F483636
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 855 | 275 | 853 | 263 |
Family's Representative Sequence
| Representative Sequence | 3300048910|Ga0496107_0174394|Ga0496107_0174394_283_1218 |
| Length | 311 |
| Sequence | MFIDSHAHIDGPEFDADREEVIERARAAGVSTILNVGTGDPHSGVFERAVELGKKYESVYTAIGTHPHDARLYDDQAEDKIKSLVQSERVIAWGEIGLDFHYDNSPRDVQVEVFKRQLRAARDCDLPVVIHTRKAEPETIEILKSDYAGAECRGVFHCFSGGMELAQRAIELGFMISFSGIVTFKKADELRAVAKQVPLDRLLIETDCPYLSPIPYRGKRNEPAYVVEVARCLAGIHGVDIEEIARLTTENFRKFFSRKGAKTQSSSRVYILPLRLCAFAGEMSLPAIQGLSTSTSSSSRELGRRRGVCGD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2671180531 | Gemmata sp. SH-PL17 | Isolate | Unclassified |
| 2 | 3300000532 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300001426 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 | Metagenome | Rhizosphere |
| 4 | 3300001432 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 5 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 6 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 7 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 8 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 9 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 12 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 19 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 23 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 46 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 53 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 60 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 62 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 63 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 65 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 66 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 67 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 68 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 69 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 70 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 71 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 72 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 73 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 74 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 75 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 76 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 80 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 81 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 82 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 83 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 84 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 85 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 86 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 87 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 88 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 90 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 91 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 120 | 3300025223 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 171 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 174 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 175 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 176 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 177 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 178 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 179 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 180 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 181 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 182 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 183 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 184 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 185 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 186 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 187 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 188 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 189 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 190 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 191 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 192 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 193 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 194 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 195 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 196 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 197 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 198 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 199 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 200 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 201 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 202 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 203 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 204 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 205 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 206 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 207 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 208 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 209 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 210 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 211 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 212 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 213 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 214 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 215 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 216 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 217 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 218 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 219 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 220 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 230 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 231 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 232 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 233 | 3300049524 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control | Metagenome | Rhizosphere |
| 234 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 235 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 236 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 238 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 239 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 240 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 241 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 242 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 243 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 244 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 246 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 247 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 248 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 249 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 250 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 251 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 252 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 253 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 254 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 255 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 256 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 257 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 258 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 261 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 262 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 263 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 264 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 265 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 266 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 267 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 268 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 269 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 270 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 271 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 272 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 273 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 275 | 8007371054 | Clostridium sp. YIM B02515 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.77 |
| Metatranscriptomes | 0 |
| Isolates | 0.23 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.23 |
| Nodule | 0 |
| Rhizoplane | 0.58 |
| Rhizosphere | 97.66 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.52 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | CNAas_1001219 | 3300000532 | Bacteria | 2298 |
| 2 | JGI24030J14995_100170 | 3300001426 | Unclassified | 1773 |
| 3 | JGI24034J14986_101130 | 3300001432 | Unclassified | 1563 |
| 4 | JGI24748J21848_1000003 | 3300002074 | Bacteria | 323921 |
| 5 | JGI24034J26672_10000005 | 3300002239 | Bacteria | 404185 |
| 6 | JGI24751J29686_10000085 | 3300002459 | Bacteria | 52356 |
| 7 | JGI25406J46586_10000438 | 3300003203 | Bacteria | 19276 |
| 8 | JGI25406J46586_10006797 | 3300003203 | Bacteria | 5254 |
| 9 | JGI25406J46586_10011063 | 3300003203 | Unclassified | 3966 |
| 10 | Ga0065714_10064444 | 3300005288 | Bacteria | 94227 |
| 11 | Ga0065704_10004769 | 3300005289 | Bacteria | 3560 |
| 12 | Ga0065712_10010420 | 3300005290 | Unclassified | 3108 |
| 13 | Ga0065712_10067736 | 3300005290 | Bacteria | 94196 |
| 14 | Ga0065712_10125633 | 3300005290 | Bacteria | 1611 |
| 15 | Ga0065712_10242113 | 3300005290 | Bacteria | 981 |
| 16 | Ga0065715_10003956 | 3300005293 | Bacteria | 3758 |
| 17 | Ga0065715_10014485 | 3300005293 | Bacteria | 2224 |
| 18 | Ga0065715_10018531 | 3300005293 | Bacteria | 2202 |
| 19 | Ga0065715_10090715 | 3300005293 | Bacteria | 6575 |
| 20 | Ga0065715_10100860 | 3300005293 | Bacteria | 3260 |
| 21 | Ga0065715_10122203 | 3300005293 | Unclassified | 2188 |
| 22 | Ga0065715_10123337 | 3300005293 | Unclassified | 2168 |
| 23 | Ga0065707_10001462 | 3300005295 | Bacteria | 11811 |
| 24 | Ga0065707_10091531 | 3300005295 | Bacteria | 3926 |
| 25 | Ga0065707_10096313 | 3300005295 | Bacteria | 3281 |
| 26 | Ga0070658_10008799 | 3300005327 | Bacteria | 8113 |
| 27 | Ga0070676_10061106 | 3300005328 | Bacteria | 2239 |
| 28 | Ga0070690_100002320 | 3300005330 | Bacteria | 10217 |
| 29 | Ga0070690_100081286 | 3300005330 | Unclassified | 2120 |
| 30 | Ga0070690_100106789 | 3300005330 | Bacteria | 1863 |
| 31 | Ga0070690_100115287 | 3300005330 | Bacteria | 1797 |
| 32 | Ga0070670_100000057 | 3300005331 | Bacteria | 118540 |
| 33 | Ga0070670_100026732 | 3300005331 | Bacteria | 4964 |
| 34 | Ga0070670_100050310 | 3300005331 | Bacteria | 3581 |
| 35 | Ga0070670_100088040 | 3300005331 | Bacteria | 2669 |
| 36 | Ga0070670_100110634 | 3300005331 | Bacteria | 2367 |
| 37 | Ga0070670_100128392 | 3300005331 | Bacteria | 2188 |
| 38 | Ga0070670_100213711 | 3300005331 | Bacteria | 1677 |
| 39 | Ga0068869_100013570 | 3300005334 | Bacteria | 5422 |
| 40 | Ga0068869_100110724 | 3300005334 | Bacteria | 2089 |
| 41 | Ga0068869_100129407 | 3300005334 | Bacteria | 1939 |
| 42 | Ga0068869_100166919 | 3300005334 | Bacteria | 1717 |
| 43 | Ga0068869_100183434 | 3300005334 | Unclassified | 1642 |
| 44 | Ga0068869_100210339 | 3300005334 | Bacteria | 1537 |
| 45 | Ga0068869_100214733 | 3300005334 | Bacteria | 1522 |
| 46 | Ga0070666_10155874 | 3300005335 | Bacteria | 1595 |
| 47 | Ga0070680_100004835 | 3300005336 | Bacteria | 10143 |
| 48 | Ga0070680_100253433 | 3300005336 | Bacteria | 1488 |
| 49 | Ga0070680_100319717 | 3300005336 | Bacteria | 1317 |
| 50 | Ga0070680_100396025 | 3300005336 | Bacteria | 1177 |
| 51 | Ga0070682_100000068 | 3300005337 | Bacteria | 96186 |
| 52 | Ga0070682_100001206 | 3300005337 | Bacteria | 14741 |
| 53 | Ga0068868_100052164 | 3300005338 | Bacteria | 3220 |
| 54 | Ga0068868_100106440 | 3300005338 | Bacteria | 2275 |
| 55 | Ga0070660_100233421 | 3300005339 | Bacteria | 1497 |
| 56 | Ga0070689_100000292 | 3300005340 | Bacteria | 29087 |
| 57 | Ga0070689_100030290 | 3300005340 | Unclassified | 4107 |
| 58 | Ga0070689_100188181 | 3300005340 | Bacteria | 1680 |
| 59 | Ga0070689_100477160 | 3300005340 | Bacteria | 1065 |
| 60 | Ga0070687_100060679 | 3300005343 | Unclassified | 1996 |
| 61 | Ga0070661_100029084 | 3300005344 | Bacteria | 3987 |
| 62 | Ga0070661_100353317 | 3300005344 | Bacteria | 1154 |
| 63 | Ga0070692_10002955 | 3300005345 | Bacteria | 6761 |
| 64 | Ga0070692_10045813 | 3300005345 | Bacteria | 2257 |
| 65 | Ga0070692_10065754 | 3300005345 | Bacteria | 1921 |
| 66 | Ga0070668_100006439 | 3300005347 | Bacteria | 8707 |
| 67 | Ga0070669_100002525 | 3300005353 | Bacteria | 13228 |
| 68 | Ga0070669_100010925 | 3300005353 | Bacteria | 6447 |
| 69 | Ga0070669_100047062 | 3300005353 | Unclassified | 3146 |
| 70 | Ga0070669_100118096 | 3300005353 | Bacteria | 2020 |
| 71 | Ga0070669_100122369 | 3300005353 | Bacteria | 1987 |
| 72 | Ga0070675_100096163 | 3300005354 | Bacteria | 2488 |
| 73 | Ga0070675_100112115 | 3300005354 | Unclassified | 2309 |
| 74 | Ga0070675_100392041 | 3300005354 | Unclassified | 1237 |
| 75 | Ga0070671_100005420 | 3300005355 | Bacteria | 10177 |
| 76 | Ga0070671_100030391 | 3300005355 | Bacteria | 4457 |
| 77 | Ga0070671_100331782 | 3300005355 | Bacteria | 1297 |
| 78 | Ga0070671_100477977 | 3300005355 | Bacteria | 1070 |
| 79 | Ga0070671_100557814 | 3300005355 | Bacteria | 988 |
| 80 | Ga0070674_100541778 | 3300005356 | Viruses | 975 |
| 81 | Ga0070673_100051706 | 3300005364 | Bacteria | 3220 |
| 82 | Ga0070673_100192708 | 3300005364 | Bacteria | 1751 |
| 83 | Ga0070673_100332014 | 3300005364 | Bacteria | 1345 |
| 84 | Ga0070688_100131439 | 3300005365 | Bacteria | 1689 |
| 85 | Ga0070659_100002999 | 3300005366 | Bacteria | 12012 |
| 86 | Ga0070667_100067474 | 3300005367 | Bacteria | 3041 |
| 87 | Ga0070667_100183140 | 3300005367 | Unclassified | 1853 |
| 88 | Ga0070703_10000036 | 3300005406 | Bacteria | 65827 |
| 89 | Ga0070701_10037404 | 3300005438 | Bacteria | 2450 |
| 90 | Ga0070701_10248038 | 3300005438 | Bacteria | 1074 |
| 91 | Ga0070701_10470917 | 3300005438 | Unclassified | 810 |
| 92 | Ga0070705_100144075 | 3300005440 | Bacteria | 1572 |
| 93 | Ga0070705_100256924 | 3300005440 | Bacteria | 1230 |
| 94 | Ga0070705_100270300 | 3300005440 | Bacteria | 1203 |
| 95 | Ga0070705_100420960 | 3300005440 | Unclassified | 994 |
| 96 | Ga0070700_100000305 | 3300005441 | Bacteria | 25711 |
| 97 | Ga0070700_100013026 | 3300005441 | Bacteria | 4663 |
| 98 | Ga0070700_100013485 | 3300005441 | Bacteria | 4591 |
| 99 | Ga0070700_100066109 | 3300005441 | Unclassified | 2294 |
| 100 | Ga0070700_100111621 | 3300005441 | Bacteria | 1819 |
| 101 | Ga0070700_100268723 | 3300005441 | Unclassified | 1231 |
| 102 | Ga0070700_100483850 | 3300005441 | Unclassified | 949 |
| 103 | Ga0070694_100003401 | 3300005444 | Bacteria | 9536 |
| 104 | Ga0070694_100012648 | 3300005444 | Bacteria | 5254 |
| 105 | Ga0070694_100025987 | 3300005444 | Bacteria | 3792 |
| 106 | Ga0070694_100049475 | 3300005444 | Bacteria | 2831 |
| 107 | Ga0070694_100053308 | 3300005444 | Bacteria | 2737 |
| 108 | Ga0070694_100157885 | 3300005444 | Bacteria | 1662 |
| 109 | Ga0070694_100650476 | 3300005444 | Unclassified | 853 |
| 110 | Ga0070708_100000002 | 3300005445 | Bacteria | 195857 |
| 111 | Ga0070708_100272617 | 3300005445 | Bacteria | 1592 |
| 112 | Ga0070708_100313686 | 3300005445 | Bacteria | 1477 |
| 113 | Ga0070708_100514079 | 3300005445 | Unclassified | 1129 |
| 114 | Ga0070662_100122203 | 3300005457 | Unclassified | 1997 |
| 115 | Ga0070681_10000041 | 3300005458 | Bacteria | 89178 |
