441 3300025986 Ga0207658_10125671 Ga0207658_101256713 258
442 3300026035 Ga0207703_10006636 Ga0207703_100066367 258
443 3300026035 Ga0207703_10055950 Ga0207703_100559504 258
444 3300026035 Ga0207703_10396280 Ga0207703_103962801 258
445 3300026035 Ga0207703_10580467 Ga0207703_105804671 258
446 3300026041 Ga0207639_10153298 Ga0207639_101532981 258
447 3300026067 Ga0207678_10140884 Ga0207678_101408843 258
448 3300026075 Ga0207708_10022826 Ga0207708_100228263 258
449 3300026088 Ga0207641_10005244 Ga0207641_100052447 258
450 3300026088 Ga0207641_10157747 Ga0207641_101577473 258
451 3300026089 Ga0207648_10102424 Ga0207648_101024243 258
452 3300026089 Ga0207648_10428139 Ga0207648_104281391 258
453 3300026095 Ga0207676_10001919 Ga0207676_100019199 258
454 3300026095 Ga0207676_10006195 Ga0207676_100061957 258
455 3300026095 Ga0207676_10469703 Ga0207676_104697032 258
456 3300026095 Ga0207676_10528971 Ga0207676_105289711 258
457 3300026095 Ga0207676_10558310 Ga0207676_105583102 258
458 3300026116 Ga0207674_10000525 Ga0207674_100005257 258
459 3300026118 Ga0207675_100017262 Ga0207675_1000172621 258
460 3300026142 Ga0207698_10826949 Ga0207698_108269491 258
461 3300027907 Ga0207428_10005514 Ga0207428_1000551414 258
462 3300028380 Ga0268265_10003630 Ga0268265_1000363012 258
463 3300028381 Ga0268264_10019417 Ga0268264_100194173 258
464 3300028381 Ga0268264_10351733 Ga0268264_103517331 258
465 3300028381 Ga0268264_10381543 Ga0268264_103815432 258
466 3300031731 Ga0307405_10549987 Ga0307405_105499871 258
467 3300031824 Ga0307413_10172345 Ga0307413_101723451 258
468 3300031852 Ga0307410_10250672 Ga0307410_102506722 258
469 3300031911 Ga0307412_10056920 Ga0307412_100569203 258
470 3300032002 Ga0307416_100197179 Ga0307416_1001971792 258
471 3300035088 Ga0373940_0035690 Ga0373940_0035690_98_874 258
472 3300035091 Ga0373951_0003754 Ga0373951_0003754_378_1160 258
473 3300035117 Ga0373953_0055114 Ga0373953_0055114_673_1455 258
474 3300035207 Ga0373942_0024221 Ga0373942_0024221_473_1249 258
475 3300036401 Ga0373937_0089715 Ga0373937_0089715_1487_2269 258
476 3300037418 Ga0395900_0649130 Ga0395900_0649130_64_840 258
477 3300039437 Ga0436365_0421852 Ga0436365_0421852_2328_3113 258
478 3300050507 nmdc:mga05p37_166487_c1 nmdc:mga05p37_166487_c1_1367_2143 258
479 3300050508 nmdc:mga09592_122616_c1 nmdc:mga09592_122616_c1_650_1426 258
480 3300050508 nmdc:mga09592_234598_c1 nmdc:mga09592_234598_c1_666_1451 258
481 3300050508 nmdc:mga09592_288863_c1 nmdc:mga09592_288863_c1_81_872 258
482 3300050512 nmdc:mga0n895_603749_c1 nmdc:mga0n895_603749_c1_121_933 258
483 3300050515 nmdc:mga0a205_175950_c1 nmdc:mga0a205_175950_c1_621_1433 258
484 3300050515 nmdc:mga0a205_214547_c1 nmdc:mga0a205_214547_c1_896_1708 258
485 3300001426 JGI24030J14995_100170 JGI24030J14995_1001701 259
486 3300001432 JGI24034J14986_101130 JGI24034J14986_1011302 259
487 3300002074 JGI24748J21848_1000003 JGI24748J21848_1000003158 259
488 3300002239 JGI24034J26672_10000005 JGI24034J26672_10000005243 259
489 3300003203 JGI25406J46586_10000438 JGI25406J46586_100004385 259
490 3300005288 Ga0065714_10064444 Ga0065714_1006444477 259
491 3300005290 Ga0065712_10067736 Ga0065712_1006773623 259
492 3300005290 Ga0065712_10242113 Ga0065712_102421131 259
493 3300005293 Ga0065715_10090715 Ga0065715_100907156 259
494 3300005327 Ga0070658_10008799 Ga0070658_100087995 259
495 3300005330 Ga0070690_100002320 Ga0070690_1000023206 259