| 116 | Ga0070681_10018062 | 3300005458 | Bacteria | 7048 |
| 117 | Ga0070681_10029594 | 3300005458 | Bacteria | 5499 |
| 118 | Ga0070681_10056272 | 3300005458 | Bacteria | 3915 |
| 119 | Ga0070681_10058592 | 3300005458 | Bacteria | 3831 |
| 120 | Ga0070681_10408994 | 3300005458 | Bacteria | 1269 |
| 121 | Ga0068867_100270907 | 3300005459 | Bacteria | 1388 |
| 122 | Ga0068867_100513930 | 3300005459 | Bacteria | 1032 |
| 123 | Ga0070706_100000002 | 3300005467 | Bacteria | 326510 |
| 124 | Ga0070706_100005846 | 3300005467 | Bacteria | 11671 |
| 125 | Ga0070706_100013151 | 3300005467 | Bacteria | 7658 |
| 126 | Ga0070706_100018943 | 3300005467 | Bacteria | 6349 |
| 127 | Ga0070706_100060029 | 3300005467 | Bacteria | 3510 |
| 128 | Ga0070706_100065565 | 3300005467 | Bacteria | 3359 |
| 129 | Ga0070706_100854147 | 3300005467 | Bacteria | 841 |
| 130 | Ga0070707_100000167 | 3300005468 | Bacteria | 63391 |
| 131 | Ga0070707_100003979 | 3300005468 | Bacteria | 13913 |
| 132 | Ga0070707_100007291 | 3300005468 | Bacteria | 10269 |
| 133 | Ga0070707_100021845 | 3300005468 | Bacteria | 6050 |
| 134 | Ga0070707_100144200 | 3300005468 | Bacteria | 2318 |
| 135 | Ga0070707_100276880 | 3300005468 | Unclassified | 1631 |
| 136 | Ga0070707_100378087 | 3300005468 | Bacteria | 1376 |
| 137 | Ga0070698_100000164 | 3300005471 | Bacteria | 61194 |
| 138 | Ga0070698_100000916 | 3300005471 | Bacteria | 32268 |
| 139 | Ga0070698_100002314 | 3300005471 | Bacteria | 21075 |
| 140 | Ga0070698_100004907 | 3300005471 | Bacteria | 14674 |
| 141 | Ga0070698_100010410 | 3300005471 | Bacteria | 9933 |
| 142 | Ga0070698_100033807 | 3300005471 | Bacteria | 5297 |
| 143 | Ga0070698_100033997 | 3300005471 | Bacteria | 5281 |
| 144 | Ga0070698_100059613 | 3300005471 | Unclassified | 3854 |
| 145 | Ga0070698_100071065 | 3300005471 | Bacteria | 3491 |
| 146 | Ga0070698_100138191 | 3300005471 | Bacteria | 2389 |
| 147 | Ga0070698_100874239 | 3300005471 | Bacteria | 844 |
| 148 | Ga0070699_100000169 | 3300005518 | Bacteria | 63052 |
| 149 | Ga0070699_100000483 | 3300005518 | Bacteria | 37967 |
| 150 | Ga0070699_100059794 | 3300005518 | Unclassified | 3301 |
| 151 | Ga0070699_100061167 | 3300005518 | Bacteria | 3264 |
| 152 | Ga0070699_100136443 | 3300005518 | Bacteria | 2164 |
| 153 | Ga0070699_100198725 | 3300005518 | Bacteria | 1782 |
| 154 | Ga0070699_100310977 | 3300005518 | Bacteria | 1414 |
| 155 | Ga0070679_100000074 | 3300005530 | Bacteria | 74890 |
| 156 | Ga0070679_100014621 | 3300005530 | Bacteria | 7543 |
| 157 | Ga0070697_100000071 | 3300005536 | Bacteria | 80945 |
| 158 | Ga0070697_100006099 | 3300005536 | Bacteria | 9323 |
| 159 | Ga0070697_100008492 | 3300005536 | Bacteria | 8015 |
| 160 | Ga0070697_100013343 | 3300005536 | Bacteria | 6444 |
| 161 | Ga0070697_100027095 | 3300005536 | Bacteria | 4583 |
| 162 | Ga0070697_100051154 | 3300005536 | Bacteria | 3356 |
| 163 | Ga0070697_100058589 | 3300005536 | Bacteria | 3135 |
| 164 | Ga0070697_100203799 | 3300005536 | Bacteria | 1682 |
| 165 | Ga0070697_100351578 | 3300005536 | Bacteria | 1273 |
| 166 | Ga0070697_100656103 | 3300005536 | Bacteria | 924 |
| 167 | Ga0068853_100009751 | 3300005539 | Bacteria | 7746 |
| 168 | Ga0068853_100018350 | 3300005539 | Bacteria | 5790 |
| 169 | Ga0068853_100033867 | 3300005539 | Bacteria | 4334 |
| 170 | Ga0068853_100110758 | 3300005539 | Bacteria | 2438 |
| 171 | Ga0070672_100406543 | 3300005543 | Bacteria | 1167 |
| 172 | Ga0070686_100006607 | 3300005544 | Bacteria | 6455 |
| 173 | Ga0070686_100009506 | 3300005544 | Bacteria | 5466 |
| 174 | Ga0070686_100062493 | 3300005544 | Bacteria | 2410 |
| 175 | Ga0070686_100459957 | 3300005544 | Bacteria | 980 |
| 176 | Ga0070695_100094994 | 3300005545 | Bacteria | 1997 |
| 177 | Ga0070695_100111012 | 3300005545 | Bacteria | 1861 |
| 178 | Ga0070695_100374524 | 3300005545 | Bacteria | 1073 |
| 179 | Ga0070695_100434657 | 3300005545 | Bacteria | 1002 |
| 180 | Ga0070696_100014172 | 3300005546 | Bacteria | 5349 |
| 181 | Ga0070696_100017420 | 3300005546 | Bacteria | 4848 |
| 182 | Ga0070696_100133512 | 3300005546 | Unclassified | 1809 |
| 183 | Ga0070696_100259934 | 3300005546 | Bacteria | 1316 |
| 184 | Ga0070696_100282769 | 3300005546 | Bacteria | 1265 |
| 185 | Ga0070693_100015794 | 3300005547 | Bacteria | 3895 |
| 186 | Ga0070693_100204293 | 3300005547 | Bacteria | 1285 |
| 187 | Ga0070704_100003508 | 3300005549 | Bacteria | 9009 |
| 188 | Ga0070704_100035319 | 3300005549 | Unclassified | 3397 |
| 189 | Ga0070704_100035616 | 3300005549 | Unclassified | 3384 |
| 190 | Ga0070704_100092735 | 3300005549 | Bacteria | 2255 |
| 191 | Ga0070704_100210472 | 3300005549 | Bacteria | 1575 |
| 192 | Ga0070704_100367951 | 3300005549 | Bacteria | 1218 |
| 193 | Ga0070704_100409901 | 3300005549 | Bacteria | 1158 |
| 194 | Ga0070704_100504389 | 3300005549 | Bacteria | 1050 |
| 195 | Ga0068855_100605770 | 3300005563 | Bacteria | 1181 |
| 196 | Ga0070664_100000280 | 3300005564 | Bacteria | 36774 |
| 197 | Ga0070664_100040842 | 3300005564 | Bacteria | 3913 |
| 198 | Ga0070664_100524113 | 3300005564 | Bacteria | 1094 |
| 199 | Ga0068857_100579234 | 3300005577 | Bacteria | 1059 |
| 200 | Ga0068854_100056328 | 3300005578 | Bacteria | 2833 |
| 201 | Ga0068854_100217479 | 3300005578 | Bacteria | 1510 |
| 202 | Ga0068854_100234550 | 3300005578 | Unclassified | 1458 |
| 203 | Ga0068854_100357432 | 3300005578 | Bacteria | 1197 |
| 204 | Ga0068854_100666344 | 3300005578 | Bacteria | 895 |
| 205 | Ga0070702_100002032 | 3300005615 | Bacteria | 8549 |
| 206 | Ga0070702_100028198 | 3300005615 | Archaea | 3041 |
| 207 | Ga0070702_100065890 | 3300005615 | Bacteria | 2123 |
| 208 | Ga0068852_100140694 | 3300005616 | Bacteria | 2233 |
| 209 | Ga0068852_100149455 | 3300005616 | Bacteria | 2171 |
| 210 | Ga0068852_100313932 | 3300005616 | Bacteria | 1520 |
| 211 | Ga0068852_100540037 | 3300005616 | Bacteria | 1165 |
| 212 | Ga0068852_100643349 | 3300005616 | Unclassified | 1067 |
| 213 | Ga0068859_100018658 | 3300005617 | Bacteria | 6973 |
| 214 | Ga0068859_100026938 | 3300005617 | Bacteria | 5766 |
| 215 | Ga0068859_100033363 | 3300005617 | Bacteria | 5169 |
| 216 | Ga0068859_100035651 | 3300005617 | Bacteria | 4992 |
| 217 | Ga0068859_100045900 | 3300005617 | Bacteria | 4388 |
| 218 | Ga0068859_100061173 | 3300005617 | Bacteria | 3794 |
| 219 | Ga0068859_100103052 | 3300005617 | Bacteria | 2911 |
| 220 | Ga0068859_100109989 | 3300005617 | Bacteria | 2817 |
| 221 | Ga0068859_100119379 | 3300005617 | Bacteria | 2703 |
| 222 | Ga0068859_100175866 | 3300005617 | Bacteria | 2222 |
| 223 | Ga0068859_100179404 | 3300005617 | Bacteria | 2200 |
| 224 | Ga0068859_100189302 | 3300005617 | Bacteria | 2142 |
| 225 | Ga0068859_100195755 | 3300005617 | Unclassified | 2105 |
| 226 | Ga0068859_100206524 | 3300005617 | Unclassified | 2049 |
| 227 | Ga0068859_100261688 | 3300005617 | Bacteria | 1821 |
| 228 | Ga0068859_100280038 | 3300005617 | Bacteria | 1760 |
| 229 | Ga0068859_100457867 | 3300005617 | Bacteria | 1372 |
| 230 | Ga0068859_100577644 | 3300005617 | Bacteria | 1218 |
| 231 | Ga0068859_100810579 | 3300005617 | Bacteria | 1023 |
| 232 | Ga0068864_100022935 | 3300005618 | Bacteria | 5237 |
| 233 | Ga0068864_100033299 | 3300005618 | Bacteria | 4381 |
| 234 | Ga0068864_100045602 | 3300005618 | Unclassified | 3760 |
| 235 | Ga0068864_100207507 | 3300005618 | Bacteria | 1802 |
| 236 | Ga0068864_100439737 | 3300005618 | Bacteria | 1246 |
| 237 | Ga0068866_10053147 | 3300005718 | Bacteria | 2070 |
| 238 | Ga0068866_10128428 | 3300005718 | Bacteria | 1438 |
| 239 | Ga0068866_10137060 | 3300005718 | Bacteria | 1400 |
| 240 | Ga0068861_100000717 | 3300005719 | Bacteria | 19814 |
| 241 | Ga0068861_100029995 | 3300005719 | Bacteria | 3983 |
| 242 | Ga0068861_100097003 | 3300005719 | Bacteria | 2337 |
| 243 | Ga0068861_100121439 | 3300005719 | Bacteria | 2108 |
| 244 | Ga0068861_100181743 | 3300005719 | Bacteria | 1751 |
| 245 | Ga0068861_100211690 | 3300005719 | Bacteria | 1633 |
| 246 | Ga0068861_100273294 | 3300005719 | Bacteria | 1452 |
| 247 | Ga0068861_100741301 | 3300005719 | Bacteria | 917 |
| 248 | Ga0068851_10095564 | 3300005834 | Bacteria | 1570 |
| 249 | Ga0068870_10030552 | 3300005840 | Bacteria | 2723 |
| 250 | Ga0068870_10178023 | 3300005840 | Bacteria | 1274 |
| 251 | Ga0068870_10370093 | 3300005840 | Bacteria | 925 |
| 252 | Ga0068863_100018375 | 3300005841 | Bacteria | 6691 |
| 253 | Ga0068863_100037936 | 3300005841 | Unclassified | 4586 |
| 254 | Ga0068863_100044808 | 3300005841 | Unclassified | 4198 |
| 255 | Ga0068863_100046793 | 3300005841 | Bacteria | 4106 |
| 256 | Ga0068863_100047679 | 3300005841 | Bacteria | 4063 |
| 257 | Ga0068863_100061232 | 3300005841 | Unclassified | 3558 |
| 258 | Ga0068863_100082478 | 3300005841 | Bacteria | 3047 |
| 259 | Ga0068863_100362025 | 3300005841 | Bacteria | 1414 |
| 260 | Ga0068863_100596828 | 3300005841 | Bacteria | 1093 |
| 261 | Ga0068858_100000134 | 3300005842 | Bacteria | 77566 |
| 262 | Ga0068858_100014863 | 3300005842 | Bacteria | 7323 |
| 263 | Ga0068858_100027082 | 3300005842 | Bacteria | 5325 |
| 264 | Ga0068858_100041991 | 3300005842 | Bacteria | 4240 |
| 265 | Ga0068858_100056480 | 3300005842 | Unclassified | 3628 |
| 266 | Ga0068858_100129545 | 3300005842 | Unclassified | 2365 |
| 267 | Ga0068858_100138359 | 3300005842 | Bacteria | 2286 |
| 268 | Ga0068858_100166619 | 3300005842 | Bacteria | 2076 |
| 269 | Ga0068858_100175387 | 3300005842 | Bacteria | 2023 |
| 270 | Ga0068858_100462773 | 3300005842 | Bacteria | 1223 |
| 271 | Ga0068860_100006276 | 3300005843 | Bacteria | 11937 |
| 272 | Ga0068860_100043714 | 3300005843 | Bacteria | 4272 |
| 273 | Ga0068860_100107672 | 3300005843 | Bacteria | 2664 |
| 274 | Ga0068860_100109223 | 3300005843 | Bacteria | 2643 |
| 275 | Ga0068860_100112769 | 3300005843 | Bacteria | 2600 |
| 276 | Ga0068860_100191474 | 3300005843 | Unclassified | 1979 |
| 277 | Ga0068860_100234441 | 3300005843 | Unclassified | 1784 |
| 278 | Ga0068860_100236824 | 3300005843 | Bacteria | 1775 |
| 279 | Ga0068860_100272955 | 3300005843 | Bacteria | 1651 |
| 280 | Ga0068860_100543992 | 3300005843 | Bacteria | 1163 |
| 281 | Ga0068862_100101196 | 3300005844 | Unclassified | 2521 |
| 282 | Ga0068862_100118142 | 3300005844 | Bacteria | 2334 |
| 283 | Ga0068862_100209752 | 3300005844 | Bacteria | 1760 |
| 284 | Ga0081539_10000731 | 3300005985 | Bacteria | 65764 |
| 285 | Ga0081539_10000931 | 3300005985 | Bacteria | 54965 |
| 286 | Ga0081539_10002625 | 3300005985 | Bacteria | 24575 |
| 287 | Ga0081539_10006502 | 3300005985 | Bacteria | 11175 |
| 288 | Ga0070715_10000018 | 3300006163 | Bacteria | 124487 |
| 289 | Ga0070716_100000017 | 3300006173 | Bacteria | 88957 |
| 290 | Ga0070716_100033150 | 3300006173 | Bacteria | 2823 |
| 291 | Ga0070716_100298041 | 3300006173 | Bacteria | 1120 |
| 292 | Ga0097621_100001570 | 3300006237 | Bacteria | 15609 |
| 293 | Ga0097621_100003941 | 3300006237 | Bacteria | 10284 |
| 294 | Ga0097621_100025494 | 3300006237 | Bacteria | 4627 |
| 295 | Ga0097621_100074871 | 3300006237 | Bacteria | 2805 |
| 296 | Ga0097621_100235129 | 3300006237 | Bacteria | 1600 |
| 297 | Ga0068871_100001715 | 3300006358 | Bacteria | 14742 |
| 298 | Ga0068871_100003493 | 3300006358 | Bacteria | 10806 |
| 299 | Ga0068871_100004902 | 3300006358 | Bacteria | 9349 |
| 300 | Ga0068871_100458521 | 3300006358 | Bacteria | 1144 |
| 301 | Ga0075428_100308669 | 3300006844 | Bacteria | 1700 |
| 302 | Ga0075428_100401259 | 3300006844 | Bacteria | 1469 |
| 303 | Ga0075428_100506546 | 3300006844 | Bacteria | 1291 |
| 304 | Ga0075428_100529982 | 3300006844 | Bacteria | 1259 |
| 305 | Ga0075428_100654440 | 3300006844 | Bacteria | 1120 |
| 306 | Ga0075430_100050628 | 3300006846 | Bacteria | 3501 |
| 307 | Ga0075430_100164322 | 3300006846 | Unclassified | 1847 |
| 308 | Ga0075431_100231300 | 3300006847 | Bacteria | 1883 |
| 309 | Ga0075433_10023132 | 3300006852 | Bacteria | 5227 |
| 310 | Ga0075433_10178463 | 3300006852 | Bacteria | 1889 |
| 311 | Ga0075433_10238450 | 3300006852 | Bacteria | 1614 |
| 312 | Ga0075433_10312900 | 3300006852 | Unclassified | 1390 |
| 313 | Ga0075433_10603420 | 3300006852 | Bacteria | 964 |
| 314 | Ga0075434_100195837 | 3300006871 | Bacteria | 2041 |
| 315 | Ga0075434_100240066 | 3300006871 | Unclassified | 1832 |
| 316 | Ga0075434_100252270 | 3300006871 | Bacteria | 1784 |
| 317 | Ga0075434_100398827 | 3300006871 | Bacteria | 1397 |
| 318 | Ga0075434_100479746 | 3300006871 | Bacteria | 1265 |
| 319 | Ga0075429_100116667 | 3300006880 | Bacteria | 2333 |
| 320 | Ga0075429_100307330 | 3300006880 | Bacteria | 1388 |
| 321 | Ga0068865_100030118 | 3300006881 | Bacteria | 3607 |
| 322 | Ga0068865_100031323 | 3300006881 | Bacteria | 3545 |
| 323 | Ga0068865_100080047 | 3300006881 | Bacteria | 2342 |
| 324 | Ga0075436_100000011 | 3300006914 | Bacteria | 208094 |
| 325 | Ga0075436_100325661 | 3300006914 | Bacteria | 1104 |
| 326 | Ga0075436_100386850 | 3300006914 | Bacteria | 1012 |
| 327 | Ga0097620_100018658 | 3300006931 | Bacteria | 6973 |
| 328 | Ga0097620_100026938 | 3300006931 | Bacteria | 5766 |
| 329 | Ga0097620_100033364 | 3300006931 | Bacteria | 5169 |
| 330 | Ga0097620_100035652 | 3300006931 | Bacteria | 4992 |
| 331 | Ga0097620_100045900 | 3300006931 | Bacteria | 4388 |
| 332 | Ga0097620_100061173 | 3300006931 | Bacteria | 3794 |
| 333 | Ga0097620_100103046 | 3300006931 | Bacteria | 2911 |
| 334 | Ga0097620_100109983 | 3300006931 | Bacteria | 2817 |
| 335 | Ga0097620_100119364 | 3300006931 | Bacteria | 2703 |
| 336 | Ga0097620_100175870 | 3300006931 | Bacteria | 2222 |
| 337 | Ga0097620_100179393 | 3300006931 | Bacteria | 2200 |
| 338 | Ga0097620_100189300 | 3300006931 | Bacteria | 2142 |
| 339 | Ga0097620_100195762 | 3300006931 | Unclassified | 2105 |
| 340 | Ga0097620_100206534 | 3300006931 | Unclassified | 2049 |
| 341 | Ga0097620_100261674 | 3300006931 | Bacteria | 1821 |
| 342 | Ga0097620_100280047 | 3300006931 | Bacteria | 1760 |
| 343 | Ga0097620_100457887 | 3300006931 | Bacteria | 1372 |
| 344 | Ga0097620_100577642 | 3300006931 | Bacteria | 1218 |
| 345 | Ga0097620_100810591 | 3300006931 | Bacteria | 1023 |
| 346 | Ga0075435_100009513 | 3300007076 | Bacteria | 7043 |
| 347 | Ga0099794_10027450 | 3300007265 | Unclassified | 2639 |
| 348 | Ga0105240_10041387 | 3300009093 | Bacteria | 5881 |
| 349 | Ga0111539_10001784 | 3300009094 | Bacteria | 28601 |
| 350 | Ga0111539_10098886 | 3300009094 | Bacteria | 3427 |
| 351 | Ga0111539_10131725 | 3300009094 | Bacteria | 2928 |
| 352 | Ga0111539_10179811 | 3300009094 | Bacteria | 2471 |
| 353 | Ga0105245_10094357 | 3300009098 | Bacteria | 2758 |
| 354 | Ga0105245_10187351 | 3300009098 | Bacteria | 1980 |
| 355 | Ga0105245_10342591 | 3300009098 | Bacteria | 1479 |
| 356 | Ga0105245_10886819 | 3300009098 | Bacteria | 933 |
| 357 | Ga0105247_10000022 | 3300009101 | Bacteria | 219796 |
| 358 | Ga0105247_10003696 | 3300009101 | Bacteria | 9931 |
| 359 | Ga0105247_10041404 | 3300009101 | Unclassified | 2819 |
| 360 | Ga0105247_10042199 | 3300009101 | Bacteria | 2793 |
| 361 | Ga0105247_10056432 | 3300009101 | Unclassified | 2425 |
| 362 | Ga0105247_10416345 | 3300009101 | Bacteria | 961 |
| 363 | Ga0114129_10077095 | 3300009147 | Bacteria | 4638 |
| 364 | Ga0114129_10128631 | 3300009147 | Bacteria | 3481 |
| 365 | Ga0114129_10169017 | 3300009147 | Bacteria | 2982 |
| 366 | Ga0114129_10198008 | 3300009147 | Unclassified | 2723 |
| 367 | Ga0114129_10273284 | 3300009147 | Bacteria | 2260 |
| 368 | Ga0114129_10399162 | 3300009147 | Bacteria | 1812 |
| 369 | Ga0114129_10489936 | 3300009147 | Bacteria | 1607 |
| 370 | Ga0105243_10000102 | 3300009148 | Bacteria | 97833 |
| 371 | Ga0105243_10000207 | 3300009148 | Bacteria | 68914 |
| 372 | Ga0105243_10040911 | 3300009148 | Unclassified | 3623 |
| 373 | Ga0105243_10110958 | 3300009148 | Unclassified | 2295 |
| 374 | Ga0105243_10219470 | 3300009148 | Bacteria | 1680 |
| 375 | Ga0105243_10231840 | 3300009148 | Unclassified | 1638 |
| 376 | Ga0105243_10311564 | 3300009148 | Bacteria | 1430 |
| 377 | Ga0105243_10704469 | 3300009148 | Bacteria | 985 |
| 378 | Ga0105241_10019871 | 3300009174 | Unclassified | 4957 |
| 379 | Ga0105241_10779524 | 3300009174 | Bacteria | 879 |
| 380 | Ga0105242_10000279 | 3300009176 | Bacteria | 40655 |
| 381 | Ga0105242_10000807 | 3300009176 | Bacteria | 24281 |
| 382 | Ga0105242_10005822 | 3300009176 | Bacteria | 9493 |
| 383 | Ga0105242_10108836 | 3300009176 | Bacteria | 2359 |
| 384 | Ga0105242_10155864 | 3300009176 | Bacteria | 1995 |
| 385 | Ga0105248_10004786 | 3300009177 | Bacteria | 14983 |
| 386 | Ga0105248_10013500 | 3300009177 | Bacteria | 8993 |
| 387 | Ga0105248_10116314 | 3300009177 | Unclassified | 3016 |
| 388 | Ga0105248_10130327 | 3300009177 | Bacteria | 2837 |
| 389 | Ga0105248_10190150 | 3300009177 | Bacteria | 2313 |
| 390 | Ga0105248_10312045 | 3300009177 | Bacteria | 1771 |
| 391 | Ga0105248_10437898 | 3300009177 | Bacteria | 1472 |
| 392 | Ga0105248_10526596 | 3300009177 | Bacteria | 1333 |
| 393 | Ga0105248_10787017 | 3300009177 | Bacteria | 1073 |
| 394 | Ga0105248_10879568 | 3300009177 | Unclassified | 1012 |
| 395 | Ga0105237_10034027 | 3300009545 | Bacteria | 5161 |
| 396 | Ga0105237_10073202 | 3300009545 | Bacteria | 3419 |
| 397 | Ga0105237_10322546 | 3300009545 | Bacteria | 1548 |
| 398 | Ga0105238_10009968 | 3300009551 | Bacteria | 9527 |
| 399 | Ga0105238_10013272 | 3300009551 | Bacteria | 8313 |
| 400 | Ga0105249_10000254 | 3300009553 | Bacteria | 58502 |
| 401 | Ga0105249_10074481 | 3300009553 | Bacteria | 3142 |
| 402 | Ga0105249_10159769 | 3300009553 | Bacteria | 2177 |
| 403 | Ga0105249_10180798 | 3300009553 | Bacteria | 2052 |
| 404 | Ga0105249_10192297 | 3300009553 | Bacteria | 1992 |
| 405 | Ga0105249_10487386 | 3300009553 | Bacteria | 1276 |
| 406 | Ga0105249_10679044 | 3300009553 | Unclassified | 1089 |
| 407 | Ga0105239_10135754 | 3300010375 | Bacteria | 2739 |
| 408 | Ga0105239_10352157 | 3300010375 | Unclassified | 1662 |
| 409 | Ga0105239_10601699 | 3300010375 | Bacteria | 1254 |
| 410 | Ga0105246_10012997 | 3300011119 | Bacteria | 5210 |
| 411 | Ga0105246_10186646 | 3300011119 | Viruses | 1601 |
| 412 | Ga0105246_10253604 | 3300011119 | Bacteria | 1398 |
| 413 | Ga0157373_10004608 | 3300013100 | Bacteria | 10368 |
| 414 | Ga0157373_10172215 | 3300013100 | Bacteria | 1523 |
| 415 | Ga0157373_10222501 | 3300013100 | Unclassified | 1332 |
| 416 | Ga0157371_10557392 | 3300013102 | Unclassified | 850 |
| 417 | Ga0157369_10365050 | 3300013105 | Unclassified | 1499 |
| 418 | Ga0157374_10037875 | 3300013296 | Bacteria | 4430 |
| 419 | Ga0157374_10173327 | 3300013296 | Bacteria | 2105 |
| 420 | Ga0157378_10000191 | 3300013297 | Bacteria | 59071 |
| 421 | Ga0157378_10009723 | 3300013297 | Bacteria | 8377 |
| 422 | Ga0157378_10014643 | 3300013297 | Bacteria | 6867 |
| 423 | Ga0157378_10024594 | 3300013297 | Bacteria | 5302 |
| 424 | Ga0157378_10033984 | 3300013297 | Bacteria | 4510 |
| 425 | Ga0157378_10085582 | 3300013297 | Bacteria | 2856 |
| 426 | Ga0157378_10092551 | 3300013297 | Unclassified | 2751 |
| 427 | Ga0157378_10147662 | 3300013297 | Bacteria | 2188 |
| 428 | Ga0157378_10231787 | 3300013297 | Bacteria | 1760 |
| 429 | Ga0157378_10260632 | 3300013297 | Bacteria | 1663 |
| 430 | Ga0157378_10306078 | 3300013297 | Bacteria | 1540 |
| 431 | Ga0157378_10505085 | 3300013297 | Unclassified | 1208 |
| 432 | Ga0157378_10818482 | 3300013297 | Bacteria | 958 |
| 433 | Ga0163162_10000179 | 3300013306 | Bacteria | 58502 |
| 434 | Ga0163162_10012064 | 3300013306 | Bacteria | 8429 |
| 435 | Ga0163162_10015538 | 3300013306 | Bacteria | 7438 |
| 436 | Ga0163162_10038965 | 3300013306 | Unclassified | 4745 |
| 437 | Ga0163162_10042270 | 3300013306 | Unclassified | 4561 |
| 438 | Ga0163162_10075719 | 3300013306 | Bacteria | 3426 |
| 439 | Ga0163162_10082924 | 3300013306 | Bacteria | 3279 |
| 440 | Ga0163162_10124137 | 3300013306 | Unclassified | 2687 |
| 441 | Ga0163162_10238326 | 3300013306 | Bacteria | 1950 |
| 442 | Ga0163162_10320613 | 3300013306 | Bacteria | 1682 |
| 443 | Ga0163162_10440929 | 3300013306 | Bacteria | 1434 |
| 444 | Ga0163162_10555069 | 3300013306 | Bacteria | 1277 |
| 445 | Ga0163162_10594381 | 3300013306 | Bacteria | 1233 |
| 446 | Ga0157372_10043475 | 3300013307 | Unclassified | 4974 |
| 447 | Ga0157372_10044452 | 3300013307 | Bacteria | 4922 |
| 448 | Ga0157372_10108256 | 3300013307 | Bacteria | 3180 |
| 449 | Ga0157375_10004435 | 3300013308 | Bacteria | 12188 |
| 450 | Ga0157375_10021549 | 3300013308 | Bacteria | 5912 |
| 451 | Ga0157375_10023277 | 3300013308 | Bacteria | 5713 |
| 452 | Ga0157375_10066328 | 3300013308 | Bacteria | 3603 |
| 453 | Ga0157375_10093322 | 3300013308 | Unclassified | 3076 |
| 454 | Ga0157375_10463376 | 3300013308 | Bacteria | 1433 |
| 455 | Ga0157375_10633756 | 3300013308 | Bacteria | 1226 |
| 456 | Ga0163163_10000184 | 3300014325 | Bacteria | 64203 |
| 457 | Ga0163163_10004533 | 3300014325 | Bacteria | 11860 |
| 458 | Ga0163163_10005720 | 3300014325 | Bacteria | 10783 |
| 459 | Ga0163163_10012406 | 3300014325 | Bacteria | 7762 |
| 460 | Ga0163163_10024208 | 3300014325 | Bacteria | 5776 |
| 461 | Ga0163163_10104265 | 3300014325 | Unclassified | 2861 |
| 462 | Ga0163163_10204687 | 3300014325 | Unclassified | 2022 |
| 463 | Ga0163163_10633934 | 3300014325 | Bacteria | 1132 |
| 464 | Ga0157380_10000627 | 3300014326 | Bacteria | 21695 |
| 465 | Ga0157380_10003949 | 3300014326 | Bacteria | 10238 |
| 466 | Ga0157380_10006388 | 3300014326 | Bacteria | 8297 |
| 467 | Ga0157380_10016724 | 3300014326 | Bacteria | 5417 |
| 468 | Ga0157380_10047258 | 3300014326 | Bacteria | 3385 |
| 469 | Ga0157380_11016156 | 3300014326 | Bacteria | 863 |
| 470 | Ga0157377_10109087 | 3300014745 | Bacteria | 1661 |
| 471 | Ga0157377_10355611 | 3300014745 | Bacteria | 984 |
| 472 | Ga0157379_10049363 | 3300014968 | Bacteria | 3758 |
| 473 | Ga0157379_10090990 | 3300014968 | Unclassified | 2737 |
| 474 | Ga0157379_10396728 | 3300014968 | Bacteria | 1268 |
| 475 | Ga0157376_10015880 | 3300014969 | Bacteria | 5701 |
| 476 | Ga0157376_10038847 | 3300014969 | Unclassified | 3876 |
| 477 | Ga0157376_10566630 | 3300014969 | Bacteria | 1126 |
| 478 | Ga0163161_10022258 | 3300017792 | Bacteria | 4461 |
| 479 | Ga0163161_10118375 | 3300017792 | Bacteria | 1988 |
| 480 | Ga0163161_10174222 | 3300017792 | Bacteria | 1646 |
| 481 | Ga0163161_10343028 | 3300017792 | Unclassified | 1185 |
| 482 | Ga0213876_10000043 | 3300021384 | Bacteria | 162257 |
| 483 | Ga0213876_10000228 | 3300021384 | Bacteria | 55016 |
| 484 | Ga0213876_10001953 | 3300021384 | Bacteria | 12347 |
| 485 | Ga0207672_1000046 | 3300025223 | Bacteria | 16046 |
| 486 | Ga0207653_10000008 | 3300025885 | Bacteria | 197323 |
| 487 | Ga0207642_10040653 | 3300025899 | Bacteria | 2030 |
| 488 | Ga0207642_10136482 | 3300025899 | Unclassified | 1287 |
| 489 | Ga0207710_10000001 | 3300025900 | Bacteria | 1797433 |
| 490 | Ga0207710_10009002 | 3300025900 | Bacteria | 4202 |
| 491 | Ga0207647_10006088 | 3300025904 | Bacteria | 8792 |
| 492 | Ga0207685_10000022 | 3300025905 | Bacteria | 125184 |
| 493 | Ga0207643_10009459 | 3300025908 | Bacteria | 5235 |
| 494 | Ga0207643_10035314 | 3300025908 | Bacteria | 2803 |
| 495 | Ga0207705_10026077 | 3300025909 | Bacteria | 4171 |
| 496 | Ga0207684_10000076 | 3300025910 | Bacteria | 183107 |
| 497 | Ga0207684_10010598 | 3300025910 | Bacteria | 8103 |
| 498 | Ga0207684_10014326 | 3300025910 | Bacteria | 6839 |
| 499 | Ga0207684_10080999 | 3300025910 | Bacteria | 2762 |
| 500 | Ga0207684_10090064 | 3300025910 | Bacteria | 2614 |
| 501 | Ga0207684_10161537 | 3300025910 | Bacteria | 1929 |
| 502 | Ga0207684_10722182 | 3300025910 | Bacteria | 846 |
| 503 | Ga0207654_10475760 | 3300025911 | Bacteria | 879 |
| 504 | Ga0207707_10000077 | 3300025912 | Bacteria | 100255 |
| 505 | Ga0207707_10010071 | 3300025912 | Bacteria | 8201 |
| 506 | Ga0207707_10017193 | 3300025912 | Bacteria | 6303 |
| 507 | Ga0207707_10027372 | 3300025912 | Bacteria | 4987 |
| 508 | Ga0207707_10310225 | 3300025912 | Bacteria | 1363 |
| 509 | Ga0207695_10097543 | 3300025913 | Unclassified | 2940 |
| 510 | Ga0207671_10002740 | 3300025914 | Bacteria | 18427 |
| 511 | Ga0207671_10088224 | 3300025914 | Bacteria | 2333 |
| 512 | Ga0207671_10415242 | 3300025914 | Bacteria | 1071 |
| 513 | Ga0207662_10025954 | 3300025918 | Bacteria | 3377 |
| 514 | Ga0207662_10071936 | 3300025918 | Bacteria | 2095 |
| 515 | Ga0207662_10081775 | 3300025918 | Bacteria | 1972 |
| 516 | Ga0207652_10000096 | 3300025921 | Bacteria | 96047 |
| 517 | Ga0207652_10081877 | 3300025921 | Bacteria | 2824 |
| 518 | Ga0207652_10247382 | 3300025921 | Bacteria | 1608 |
| 519 | Ga0207646_10001426 | 3300025922 | Bacteria | 29683 |
| 520 | Ga0207646_10005266 | 3300025922 | Bacteria | 13641 |
| 521 | Ga0207646_10022181 | 3300025922 | Bacteria | 5854 |
| 522 | Ga0207646_10226111 | 3300025922 | Bacteria | 1690 |
| 523 | Ga0207646_10263093 | 3300025922 | Bacteria | 1559 |
| 524 | Ga0207646_10278437 | 3300025922 | Bacteria | 1512 |
| 525 | Ga0207646_10329243 | 3300025922 | Bacteria | 1380 |
| 526 | Ga0207681_10007662 | 3300025923 | Bacteria | 6616 |
| 527 | Ga0207681_10055772 | 3300025923 | Unclassified | 2693 |
| 528 | Ga0207681_10063593 | 3300025923 | Unclassified | 2545 |
| 529 | Ga0207681_10078357 | 3300025923 | Bacteria | 2325 |
| 530 | Ga0207681_10091343 | 3300025923 | Unclassified | 2175 |
| 531 | Ga0207694_10015740 | 3300025924 | Bacteria | 5706 |
| 532 | Ga0207650_10000027 | 3300025925 | Bacteria | 257466 |
| 533 | Ga0207650_10000623 | 3300025925 | Bacteria | 28245 |
| 534 | Ga0207650_10027728 | 3300025925 | Unclassified | 4056 |
| 535 | Ga0207650_10072198 | 3300025925 | Bacteria | 2598 |
| 536 | Ga0207650_10162273 | 3300025925 | Unclassified | 1771 |
| 537 | Ga0207650_10413232 | 3300025925 | Unclassified | 1118 |
| 538 | Ga0207650_10546565 | 3300025925 | Unclassified | 971 |
| 539 | Ga0207659_10064987 | 3300025926 | Unclassified | 2643 |
| 540 | Ga0207659_10080003 | 3300025926 | Bacteria | 2413 |
| 541 | Ga0207659_10098422 | 3300025926 | Unclassified | 2200 |
| 542 | Ga0207659_10369162 | 3300025926 | Bacteria | 1194 |
| 543 | Ga0207687_10026530 | 3300025927 | Unclassified | 3880 |
| 544 | Ga0207687_10153793 | 3300025927 | Unclassified | 1758 |
| 545 | Ga0207644_10002044 | 3300025931 | Bacteria | 13063 |
| 546 | Ga0207644_10020094 | 3300025931 | Bacteria | 4538 |
| 547 | Ga0207644_10025578 | 3300025931 | Bacteria | 4059 |
| 548 | Ga0207644_10099520 | 3300025931 | Bacteria | 2182 |
| 549 | Ga0207644_10229957 | 3300025931 | Bacteria | 1473 |
| 550 | Ga0207686_10000062 | 3300025934 | Bacteria | 97842 |
| 551 | Ga0207686_10001492 | 3300025934 | Bacteria | 13197 |
| 552 | Ga0207686_10007557 | 3300025934 | Bacteria | 5853 |
| 553 | Ga0207709_10000091 | 3300025935 | Bacteria | 144622 |
| 554 | Ga0207709_10022753 | 3300025935 | Unclassified | 3558 |
| 555 | Ga0207709_10120115 | 3300025935 | Bacteria | 1773 |
| 556 | Ga0207670_10041254 | 3300025936 | Bacteria | 3034 |
| 557 | Ga0207670_10402796 | 3300025936 | Bacteria | 1094 |
| 558 | Ga0207704_10031813 | 3300025938 | Bacteria | 2978 |
| 559 | Ga0207704_10117842 | 3300025938 | Bacteria | 1810 |
| 560 | Ga0207665_10000033 | 3300025939 | Bacteria | 89014 |
| 561 | Ga0207665_10036012 | 3300025939 | Bacteria | 3288 |
| 562 | Ga0207665_10308283 | 3300025939 | Bacteria | 1185 |
| 563 | Ga0207665_10315161 | 3300025939 | Bacteria | 1172 |
| 564 | Ga0207691_10023812 | 3300025940 | Bacteria | 5763 |
| 565 | Ga0207691_10044279 | 3300025940 | Bacteria | 4097 |
| 566 | Ga0207691_10264776 | 3300025940 | Bacteria | 1481 |
| 567 | Ga0207711_10004896 | 3300025941 | Bacteria | 11367 |
| 568 | Ga0207711_10009657 | 3300025941 | Bacteria | 8039 |
| 569 | Ga0207711_10044876 | 3300025941 | Bacteria | 3775 |
| 570 | Ga0207711_10054024 | 3300025941 | Unclassified | 3445 |
| 571 | Ga0207711_10208386 | 3300025941 | Unclassified | 1785 |
| 572 | Ga0207711_10223831 | 3300025941 | Bacteria | 1722 |
| 573 | Ga0207711_10658746 | 3300025941 | Unclassified | 977 |
| 574 | Ga0207711_10728045 | 3300025941 | Unclassified | 925 |
| 575 | Ga0207689_10006262 | 3300025942 | Bacteria | 10547 |
| 576 | Ga0207689_10011390 | 3300025942 | Bacteria | 7621 |
| 577 | Ga0207689_10045330 | 3300025942 | Bacteria | 3636 |
| 578 | Ga0207689_10051986 | 3300025942 | Unclassified | 3377 |
| 579 | Ga0207689_10088648 | 3300025942 | Bacteria | 2541 |
| 580 | Ga0207689_10148650 | 3300025942 | Bacteria | 1931 |
| 581 | Ga0207689_10202658 | 3300025942 | Unclassified | 1638 |
| 582 | Ga0207689_10318756 | 3300025942 | Bacteria | 1290 |
| 583 | Ga0207679_10055065 | 3300025945 | Bacteria | 2931 |
| 584 | Ga0207667_10549017 | 3300025949 | Bacteria | 1169 |
| 585 | Ga0207651_10043386 | 3300025960 | Bacteria | 3001 |
| 586 | Ga0207651_10070141 | 3300025960 | Bacteria | 2478 |
| 587 | Ga0207651_10107459 | 3300025960 | Unclassified | 2086 |
| 588 | Ga0207651_10395093 | 3300025960 | Unclassified | 1175 |
| 589 | Ga0207712_10000781 | 3300025961 | Bacteria | 23731 |
| 590 | Ga0207712_10015035 | 3300025961 | Bacteria | 4987 |
| 591 | Ga0207712_10016341 | 3300025961 | Bacteria | 4803 |
| 592 | Ga0207712_10046975 | 3300025961 | Bacteria | 2995 |
| 593 | Ga0207712_10170114 | 3300025961 | Bacteria | 1702 |
| 594 | Ga0207668_10010711 | 3300025972 | Bacteria | 5549 |
| 595 | Ga0207640_10135686 | 3300025981 | Bacteria | 1786 |
| 596 | Ga0207640_10213101 | 3300025981 | Bacteria | 1473 |
| 597 | Ga0207640_10223310 | 3300025981 | Unclassified | 1444 |
| 598 | Ga0207640_10234924 | 3300025981 | Bacteria | 1413 |
| 599 | Ga0207658_10023337 | 3300025986 | Bacteria | 4318 |
| 600 | Ga0207658_10125671 | 3300025986 | Unclassified | 2052 |
| 601 | Ga0207658_10277046 | 3300025986 | Unclassified | 1436 |
| 602 | Ga0207677_10370550 | 3300026023 | Bacteria | 1206 |
| 603 | Ga0207703_10000481 | 3300026035 | Bacteria | 41719 |
| 604 | Ga0207703_10006636 | 3300026035 | Bacteria | 9232 |
| 605 | Ga0207703_10015662 | 3300026035 | Bacteria | 5913 |
| 606 | Ga0207703_10032728 | 3300026035 | Bacteria | 4116 |
| 607 | Ga0207703_10055950 | 3300026035 | Bacteria | 3211 |
| 608 | Ga0207703_10059809 | 3300026035 | Unclassified | 3113 |
| 609 | Ga0207703_10132078 | 3300026035 | Bacteria | 2157 |
| 610 | Ga0207703_10234759 | 3300026035 | Unclassified | 1646 |
| 611 | Ga0207703_10249011 | 3300026035 | Bacteria | 1600 |
| 612 | Ga0207703_10396280 | 3300026035 | Bacteria | 1280 |
| 613 | Ga0207703_10580467 | 3300026035 | Bacteria | 1059 |
| 614 | Ga0207703_10708570 | 3300026035 | Bacteria | 957 |
| 615 | Ga0207639_10025126 | 3300026041 | Bacteria | 4319 |
| 616 | Ga0207639_10038113 | 3300026041 | Unclassified | 3574 |
| 617 | Ga0207639_10058152 | 3300026041 | Bacteria | 2972 |
| 618 | Ga0207639_10153298 | 3300026041 | Bacteria | 1933 |
| 619 | Ga0207678_10140884 | 3300026067 | Bacteria | 2058 |
| 620 | Ga0207708_10000235 | 3300026075 | Bacteria | 43719 |
| 621 | Ga0207708_10015082 | 3300026075 | Bacteria | 5792 |
| 622 | Ga0207708_10022826 | 3300026075 | Bacteria | 4726 |