496 3300005330 Ga0070690_100081286 Ga0070690_1000812862 259
497 3300005331 Ga0070670_100088040 Ga0070670_1000880403 259
498 3300005331 Ga0070670_100128392 Ga0070670_1001283922 259
499 3300005334 Ga0068869_100013570 Ga0068869_1000135703 259
500 3300005334 Ga0068869_100129407 Ga0068869_1001294072 259
501 3300005334 Ga0068869_100183434 Ga0068869_1001834342 259
502 3300005336 Ga0070680_100004835 Ga0070680_1000048356 259
503 3300005336 Ga0070680_100253433 Ga0070680_1002534332 259
504 3300005337 Ga0070682_100000068 Ga0070682_10000006863 259
505 3300005338 Ga0068868_100052164 Ga0068868_1000521643 259
506 3300005340 Ga0070689_100000292 Ga0070689_1000002921 259
507 3300005340 Ga0070689_100477160 Ga0070689_1004771601 259
508 3300005345 Ga0070692_10045813 Ga0070692_100458132 259
509 3300005347 Ga0070668_100006439 Ga0070668_1000064396 259
510 3300005354 Ga0070675_100392041 Ga0070675_1003920411 259
511 3300005355 Ga0070671_100005420 Ga0070671_1000054207 259
512 3300005355 Ga0070671_100030391 Ga0070671_1000303913 259
513 3300005355 Ga0070671_100557814 Ga0070671_1005578141 259
514 3300005364 Ga0070673_100192708 Ga0070673_1001927082 259
515 3300005406 Ga0070703_10000036 Ga0070703_1000003615 259
516 3300005438 Ga0070701_10037404 Ga0070701_100374042 259
517 3300005440 Ga0070705_100144075 Ga0070705_1001440752 259
518 3300005440 Ga0070705_100420960 Ga0070705_1004209602 259
519 3300005441 Ga0070700_100000305 Ga0070700_10000030520 259
520 3300005441 Ga0070700_100013485 Ga0070700_1000134852 259
521 3300005441 Ga0070700_100066109 Ga0070700_1000661093 259
522 3300005444 Ga0070694_100003401 Ga0070694_1000034019 259
523 3300005444 Ga0070694_100012648 Ga0070694_1000126482 259
524 3300005444 Ga0070694_100053308 Ga0070694_1000533082 259
525 3300005445 Ga0070708_100000002 Ga0070708_100000002122 259
526 3300005445 Ga0070708_100272617 Ga0070708_1002726171 259
527 3300005457 Ga0070662_100122203 Ga0070662_1001222032 259
528 3300005458 Ga0070681_10000041 Ga0070681_1000004135 259
529 3300005458 Ga0070681_10029594 Ga0070681_100295944 259
530 3300005458 Ga0070681_10056272 Ga0070681_100562723 259
531 3300005458 Ga0070681_10408994 Ga0070681_104089942 259
532 3300005467 Ga0070706_100000002 Ga0070706_100000002166 259
533 3300005467 Ga0070706_100005846 Ga0070706_1000058463 259
534 3300005467 Ga0070706_100013151 Ga0070706_1000131513 259
535 3300005467 Ga0070706_100018943 Ga0070706_1000189437 259
536 3300005467 Ga0070706_100065565 Ga0070706_1000655653 259
537 3300005468 Ga0070707_100000167 Ga0070707_10000016722 259
538 3300005468 Ga0070707_100007291 Ga0070707_1000072912 259
539 3300005468 Ga0070707_100144200 Ga0070707_1001442002 259
540 3300005468 Ga0070707_100276880 Ga0070707_1002768802 259
541 3300005468 Ga0070707_100378087 Ga0070707_1003780872 259
542 3300005471 Ga0070698_100000164 Ga0070698_10000016414 259
543 3300005471 Ga0070698_100002314 Ga0070698_10000231422 259
544 3300005471 Ga0070698_100010410 Ga0070698_1000104108 259
545 3300005471 Ga0070698_100059613 Ga0070698_1000596131 259
546 3300005471 Ga0070698_100138191 Ga0070698_1001381911 259
547 3300005518 Ga0070699_100000169 Ga0070699_10000016942 259
548 3300005518 Ga0070699_100000483 Ga0070699_1000004838 259
549 3300005518 Ga0070699_100059794 Ga0070699_1000597944 259
550 3300005518 Ga0070699_100061167 Ga0070699_1000611672 259
551 3300005518 Ga0070699_100198725 Ga0070699_1001987253 259