| 623 | Ga0207708_10039853 | 3300026075 | Bacteria | 3580 |
| 624 | Ga0207708_10058415 | 3300026075 | Bacteria | 2943 |
| 625 | Ga0207708_10088520 | 3300026075 | Unclassified | 2385 |
| 626 | Ga0207708_10186795 | 3300026075 | Unclassified | 1647 |
| 627 | Ga0207708_10522704 | 3300026075 | Unclassified | 997 |
| 628 | Ga0207641_10005244 | 3300026088 | Bacteria | 11081 |
| 629 | Ga0207641_10062794 | 3300026088 | Unclassified | 3171 |
| 630 | Ga0207641_10108890 | 3300026088 | Bacteria | 2453 |
| 631 | Ga0207641_10124678 | 3300026088 | Unclassified | 2304 |
| 632 | Ga0207641_10157747 | 3300026088 | Bacteria | 2060 |
| 633 | Ga0207641_10317875 | 3300026088 | Bacteria | 1475 |
| 634 | Ga0207641_10561598 | 3300026088 | Bacteria | 1114 |
| 635 | Ga0207648_10009383 | 3300026089 | Bacteria | 9372 |
| 636 | Ga0207648_10102424 | 3300026089 | Bacteria | 2509 |
| 637 | Ga0207648_10135270 | 3300026089 | Bacteria | 2171 |
| 638 | Ga0207648_10145571 | 3300026089 | Unclassified | 2090 |
| 639 | Ga0207648_10428139 | 3300026089 | Bacteria | 1202 |
| 640 | Ga0207676_10001919 | 3300026095 | Bacteria | 15191 |
| 641 | Ga0207676_10006195 | 3300026095 | Bacteria | 8447 |
| 642 | Ga0207676_10076835 | 3300026095 | Bacteria | 2699 |
| 643 | Ga0207676_10390477 | 3300026095 | Bacteria | 1298 |
| 644 | Ga0207676_10469703 | 3300026095 | Bacteria | 1189 |
| 645 | Ga0207676_10528971 | 3300026095 | Bacteria | 1123 |
| 646 | Ga0207676_10558310 | 3300026095 | Bacteria | 1095 |
| 647 | Ga0207676_10578753 | 3300026095 | Unclassified | 1076 |
| 648 | Ga0207674_10000525 | 3300026116 | Bacteria | 50323 |
| 649 | Ga0207674_10017630 | 3300026116 | Bacteria | 7787 |
| 650 | Ga0207674_10814648 | 3300026116 | Unclassified | 901 |
| 651 | Ga0207675_100001552 | 3300026118 | Bacteria | 22994 |
| 652 | Ga0207675_100005444 | 3300026118 | Bacteria | 12201 |
| 653 | Ga0207675_100007761 | 3300026118 | Bacteria | 10124 |
| 654 | Ga0207675_100017262 | 3300026118 | Bacteria | 6739 |
| 655 | Ga0207675_100068607 | 3300026118 | Bacteria | 3314 |
| 656 | Ga0207675_100137966 | 3300026118 | Bacteria | 2315 |
| 657 | Ga0207675_100160160 | 3300026118 | Bacteria | 2146 |
| 658 | Ga0207675_100229015 | 3300026118 | Unclassified | 1792 |
| 659 | Ga0207675_100447042 | 3300026118 | Bacteria | 1280 |
| 660 | Ga0207683_10370001 | 3300026121 | Bacteria | 1317 |
| 661 | Ga0207698_10108223 | 3300026142 | Bacteria | 2323 |
| 662 | Ga0207698_10826949 | 3300026142 | Unclassified | 930 |
| 663 | Ga0209588_1009760 | 3300027671 | Unclassified | 2873 |
| 664 | Ga0207428_10004899 | 3300027907 | Bacteria | 12612 |
| 665 | Ga0207428_10005514 | 3300027907 | Bacteria | 11787 |
| 666 | Ga0207428_10071821 | 3300027907 | Unclassified | 2718 |
| 667 | Ga0207428_10126437 | 3300027907 | Unclassified | 1957 |
| 668 | Ga0268265_10003630 | 3300028380 | Bacteria | 11011 |
| 669 | Ga0268265_10158559 | 3300028380 | Bacteria | 1918 |
| 670 | Ga0268264_10005319 | 3300028381 | Bacteria | 10904 |
| 671 | Ga0268264_10006931 | 3300028381 | Bacteria | 9507 |
| 672 | Ga0268264_10019417 | 3300028381 | Bacteria | 5555 |
| 673 | Ga0268264_10182889 | 3300028381 | Bacteria | 1905 |
| 674 | Ga0268264_10303390 | 3300028381 | Unclassified | 1504 |
| 675 | Ga0268264_10317935 | 3300028381 | Unclassified | 1471 |
| 676 | Ga0268264_10351722 | 3300028381 | Bacteria | 1403 |
| 677 | Ga0268264_10351733 | 3300028381 | Unclassified | 1403 |
| 678 | Ga0268264_10381543 | 3300028381 | Bacteria | 1350 |
| 679 | Ga0268264_10530989 | 3300028381 | Bacteria | 1151 |
| 680 | Ga0307408_100008854 | 3300031548 | Bacteria | 6647 |
| 681 | Ga0307408_100190798 | 3300031548 | Unclassified | 1650 |
| 682 | Ga0316575_10005290 | 3300031665 | Unclassified | 4594 |
| 683 | Ga0316575_10042085 | 3300031665 | Bacteria | 1808 |
| 684 | Ga0316579_10001197 | 3300031691 | Bacteria | 9294 |
| 685 | Ga0316579_10018294 | 3300031691 | Bacteria | 3082 |
| 686 | Ga0316576_10012005 | 3300031727 | Bacteria | 5705 |
| 687 | Ga0316576_10119069 | 3300031727 | Bacteria | 1982 |
| 688 | Ga0316578_10110200 | 3300031728 | Bacteria | 1653 |
| 689 | Ga0307405_10004255 | 3300031731 | Bacteria | 6736 |
| 690 | Ga0307405_10098022 | 3300031731 | Bacteria | 1959 |
| 691 | Ga0307405_10298622 | 3300031731 | Bacteria | 1221 |
| 692 | Ga0307405_10549987 | 3300031731 | Bacteria | 934 |
| 693 | Ga0316577_10000549 | 3300031733 | Bacteria | 15247 |
| 694 | Ga0316577_10002288 | 3300031733 | Bacteria | 9440 |
| 695 | Ga0316577_10136729 | 3300031733 | Bacteria | 1380 |
| 696 | Ga0316577_10152392 | 3300031733 | Bacteria | 1303 |
| 697 | Ga0307413_10018801 | 3300031824 | Bacteria | 3634 |
| 698 | Ga0307413_10172345 | 3300031824 | Bacteria | 1533 |
| 699 | Ga0307410_10013140 | 3300031852 | Bacteria | 4818 |
| 700 | Ga0307410_10017066 | 3300031852 | Bacteria | 4348 |
| 701 | Ga0307410_10250672 | 3300031852 | Bacteria | 1376 |
| 702 | Ga0307406_10011489 | 3300031901 | Bacteria | 5029 |
| 703 | Ga0307406_10014727 | 3300031901 | Bacteria | 4505 |
| 704 | Ga0307407_10007946 | 3300031903 | Bacteria | 4835 |
| 705 | Ga0307412_10052512 | 3300031911 | Bacteria | 2699 |
| 706 | Ga0307412_10056920 | 3300031911 | Unclassified | 2608 |
| 707 | Ga0307412_10085572 | 3300031911 | Bacteria | 2191 |
| 708 | Ga0307409_100006264 | 3300031995 | Bacteria | 6969 |
| 709 | Ga0307416_100004832 | 3300032002 | Bacteria | 8196 |
| 710 | Ga0307416_100015918 | 3300032002 | Bacteria | 5210 |
| 711 | Ga0307416_100197179 | 3300032002 | Bacteria | 1906 |
| 712 | Ga0307414_10011752 | 3300032004 | Bacteria | 5150 |
| 713 | Ga0307414_10049325 | 3300032004 | Bacteria | 2910 |
| 714 | Ga0307414_10357272 | 3300032004 | Bacteria | 1256 |
| 715 | Ga0307411_10006971 | 3300032005 | Bacteria | 5707 |
| 716 | Ga0307411_10021834 | 3300032005 | Bacteria | 3756 |
| 717 | Ga0307411_10120851 | 3300032005 | Bacteria | 1895 |
| 718 | Ga0307411_10181296 | 3300032005 | Bacteria | 1599 |
| 719 | Ga0307415_100009335 | 3300032126 | Bacteria | 5492 |
| 720 | Ga0307415_100016598 | 3300032126 | Bacteria | 4393 |
| 721 | Ga0373940_0035690 | 3300035088 | Bacteria | 1347 |
| 722 | Ga0373951_0003754 | 3300035091 | Bacteria | 3662 |
| 723 | Ga0373923_0056380 | 3300035111 | Unclassified | 1659 |
| 724 | Ga0373953_0055114 | 3300035117 | Bacteria | 1614 |
| 725 | Ga0373954_0038225 | 3300035118 | Bacteria | 2232 |
| 726 | Ga0373946_0062419 | 3300035171 | Bacteria | 1589 |
| 727 | Ga0373955_0107694 | 3300035172 | Bacteria | 1608 |
| 728 | Ga0373942_0024221 | 3300035207 | Bacteria | 1555 |
| 729 | Ga0373962_0065149 | 3300035242 | Bacteria | 1078 |
| 730 | Ga0316574_0008749 | 3300035398 | Bacteria | 5638 |
| 731 | Ga0373931_0066568 | 3300035691 | Bacteria | 1955 |
| 732 | Ga0373937_0089715 | 3300036401 | Unclassified | 2847 |
| 733 | Ga0316582_0001214 | 3300036647 | Bacteria | 11069 |
| 734 | Ga0316582_0073512 | 3300036647 | Bacteria | 2218 |
| 735 | Ga0316582_0330660 | 3300036647 | Bacteria | 1048 |
| 736 | Ga0316584_0013247 | 3300036712 | Bacteria | 5833 |
| 737 | Ga0316584_0060282 | 3300036712 | Unclassified | 2842 |
| 738 | Ga0316584_0116022 | 3300036712 | Bacteria | 2003 |
| 739 | Ga0316584_0223988 | 3300036712 | Bacteria | 1380 |
| 740 | Ga0316584_0302427 | 3300036712 | Bacteria | 1158 |
| 741 | Ga0395900_0215130 | 3300037418 | Bacteria | 1940 |
| 742 | Ga0395900_0550889 | 3300037418 | Unclassified | 1098 |
| 743 | Ga0395900_0649130 | 3300037418 | Bacteria | 992 |
| 744 | Ga0395898_0321229 | 3300037466 | Bacteria | 1477 |
| 745 | Ga0395905_0029319 | 3300037471 | Bacteria | 5185 |
| 746 | Ga0316581_0016790 | 3300037588 | Bacteria | 2105 |
| 747 | Ga0436364_0009890 | 3300037853 | Bacteria | 6277 |
| 748 | Ga0436364_1116912 | 3300037853 | Unclassified | 3325 |
| 749 | Ga0242420_004415 | 3300038996 | Unclassified | 2126 |
| 750 | Ga0242420_004617 | 3300038996 | Bacteria | 2091 |
| 751 | Ga0436365_0013216 | 3300039437 | Bacteria | 44926 |
| 752 | Ga0436365_0421852 | 3300039437 | Bacteria | 162876 |
| 753 | Ga0436365_0629287 | 3300039437 | Bacteria | 1502 |
| 754 | Ga0436365_1045327 | 3300039437 | Bacteria | 3173 |
| 755 | Ga0436365_1090258 | 3300039437 | Bacteria | 7647 |
| 756 | Ga0436363_1633109 | 3300039450 | Bacteria | 2021 |
| 757 | Ga0439446_0011230 | 3300042156 | Bacteria | 2429 |
| 758 | Ga0439458_0005147 | 3300042157 | Bacteria | 2949 |
| 759 | Ga0439434_0022033 | 3300042435 | Bacteria | 1915 |
| 760 | Ga0453683_0026879 | 3300044673 | Unclassified | 3653 |
| 761 | Ga0453684_0027150 | 3300044712 | Bacteria | 8226 |
| 762 | Ga0453684_0263576 | 3300044712 | Unclassified | 1973 |
| 763 | Ga0466960_0034289 | 3300044901 | Bacteria | 2364 |
| 764 | Ga0451576_0042739 | 3300045051 | Unclassified | 4784 |
| 765 | Ga0466967_0576198 | 3300045976 | Bacteria | 1109 |
| 766 | Ga0495639_0123655 | 3300046475 | Bacteria | 1235 |
| 767 | Ga0495664_0285310 | 3300046477 | Bacteria | 997 |
| 768 | Ga0495628_0039307 | 3300046516 | Bacteria | 3784 |
| 769 | Ga0495630_0011870 | 3300046517 | Bacteria | 6315 |
| 770 | Ga0495663_0000433 | 3300046525 | Bacteria | 15293 |
| 771 | Ga0495586_0019771 | 3300046535 | Bacteria | 3586 |
| 772 | Ga0495598_0002150 | 3300046537 | Bacteria | 4026 |
| 773 | Ga0495621_0002053 | 3300046539 | Bacteria | 5328 |
| 774 | Ga0495672_0093934 | 3300047320 | Bacteria | 1641 |
| 775 | Ga0496102_0549527 | 3300048905 | Unclassified | 1078 |
| 776 | Ga0496107_0174394 | 3300048910 | Bacteria | 1596 |
| 777 | Ga0496110_0183546 | 3300048913 | Bacteria | 1900 |
| 778 | Ga0496112_0241295 | 3300048915 | Bacteria | 1760 |
| 779 | Ga0496112_0451177 | 3300048915 | Bacteria | 1224 |
| 780 | Ga0501301_001508 | 3300049524 | Bacteria | 1476 |
| 781 | Ga0501032_0080857 | 3300049569 | Bacteria | 2162 |
| 782 | Ga0501036_0318046 | 3300049572 | Bacteria | 1301 |
| 783 | Ga0501037_0010158 | 3300049573 | Bacteria | 6907 |
| 784 | Ga0501038_0003660 | 3300049574 | Bacteria | 14324 |
| 785 | Ga0501038_0109470 | 3300049574 | Bacteria | 2289 |
| 786 | Ga0501041_0148003 | 3300049577 | Bacteria | 1465 |
| 787 | Ga0501042_0010054 | 3300049578 | Bacteria | 6326 |
| 788 | Ga0501042_0014097 | 3300049578 | Bacteria | 5451 |
| 789 | Ga0501046_0059421 | 3300049580 | Bacteria | 2995 |
| 790 | Ga0501046_0118778 | 3300049580 | Bacteria | 2013 |
| 791 | Ga0501047_0140121 | 3300049581 | Bacteria | 2297 |
| 792 | Ga0501070_0110124 | 3300049586 | Bacteria | 2276 |
| 793 | Ga0501071_0267084 | 3300049587 | Bacteria | 1293 |
| 794 | Ga0501076_0146395 | 3300049592 | Bacteria | 1921 |
| 795 | Ga0501076_0252035 | 3300049592 | Bacteria | 1445 |
| 796 | Ga0501202_013011 | 3300049652 | Bacteria | 1579 |
| 797 | Ga0501217_005217 | 3300049661 | Bacteria | 2708 |
| 798 | Ga0501223_005137 | 3300049663 | Bacteria | 2764 |
| 799 | Ga0501223_010856 | 3300049663 | Bacteria | 1829 |
| 800 | Ga0501224_009207 | 3300049664 | Bacteria | 1443 |
| 801 | Ga0501227_000507 | 3300049665 | Bacteria | 8353 |
| 802 | Ga0501230_021618 | 3300049667 | Bacteria | 1129 |
| 803 | Ga0501233_001430 | 3300049668 | Bacteria | 4069 |
| 804 | Ga0501235_002582 | 3300049669 | Bacteria | 3897 |
| 805 | Ga0501235_012582 | 3300049669 | Bacteria | 1861 |
| 806 | Ga0501243_008153 | 3300049675 | Bacteria | 1611 |
| 807 | Ga0501249_015253 | 3300049679 | Bacteria | 1643 |
| 808 | Ga0501259_011652 | 3300049688 | Bacteria | 1457 |
| 809 | Ga0501221_010336 | 3300049704 | Bacteria | 1656 |
| 810 | Ga0501225_0000353 | 3300049705 | Bacteria | 14561 |
| 811 | Ga0501225_0002065 | 3300049705 | Bacteria | 6245 |
| 812 | Ga0501225_0022930 | 3300049705 | Bacteria | 1722 |
| 813 | Ga0501035_0020836 | 3300049822 | Bacteria | 6024 |
| 814 | Ga0501035_0337233 | 3300049822 | Bacteria | 1264 |
| 815 | Ga0501035_0432760 | 3300049822 | Bacteria | 1091 |
| 816 | Ga0501044_0614665 | 3300049823 | Bacteria | 979 |
| 817 | Ga0501212_007983 | 3300049851 | Bacteria | 1462 |
| 818 | Ga0501226_000515 | 3300049853 | Bacteria | 5378 |
| 819 | nmdc:mga05p37_1014518_c1 | 3300050507 | Unclassified | 880 |
| 820 | nmdc:mga05p37_13138_c2 | 3300050507 | Bacteria | 4705 |
| 821 | nmdc:mga05p37_157730_c2 | 3300050507 | Bacteria | 2350 |
| 822 | nmdc:mga05p37_166487_c1 | 3300050507 | Bacteria | 2690 |
| 823 | nmdc:mga05p37_318323_c1 | 3300050507 | Bacteria | 1842 |
| 824 | nmdc:mga05p37_522911_c1 | 3300050507 | Unclassified | 1357 |
| 825 | nmdc:mga05p37_65876_c2 | 3300050507 | Bacteria | 3919 |
| 826 | nmdc:mga05p37_688926_c1 | 3300050507 | Bacteria | 1137 |
| 827 | nmdc:mga09592_122616_c1 | 3300050508 | Bacteria | 2233 |
| 828 | nmdc:mga09592_134411_c1 | 3300050508 | Bacteria | 2130 |
| 829 | nmdc:mga09592_234598_c1 | 3300050508 | Bacteria | 1589 |
| 830 | nmdc:mga09592_288863_c1 | 3300050508 | Bacteria | 1422 |
| 831 | nmdc:mga0qj67_256728_c1 | 3300050509 | Unclassified | 1418 |
| 832 | nmdc:mga0qj67_54043_c1 | 3300050509 | Bacteria | 3180 |
| 833 | nmdc:mga06r32_207775_c1 | 3300050510 | Bacteria | 1946 |
| 834 | nmdc:mga08y16_161298_c1 | 3300050511 | Bacteria | 2330 |
| 835 | nmdc:mga08y16_321939_c1 | 3300050511 | Unclassified | 1592 |
| 836 | nmdc:mga08y16_3544_c1 | 3300050511 | Bacteria | 16207 |
| 837 | nmdc:mga0n895_145294_c1 | 3300050512 | Bacteria | 2401 |
| 838 | nmdc:mga0n895_439170_c1 | 3300050512 | Bacteria | 1318 |
| 839 | nmdc:mga0n895_603749_c1 | 3300050512 | Bacteria | 1099 |
| 840 | nmdc:mga0n895_785299_c1 | 3300050512 | Bacteria | 943 |
| 841 | nmdc:mga0rr50_492596_c1 | 3300050513 | Bacteria | 1041 |
| 842 | nmdc:mga0rr50_9855_c1 | 3300050513 | Bacteria | 6036 |
| 843 | nmdc:mga08x19_13_c1 | 3300050514 | Bacteria | 366166 |
| 844 | nmdc:mga0a205_175950_c1 | 3300050515 | Bacteria | 2035 |
| 845 | nmdc:mga0a205_198585_c1 | 3300050515 | Bacteria | 1897 |
| 846 | nmdc:mga0a205_214547_c1 | 3300050515 | Bacteria | 1812 |
| 847 | nmdc:mga0a205_22311_c1 | 3300050515 | Bacteria | 5994 |
| 848 | nmdc:mga0a205_49266_c1 | 3300050515 | Unclassified | 4066 |
| 849 | nmdc:mga0a205_519849_c1 | 3300050515 | Bacteria | 1047 |
| 850 | Ga0500577_0000869 | 3300053142 | Bacteria | 7811 |
| 851 | Ga0500616_0003139 | 3300053153 | Bacteria | 12913 |
| 852 | Ga0501084_0490654 | 3300054114 | Unclassified | 1038 |
| 853 | Ga0530510_0032439 | 3300061734 | Bacteria | 3758 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025942 | Ga0207689_10318756 | Ga0207689_103187562 | 215 |
| 2 | 3300048913 | Ga0496110_0183546 | Ga0496110_0183546_16_684 | 216 |
| 3 | 3300005438 | Ga0070701_10470917 | Ga0070701_104709171 | 218 |
| 4 | 3300005468 | Ga0070707_100021845 | Ga0070707_1000218453 | 227 |
| 5 | 3300036647 | Ga0316582_0073512 | Ga0316582_0073512_1478_2206 | 227 |
| 6 | 3300005471 | Ga0070698_100033807 | Ga0070698_1000338073 | 228 |
| 7 | 3300035242 | Ga0373962_0065149 | Ga0373962_0065149_363_1055 | 229 |
| 8 | 3300026118 | Ga0207675_100137966 | Ga0207675_1001379663 | 230 |
| 9 | 3300006852 | Ga0075433_10178463 | Ga0075433_101784632 | 233 |
| 10 | 3300050515 | nmdc:mga0a205_198585_c1 | nmdc:mga0a205_198585_c1_947_1708 | 233 |
| 11 | 3300025941 | Ga0207711_10728045 | Ga0207711_107280451 | 238 |
| 12 | 3300005336 | Ga0070680_100396025 | Ga0070680_1003960252 | 240 |
| 13 | 3300009094 | Ga0111539_10098886 | Ga0111539_100988863 | 242 |
| 14 | 3300044712 | Ga0453684_0027150 | Ga0453684_0027150_3069_3944 | 242 |
| 15 | iso_pu_bacteria | 2671180531 | 2673166608 | 244 |
| 16 | 3300013105 | Ga0157369_10365050 | Ga0157369_103650502 | 245 |
| 17 | 3300049580 | Ga0501046_0059421 | Ga0501046_0059421_2227_2985 | 246 |
| 18 | iso_pu_bacteria | 8007371054 | 8007374521 | 246 |
| 19 | 3300031665 | Ga0316575_10005290 | Ga0316575_100052904 | 247 |
| 20 | 3300037853 | Ga0436364_1116912 | Ga0436364_1116912_786_1553 | 248 |