552 3300005530 Ga0070679_100000074 Ga0070679_10000007462 259
553 3300005536 Ga0070697_100000071 Ga0070697_10000007111 259
554 3300005536 Ga0070697_100008492 Ga0070697_1000084922 259
555 3300005536 Ga0070697_100013343 Ga0070697_1000133431 259
556 3300005536 Ga0070697_100203799 Ga0070697_1002037991 259
557 3300005536 Ga0070697_100351578 Ga0070697_1003515781 259
558 3300005536 Ga0070697_100656103 Ga0070697_1006561031 259
559 3300005539 Ga0068853_100018350 Ga0068853_1000183504 259
560 3300005544 Ga0070686_100006607 Ga0070686_1000066073 259
561 3300005545 Ga0070695_100434657 Ga0070695_1004346571 259
562 3300005546 Ga0070696_100014172 Ga0070696_1000141723 259
563 3300005546 Ga0070696_100017420 Ga0070696_1000174205 259
564 3300005546 Ga0070696_100133512 Ga0070696_1001335122 259
565 3300005546 Ga0070696_100259934 Ga0070696_1002599341 259
566 3300005547 Ga0070693_100204293 Ga0070693_1002042932 259
567 3300005549 Ga0070704_100003508 Ga0070704_1000035083 259
568 3300005549 Ga0070704_100035616 Ga0070704_1000356162 259
569 3300005549 Ga0070704_100092735 Ga0070704_1000927352 259
570 3300005549 Ga0070704_100367951 Ga0070704_1003679512 259
571 3300005564 Ga0070664_100524113 Ga0070664_1005241132 259
572 3300005577 Ga0068857_100579234 Ga0068857_1005792342 259
573 3300005578 Ga0068854_100056328 Ga0068854_1000563282 259
574 3300005578 Ga0068854_100234550 Ga0068854_1002345501 259
575 3300005578 Ga0068854_100357432 Ga0068854_1003574322 259
576 3300005615 Ga0070702_100028198 Ga0070702_1000281982 259
577 3300005616 Ga0068852_100313932 Ga0068852_1003139322 259
578 3300005617 Ga0068859_100035651 Ga0068859_1000356515 259
579 3300005617 Ga0068859_100045900 Ga0068859_1000459003 259
580 3300005617 Ga0068859_100103052 Ga0068859_1001030522 259
581 3300005617 Ga0068859_100175866 Ga0068859_1001758662 259
582 3300005617 Ga0068859_100179404 Ga0068859_1001794042 259
583 3300005617 Ga0068859_100810579 Ga0068859_1008105791 259
584 3300005618 Ga0068864_100207507 Ga0068864_1002075072 259
585 3300005618 Ga0068864_100439737 Ga0068864_1004397371 259
586 3300005718 Ga0068866_10053147 Ga0068866_100531472 259
587 3300005719 Ga0068861_100029995 Ga0068861_1000299953 259
588 3300005840 Ga0068870_10370093 Ga0068870_103700931 259
589 3300005841 Ga0068863_100046793 Ga0068863_1000467933 259
590 3300005841 Ga0068863_100061232 Ga0068863_1000612325 259
591 3300005841 Ga0068863_100082478 Ga0068863_1000824782 259
592 3300005841 Ga0068863_100362025 Ga0068863_1003620252 259
593 3300005842 Ga0068858_100000134 Ga0068858_1000001342 259
594 3300005842 Ga0068858_100041991 Ga0068858_1000419912 259
595 3300005842 Ga0068858_100129545 Ga0068858_1001295452 259
596 3300005842 Ga0068858_100462773 Ga0068858_1004627732 259
597 3300005843 Ga0068860_100006276 Ga0068860_1000062762 259
598 3300005843 Ga0068860_100191474 Ga0068860_1001914742 259
599 3300005843 Ga0068860_100543992 Ga0068860_1005439922 259
600 3300005844 Ga0068862_100101196 Ga0068862_1001011961 259
601 3300005844 Ga0068862_100118142 Ga0068862_1001181423 259
602 3300005985 Ga0081539_10000731 Ga0081539_1000073140 259
603 3300006163 Ga0070715_10000018 Ga0070715_1000001868 259
604 3300006173 Ga0070716_100000017 Ga0070716_10000001742 259
605 3300006173 Ga0070716_100033150 Ga0070716_1000331503 259
606 3300006173 Ga0070716_100298041 Ga0070716_1002980411 259
607 3300006237 Ga0097621_100003941 Ga0097621_1000039415 259
608 3300006358 Ga0068871_100003493 Ga0068871_1000034935 259
609 3300006844 Ga0075428_100529982 Ga0075428_1005299822 259
610 3300006852 Ga0075433_10023132 Ga0075433_100231323 259
611 3300006852 Ga0075433_10238450 Ga0075433_102384502 259
612 3300006852 Ga0075433_10312900 Ga0075433_103129001 259
613 3300006871 Ga0075434_100195837 Ga0075434_1001958372 259
614 3300006871 Ga0075434_100398827 Ga0075434_1003988271 259
615 3300006871 Ga0075434_100479746 Ga0075434_1004797462 259
616 3300006881 Ga0068865_100030118 Ga0068865_1000301183 259
617 3300006881 Ga0068865_100080047 Ga0068865_1000800473 259
618 3300006914 Ga0075436_100000011 Ga0075436_1000000114 259
619 3300006914 Ga0075436_100386850 Ga0075436_1003868502 259
620 3300006931 Ga0097620_100035652 Ga0097620_1000356522 259
621 3300006931 Ga0097620_100045900 Ga0097620_1000459003 259
622 3300006931 Ga0097620_100103046 Ga0097620_1001030462 259
623 3300006931 Ga0097620_100175870 Ga0097620_1001758702 259
624 3300006931 Ga0097620_100179393 Ga0097620_1001793933 259
625 3300006931 Ga0097620_100810591 Ga0097620_1008105911 259
626 3300007076 Ga0075435_100009513 Ga0075435_1000095134 259
627 3300007265 Ga0099794_10027450 Ga0099794_100274505 259
628 3300009094 Ga0111539_10179811 Ga0111539_101798113 259
629 3300009098 Ga0105245_10094357 Ga0105245_100943571 259
630 3300009101 Ga0105247_10000022 Ga0105247_10000022149 259
631 3300009101 Ga0105247_10003696 Ga0105247_100036965 259
632 3300009101 Ga0105247_10056432 Ga0105247_100564322 259
633 3300009147 Ga0114129_10128631 Ga0114129_101286313 259
634 3300009147 Ga0114129_10169017 Ga0114129_101690172 259
635 3300009147 Ga0114129_10198008 Ga0114129_101980082 259
636 3300009147 Ga0114129_10399162 Ga0114129_103991621 259
637 3300009147 Ga0114129_10489936 Ga0114129_104899361 259
638 3300009148 Ga0105243_10000102 Ga0105243_100001026 259
639 3300009148 Ga0105243_10000207 Ga0105243_1000020729 259
640 3300009148 Ga0105243_10219470 Ga0105243_102194702 259
641 3300009148 Ga0105243_10231840 Ga0105243_102318402 259
642 3300009174 Ga0105241_10019871 Ga0105241_100198715 259
643 3300009174 Ga0105241_10779524 Ga0105241_107795241 259
644 3300009176 Ga0105242_10000279 Ga0105242_100002795 259
645 3300009176 Ga0105242_10005822 Ga0105242_100058223 259
646 3300009177 Ga0105248_10004786 Ga0105248_1000478614 259
647 3300009177 Ga0105248_10116314 Ga0105248_101163143 259
648 3300009553 Ga0105249_10000254 Ga0105249_1000025441 259
649 3300009553 Ga0105249_10180798 Ga0105249_101807982 259
650 3300009553 Ga0105249_10679044 Ga0105249_106790441 259
651 3300010375 Ga0105239_10135754 Ga0105239_101357543 259
652 3300010375 Ga0105239_10601699 Ga0105239_106016992 259
653 3300011119 Ga0105246_10253604 Ga0105246_102536042 259
654 3300013100 Ga0157373_10172215 Ga0157373_101722152 259
655 3300013100 Ga0157373_10222501 Ga0157373_102225012 259
656 3300013296 Ga0157374_10037875 Ga0157374_100378753 259
657 3300013296 Ga0157374_10173327 Ga0157374_101733272 259
658 3300013297 Ga0157378_10000191 Ga0157378_1000019118 259
659 3300013297 Ga0157378_10024594 Ga0157378_100245942 259
660 3300013297 Ga0157378_10085582 Ga0157378_100855823 259
661 3300013297 Ga0157378_10147662 Ga0157378_101476622 259
662 3300013297 Ga0157378_10505085 Ga0157378_105050851 259
663 3300013297 Ga0157378_10818482 Ga0157378_108184821 259
664 3300013306 Ga0163162_10000179 Ga0163162_1000017941 259
665 3300013306 Ga0163162_10042270 Ga0163162_100422705 259