| 21 | 3300049580 | Ga0501046_0118778 | Ga0501046_0118778_432_1202 | 248 |
| 22 | 3300049581 | Ga0501047_0140121 | Ga0501047_0140121_1086_1856 | 248 |
| 23 | 3300049586 | Ga0501070_0110124 | Ga0501070_0110124_244_1014 | 248 |
| 24 | 3300049592 | Ga0501076_0252035 | Ga0501076_0252035_464_1234 | 248 |
| 25 | 3300049822 | Ga0501035_0432760 | Ga0501035_0432760_176_946 | 248 |
| 26 | 3300006844 | Ga0075428_100654440 | Ga0075428_1006544402 | 249 |
| 27 | 3300049823 | Ga0501044_0614665 | Ga0501044_0614665_36_815 | 249 |
| 28 | 3300003203 | JGI25406J46586_10006797 | JGI25406J46586_100067974 | 250 |
| 29 | 3300005340 | Ga0070689_100188181 | Ga0070689_1001881812 | 250 |
| 30 | 3300005441 | Ga0070700_100483850 | Ga0070700_1004838501 | 250 |
| 31 | 3300005471 | Ga0070698_100874239 | Ga0070698_1008742391 | 250 |
| 32 | 3300005536 | Ga0070697_100051154 | Ga0070697_1000511544 | 250 |
| 33 | 3300005544 | Ga0070686_100062493 | Ga0070686_1000624933 | 250 |
| 34 | 3300005718 | Ga0068866_10137060 | Ga0068866_101370602 | 250 |
| 35 | 3300005719 | Ga0068861_100273294 | Ga0068861_1002732941 | 250 |
| 36 | 3300005985 | Ga0081539_10002625 | Ga0081539_1000262518 | 250 |
| 37 | 3300006844 | Ga0075428_100308669 | Ga0075428_1003086692 | 250 |
| 38 | 3300006844 | Ga0075428_100506546 | Ga0075428_1005065461 | 250 |
| 39 | 3300006914 | Ga0075436_100325661 | Ga0075436_1003256611 | 250 |
| 40 | 3300013306 | Ga0163162_10555069 | Ga0163162_105550692 | 250 |
| 41 | 3300014325 | Ga0163163_10633934 | Ga0163163_106339341 | 250 |
| 42 | 3300017792 | Ga0163161_10118375 | Ga0163161_101183752 | 250 |
| 43 | 3300025910 | Ga0207684_10090064 | Ga0207684_100900642 | 250 |
| 44 | 3300026075 | Ga0207708_10186795 | Ga0207708_101867952 | 250 |
| 45 | 3300027907 | Ga0207428_10071821 | Ga0207428_100718212 | 250 |
| 46 | 3300027907 | Ga0207428_10126437 | Ga0207428_101264373 | 250 |
| 47 | 3300028381 | Ga0268264_10530989 | Ga0268264_105309892 | 250 |
| 48 | 3300035118 | Ga0373954_0038225 | Ga0373954_0038225_810_1565 | 250 |
| 49 | 3300035171 | Ga0373946_0062419 | Ga0373946_0062419_132_887 | 250 |
| 50 | 3300035172 | Ga0373955_0107694 | Ga0373955_0107694_635_1390 | 250 |
| 51 | 3300035691 | Ga0373931_0066568 | Ga0373931_0066568_1176_1931 | 250 |
| 52 | 3300046475 | Ga0495639_0123655 | Ga0495639_0123655_409_1164 | 250 |
| 53 | 3300046477 | Ga0495664_0285310 | Ga0495664_0285310_28_783 | 250 |
| 54 | 3300046516 | Ga0495628_0039307 | Ga0495628_0039307_511_1266 | 250 |
| 55 | 3300046517 | Ga0495630_0011870 | Ga0495630_0011870_4727_5482 | 250 |
| 56 | 3300046535 | Ga0495586_0019771 | Ga0495586_0019771_297_1052 | 250 |
| 57 | 3300050507 | nmdc:mga05p37_1014518_c1 | nmdc:mga05p37_1014518_c1_84_857 | 250 |
| 58 | 3300050511 | nmdc:mga08y16_321939_c1 | nmdc:mga08y16_321939_c1_53_817 | 250 |
| 59 | 3300026089 | Ga0207648_10135270 | Ga0207648_101352703 | 251 |
| 60 | 3300044901 | Ga0466960_0034289 | Ga0466960_0034289_1180_1962 | 251 |
| 61 | 3300045976 | Ga0466967_0576198 | Ga0466967_0576198_45_827 | 251 |
| 62 | 3300005445 | Ga0070708_100313686 | Ga0070708_1003136862 | 252 |
| 63 | 3300006846 | Ga0075430_100050628 | Ga0075430_1000506282 | 252 |
| 64 | 3300006847 | Ga0075431_100231300 | Ga0075431_1002313003 | 252 |
| 65 | 3300037853 | Ga0436364_0009890 | Ga0436364_0009890_4070_4876 | 252 |
| 66 | 3300005295 | Ga0065707_10096313 | Ga0065707_100963134 | 253 |
| 67 | 3300005458 | Ga0070681_10058592 | Ga0070681_100585922 | 253 |
| 68 | 3300035111 | Ga0373923_0056380 | Ga0373923_0056380_786_1583 | 253 |
| 69 | 3300049578 | Ga0501042_0010054 | Ga0501042_0010054_1011_1778 | 253 |
| 70 | 3300049587 | Ga0501071_0267084 | Ga0501071_0267084_328_1095 | 253 |
| 71 | 3300049822 | Ga0501035_0337233 | Ga0501035_0337233_300_1067 | 253 |
| 72 | 3300005615 | Ga0070702_100065890 | Ga0070702_1000658902 | 254 |
| 73 | 3300005617 | Ga0068859_100577644 | Ga0068859_1005776442 | 254 |
| 74 | 3300006931 | Ga0097620_100577642 | Ga0097620_1005776422 | 254 |
| 75 | 3300026118 | Ga0207675_100447042 | Ga0207675_1004470422 | 254 |
| 76 | 3300038996 | Ga0242420_004617 | Ga0242420_004617_38_802 | 254 |
| 77 | 3300049569 | Ga0501032_0080857 | Ga0501032_0080857_120_902 | 254 |
| 78 | 3300049572 | Ga0501036_0318046 | Ga0501036_0318046_359_1141 | 254 |
| 79 | 3300049573 | Ga0501037_0010158 | Ga0501037_0010158_4852_5634 | 254 |
| 80 | 3300049574 | Ga0501038_0109470 | Ga0501038_0109470_39_821 | 254 |
| 81 | 3300049577 | Ga0501041_0148003 | Ga0501041_0148003_224_1006 | 254 |
| 82 | 3300049578 | Ga0501042_0014097 | Ga0501042_0014097_3064_3846 | 254 |
| 83 | 3300049592 | Ga0501076_0146395 | Ga0501076_0146395_1113_1895 | 254 |
| 84 | 3300049822 | Ga0501035_0020836 | Ga0501035_0020836_1451_2233 | 254 |
| 85 | 3300005293 | Ga0065715_10014485 | Ga0065715_100144853 | 255 |
| 86 | 3300005334 | Ga0068869_100166919 | Ga0068869_1001669192 | 255 |
| 87 | 3300005343 | Ga0070687_100060679 | Ga0070687_1000606792 | 255 |
| 88 | 3300005353 | Ga0070669_100002525 | Ga0070669_1000025255 | 255 |
| 89 | 3300005353 | Ga0070669_100047062 | Ga0070669_1000470623 | 255 |
| 90 | 3300005364 | Ga0070673_100332014 | Ga0070673_1003320142 | 255 |
| 91 | 3300005441 | Ga0070700_100111621 | Ga0070700_1001116212 | 255 |
| 92 | 3300005616 | Ga0068852_100149455 | Ga0068852_1001494552 | 255 |
| 93 | 3300005617 | Ga0068859_100018658 | Ga0068859_1000186583 | 255 |
| 94 | 3300005617 | Ga0068859_100119379 | Ga0068859_1001193792 | 255 |
| 95 | 3300005617 | Ga0068859_100261688 | Ga0068859_1002616882 | 255 |
| 96 | 3300005719 | Ga0068861_100097003 | Ga0068861_1000970032 | 255 |
| 97 | 3300005842 | Ga0068858_100138359 | Ga0068858_1001383592 | 255 |
| 98 | 3300005842 | Ga0068858_100175387 | Ga0068858_1001753872 | 255 |
| 99 | 3300005843 | Ga0068860_100112769 | Ga0068860_1001127692 | 255 |
| 100 | 3300005843 | Ga0068860_100234441 | Ga0068860_1002344412 | 255 |
| 101 | 3300005843 | Ga0068860_100272955 | Ga0068860_1002729551 | 255 |
| 102 | 3300006931 | Ga0097620_100018658 | Ga0097620_1000186585 | 255 |
| 103 | 3300006931 | Ga0097620_100119364 | Ga0097620_1001193642 | 255 |
| 104 | 3300006931 | Ga0097620_100261674 | Ga0097620_1002616742 | 255 |
| 105 | 3300009101 | Ga0105247_10041404 | Ga0105247_100414043 | 255 |
| 106 | 3300009177 | Ga0105248_10190150 | Ga0105248_101901502 | 255 |
| 107 | 3300009553 | Ga0105249_10487386 | Ga0105249_104873862 | 255 |
| 108 | 3300014326 | Ga0157380_10016724 | Ga0157380_100167243 | 255 |
| 109 | 3300014326 | Ga0157380_11016156 | Ga0157380_110161561 | 255 |
| 110 | 3300014745 | Ga0157377_10109087 | Ga0157377_101090872 | 255 |
| 111 | 3300014968 | Ga0157379_10049363 | Ga0157379_100493632 | 255 |
| 112 | 3300014968 | Ga0157379_10396728 | Ga0157379_103967282 | 255 |
| 113 | 3300025918 | Ga0207662_10071936 | Ga0207662_100719362 | 255 |
| 114 | 3300025922 | Ga0207646_10263093 | Ga0207646_102630932 | 255 |
| 115 | 3300025923 | Ga0207681_10055772 | Ga0207681_100557722 | 255 |
| 116 | 3300025923 | Ga0207681_10063593 | Ga0207681_100635932 | 255 |
| 117 | 3300025926 | Ga0207659_10064987 | Ga0207659_100649873 | 255 |
| 118 | 3300025942 | Ga0207689_10148650 | Ga0207689_101486502 | 255 |
| 119 | 3300025981 | Ga0207640_10234924 | Ga0207640_102349242 | 255 |
| 120 | 3300026035 | Ga0207703_10132078 | Ga0207703_101320783 | 255 |
| 121 | 3300026035 | Ga0207703_10249011 | Ga0207703_102490112 | 255 |
| 122 | 3300026035 | Ga0207703_10708570 | Ga0207703_107085701 | 255 |
| 123 | 3300026075 | Ga0207708_10058415 | Ga0207708_100584152 | 255 |
| 124 | 3300026118 | Ga0207675_100068607 | Ga0207675_1000686072 | 255 |
| 125 | 3300026142 | Ga0207698_10108223 | Ga0207698_101082232 | 255 |
| 126 | 3300028381 | Ga0268264_10182889 | Ga0268264_101828892 | 255 |
| 127 | 3300028381 | Ga0268264_10351722 | Ga0268264_103517221 | 255 |
| 128 | 3300031733 | Ga0316577_10136729 | Ga0316577_101367292 | 255 |
| 129 | 3300036647 | Ga0316582_0001214 | Ga0316582_0001214_10091_10903 | 255 |
| 130 | 3300048915 | Ga0496112_0451177 | Ga0496112_0451177_206_973 | 255 |
| 131 | 3300053153 | Ga0500616_0003139 | Ga0500616_0003139_5793_6605 | 255 |
| 132 | 3300021384 | Ga0213876_10001953 | Ga0213876_100019537 | 256 |
| 133 | 3300026116 | Ga0207674_10814648 | Ga0207674_108146481 | 256 |
| 134 | 3300031665 | Ga0316575_10042085 | Ga0316575_100420852 | 256 |
| 135 | 3300031691 | Ga0316579_10001197 | Ga0316579_100011974 | 256 |
| 136 | 3300031691 | Ga0316579_10018294 | Ga0316579_100182942 | 256 |
| 137 | 3300031727 | Ga0316576_10012005 | Ga0316576_100120053 | 256 |
| 138 | 3300031727 | Ga0316576_10119069 | Ga0316576_101190692 | 256 |
| 139 | 3300031728 | Ga0316578_10110200 | Ga0316578_101102002 | 256 |
| 140 | 3300031733 | Ga0316577_10000549 | Ga0316577_1000054915 | 256 |
| 141 | 3300031733 | Ga0316577_10002288 | Ga0316577_100022888 | 256 |
| 142 | 3300031733 | Ga0316577_10152392 | Ga0316577_101523922 | 256 |
| 143 | 3300035398 | Ga0316574_0008749 | Ga0316574_0008749_4361_5179 | 256 |
| 144 | 3300036647 | Ga0316582_0330660 | Ga0316582_0330660_131_949 | 256 |
| 145 | 3300036712 | Ga0316584_0013247 | Ga0316584_0013247_1812_2657 | 256 |
| 146 | 3300036712 | Ga0316584_0060282 | Ga0316584_0060282_321_1139 | 256 |
| 147 | 3300036712 | Ga0316584_0116022 | Ga0316584_0116022_777_1571 | 256 |
| 148 | 3300036712 | Ga0316584_0223988 | Ga0316584_0223988_22_840 | 256 |
| 149 | 3300036712 | Ga0316584_0302427 | Ga0316584_0302427_132_926 | 256 |
| 150 | 3300037588 | Ga0316581_0016790 | Ga0316581_0016790_1167_1985 | 256 |
| 151 | 3300039437 | Ga0436365_0629287 | Ga0436365_0629287_232_1095 | 256 |
| 152 | 3300039437 | Ga0436365_1045327 | Ga0436365_1045327_1723_2553 | 256 |
| 153 | 3300039437 | Ga0436365_1090258 | Ga0436365_1090258_1552_2382 | 256 |
| 154 | 3300039450 | Ga0436363_1633109 | Ga0436363_1633109_732_1595 | 256 |
| 155 | 3300005293 | Ga0065715_10018531 | Ga0065715_100185313 | 257 |
| 156 | 3300005293 | Ga0065715_10100860 | Ga0065715_101008602 | 257 |
| 157 | 3300005295 | Ga0065707_10001462 | Ga0065707_100014627 | 257 |
| 158 | 3300005328 | Ga0070676_10061106 | Ga0070676_100611061 | 257 |
| 159 | 3300005330 | Ga0070690_100115287 | Ga0070690_1001152871 | 257 |
| 160 | 3300005334 | Ga0068869_100210339 | Ga0068869_1002103391 | 257 |
| 161 | 3300005353 | Ga0070669_100122369 | Ga0070669_1001223691 | 257 |
| 162 | 3300005354 | Ga0070675_100096163 | Ga0070675_1000961632 | 257 |
| 163 | 3300005355 | Ga0070671_100331782 | Ga0070671_1003317822 | 257 |
| 164 | 3300005365 | Ga0070688_100131439 | Ga0070688_1001314392 | 257 |
| 165 | 3300005438 | Ga0070701_10248038 | Ga0070701_102480381 | 257 |
| 166 | 3300005440 | Ga0070705_100256924 | Ga0070705_1002569241 | 257 |
| 167 | 3300005440 | Ga0070705_100270300 | Ga0070705_1002703001 | 257 |
| 168 | 3300005441 | Ga0070700_100268723 | Ga0070700_1002687232 | 257 |
| 169 | 3300005467 | Ga0070706_100060029 | Ga0070706_1000600292 | 257 |
| 170 | 3300005468 | Ga0070707_100003979 | Ga0070707_10000397912 | 257 |
| 171 | 3300005471 | Ga0070698_100071065 | Ga0070698_1000710652 | 257 |
| 172 | 3300005518 | Ga0070699_100136443 | Ga0070699_1001364432 | 257 |
| 173 | 3300005536 | Ga0070697_100027095 | Ga0070697_1000270953 | 257 |
| 174 | 3300005539 | Ga0068853_100033867 | Ga0068853_1000338672 | 257 |
| 175 | 3300005543 | Ga0070672_100406543 | Ga0070672_1004065431 | 257 |
| 176 | 3300005544 | Ga0070686_100459957 | Ga0070686_1004599571 | 257 |
| 177 | 3300005545 | Ga0070695_100094994 | Ga0070695_1000949942 | 257 |
| 178 | 3300005545 | Ga0070695_100374524 | Ga0070695_1003745241 | 257 |
| 179 | 3300005549 | Ga0070704_100504389 | Ga0070704_1005043891 | 257 |
| 180 | 3300005615 | Ga0070702_100002032 | Ga0070702_1000020325 | 257 |
| 181 | 3300005617 | Ga0068859_100033363 | Ga0068859_1000333632 | 257 |
| 182 | 3300005618 | Ga0068864_100022935 | Ga0068864_1000229355 | 257 |
| 183 | 3300005840 | Ga0068870_10178023 | Ga0068870_101780232 | 257 |
| 184 | 3300005841 | Ga0068863_100047679 | Ga0068863_1000476792 | 257 |
| 185 | 3300005842 | Ga0068858_100027082 | Ga0068858_1000270826 | 257 |
| 186 | 3300005843 | Ga0068860_100043714 | Ga0068860_1000437144 | 257 |
| 187 | 3300005843 | Ga0068860_100109223 | Ga0068860_1001092232 | 257 |
| 188 | 3300006237 | Ga0097621_100074871 | Ga0097621_1000748712 | 257 |
| 189 | 3300006358 | Ga0068871_100001715 | Ga0068871_1000017157 | 257 |
| 190 | 3300006881 | Ga0068865_100031323 | Ga0068865_1000313231 | 257 |
| 191 | 3300006931 | Ga0097620_100033364 | Ga0097620_1000333642 | 257 |
| 192 | 3300009094 | Ga0111539_10001784 | Ga0111539_100017848 | 257 |
| 193 | 3300009098 | Ga0105245_10187351 | Ga0105245_101873512 | 257 |
| 194 | 3300009101 | Ga0105247_10416345 | Ga0105247_104163451 | 257 |
| 195 | 3300009148 | Ga0105243_10040911 | Ga0105243_100409113 | 257 |
| 196 | 3300009148 | Ga0105243_10110958 | Ga0105243_101109582 | 257 |
| 197 | 3300009176 | Ga0105242_10155864 | Ga0105242_101558641 | 257 |
| 198 | 3300009177 | Ga0105248_10312045 | Ga0105248_103120452 | 257 |
| 199 | 3300009177 | Ga0105248_10879568 | Ga0105248_108795681 | 257 |
| 200 | 3300009551 | Ga0105238_10009968 | Ga0105238_100099686 | 257 |
| 201 | 3300013297 | Ga0157378_10092551 | Ga0157378_100925513 | 257 |
| 202 | 3300013297 | Ga0157378_10306078 | Ga0157378_103060782 | 257 |
| 203 | 3300013306 | Ga0163162_10012064 | Ga0163162_100120643 | 257 |
| 204 | 3300013308 | Ga0157375_10633756 | Ga0157375_106337561 | 257 |
| 205 | 3300014745 | Ga0157377_10355611 | Ga0157377_103556111 | 257 |
| 206 | 3300014969 | Ga0157376_10566630 | Ga0157376_105666301 | 257 |
| 207 | 3300025899 | Ga0207642_10040653 | Ga0207642_100406531 | 257 |
| 208 | 3300025904 | Ga0207647_10006088 | Ga0207647_100060887 | 257 |
| 209 | 3300025910 | Ga0207684_10010598 | Ga0207684_100105983 | 257 |
| 210 | 3300025922 | Ga0207646_10005266 | Ga0207646_1000526613 | 257 |
| 211 | 3300025925 | Ga0207650_10162273 | Ga0207650_101622732 | 257 |
| 212 | 3300025926 | Ga0207659_10080003 | Ga0207659_100800032 | 257 |
| 213 | 3300025926 | Ga0207659_10369162 | Ga0207659_103691622 | 257 |
| 214 | 3300025927 | Ga0207687_10026530 | Ga0207687_100265301 | 257 |
| 215 | 3300025931 | Ga0207644_10099520 | Ga0207644_100995201 | 257 |
| 216 | 3300025935 | Ga0207709_10022753 | Ga0207709_100227533 | 257 |
| 217 | 3300025936 | Ga0207670_10402796 | Ga0207670_104027962 | 257 |
| 218 | 3300025938 | Ga0207704_10031813 | Ga0207704_100318131 | 257 |
| 219 | 3300025940 | Ga0207691_10044279 | Ga0207691_100442795 | 257 |
| 220 | 3300025941 | Ga0207711_10208386 | Ga0207711_102083862 | 257 |
| 221 | 3300025942 | Ga0207689_10011390 | Ga0207689_100113905 | 257 |
| 222 | 3300025961 | Ga0207712_10046975 | Ga0207712_100469752 | 257 |
| 223 | 3300026023 | Ga0207677_10370550 | Ga0207677_103705502 | 257 |
| 224 | 3300026035 | Ga0207703_10032728 | Ga0207703_100327283 | 257 |
| 225 | 3300026041 | Ga0207639_10025126 | Ga0207639_100251265 | 257 |
| 226 | 3300026088 | Ga0207641_10108890 | Ga0207641_101088902 | 257 |
| 227 | 3300026088 | Ga0207641_10561598 | Ga0207641_105615981 | 257 |
| 228 | 3300026089 | Ga0207648_10009383 | Ga0207648_100093835 | 257 |
| 229 | 3300026095 | Ga0207676_10390477 | Ga0207676_103904771 | 257 |
| 230 | 3300026116 | Ga0207674_10017630 | Ga0207674_100176303 | 257 |
| 231 | 3300026118 | Ga0207675_100005444 | Ga0207675_1000054441 | 257 |
| 232 | 3300026121 | Ga0207683_10370001 | Ga0207683_103700012 | 257 |
| 233 | 3300027907 | Ga0207428_10004899 | Ga0207428_100048999 | 257 |
| 234 | 3300050511 | nmdc:mga08y16_3544_c1 | nmdc:mga08y16_3544_c1_5500_6273 | 257 |
| 235 | 3300002459 | JGI24751J29686_10000085 | JGI24751J29686_1000008548 | 258 |
| 236 | 3300003203 | JGI25406J46586_10011063 | JGI25406J46586_100110632 | 258 |