666 3300013306 Ga0163162_10075719 Ga0163162_100757192 259
667 3300013306 Ga0163162_10082924 Ga0163162_100829242 259
668 3300013306 Ga0163162_10124137 Ga0163162_101241373 259
669 3300013306 Ga0163162_10238326 Ga0163162_102383263 259
670 3300013307 Ga0157372_10044452 Ga0157372_100444524 259
671 3300013308 Ga0157375_10004435 Ga0157375_1000443510 259
672 3300013308 Ga0157375_10021549 Ga0157375_100215493 259
673 3300013308 Ga0157375_10093322 Ga0157375_100933225 259
674 3300014325 Ga0163163_10012406 Ga0163163_100124069 259
675 3300014325 Ga0163163_10104265 Ga0163163_101042652 259
676 3300014326 Ga0157380_10000627 Ga0157380_100006277 259
677 3300014326 Ga0157380_10003949 Ga0157380_100039496 259
678 3300014326 Ga0157380_10047258 Ga0157380_100472583 259
679 3300014968 Ga0157379_10090990 Ga0157379_100909903 259
680 3300014969 Ga0157376_10038847 Ga0157376_100388474 259
681 3300017792 Ga0163161_10343028 Ga0163161_103430282 259
682 3300021384 Ga0213876_10000228 Ga0213876_1000022819 259
683 3300025223 Ga0207672_1000046 Ga0207672_100004611 259
684 3300025885 Ga0207653_10000008 Ga0207653_10000008154 259
685 3300025899 Ga0207642_10136482 Ga0207642_101364822 259
686 3300025900 Ga0207710_10000001 Ga0207710_10000001256 259
687 3300025905 Ga0207685_10000022 Ga0207685_1000002239 259
688 3300025908 Ga0207643_10009459 Ga0207643_100094597 259
689 3300025909 Ga0207705_10026077 Ga0207705_100260772 259
690 3300025910 Ga0207684_10000076 Ga0207684_1000007651 259
691 3300025910 Ga0207684_10014326 Ga0207684_100143261 259
692 3300025910 Ga0207684_10080999 Ga0207684_100809993 259
693 3300025911 Ga0207654_10475760 Ga0207654_104757601 259
694 3300025912 Ga0207707_10000077 Ga0207707_1000007743 259
695 3300025912 Ga0207707_10010071 Ga0207707_100100713 259
696 3300025912 Ga0207707_10017193 Ga0207707_100171933 259
697 3300025912 Ga0207707_10027372 Ga0207707_100273722 259
698 3300025921 Ga0207652_10000096 Ga0207652_1000009641 259
699 3300025921 Ga0207652_10247382 Ga0207652_102473822 259
700 3300025922 Ga0207646_10001426 Ga0207646_1000142614 259
701 3300025922 Ga0207646_10022181 Ga0207646_100221814 259
702 3300025922 Ga0207646_10278437 Ga0207646_102784372 259
703 3300025922 Ga0207646_10329243 Ga0207646_103292431 259
704 3300025923 Ga0207681_10091343 Ga0207681_100913431 259
705 3300025925 Ga0207650_10027728 Ga0207650_100277283 259
706 3300025925 Ga0207650_10413232 Ga0207650_104132322 259
707 3300025927 Ga0207687_10153793 Ga0207687_101537931 259
708 3300025931 Ga0207644_10002044 Ga0207644_100020447 259
709 3300025931 Ga0207644_10025578 Ga0207644_100255785 259
710 3300025934 Ga0207686_10000062 Ga0207686_100000626 259
711 3300025934 Ga0207686_10007557 Ga0207686_100075574 259
712 3300025935 Ga0207709_10000091 Ga0207709_1000009177 259
713 3300025936 Ga0207670_10041254 Ga0207670_100412542 259
714 3300025938 Ga0207704_10117842 Ga0207704_101178422 259
715 3300025939 Ga0207665_10000033 Ga0207665_1000003342 259
716 3300025939 Ga0207665_10036012 Ga0207665_100360122 259
717 3300025939 Ga0207665_10308283 Ga0207665_103082832 259
718 3300025939 Ga0207665_10315161 Ga0207665_103151611 259
719 3300025940 Ga0207691_10264776 Ga0207691_102647762 259
720 3300025941 Ga0207711_10004896 Ga0207711_100048968 259
721 3300025941 Ga0207711_10044876 Ga0207711_100448762 259
722 3300025941 Ga0207711_10223831 Ga0207711_102238312 259
723 3300025942 Ga0207689_10006262 Ga0207689_100062624 259
724 3300025942 Ga0207689_10051986 Ga0207689_100519862 259
725 3300025942 Ga0207689_10088648 Ga0207689_100886482 259
726 3300025960 Ga0207651_10070141 Ga0207651_100701412 259
727 3300025961 Ga0207712_10000781 Ga0207712_100007811 259
728 3300025961 Ga0207712_10015035 Ga0207712_100150353 259
729 3300025972 Ga0207668_10010711 Ga0207668_100107112 259
730 3300025981 Ga0207640_10135686 Ga0207640_101356862 259
731 3300025981 Ga0207640_10223310 Ga0207640_102233102 259
732 3300025986 Ga0207658_10277046 Ga0207658_102770462 259
733 3300026035 Ga0207703_10000481 Ga0207703_1000048141 259
734 3300026035 Ga0207703_10015662 Ga0207703_100156624 259
735 3300026035 Ga0207703_10059809 Ga0207703_100598092 259
736 3300026035 Ga0207703_10234759 Ga0207703_102347592 259
737 3300026041 Ga0207639_10038113 Ga0207639_100381134 259
738 3300026041 Ga0207639_10058152 Ga0207639_100581522 259
739 3300026075 Ga0207708_10000235 Ga0207708_1000023529 259
740 3300026075 Ga0207708_10015082 Ga0207708_100150823 259
741 3300026075 Ga0207708_10039853 Ga0207708_100398534 259
742 3300026075 Ga0207708_10088520 Ga0207708_100885203 259
743 3300026075 Ga0207708_10522704 Ga0207708_105227041 259
744 3300026088 Ga0207641_10062794 Ga0207641_100627943 259
745 3300026088 Ga0207641_10124678 Ga0207641_101246781 259
746 3300026088 Ga0207641_10317875 Ga0207641_103178751 259
747 3300026089 Ga0207648_10145571 Ga0207648_101455712 259
748 3300026095 Ga0207676_10076835 Ga0207676_100768352 259
749 3300026095 Ga0207676_10578753 Ga0207676_105787532 259
750 3300026118 Ga0207675_100001552 Ga0207675_10000155216 259
751 3300026118 Ga0207675_100160160 Ga0207675_1001601603 259
752 3300026118 Ga0207675_100229015 Ga0207675_1002290152 259
753 3300027671 Ga0209588_1009760 Ga0209588_10097605 259
754 3300028380 Ga0268265_10158559 Ga0268265_101585592 259
755 3300028381 Ga0268264_10005319 Ga0268264_100053192 259
756 3300028381 Ga0268264_10006931 Ga0268264_100069313 259
757 3300028381 Ga0268264_10303390 Ga0268264_103033902 259
758 3300028381 Ga0268264_10317935 Ga0268264_103179352 259
759 3300031548 Ga0307408_100008854 Ga0307408_1000088545 259
760 3300031548 Ga0307408_100190798 Ga0307408_1001907982 259
761 3300031731 Ga0307405_10004255 Ga0307405_100042555 259
762 3300031731 Ga0307405_10098022 Ga0307405_100980222 259
763 3300031731 Ga0307405_10298622 Ga0307405_102986222 259
764 3300031824 Ga0307413_10018801 Ga0307413_100188014 259
765 3300031852 Ga0307410_10013140 Ga0307410_100131405 259
766 3300031852 Ga0307410_10017066 Ga0307410_100170664 259
767 3300031901 Ga0307406_10011489 Ga0307406_100114894 259
768 3300031901 Ga0307406_10014727 Ga0307406_100147274 259
769 3300031903 Ga0307407_10007946 Ga0307407_100079462 259
770 3300031911 Ga0307412_10052512 Ga0307412_100525124 259
771 3300031911 Ga0307412_10085572 Ga0307412_100855722 259
772 3300031995 Ga0307409_100006264 Ga0307409_1000062644 259
773 3300032002 Ga0307416_100004832 Ga0307416_1000048324 259
774 3300032002 Ga0307416_100015918 Ga0307416_1000159182 259
775 3300032004 Ga0307414_10011752 Ga0307414_100117523 259
776 3300032004 Ga0307414_10049325 Ga0307414_100493254 259
777 3300032004 Ga0307414_10357272 Ga0307414_103572722 259
778 3300032005 Ga0307411_10006971 Ga0307411_100069714 259
779 3300032005 Ga0307411_10021834 Ga0307411_100218342 259
780 3300032005 Ga0307411_10120851 Ga0307411_101208511 259
781 3300032005 Ga0307411_10181296 Ga0307411_101812961 259