| 237 | 3300005289 | Ga0065704_10004769 | Ga0065704_100047692 | 258 |
| 238 | 3300005290 | Ga0065712_10010420 | Ga0065712_100104202 | 258 |
| 239 | 3300005290 | Ga0065712_10125633 | Ga0065712_101256332 | 258 |
| 240 | 3300005293 | Ga0065715_10003956 | Ga0065715_100039563 | 258 |
| 241 | 3300005293 | Ga0065715_10122203 | Ga0065715_101222033 | 258 |
| 242 | 3300005293 | Ga0065715_10123337 | Ga0065715_101233371 | 258 |
| 243 | 3300005295 | Ga0065707_10091531 | Ga0065707_100915313 | 258 |
| 244 | 3300005330 | Ga0070690_100106789 | Ga0070690_1001067892 | 258 |
| 245 | 3300005331 | Ga0070670_100000057 | Ga0070670_100000057106 | 258 |
| 246 | 3300005331 | Ga0070670_100026732 | Ga0070670_1000267324 | 258 |
| 247 | 3300005331 | Ga0070670_100050310 | Ga0070670_1000503103 | 258 |
| 248 | 3300005331 | Ga0070670_100110634 | Ga0070670_1001106342 | 258 |
| 249 | 3300005331 | Ga0070670_100213711 | Ga0070670_1002137112 | 258 |
| 250 | 3300005334 | Ga0068869_100110724 | Ga0068869_1001107242 | 258 |
| 251 | 3300005334 | Ga0068869_100214733 | Ga0068869_1002147331 | 258 |
| 252 | 3300005335 | Ga0070666_10155874 | Ga0070666_101558742 | 258 |
| 253 | 3300005336 | Ga0070680_100319717 | Ga0070680_1003197171 | 258 |
| 254 | 3300005337 | Ga0070682_100001206 | Ga0070682_10000120610 | 258 |
| 255 | 3300005338 | Ga0068868_100106440 | Ga0068868_1001064402 | 258 |
| 256 | 3300005339 | Ga0070660_100233421 | Ga0070660_1002334212 | 258 |
| 257 | 3300005340 | Ga0070689_100030290 | Ga0070689_1000302902 | 258 |
| 258 | 3300005344 | Ga0070661_100029084 | Ga0070661_1000290843 | 258 |
| 259 | 3300005344 | Ga0070661_100353317 | Ga0070661_1003533172 | 258 |
| 260 | 3300005345 | Ga0070692_10002955 | Ga0070692_100029554 | 258 |
| 261 | 3300005345 | Ga0070692_10065754 | Ga0070692_100657542 | 258 |
| 262 | 3300005353 | Ga0070669_100010925 | Ga0070669_1000109252 | 258 |
| 263 | 3300005353 | Ga0070669_100118096 | Ga0070669_1001180961 | 258 |
| 264 | 3300005354 | Ga0070675_100112115 | Ga0070675_1001121153 | 258 |
| 265 | 3300005355 | Ga0070671_100477977 | Ga0070671_1004779771 | 258 |
| 266 | 3300005356 | Ga0070674_100541778 | Ga0070674_1005417781 | 258 |
| 267 | 3300005364 | Ga0070673_100051706 | Ga0070673_1000517061 | 258 |
| 268 | 3300005366 | Ga0070659_100002999 | Ga0070659_1000029996 | 258 |
| 269 | 3300005367 | Ga0070667_100067474 | Ga0070667_1000674742 | 258 |
| 270 | 3300005367 | Ga0070667_100183140 | Ga0070667_1001831402 | 258 |
| 271 | 3300005441 | Ga0070700_100013026 | Ga0070700_1000130263 | 258 |
| 272 | 3300005444 | Ga0070694_100025987 | Ga0070694_1000259871 | 258 |
| 273 | 3300005444 | Ga0070694_100049475 | Ga0070694_1000494752 | 258 |
| 274 | 3300005444 | Ga0070694_100157885 | Ga0070694_1001578853 | 258 |
| 275 | 3300005445 | Ga0070708_100514079 | Ga0070708_1005140792 | 258 |
| 276 | 3300005458 | Ga0070681_10018062 | Ga0070681_100180621 | 258 |
| 277 | 3300005459 | Ga0068867_100270907 | Ga0068867_1002709071 | 258 |
| 278 | 3300005459 | Ga0068867_100513930 | Ga0068867_1005139302 | 258 |
| 279 | 3300005467 | Ga0070706_100854147 | Ga0070706_1008541471 | 258 |
| 280 | 3300005471 | Ga0070698_100000916 | Ga0070698_10000091612 | 258 |
| 281 | 3300005471 | Ga0070698_100004907 | Ga0070698_10000490716 | 258 |
| 282 | 3300005518 | Ga0070699_100310977 | Ga0070699_1003109772 | 258 |
| 283 | 3300005530 | Ga0070679_100014621 | Ga0070679_1000146215 | 258 |
| 284 | 3300005536 | Ga0070697_100006099 | Ga0070697_1000060994 | 258 |
| 285 | 3300005536 | Ga0070697_100058589 | Ga0070697_1000585893 | 258 |
| 286 | 3300005539 | Ga0068853_100009751 | Ga0068853_1000097513 | 258 |
| 287 | 3300005539 | Ga0068853_100110758 | Ga0068853_1001107582 | 258 |
| 288 | 3300005544 | Ga0070686_100009506 | Ga0070686_1000095061 | 258 |
| 289 | 3300005545 | Ga0070695_100111012 | Ga0070695_1001110122 | 258 |
| 290 | 3300005546 | Ga0070696_100282769 | Ga0070696_1002827692 | 258 |
| 291 | 3300005547 | Ga0070693_100015794 | Ga0070693_1000157942 | 258 |
| 292 | 3300005549 | Ga0070704_100035319 | Ga0070704_1000353192 | 258 |
| 293 | 3300005549 | Ga0070704_100409901 | Ga0070704_1004099012 | 258 |
| 294 | 3300005563 | Ga0068855_100605770 | Ga0068855_1006057702 | 258 |
| 295 | 3300005564 | Ga0070664_100000280 | Ga0070664_10000028036 | 258 |
| 296 | 3300005564 | Ga0070664_100040842 | Ga0070664_1000408422 | 258 |
| 297 | 3300005578 | Ga0068854_100217479 | Ga0068854_1002174791 | 258 |
| 298 | 3300005578 | Ga0068854_100666344 | Ga0068854_1006663441 | 258 |
| 299 | 3300005616 | Ga0068852_100140694 | Ga0068852_1001406942 | 258 |
| 300 | 3300005616 | Ga0068852_100540037 | Ga0068852_1005400371 | 258 |
| 301 | 3300005616 | Ga0068852_100643349 | Ga0068852_1006433491 | 258 |
| 302 | 3300005617 | Ga0068859_100026938 | Ga0068859_1000269387 | 258 |
| 303 | 3300005617 | Ga0068859_100061173 | Ga0068859_1000611732 | 258 |
| 304 | 3300005617 | Ga0068859_100109989 | Ga0068859_1001099893 | 258 |
| 305 | 3300005617 | Ga0068859_100189302 | Ga0068859_1001893022 | 258 |
| 306 | 3300005617 | Ga0068859_100195755 | Ga0068859_1001957552 | 258 |
| 307 | 3300005617 | Ga0068859_100206524 | Ga0068859_1002065242 | 258 |
| 308 | 3300005617 | Ga0068859_100280038 | Ga0068859_1002800381 | 258 |
| 309 | 3300005617 | Ga0068859_100457867 | Ga0068859_1004578672 | 258 |
| 310 | 3300005618 | Ga0068864_100033299 | Ga0068864_1000332992 | 258 |
| 311 | 3300005618 | Ga0068864_100045602 | Ga0068864_1000456022 | 258 |
| 312 | 3300005718 | Ga0068866_10128428 | Ga0068866_101284281 | 258 |
| 313 | 3300005719 | Ga0068861_100121439 | Ga0068861_1001214393 | 258 |
| 314 | 3300005719 | Ga0068861_100181743 | Ga0068861_1001817433 | 258 |
| 315 | 3300005719 | Ga0068861_100211690 | Ga0068861_1002116902 | 258 |
| 316 | 3300005719 | Ga0068861_100741301 | Ga0068861_1007413011 | 258 |
| 317 | 3300005834 | Ga0068851_10095564 | Ga0068851_100955641 | 258 |
| 318 | 3300005840 | Ga0068870_10030552 | Ga0068870_100305522 | 258 |
| 319 | 3300005841 | Ga0068863_100018375 | Ga0068863_1000183752 | 258 |
| 320 | 3300005841 | Ga0068863_100037936 | Ga0068863_1000379362 | 258 |
| 321 | 3300005841 | Ga0068863_100044808 | Ga0068863_1000448085 | 258 |
| 322 | 3300005841 | Ga0068863_100596828 | Ga0068863_1005968282 | 258 |
| 323 | 3300005842 | Ga0068858_100014863 | Ga0068858_1000148631 | 258 |
| 324 | 3300005842 | Ga0068858_100056480 | Ga0068858_1000564802 | 258 |
| 325 | 3300005842 | Ga0068858_100166619 | Ga0068858_1001666193 | 258 |
| 326 | 3300005843 | Ga0068860_100107672 | Ga0068860_1001076723 | 258 |
| 327 | 3300005843 | Ga0068860_100236824 | Ga0068860_1002368242 | 258 |
| 328 | 3300005844 | Ga0068862_100209752 | Ga0068862_1002097522 | 258 |
| 329 | 3300005985 | Ga0081539_10000931 | Ga0081539_1000093143 | 258 |
| 330 | 3300006237 | Ga0097621_100001570 | Ga0097621_10000157011 | 258 |
| 331 | 3300006237 | Ga0097621_100025494 | Ga0097621_1000254942 | 258 |
| 332 | 3300006237 | Ga0097621_100235129 | Ga0097621_1002351292 | 258 |
| 333 | 3300006358 | Ga0068871_100004902 | Ga0068871_1000049025 | 258 |
| 334 | 3300006358 | Ga0068871_100458521 | Ga0068871_1004585211 | 258 |
| 335 | 3300006844 | Ga0075428_100401259 | Ga0075428_1004012592 | 258 |
| 336 | 3300006846 | Ga0075430_100164322 | Ga0075430_1001643222 | 258 |
| 337 | 3300006852 | Ga0075433_10603420 | Ga0075433_106034201 | 258 |
| 338 | 3300006871 | Ga0075434_100252270 | Ga0075434_1002522701 | 258 |
| 339 | 3300006880 | Ga0075429_100116667 | Ga0075429_1001166672 | 258 |
| 340 | 3300006880 | Ga0075429_100307330 | Ga0075429_1003073301 | 258 |
| 341 | 3300006931 | Ga0097620_100026938 | Ga0097620_1000269387 | 258 |
| 342 | 3300006931 | Ga0097620_100061173 | Ga0097620_1000611732 | 258 |
| 343 | 3300006931 | Ga0097620_100109983 | Ga0097620_1001099833 | 258 |
| 344 | 3300006931 | Ga0097620_100189300 | Ga0097620_1001893002 | 258 |
| 345 | 3300006931 | Ga0097620_100195762 | Ga0097620_1001957622 | 258 |
| 346 | 3300006931 | Ga0097620_100206534 | Ga0097620_1002065343 | 258 |
| 347 | 3300006931 | Ga0097620_100280047 | Ga0097620_1002800471 | 258 |
| 348 | 3300006931 | Ga0097620_100457887 | Ga0097620_1004578872 | 258 |
| 349 | 3300009093 | Ga0105240_10041387 | Ga0105240_100413873 | 258 |
| 350 | 3300009094 | Ga0111539_10131725 | Ga0111539_101317251 | 258 |
| 351 | 3300009098 | Ga0105245_10342591 | Ga0105245_103425911 | 258 |
| 352 | 3300009098 | Ga0105245_10886819 | Ga0105245_108868191 | 258 |
| 353 | 3300009101 | Ga0105247_10042199 | Ga0105247_100421993 | 258 |
| 354 | 3300009147 | Ga0114129_10077095 | Ga0114129_100770955 | 258 |
| 355 | 3300009147 | Ga0114129_10273284 | Ga0114129_102732843 | 258 |
| 356 | 3300009148 | Ga0105243_10311564 | Ga0105243_103115642 | 258 |
| 357 | 3300009148 | Ga0105243_10704469 | Ga0105243_107044691 | 258 |
| 358 | 3300009176 | Ga0105242_10000807 | Ga0105242_1000080714 | 258 |
| 359 | 3300009176 | Ga0105242_10108836 | Ga0105242_101088362 | 258 |
| 360 | 3300009177 | Ga0105248_10013500 | Ga0105248_100135003 | 258 |
| 361 | 3300009177 | Ga0105248_10130327 | Ga0105248_101303272 | 258 |
| 362 | 3300009177 | Ga0105248_10437898 | Ga0105248_104378981 | 258 |
| 363 | 3300009177 | Ga0105248_10526596 | Ga0105248_105265962 | 258 |
| 364 | 3300009177 | Ga0105248_10787017 | Ga0105248_107870172 | 258 |
| 365 | 3300009545 | Ga0105237_10034027 | Ga0105237_100340272 | 258 |
| 366 | 3300009545 | Ga0105237_10073202 | Ga0105237_100732022 | 258 |
| 367 | 3300009545 | Ga0105237_10322546 | Ga0105237_103225462 | 258 |
| 368 | 3300009551 | Ga0105238_10013272 | Ga0105238_100132727 | 258 |
| 369 | 3300009553 | Ga0105249_10074481 | Ga0105249_100744812 | 258 |
| 370 | 3300009553 | Ga0105249_10159769 | Ga0105249_101597692 | 258 |
| 371 | 3300009553 | Ga0105249_10192297 | Ga0105249_101922972 | 258 |
| 372 | 3300010375 | Ga0105239_10352157 | Ga0105239_103521572 | 258 |
| 373 | 3300011119 | Ga0105246_10012997 | Ga0105246_100129973 | 258 |
| 374 | 3300011119 | Ga0105246_10186646 | Ga0105246_101866462 | 258 |
| 375 | 3300013100 | Ga0157373_10004608 | Ga0157373_100046089 | 258 |
| 376 | 3300013102 | Ga0157371_10557392 | Ga0157371_105573921 | 258 |
| 377 | 3300013297 | Ga0157378_10009723 | Ga0157378_100097235 | 258 |
| 378 | 3300013297 | Ga0157378_10014643 | Ga0157378_100146432 | 258 |
| 379 | 3300013297 | Ga0157378_10033984 | Ga0157378_100339845 | 258 |
| 380 | 3300013297 | Ga0157378_10231787 | Ga0157378_102317873 | 258 |
| 381 | 3300013297 | Ga0157378_10260632 | Ga0157378_102606322 | 258 |
| 382 | 3300013306 | Ga0163162_10015538 | Ga0163162_100155384 | 258 |
| 383 | 3300013306 | Ga0163162_10038965 | Ga0163162_100389655 | 258 |
| 384 | 3300013306 | Ga0163162_10320613 | Ga0163162_103206132 | 258 |
| 385 | 3300013306 | Ga0163162_10440929 | Ga0163162_104409292 | 258 |
| 386 | 3300013306 | Ga0163162_10594381 | Ga0163162_105943812 | 258 |
| 387 | 3300013307 | Ga0157372_10043475 | Ga0157372_100434755 | 258 |
| 388 | 3300013307 | Ga0157372_10108256 | Ga0157372_101082563 | 258 |
| 389 | 3300013308 | Ga0157375_10023277 | Ga0157375_100232776 | 258 |
| 390 | 3300013308 | Ga0157375_10066328 | Ga0157375_100663285 | 258 |
| 391 | 3300013308 | Ga0157375_10463376 | Ga0157375_104633762 | 258 |
| 392 | 3300014325 | Ga0163163_10000184 | Ga0163163_1000018462 | 258 |
| 393 | 3300014325 | Ga0163163_10004533 | Ga0163163_100045335 | 258 |
| 394 | 3300014325 | Ga0163163_10005720 | Ga0163163_100057207 | 258 |
| 395 | 3300014325 | Ga0163163_10024208 | Ga0163163_100242086 | 258 |
| 396 | 3300014325 | Ga0163163_10204687 | Ga0163163_102046872 | 258 |
| 397 | 3300014326 | Ga0157380_10006388 | Ga0157380_100063885 | 258 |
| 398 | 3300014969 | Ga0157376_10015880 | Ga0157376_100158806 | 258 |
| 399 | 3300017792 | Ga0163161_10022258 | Ga0163161_100222582 | 258 |
| 400 | 3300017792 | Ga0163161_10174222 | Ga0163161_101742222 | 258 |
| 401 | 3300021384 | Ga0213876_10000043 | Ga0213876_100000433 | 258 |
| 402 | 3300025900 | Ga0207710_10009002 | Ga0207710_100090024 | 258 |
| 403 | 3300025908 | Ga0207643_10035314 | Ga0207643_100353142 | 258 |
| 404 | 3300025910 | Ga0207684_10722182 | Ga0207684_107221821 | 258 |
| 405 | 3300025912 | Ga0207707_10310225 | Ga0207707_103102251 | 258 |
| 406 | 3300025913 | Ga0207695_10097543 | Ga0207695_100975434 | 258 |
| 407 | 3300025914 | Ga0207671_10002740 | Ga0207671_100027403 | 258 |
| 408 | 3300025914 | Ga0207671_10088224 | Ga0207671_100882242 | 258 |
| 409 | 3300025914 | Ga0207671_10415242 | Ga0207671_104152422 | 258 |
| 410 | 3300025918 | Ga0207662_10025954 | Ga0207662_100259545 | 258 |
| 411 | 3300025918 | Ga0207662_10081775 | Ga0207662_100817753 | 258 |
| 412 | 3300025921 | Ga0207652_10081877 | Ga0207652_100818773 | 258 |
| 413 | 3300025922 | Ga0207646_10226111 | Ga0207646_102261112 | 258 |
| 414 | 3300025923 | Ga0207681_10007662 | Ga0207681_100076626 | 258 |
| 415 | 3300025923 | Ga0207681_10078357 | Ga0207681_100783573 | 258 |
| 416 | 3300025924 | Ga0207694_10015740 | Ga0207694_100157405 | 258 |
| 417 | 3300025925 | Ga0207650_10000027 | Ga0207650_100000273 | 258 |
| 418 | 3300025925 | Ga0207650_10000623 | Ga0207650_100006234 | 258 |
| 419 | 3300025925 | Ga0207650_10072198 | Ga0207650_100721982 | 258 |
| 420 | 3300025925 | Ga0207650_10546565 | Ga0207650_105465652 | 258 |
| 421 | 3300025926 | Ga0207659_10098422 | Ga0207659_100984222 | 258 |
| 422 | 3300025931 | Ga0207644_10020094 | Ga0207644_100200942 | 258 |
| 423 | 3300025931 | Ga0207644_10229957 | Ga0207644_102299572 | 258 |
| 424 | 3300025934 | Ga0207686_10001492 | Ga0207686_100014925 | 258 |
| 425 | 3300025935 | Ga0207709_10120115 | Ga0207709_101201152 | 258 |
| 426 | 3300025940 | Ga0207691_10023812 | Ga0207691_100238125 | 258 |
| 427 | 3300025941 | Ga0207711_10009657 | Ga0207711_100096575 | 258 |
| 428 | 3300025941 | Ga0207711_10054024 | Ga0207711_100540242 | 258 |
| 429 | 3300025941 | Ga0207711_10658746 | Ga0207711_106587461 | 258 |
| 430 | 3300025942 | Ga0207689_10045330 | Ga0207689_100453304 | 258 |
| 431 | 3300025942 | Ga0207689_10202658 | Ga0207689_102026582 | 258 |
| 432 | 3300025945 | Ga0207679_10055065 | Ga0207679_100550652 | 258 |
| 433 | 3300025949 | Ga0207667_10549017 | Ga0207667_105490172 | 258 |
| 434 | 3300025960 | Ga0207651_10043386 | Ga0207651_100433862 | 258 |
| 435 | 3300025960 | Ga0207651_10107459 | Ga0207651_101074593 | 258 |
| 436 | 3300025960 | Ga0207651_10395093 | Ga0207651_103950932 | 258 |
| 437 | 3300025961 | Ga0207712_10016341 | Ga0207712_100163412 | 258 |
| 438 | 3300025961 | Ga0207712_10170114 | Ga0207712_101701143 | 258 |
| 439 | 3300025981 | Ga0207640_10213101 | Ga0207640_102131012 | 258 |
| 440 | 3300025986 | Ga0207658_10023337 | Ga0207658_100233372 | 258 |
| 441 | 3300025986 | Ga0207658_10125671 | Ga0207658_101256713 | 258 |
| 442 | 3300026035 | Ga0207703_10006636 | Ga0207703_100066367 | 258 |
| 443 | 3300026035 | Ga0207703_10055950 | Ga0207703_100559504 | 258 |
| 444 | 3300026035 | Ga0207703_10396280 | Ga0207703_103962801 | 258 |
| 445 | 3300026035 | Ga0207703_10580467 | Ga0207703_105804671 | 258 |
| 446 | 3300026041 | Ga0207639_10153298 | Ga0207639_101532981 | 258 |
| 447 | 3300026067 | Ga0207678_10140884 | Ga0207678_101408843 | 258 |
| 448 | 3300026075 | Ga0207708_10022826 | Ga0207708_100228263 | 258 |
| 449 | 3300026088 | Ga0207641_10005244 | Ga0207641_100052447 | 258 |
| 450 | 3300026088 | Ga0207641_10157747 | Ga0207641_101577473 | 258 |
| 451 | 3300026089 | Ga0207648_10102424 | Ga0207648_101024243 | 258 |
| 452 | 3300026089 | Ga0207648_10428139 | Ga0207648_104281391 | 258 |
| 453 | 3300026095 | Ga0207676_10001919 | Ga0207676_100019199 | 258 |
| 454 | 3300026095 | Ga0207676_10006195 | Ga0207676_100061957 | 258 |
| 455 | 3300026095 | Ga0207676_10469703 | Ga0207676_104697032 | 258 |