782 3300032126 Ga0307415_100009335 Ga0307415_1000093351 259
783 3300032126 Ga0307415_100016598 Ga0307415_1000165984 259
784 3300037418 Ga0395900_0215130 Ga0395900_0215130_1070_1864 259
785 3300037418 Ga0395900_0550889 Ga0395900_0550889_224_1006 259
786 3300037466 Ga0395898_0321229 Ga0395898_0321229_268_1053 259
787 3300037471 Ga0395905_0029319 Ga0395905_0029319_3560_4345 259
788 3300038996 Ga0242420_004415 Ga0242420_004415_969_1781 259
789 3300039437 Ga0436365_0013216 Ga0436365_0013216_22037_22825 259
790 3300042156 Ga0439446_0011230 Ga0439446_0011230_919_1707 259
791 3300042157 Ga0439458_0005147 Ga0439458_0005147_1015_1794 259
792 3300042435 Ga0439434_0022033 Ga0439434_0022033_961_1752 259
793 3300044673 Ga0453683_0026879 Ga0453683_0026879_1680_2471 259
794 3300044712 Ga0453684_0263576 Ga0453684_0263576_172_984 259
795 3300045051 Ga0451576_0042739 Ga0451576_0042739_1820_2632 259
796 3300046525 Ga0495663_0000433 Ga0495663_0000433_260_1042 259
797 3300046537 Ga0495598_0002150 Ga0495598_0002150_2522_3304 259
798 3300046539 Ga0495621_0002053 Ga0495621_0002053_2204_2986 259
799 3300047320 Ga0495672_0093934 Ga0495672_0093934_37_822 259
800 3300048905 Ga0496102_0549527 Ga0496102_0549527_177_977 259
801 3300048910 Ga0496107_0174394 Ga0496107_0174394_283_1218 259
802 3300048915 Ga0496112_0241295 Ga0496112_0241295_207_986 259
803 3300049524 Ga0501301_001508 Ga0501301_001508_380_1162 259
804 3300049574 Ga0501038_0003660 Ga0501038_0003660_2412_3194 259
805 3300049652 Ga0501202_013011 Ga0501202_013011_359_1141 259
806 3300049661 Ga0501217_005217 Ga0501217_005217_1577_2356 259
807 3300049663 Ga0501223_005137 Ga0501223_005137_172_951 259
808 3300049663 Ga0501223_010856 Ga0501223_010856_404_1183 259
809 3300049664 Ga0501224_009207 Ga0501224_009207_478_1257 259
810 3300049665 Ga0501227_000507 Ga0501227_000507_5752_6531 259
811 3300049667 Ga0501230_021618 Ga0501230_021618_172_951 259
812 3300049668 Ga0501233_001430 Ga0501233_001430_2748_3527 259
813 3300049669 Ga0501235_002582 Ga0501235_002582_2433_3212 259
814 3300049669 Ga0501235_012582 Ga0501235_012582_1057_1839 259
815 3300049675 Ga0501243_008153 Ga0501243_008153_753_1532 259
816 3300049679 Ga0501249_015253 Ga0501249_015253_146_928 259
817 3300049688 Ga0501259_011652 Ga0501259_011652_317_1096 259
818 3300049704 Ga0501221_010336 Ga0501221_010336_168_947 259
819 3300049705 Ga0501225_0000353 Ga0501225_0000353_9760_10539 259
820 3300049705 Ga0501225_0002065 Ga0501225_0002065_278_1057 259
821 3300049705 Ga0501225_0022930 Ga0501225_0022930_326_1108 259
822 3300049851 Ga0501212_007983 Ga0501212_007983_587_1366 259
823 3300049853 Ga0501226_000515 Ga0501226_000515_4033_4812 259
824 3300050507 nmdc:mga05p37_13138_c2 nmdc:mga05p37_13138_c2_1908_2720 259
825 3300050507 nmdc:mga05p37_157730_c2 nmdc:mga05p37_157730_c2_1263_2132 259
826 3300050507 nmdc:mga05p37_318323_c1 nmdc:mga05p37_318323_c1_830_1612 259
827 3300050507 nmdc:mga05p37_522911_c1 nmdc:mga05p37_522911_c1_13_804 259
828 3300050507 nmdc:mga05p37_65876_c2 nmdc:mga05p37_65876_c2_1807_2604 259
829 3300050507 nmdc:mga05p37_688926_c1 nmdc:mga05p37_688926_c1_20_799 259
830 3300050508 nmdc:mga09592_134411_c1 nmdc:mga09592_134411_c1_122_904 259
831 3300050509 nmdc:mga0qj67_256728_c1 nmdc:mga0qj67_256728_c1_90_872 259
832 3300050509 nmdc:mga0qj67_54043_c1 nmdc:mga0qj67_54043_c1_927_1709 259
833 3300050510 nmdc:mga06r32_207775_c1 nmdc:mga06r32_207775_c1_614_1396 259
834 3300050511 nmdc:mga08y16_161298_c1 nmdc:mga08y16_161298_c1_1059_1841 259
835 3300050512 nmdc:mga0n895_145294_c1 nmdc:mga0n895_145294_c1_796_1590 259
836 3300050512 nmdc:mga0n895_785299_c1 nmdc:mga0n895_785299_c1_88_882 259
837 3300050513 nmdc:mga0rr50_492596_c1 nmdc:mga0rr50_492596_c1_238_1026 259
838 3300050513 nmdc:mga0rr50_9855_c1 nmdc:mga0rr50_9855_c1_2541_3329 259
839 3300050514 nmdc:mga08x19_13_c1 nmdc:mga08x19_13_c1_2851_3639 259
840 3300050515 nmdc:mga0a205_22311_c1 nmdc:mga0a205_22311_c1_3576_4370 259
841 3300050515 nmdc:mga0a205_49266_c1 nmdc:mga0a205_49266_c1_2396_3175 259
842 3300050515 nmdc:mga0a205_519849_c1 nmdc:mga0a205_519849_c1_192_989 259
843 3300053142 Ga0500577_0000869 Ga0500577_0000869_4818_5639 259
844 3300054114 Ga0501084_0490654 Ga0501084_0490654_205_987 259
845 3300061734 Ga0530510_0032439 Ga0530510_0032439_1390_2172 259
846 3300000532 CNAas_1001219 CNAas_10012192 260
847 3300005444 Ga0070694_100650476 Ga0070694_1006504761 260
848 3300005471 Ga0070698_100033997 Ga0070698_1000339974 260
849 3300005549 Ga0070704_100210472 Ga0070704_1002104722 260
850 3300005719 Ga0068861_100000717 Ga0068861_1000007175 260
851 3300005985 Ga0081539_10006502 Ga0081539_100065023 260
852 3300006871 Ga0075434_100240066 Ga0075434_1002400662 260
853 3300025910 Ga0207684_10161537 Ga0207684_101615372 260
854 3300026118 Ga0207675_100007761 Ga0207675_1000077615 260
855 3300050512 nmdc:mga0n895_439170_c1 nmdc:mga0n895_439170_c1_297_1097 260

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01026

TatD_DNase

TatD related DNase

3

257

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2gzx-assembly2.cif.gz_B crystal structure of the tatd deoxyribonuclease mw0446 from staphylococcus aureus. northeast structural genomics consortium target zr237. 0.9703 3 256
1j6o-assembly1.cif.gz_A crystal structure of tatd-related deoxyribonuclease (tm0667) from thermotoga maritima at 1.8 a resolution 0.9686 1 260
2gzx-assembly2.cif.gz_B crystal structure of the tatd deoxyribonuclease mw0446 from staphylococcus aureus. northeast structural genomics consortium target zr237. 0.9591 3 256
1xwy-assembly1.cif.gz_A crystal structure of tatd deoxyribonuclease from escherichia coli k12 at 2.0 a resolution 0.9552 3 256
3rcm-assembly1.cif.gz_A crystal structure of efi target 500140:tatd family hydrolase from pseudomonas putida 0.9417 1 260
ID Description Score Start End Superfamily
1j6oA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9678 2 260 3.20.20.140
2gzxB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9676 3 256 3.20.20.140
2gzxB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9562 3 256 3.20.20.140
1xwyA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9552 3 256 3.20.20.140
1j6oA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9496 2 260 3.20.20.140
ID Description Score Start End GO Terms
AF-A0A7W1BZV2-F1-model_v4 TatD family hydrolase 0.9978 175 254 GO:0005829
GO:0016788
AF-A0A1H6LEW9-F1-model_v4 TatD family hydrolase 0.9938 173 257 GO:0005829
GO:0016788
AF-A0A838RV98-F1-model_v4 TatD family hydrolase 0.9937 1 256 GO:0004536
GO:0046872
AF-A0A419E412-F1-model_v4 Hydrolase TatD 0.9925 179 254 GO:0016788
AF-A0A831JR34-F1-model_v4 Uncharacterized protein 0.9912 176 254 GO:0005829
GO:0016788

Feature Viewer

pLDDT pTM Quality
96.41 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map