| 456 | 3300026095 | Ga0207676_10528971 | Ga0207676_105289711 | 258 |
| 457 | 3300026095 | Ga0207676_10558310 | Ga0207676_105583102 | 258 |
| 458 | 3300026116 | Ga0207674_10000525 | Ga0207674_100005257 | 258 |
| 459 | 3300026118 | Ga0207675_100017262 | Ga0207675_1000172621 | 258 |
| 460 | 3300026142 | Ga0207698_10826949 | Ga0207698_108269491 | 258 |
| 461 | 3300027907 | Ga0207428_10005514 | Ga0207428_1000551414 | 258 |
| 462 | 3300028380 | Ga0268265_10003630 | Ga0268265_1000363012 | 258 |
| 463 | 3300028381 | Ga0268264_10019417 | Ga0268264_100194173 | 258 |
| 464 | 3300028381 | Ga0268264_10351733 | Ga0268264_103517331 | 258 |
| 465 | 3300028381 | Ga0268264_10381543 | Ga0268264_103815432 | 258 |
| 466 | 3300031731 | Ga0307405_10549987 | Ga0307405_105499871 | 258 |
| 467 | 3300031824 | Ga0307413_10172345 | Ga0307413_101723451 | 258 |
| 468 | 3300031852 | Ga0307410_10250672 | Ga0307410_102506722 | 258 |
| 469 | 3300031911 | Ga0307412_10056920 | Ga0307412_100569203 | 258 |
| 470 | 3300032002 | Ga0307416_100197179 | Ga0307416_1001971792 | 258 |
| 471 | 3300035088 | Ga0373940_0035690 | Ga0373940_0035690_98_874 | 258 |
| 472 | 3300035091 | Ga0373951_0003754 | Ga0373951_0003754_378_1160 | 258 |
| 473 | 3300035117 | Ga0373953_0055114 | Ga0373953_0055114_673_1455 | 258 |
| 474 | 3300035207 | Ga0373942_0024221 | Ga0373942_0024221_473_1249 | 258 |
| 475 | 3300036401 | Ga0373937_0089715 | Ga0373937_0089715_1487_2269 | 258 |
| 476 | 3300037418 | Ga0395900_0649130 | Ga0395900_0649130_64_840 | 258 |
| 477 | 3300039437 | Ga0436365_0421852 | Ga0436365_0421852_2328_3113 | 258 |
| 478 | 3300050507 | nmdc:mga05p37_166487_c1 | nmdc:mga05p37_166487_c1_1367_2143 | 258 |
| 479 | 3300050508 | nmdc:mga09592_122616_c1 | nmdc:mga09592_122616_c1_650_1426 | 258 |
| 480 | 3300050508 | nmdc:mga09592_234598_c1 | nmdc:mga09592_234598_c1_666_1451 | 258 |
| 481 | 3300050508 | nmdc:mga09592_288863_c1 | nmdc:mga09592_288863_c1_81_872 | 258 |
| 482 | 3300050512 | nmdc:mga0n895_603749_c1 | nmdc:mga0n895_603749_c1_121_933 | 258 |
| 483 | 3300050515 | nmdc:mga0a205_175950_c1 | nmdc:mga0a205_175950_c1_621_1433 | 258 |
| 484 | 3300050515 | nmdc:mga0a205_214547_c1 | nmdc:mga0a205_214547_c1_896_1708 | 258 |
| 485 | 3300001426 | JGI24030J14995_100170 | JGI24030J14995_1001701 | 259 |
| 486 | 3300001432 | JGI24034J14986_101130 | JGI24034J14986_1011302 | 259 |
| 487 | 3300002074 | JGI24748J21848_1000003 | JGI24748J21848_1000003158 | 259 |
| 488 | 3300002239 | JGI24034J26672_10000005 | JGI24034J26672_10000005243 | 259 |
| 489 | 3300003203 | JGI25406J46586_10000438 | JGI25406J46586_100004385 | 259 |
| 490 | 3300005288 | Ga0065714_10064444 | Ga0065714_1006444477 | 259 |
| 491 | 3300005290 | Ga0065712_10067736 | Ga0065712_1006773623 | 259 |
| 492 | 3300005290 | Ga0065712_10242113 | Ga0065712_102421131 | 259 |
| 493 | 3300005293 | Ga0065715_10090715 | Ga0065715_100907156 | 259 |
| 494 | 3300005327 | Ga0070658_10008799 | Ga0070658_100087995 | 259 |
| 495 | 3300005330 | Ga0070690_100002320 | Ga0070690_1000023206 | 259 |
| 496 | 3300005330 | Ga0070690_100081286 | Ga0070690_1000812862 | 259 |
| 497 | 3300005331 | Ga0070670_100088040 | Ga0070670_1000880403 | 259 |
| 498 | 3300005331 | Ga0070670_100128392 | Ga0070670_1001283922 | 259 |
| 499 | 3300005334 | Ga0068869_100013570 | Ga0068869_1000135703 | 259 |
| 500 | 3300005334 | Ga0068869_100129407 | Ga0068869_1001294072 | 259 |
| 501 | 3300005334 | Ga0068869_100183434 | Ga0068869_1001834342 | 259 |
| 502 | 3300005336 | Ga0070680_100004835 | Ga0070680_1000048356 | 259 |
| 503 | 3300005336 | Ga0070680_100253433 | Ga0070680_1002534332 | 259 |
| 504 | 3300005337 | Ga0070682_100000068 | Ga0070682_10000006863 | 259 |
| 505 | 3300005338 | Ga0068868_100052164 | Ga0068868_1000521643 | 259 |
| 506 | 3300005340 | Ga0070689_100000292 | Ga0070689_1000002921 | 259 |
| 507 | 3300005340 | Ga0070689_100477160 | Ga0070689_1004771601 | 259 |
| 508 | 3300005345 | Ga0070692_10045813 | Ga0070692_100458132 | 259 |
| 509 | 3300005347 | Ga0070668_100006439 | Ga0070668_1000064396 | 259 |
| 510 | 3300005354 | Ga0070675_100392041 | Ga0070675_1003920411 | 259 |
| 511 | 3300005355 | Ga0070671_100005420 | Ga0070671_1000054207 | 259 |
| 512 | 3300005355 | Ga0070671_100030391 | Ga0070671_1000303913 | 259 |
| 513 | 3300005355 | Ga0070671_100557814 | Ga0070671_1005578141 | 259 |
| 514 | 3300005364 | Ga0070673_100192708 | Ga0070673_1001927082 | 259 |
| 515 | 3300005406 | Ga0070703_10000036 | Ga0070703_1000003615 | 259 |
| 516 | 3300005438 | Ga0070701_10037404 | Ga0070701_100374042 | 259 |
| 517 | 3300005440 | Ga0070705_100144075 | Ga0070705_1001440752 | 259 |
| 518 | 3300005440 | Ga0070705_100420960 | Ga0070705_1004209602 | 259 |
| 519 | 3300005441 | Ga0070700_100000305 | Ga0070700_10000030520 | 259 |
| 520 | 3300005441 | Ga0070700_100013485 | Ga0070700_1000134852 | 259 |
| 521 | 3300005441 | Ga0070700_100066109 | Ga0070700_1000661093 | 259 |
| 522 | 3300005444 | Ga0070694_100003401 | Ga0070694_1000034019 | 259 |
| 523 | 3300005444 | Ga0070694_100012648 | Ga0070694_1000126482 | 259 |
| 524 | 3300005444 | Ga0070694_100053308 | Ga0070694_1000533082 | 259 |
| 525 | 3300005445 | Ga0070708_100000002 | Ga0070708_100000002122 | 259 |
| 526 | 3300005445 | Ga0070708_100272617 | Ga0070708_1002726171 | 259 |
| 527 | 3300005457 | Ga0070662_100122203 | Ga0070662_1001222032 | 259 |
| 528 | 3300005458 | Ga0070681_10000041 | Ga0070681_1000004135 | 259 |
| 529 | 3300005458 | Ga0070681_10029594 | Ga0070681_100295944 | 259 |
| 530 | 3300005458 | Ga0070681_10056272 | Ga0070681_100562723 | 259 |
| 531 | 3300005458 | Ga0070681_10408994 | Ga0070681_104089942 | 259 |
| 532 | 3300005467 | Ga0070706_100000002 | Ga0070706_100000002166 | 259 |
| 533 | 3300005467 | Ga0070706_100005846 | Ga0070706_1000058463 | 259 |
| 534 | 3300005467 | Ga0070706_100013151 | Ga0070706_1000131513 | 259 |
| 535 | 3300005467 | Ga0070706_100018943 | Ga0070706_1000189437 | 259 |
| 536 | 3300005467 | Ga0070706_100065565 | Ga0070706_1000655653 | 259 |
| 537 | 3300005468 | Ga0070707_100000167 | Ga0070707_10000016722 | 259 |
| 538 | 3300005468 | Ga0070707_100007291 | Ga0070707_1000072912 | 259 |
| 539 | 3300005468 | Ga0070707_100144200 | Ga0070707_1001442002 | 259 |
| 540 | 3300005468 | Ga0070707_100276880 | Ga0070707_1002768802 | 259 |
| 541 | 3300005468 | Ga0070707_100378087 | Ga0070707_1003780872 | 259 |
| 542 | 3300005471 | Ga0070698_100000164 | Ga0070698_10000016414 | 259 |
| 543 | 3300005471 | Ga0070698_100002314 | Ga0070698_10000231422 | 259 |
| 544 | 3300005471 | Ga0070698_100010410 | Ga0070698_1000104108 | 259 |
| 545 | 3300005471 | Ga0070698_100059613 | Ga0070698_1000596131 | 259 |
| 546 | 3300005471 | Ga0070698_100138191 | Ga0070698_1001381911 | 259 |
| 547 | 3300005518 | Ga0070699_100000169 | Ga0070699_10000016942 | 259 |
| 548 | 3300005518 | Ga0070699_100000483 | Ga0070699_1000004838 | 259 |
| 549 | 3300005518 | Ga0070699_100059794 | Ga0070699_1000597944 | 259 |
| 550 | 3300005518 | Ga0070699_100061167 | Ga0070699_1000611672 | 259 |
| 551 | 3300005518 | Ga0070699_100198725 | Ga0070699_1001987253 | 259 |
| 552 | 3300005530 | Ga0070679_100000074 | Ga0070679_10000007462 | 259 |
| 553 | 3300005536 | Ga0070697_100000071 | Ga0070697_10000007111 | 259 |
| 554 | 3300005536 | Ga0070697_100008492 | Ga0070697_1000084922 | 259 |
| 555 | 3300005536 | Ga0070697_100013343 | Ga0070697_1000133431 | 259 |
| 556 | 3300005536 | Ga0070697_100203799 | Ga0070697_1002037991 | 259 |
| 557 | 3300005536 | Ga0070697_100351578 | Ga0070697_1003515781 | 259 |
| 558 | 3300005536 | Ga0070697_100656103 | Ga0070697_1006561031 | 259 |
| 559 | 3300005539 | Ga0068853_100018350 | Ga0068853_1000183504 | 259 |
| 560 | 3300005544 | Ga0070686_100006607 | Ga0070686_1000066073 | 259 |
| 561 | 3300005545 | Ga0070695_100434657 | Ga0070695_1004346571 | 259 |
| 562 | 3300005546 | Ga0070696_100014172 | Ga0070696_1000141723 | 259 |
| 563 | 3300005546 | Ga0070696_100017420 | Ga0070696_1000174205 | 259 |
| 564 | 3300005546 | Ga0070696_100133512 | Ga0070696_1001335122 | 259 |
| 565 | 3300005546 | Ga0070696_100259934 | Ga0070696_1002599341 | 259 |
| 566 | 3300005547 | Ga0070693_100204293 | Ga0070693_1002042932 | 259 |
| 567 | 3300005549 | Ga0070704_100003508 | Ga0070704_1000035083 | 259 |
| 568 | 3300005549 | Ga0070704_100035616 | Ga0070704_1000356162 | 259 |
| 569 | 3300005549 | Ga0070704_100092735 | Ga0070704_1000927352 | 259 |
| 570 | 3300005549 | Ga0070704_100367951 | Ga0070704_1003679512 | 259 |
| 571 | 3300005564 | Ga0070664_100524113 | Ga0070664_1005241132 | 259 |
| 572 | 3300005577 | Ga0068857_100579234 | Ga0068857_1005792342 | 259 |
| 573 | 3300005578 | Ga0068854_100056328 | Ga0068854_1000563282 | 259 |
| 574 | 3300005578 | Ga0068854_100234550 | Ga0068854_1002345501 | 259 |
| 575 | 3300005578 | Ga0068854_100357432 | Ga0068854_1003574322 | 259 |
| 576 | 3300005615 | Ga0070702_100028198 | Ga0070702_1000281982 | 259 |
| 577 | 3300005616 | Ga0068852_100313932 | Ga0068852_1003139322 | 259 |
| 578 | 3300005617 | Ga0068859_100035651 | Ga0068859_1000356515 | 259 |
| 579 | 3300005617 | Ga0068859_100045900 | Ga0068859_1000459003 | 259 |
| 580 | 3300005617 | Ga0068859_100103052 | Ga0068859_1001030522 | 259 |
| 581 | 3300005617 | Ga0068859_100175866 | Ga0068859_1001758662 | 259 |
| 582 | 3300005617 | Ga0068859_100179404 | Ga0068859_1001794042 | 259 |
| 583 | 3300005617 | Ga0068859_100810579 | Ga0068859_1008105791 | 259 |
| 584 | 3300005618 | Ga0068864_100207507 | Ga0068864_1002075072 | 259 |
| 585 | 3300005618 | Ga0068864_100439737 | Ga0068864_1004397371 | 259 |
| 586 | 3300005718 | Ga0068866_10053147 | Ga0068866_100531472 | 259 |
| 587 | 3300005719 | Ga0068861_100029995 | Ga0068861_1000299953 | 259 |
| 588 | 3300005840 | Ga0068870_10370093 | Ga0068870_103700931 | 259 |
| 589 | 3300005841 | Ga0068863_100046793 | Ga0068863_1000467933 | 259 |
| 590 | 3300005841 | Ga0068863_100061232 | Ga0068863_1000612325 | 259 |
| 591 | 3300005841 | Ga0068863_100082478 | Ga0068863_1000824782 | 259 |
| 592 | 3300005841 | Ga0068863_100362025 | Ga0068863_1003620252 | 259 |
| 593 | 3300005842 | Ga0068858_100000134 | Ga0068858_1000001342 | 259 |
| 594 | 3300005842 | Ga0068858_100041991 | Ga0068858_1000419912 | 259 |
| 595 | 3300005842 | Ga0068858_100129545 | Ga0068858_1001295452 | 259 |
| 596 | 3300005842 | Ga0068858_100462773 | Ga0068858_1004627732 | 259 |
| 597 | 3300005843 | Ga0068860_100006276 | Ga0068860_1000062762 | 259 |
| 598 | 3300005843 | Ga0068860_100191474 | Ga0068860_1001914742 | 259 |
| 599 | 3300005843 | Ga0068860_100543992 | Ga0068860_1005439922 | 259 |
| 600 | 3300005844 | Ga0068862_100101196 | Ga0068862_1001011961 | 259 |
| 601 | 3300005844 | Ga0068862_100118142 | Ga0068862_1001181423 | 259 |
| 602 | 3300005985 | Ga0081539_10000731 | Ga0081539_1000073140 | 259 |
| 603 | 3300006163 | Ga0070715_10000018 | Ga0070715_1000001868 | 259 |
| 604 | 3300006173 | Ga0070716_100000017 | Ga0070716_10000001742 | 259 |
| 605 | 3300006173 | Ga0070716_100033150 | Ga0070716_1000331503 | 259 |
| 606 | 3300006173 | Ga0070716_100298041 | Ga0070716_1002980411 | 259 |
| 607 | 3300006237 | Ga0097621_100003941 | Ga0097621_1000039415 | 259 |
| 608 | 3300006358 | Ga0068871_100003493 | Ga0068871_1000034935 | 259 |
| 609 | 3300006844 | Ga0075428_100529982 | Ga0075428_1005299822 | 259 |
| 610 | 3300006852 | Ga0075433_10023132 | Ga0075433_100231323 | 259 |
| 611 | 3300006852 | Ga0075433_10238450 | Ga0075433_102384502 | 259 |
| 612 | 3300006852 | Ga0075433_10312900 | Ga0075433_103129001 | 259 |
| 613 | 3300006871 | Ga0075434_100195837 | Ga0075434_1001958372 | 259 |
| 614 | 3300006871 | Ga0075434_100398827 | Ga0075434_1003988271 | 259 |
| 615 | 3300006871 | Ga0075434_100479746 | Ga0075434_1004797462 | 259 |
| 616 | 3300006881 | Ga0068865_100030118 | Ga0068865_1000301183 | 259 |
| 617 | 3300006881 | Ga0068865_100080047 | Ga0068865_1000800473 | 259 |
| 618 | 3300006914 | Ga0075436_100000011 | Ga0075436_1000000114 | 259 |
| 619 | 3300006914 | Ga0075436_100386850 | Ga0075436_1003868502 | 259 |
| 620 | 3300006931 | Ga0097620_100035652 | Ga0097620_1000356522 | 259 |
| 621 | 3300006931 | Ga0097620_100045900 | Ga0097620_1000459003 | 259 |
| 622 | 3300006931 | Ga0097620_100103046 | Ga0097620_1001030462 | 259 |
| 623 | 3300006931 | Ga0097620_100175870 | Ga0097620_1001758702 | 259 |
| 624 | 3300006931 | Ga0097620_100179393 | Ga0097620_1001793933 | 259 |
| 625 | 3300006931 | Ga0097620_100810591 | Ga0097620_1008105911 | 259 |
| 626 | 3300007076 | Ga0075435_100009513 | Ga0075435_1000095134 | 259 |
| 627 | 3300007265 | Ga0099794_10027450 | Ga0099794_100274505 | 259 |
| 628 | 3300009094 | Ga0111539_10179811 | Ga0111539_101798113 | 259 |
| 629 | 3300009098 | Ga0105245_10094357 | Ga0105245_100943571 | 259 |
| 630 | 3300009101 | Ga0105247_10000022 | Ga0105247_10000022149 | 259 |
| 631 | 3300009101 | Ga0105247_10003696 | Ga0105247_100036965 | 259 |
| 632 | 3300009101 | Ga0105247_10056432 | Ga0105247_100564322 | 259 |
| 633 | 3300009147 | Ga0114129_10128631 | Ga0114129_101286313 | 259 |
| 634 | 3300009147 | Ga0114129_10169017 | Ga0114129_101690172 | 259 |
| 635 | 3300009147 | Ga0114129_10198008 | Ga0114129_101980082 | 259 |
| 636 | 3300009147 | Ga0114129_10399162 | Ga0114129_103991621 | 259 |
| 637 | 3300009147 | Ga0114129_10489936 | Ga0114129_104899361 | 259 |
| 638 | 3300009148 | Ga0105243_10000102 | Ga0105243_100001026 | 259 |
| 639 | 3300009148 | Ga0105243_10000207 | Ga0105243_1000020729 | 259 |
| 640 | 3300009148 | Ga0105243_10219470 | Ga0105243_102194702 | 259 |
| 641 | 3300009148 | Ga0105243_10231840 | Ga0105243_102318402 | 259 |
| 642 | 3300009174 | Ga0105241_10019871 | Ga0105241_100198715 | 259 |
| 643 | 3300009174 | Ga0105241_10779524 | Ga0105241_107795241 | 259 |
| 644 | 3300009176 | Ga0105242_10000279 | Ga0105242_100002795 | 259 |
| 645 | 3300009176 | Ga0105242_10005822 | Ga0105242_100058223 | 259 |
| 646 | 3300009177 | Ga0105248_10004786 | Ga0105248_1000478614 | 259 |
| 647 | 3300009177 | Ga0105248_10116314 | Ga0105248_101163143 | 259 |
| 648 | 3300009553 | Ga0105249_10000254 | Ga0105249_1000025441 | 259 |
| 649 | 3300009553 | Ga0105249_10180798 | Ga0105249_101807982 | 259 |
| 650 | 3300009553 | Ga0105249_10679044 | Ga0105249_106790441 | 259 |
| 651 | 3300010375 | Ga0105239_10135754 | Ga0105239_101357543 | 259 |
| 652 | 3300010375 | Ga0105239_10601699 | Ga0105239_106016992 | 259 |
| 653 | 3300011119 | Ga0105246_10253604 | Ga0105246_102536042 | 259 |
| 654 | 3300013100 | Ga0157373_10172215 | Ga0157373_101722152 | 259 |
| 655 | 3300013100 | Ga0157373_10222501 | Ga0157373_102225012 | 259 |
| 656 | 3300013296 | Ga0157374_10037875 | Ga0157374_100378753 | 259 |
| 657 | 3300013296 | Ga0157374_10173327 | Ga0157374_101733272 | 259 |
| 658 | 3300013297 | Ga0157378_10000191 | Ga0157378_1000019118 | 259 |
| 659 | 3300013297 | Ga0157378_10024594 | Ga0157378_100245942 | 259 |
| 660 | 3300013297 | Ga0157378_10085582 | Ga0157378_100855823 | 259 |
| 661 | 3300013297 | Ga0157378_10147662 | Ga0157378_101476622 | 259 |
| 662 | 3300013297 | Ga0157378_10505085 | Ga0157378_105050851 | 259 |
| 663 | 3300013297 | Ga0157378_10818482 | Ga0157378_108184821 | 259 |
| 664 | 3300013306 | Ga0163162_10000179 | Ga0163162_1000017941 | 259 |
| 665 | 3300013306 | Ga0163162_10042270 | Ga0163162_100422705 | 259 |
| 666 | 3300013306 | Ga0163162_10075719 | Ga0163162_100757192 | 259 |
| 667 | 3300013306 | Ga0163162_10082924 | Ga0163162_100829242 | 259 |
| 668 | 3300013306 | Ga0163162_10124137 | Ga0163162_101241373 | 259 |
| 669 | 3300013306 | Ga0163162_10238326 | Ga0163162_102383263 | 259 |
| 670 | 3300013307 | Ga0157372_10044452 | Ga0157372_100444524 | 259 |
| 671 | 3300013308 | Ga0157375_10004435 | Ga0157375_1000443510 | 259 |
| 672 | 3300013308 | Ga0157375_10021549 | Ga0157375_100215493 | 259 |
| 673 | 3300013308 | Ga0157375_10093322 | Ga0157375_100933225 | 259 |
| 674 | 3300014325 | Ga0163163_10012406 | Ga0163163_100124069 | 259 |
| 675 | 3300014325 | Ga0163163_10104265 | Ga0163163_101042652 | 259 |
| 676 | 3300014326 | Ga0157380_10000627 | Ga0157380_100006277 | 259 |
| 677 | 3300014326 | Ga0157380_10003949 | Ga0157380_100039496 | 259 |
| 678 | 3300014326 | Ga0157380_10047258 | Ga0157380_100472583 | 259 |
| 679 | 3300014968 | Ga0157379_10090990 | Ga0157379_100909903 | 259 |
| 680 | 3300014969 | Ga0157376_10038847 | Ga0157376_100388474 | 259 |
| 681 | 3300017792 | Ga0163161_10343028 | Ga0163161_103430282 | 259 |
| 682 | 3300021384 | Ga0213876_10000228 | Ga0213876_1000022819 | 259 |
| 683 | 3300025223 | Ga0207672_1000046 | Ga0207672_100004611 | 259 |
| 684 | 3300025885 | Ga0207653_10000008 | Ga0207653_10000008154 | 259 |
| 685 | 3300025899 | Ga0207642_10136482 | Ga0207642_101364822 | 259 |
| 686 | 3300025900 | Ga0207710_10000001 | Ga0207710_10000001256 | 259 |
| 687 | 3300025905 | Ga0207685_10000022 | Ga0207685_1000002239 | 259 |
| 688 | 3300025908 | Ga0207643_10009459 | Ga0207643_100094597 | 259 |
| 689 | 3300025909 | Ga0207705_10026077 | Ga0207705_100260772 | 259 |
| 690 | 3300025910 | Ga0207684_10000076 | Ga0207684_1000007651 | 259 |
| 691 | 3300025910 | Ga0207684_10014326 | Ga0207684_100143261 | 259 |
| 692 | 3300025910 | Ga0207684_10080999 | Ga0207684_100809993 | 259 |
| 693 | 3300025911 | Ga0207654_10475760 | Ga0207654_104757601 | 259 |
| 694 | 3300025912 | Ga0207707_10000077 | Ga0207707_1000007743 | 259 |
| 695 | 3300025912 | Ga0207707_10010071 | Ga0207707_100100713 | 259 |
| 696 | 3300025912 | Ga0207707_10017193 | Ga0207707_100171933 | 259 |
| 697 | 3300025912 | Ga0207707_10027372 | Ga0207707_100273722 | 259 |
| 698 | 3300025921 | Ga0207652_10000096 | Ga0207652_1000009641 | 259 |
| 699 | 3300025921 | Ga0207652_10247382 | Ga0207652_102473822 | 259 |
| 700 | 3300025922 | Ga0207646_10001426 | Ga0207646_1000142614 | 259 |
| 701 | 3300025922 | Ga0207646_10022181 | Ga0207646_100221814 | 259 |
| 702 | 3300025922 | Ga0207646_10278437 | Ga0207646_102784372 | 259 |
| 703 | 3300025922 | Ga0207646_10329243 | Ga0207646_103292431 | 259 |
| 704 | 3300025923 | Ga0207681_10091343 | Ga0207681_100913431 | 259 |
| 705 | 3300025925 | Ga0207650_10027728 | Ga0207650_100277283 | 259 |
| 706 | 3300025925 | Ga0207650_10413232 | Ga0207650_104132322 | 259 |
| 707 | 3300025927 | Ga0207687_10153793 | Ga0207687_101537931 | 259 |
| 708 | 3300025931 | Ga0207644_10002044 | Ga0207644_100020447 | 259 |
| 709 | 3300025931 | Ga0207644_10025578 | Ga0207644_100255785 | 259 |
| 710 | 3300025934 | Ga0207686_10000062 | Ga0207686_100000626 | 259 |
| 711 | 3300025934 | Ga0207686_10007557 | Ga0207686_100075574 | 259 |
| 712 | 3300025935 | Ga0207709_10000091 | Ga0207709_1000009177 | 259 |
| 713 | 3300025936 | Ga0207670_10041254 | Ga0207670_100412542 | 259 |
| 714 | 3300025938 | Ga0207704_10117842 | Ga0207704_101178422 | 259 |
| 715 | 3300025939 | Ga0207665_10000033 | Ga0207665_1000003342 | 259 |
| 716 | 3300025939 | Ga0207665_10036012 | Ga0207665_100360122 | 259 |
| 717 | 3300025939 | Ga0207665_10308283 | Ga0207665_103082832 | 259 |
| 718 | 3300025939 | Ga0207665_10315161 | Ga0207665_103151611 | 259 |
| 719 | 3300025940 | Ga0207691_10264776 | Ga0207691_102647762 | 259 |
| 720 | 3300025941 | Ga0207711_10004896 | Ga0207711_100048968 | 259 |
| 721 | 3300025941 | Ga0207711_10044876 | Ga0207711_100448762 | 259 |
| 722 | 3300025941 | Ga0207711_10223831 | Ga0207711_102238312 | 259 |
| 723 | 3300025942 | Ga0207689_10006262 | Ga0207689_100062624 | 259 |
| 724 | 3300025942 | Ga0207689_10051986 | Ga0207689_100519862 | 259 |
| 725 | 3300025942 | Ga0207689_10088648 | Ga0207689_100886482 | 259 |
| 726 | 3300025960 | Ga0207651_10070141 | Ga0207651_100701412 | 259 |
| 727 | 3300025961 | Ga0207712_10000781 | Ga0207712_100007811 | 259 |
| 728 | 3300025961 | Ga0207712_10015035 | Ga0207712_100150353 | 259 |
| 729 | 3300025972 | Ga0207668_10010711 | Ga0207668_100107112 | 259 |
| 730 | 3300025981 | Ga0207640_10135686 | Ga0207640_101356862 | 259 |
| 731 | 3300025981 | Ga0207640_10223310 | Ga0207640_102233102 | 259 |
| 732 | 3300025986 | Ga0207658_10277046 | Ga0207658_102770462 | 259 |
| 733 | 3300026035 | Ga0207703_10000481 | Ga0207703_1000048141 | 259 |
| 734 | 3300026035 | Ga0207703_10015662 | Ga0207703_100156624 | 259 |
| 735 | 3300026035 | Ga0207703_10059809 | Ga0207703_100598092 | 259 |
| 736 | 3300026035 | Ga0207703_10234759 | Ga0207703_102347592 | 259 |
| 737 | 3300026041 | Ga0207639_10038113 | Ga0207639_100381134 | 259 |
| 738 | 3300026041 | Ga0207639_10058152 | Ga0207639_100581522 | 259 |
| 739 | 3300026075 | Ga0207708_10000235 | Ga0207708_1000023529 | 259 |
| 740 | 3300026075 | Ga0207708_10015082 | Ga0207708_100150823 | 259 |
| 741 | 3300026075 | Ga0207708_10039853 | Ga0207708_100398534 | 259 |
| 742 | 3300026075 | Ga0207708_10088520 | Ga0207708_100885203 | 259 |
| 743 | 3300026075 | Ga0207708_10522704 | Ga0207708_105227041 | 259 |
| 744 | 3300026088 | Ga0207641_10062794 | Ga0207641_100627943 | 259 |
| 745 | 3300026088 | Ga0207641_10124678 | Ga0207641_101246781 | 259 |
| 746 | 3300026088 | Ga0207641_10317875 | Ga0207641_103178751 | 259 |
| 747 | 3300026089 | Ga0207648_10145571 | Ga0207648_101455712 | 259 |
| 748 | 3300026095 | Ga0207676_10076835 | Ga0207676_100768352 | 259 |
| 749 | 3300026095 | Ga0207676_10578753 | Ga0207676_105787532 | 259 |
| 750 | 3300026118 | Ga0207675_100001552 | Ga0207675_10000155216 | 259 |
| 751 | 3300026118 | Ga0207675_100160160 | Ga0207675_1001601603 | 259 |
| 752 | 3300026118 | Ga0207675_100229015 | Ga0207675_1002290152 | 259 |
| 753 | 3300027671 | Ga0209588_1009760 | Ga0209588_10097605 | 259 |
| 754 | 3300028380 | Ga0268265_10158559 | Ga0268265_101585592 | 259 |
| 755 | 3300028381 | Ga0268264_10005319 | Ga0268264_100053192 | 259 |
| 756 | 3300028381 | Ga0268264_10006931 | Ga0268264_100069313 | 259 |
| 757 | 3300028381 | Ga0268264_10303390 | Ga0268264_103033902 | 259 |
| 758 | 3300028381 | Ga0268264_10317935 | Ga0268264_103179352 | 259 |
| 759 | 3300031548 | Ga0307408_100008854 | Ga0307408_1000088545 | 259 |
| 760 | 3300031548 | Ga0307408_100190798 | Ga0307408_1001907982 | 259 |
| 761 | 3300031731 | Ga0307405_10004255 | Ga0307405_100042555 | 259 |
| 762 | 3300031731 | Ga0307405_10098022 | Ga0307405_100980222 | 259 |
| 763 | 3300031731 | Ga0307405_10298622 | Ga0307405_102986222 | 259 |
| 764 | 3300031824 | Ga0307413_10018801 | Ga0307413_100188014 | 259 |
| 765 | 3300031852 | Ga0307410_10013140 | Ga0307410_100131405 | 259 |
| 766 | 3300031852 | Ga0307410_10017066 | Ga0307410_100170664 | 259 |
| 767 | 3300031901 | Ga0307406_10011489 | Ga0307406_100114894 | 259 |
| 768 | 3300031901 | Ga0307406_10014727 | Ga0307406_100147274 | 259 |
| 769 | 3300031903 | Ga0307407_10007946 | Ga0307407_100079462 | 259 |
| 770 | 3300031911 | Ga0307412_10052512 | Ga0307412_100525124 | 259 |
| 771 | 3300031911 | Ga0307412_10085572 | Ga0307412_100855722 | 259 |
| 772 | 3300031995 | Ga0307409_100006264 | Ga0307409_1000062644 | 259 |
| 773 | 3300032002 | Ga0307416_100004832 | Ga0307416_1000048324 | 259 |
| 774 | 3300032002 | Ga0307416_100015918 | Ga0307416_1000159182 | 259 |
| 775 | 3300032004 | Ga0307414_10011752 | Ga0307414_100117523 | 259 |
| 776 | 3300032004 | Ga0307414_10049325 | Ga0307414_100493254 | 259 |
| 777 | 3300032004 | Ga0307414_10357272 | Ga0307414_103572722 | 259 |
| 778 | 3300032005 | Ga0307411_10006971 | Ga0307411_100069714 | 259 |
| 779 | 3300032005 | Ga0307411_10021834 | Ga0307411_100218342 | 259 |
| 780 | 3300032005 | Ga0307411_10120851 | Ga0307411_101208511 | 259 |
| 781 | 3300032005 | Ga0307411_10181296 | Ga0307411_101812961 | 259 |
| 782 | 3300032126 | Ga0307415_100009335 | Ga0307415_1000093351 | 259 |
| 783 | 3300032126 | Ga0307415_100016598 | Ga0307415_1000165984 | 259 |
| 784 | 3300037418 | Ga0395900_0215130 | Ga0395900_0215130_1070_1864 | 259 |
| 785 | 3300037418 | Ga0395900_0550889 | Ga0395900_0550889_224_1006 | 259 |
| 786 | 3300037466 | Ga0395898_0321229 | Ga0395898_0321229_268_1053 | 259 |
| 787 | 3300037471 | Ga0395905_0029319 | Ga0395905_0029319_3560_4345 | 259 |
| 788 | 3300038996 | Ga0242420_004415 | Ga0242420_004415_969_1781 | 259 |
| 789 | 3300039437 | Ga0436365_0013216 | Ga0436365_0013216_22037_22825 | 259 |
| 790 | 3300042156 | Ga0439446_0011230 | Ga0439446_0011230_919_1707 | 259 |
| 791 | 3300042157 | Ga0439458_0005147 | Ga0439458_0005147_1015_1794 | 259 |
| 792 | 3300042435 | Ga0439434_0022033 | Ga0439434_0022033_961_1752 | 259 |
| 793 | 3300044673 | Ga0453683_0026879 | Ga0453683_0026879_1680_2471 | 259 |
| 794 | 3300044712 | Ga0453684_0263576 | Ga0453684_0263576_172_984 | 259 |
| 795 | 3300045051 | Ga0451576_0042739 | Ga0451576_0042739_1820_2632 | 259 |
| 796 | 3300046525 | Ga0495663_0000433 | Ga0495663_0000433_260_1042 | 259 |
| 797 | 3300046537 | Ga0495598_0002150 | Ga0495598_0002150_2522_3304 | 259 |
| 798 | 3300046539 | Ga0495621_0002053 | Ga0495621_0002053_2204_2986 | 259 |
| 799 | 3300047320 | Ga0495672_0093934 | Ga0495672_0093934_37_822 | 259 |
| 800 | 3300048905 | Ga0496102_0549527 | Ga0496102_0549527_177_977 | 259 |
| 801 | 3300048910 | Ga0496107_0174394 | Ga0496107_0174394_283_1218 | 259 |
| 802 | 3300048915 | Ga0496112_0241295 | Ga0496112_0241295_207_986 | 259 |
| 803 | 3300049524 | Ga0501301_001508 | Ga0501301_001508_380_1162 | 259 |
| 804 | 3300049574 | Ga0501038_0003660 | Ga0501038_0003660_2412_3194 | 259 |
| 805 | 3300049652 | Ga0501202_013011 | Ga0501202_013011_359_1141 | 259 |
| 806 | 3300049661 | Ga0501217_005217 | Ga0501217_005217_1577_2356 | 259 |
| 807 | 3300049663 | Ga0501223_005137 | Ga0501223_005137_172_951 | 259 |
| 808 | 3300049663 | Ga0501223_010856 | Ga0501223_010856_404_1183 | 259 |
| 809 | 3300049664 | Ga0501224_009207 | Ga0501224_009207_478_1257 | 259 |
| 810 | 3300049665 | Ga0501227_000507 | Ga0501227_000507_5752_6531 | 259 |
| 811 | 3300049667 | Ga0501230_021618 | Ga0501230_021618_172_951 | 259 |
| 812 | 3300049668 | Ga0501233_001430 | Ga0501233_001430_2748_3527 | 259 |
| 813 | 3300049669 | Ga0501235_002582 | Ga0501235_002582_2433_3212 | 259 |
| 814 | 3300049669 | Ga0501235_012582 | Ga0501235_012582_1057_1839 | 259 |
| 815 | 3300049675 | Ga0501243_008153 | Ga0501243_008153_753_1532 | 259 |
| 816 | 3300049679 | Ga0501249_015253 | Ga0501249_015253_146_928 | 259 |
| 817 | 3300049688 | Ga0501259_011652 | Ga0501259_011652_317_1096 | 259 |
| 818 | 3300049704 | Ga0501221_010336 | Ga0501221_010336_168_947 | 259 |
| 819 | 3300049705 | Ga0501225_0000353 | Ga0501225_0000353_9760_10539 | 259 |
| 820 | 3300049705 | Ga0501225_0002065 | Ga0501225_0002065_278_1057 | 259 |
| 821 | 3300049705 | Ga0501225_0022930 | Ga0501225_0022930_326_1108 | 259 |
| 822 | 3300049851 | Ga0501212_007983 | Ga0501212_007983_587_1366 | 259 |
| 823 | 3300049853 | Ga0501226_000515 | Ga0501226_000515_4033_4812 | 259 |
| 824 | 3300050507 | nmdc:mga05p37_13138_c2 | nmdc:mga05p37_13138_c2_1908_2720 | 259 |
| 825 | 3300050507 | nmdc:mga05p37_157730_c2 | nmdc:mga05p37_157730_c2_1263_2132 | 259 |
| 826 | 3300050507 | nmdc:mga05p37_318323_c1 | nmdc:mga05p37_318323_c1_830_1612 | 259 |
| 827 | 3300050507 | nmdc:mga05p37_522911_c1 | nmdc:mga05p37_522911_c1_13_804 | 259 |
| 828 | 3300050507 | nmdc:mga05p37_65876_c2 | nmdc:mga05p37_65876_c2_1807_2604 | 259 |
| 829 | 3300050507 | nmdc:mga05p37_688926_c1 | nmdc:mga05p37_688926_c1_20_799 | 259 |
| 830 | 3300050508 | nmdc:mga09592_134411_c1 | nmdc:mga09592_134411_c1_122_904 | 259 |
| 831 | 3300050509 | nmdc:mga0qj67_256728_c1 | nmdc:mga0qj67_256728_c1_90_872 | 259 |
| 832 | 3300050509 | nmdc:mga0qj67_54043_c1 | nmdc:mga0qj67_54043_c1_927_1709 | 259 |
| 833 | 3300050510 | nmdc:mga06r32_207775_c1 | nmdc:mga06r32_207775_c1_614_1396 | 259 |
| 834 | 3300050511 | nmdc:mga08y16_161298_c1 | nmdc:mga08y16_161298_c1_1059_1841 | 259 |
| 835 | 3300050512 | nmdc:mga0n895_145294_c1 | nmdc:mga0n895_145294_c1_796_1590 | 259 |
| 836 | 3300050512 | nmdc:mga0n895_785299_c1 | nmdc:mga0n895_785299_c1_88_882 | 259 |
| 837 | 3300050513 | nmdc:mga0rr50_492596_c1 | nmdc:mga0rr50_492596_c1_238_1026 | 259 |
| 838 | 3300050513 | nmdc:mga0rr50_9855_c1 | nmdc:mga0rr50_9855_c1_2541_3329 | 259 |
| 839 | 3300050514 | nmdc:mga08x19_13_c1 | nmdc:mga08x19_13_c1_2851_3639 | 259 |
| 840 | 3300050515 | nmdc:mga0a205_22311_c1 | nmdc:mga0a205_22311_c1_3576_4370 | 259 |
| 841 | 3300050515 | nmdc:mga0a205_49266_c1 | nmdc:mga0a205_49266_c1_2396_3175 | 259 |
| 842 | 3300050515 | nmdc:mga0a205_519849_c1 | nmdc:mga0a205_519849_c1_192_989 | 259 |
| 843 | 3300053142 | Ga0500577_0000869 | Ga0500577_0000869_4818_5639 | 259 |
| 844 | 3300054114 | Ga0501084_0490654 | Ga0501084_0490654_205_987 | 259 |
| 845 | 3300061734 | Ga0530510_0032439 | Ga0530510_0032439_1390_2172 | 259 |
| 846 | 3300000532 | CNAas_1001219 | CNAas_10012192 | 260 |
| 847 | 3300005444 | Ga0070694_100650476 | Ga0070694_1006504761 | 260 |
| 848 | 3300005471 | Ga0070698_100033997 | Ga0070698_1000339974 | 260 |
| 849 | 3300005549 | Ga0070704_100210472 | Ga0070704_1002104722 | 260 |
| 850 | 3300005719 | Ga0068861_100000717 | Ga0068861_1000007175 | 260 |
| 851 | 3300005985 | Ga0081539_10006502 | Ga0081539_100065023 | 260 |
| 852 | 3300006871 | Ga0075434_100240066 | Ga0075434_1002400662 | 260 |
| 853 | 3300025910 | Ga0207684_10161537 | Ga0207684_101615372 | 260 |
| 854 | 3300026118 | Ga0207675_100007761 | Ga0207675_1000077615 | 260 |
| 855 | 3300050512 | nmdc:mga0n895_439170_c1 | nmdc:mga0n895_439170_c1_297_1097 | 260 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2gzx-assembly2.cif.gz_B | crystal structure of the tatd deoxyribonuclease mw0446 from staphylococcus aureus. northeast structural genomics consortium target zr237. | 0.9703 | 3 | 256 |
| 1j6o-assembly1.cif.gz_A | crystal structure of tatd-related deoxyribonuclease (tm0667) from thermotoga maritima at 1.8 a resolution | 0.9686 | 1 | 260 |
| 2gzx-assembly2.cif.gz_B | crystal structure of the tatd deoxyribonuclease mw0446 from staphylococcus aureus. northeast structural genomics consortium target zr237. | 0.9591 | 3 | 256 |
| 1xwy-assembly1.cif.gz_A | crystal structure of tatd deoxyribonuclease from escherichia coli k12 at 2.0 a resolution | 0.9552 | 3 | 256 |
| 3rcm-assembly1.cif.gz_A | crystal structure of efi target 500140:tatd family hydrolase from pseudomonas putida | 0.9417 | 1 | 260 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1j6oA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.9678 | 2 | 260 | 3.20.20.140 |
| 2gzxB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.9676 | 3 | 256 | 3.20.20.140 |
| 2gzxB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.9562 | 3 | 256 | 3.20.20.140 |
| 1xwyA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.9552 | 3 | 256 | 3.20.20.140 |
| 1j6oA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.9496 | 2 | 260 | 3.20.20.140 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W1BZV2-F1-model_v4 | TatD family hydrolase | 0.9978 | 175 | 254 |
GO:0005829
GO:0016788 |
| AF-A0A1H6LEW9-F1-model_v4 | TatD family hydrolase | 0.9938 | 173 | 257 |
GO:0005829
GO:0016788 |
| AF-A0A838RV98-F1-model_v4 | TatD family hydrolase | 0.9937 | 1 | 256 |
GO:0004536
GO:0046872 |
| AF-A0A419E412-F1-model_v4 | Hydrolase TatD | 0.9925 | 179 | 254 |
GO:0016788
|
| AF-A0A831JR34-F1-model_v4 | Uncharacterized protein | 0.9912 | 176 | 254 |
GO:0005829
GO:0016788 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar