F483617

General Info

Members Datasets Scaffolds Average Seq Length
855 286 1710 138

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10001252|Ga0114129_1000125228
Length 164
Sequence MPTPHWRCDSLAIGIHQFTNSPTHEFVMHTYTDYLWFTTKKRQEFVRITDEVAEIVAKSGVGDGLVLVSAMHITAGVYVNDWENGLIQDFQTWLETLAPAGLDYRHHQTGEDNADAHLKRTLMGHQVTLPITNGKLDLGPWEQVFYAEFDGQRRKRVIVKVIGE

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
66 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
67 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
68 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
69 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
73 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
74 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
79 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
80 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
163 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
165 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
169 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
170 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
171 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
172 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
173 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
174 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
175 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
176 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
177 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
178 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
179 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
180 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
181 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
182 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
183 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
184 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
185 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
186 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
187 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
188 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
189 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
190 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
191 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
192 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
193 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
194 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
195 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
196 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
197 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
198 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
199 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
200 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
201 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
202 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
203 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
204 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
205 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
206 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
207 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
208 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
209 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
210 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
211 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
212 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
213 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
214 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
215 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
216 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
217 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
218 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
219 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
220 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
221 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
222 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
223 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
224 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
225 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
226 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
227 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
228 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
229 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
230 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
231 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
232 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
233 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
234 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
235 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
236 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
237 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
246 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
247 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
248 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
249 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
250 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
251 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
252 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
253 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
254 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
255 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
256 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
257 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
258 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
259 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
260 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
261 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
262 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
263 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
264 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
265 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
267 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
268 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
269 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
270 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
271 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
272 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
273 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
274 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
275 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
276 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
277 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
278 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
279 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
280 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
281 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
282 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
283 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
284 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
285 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
286 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.29
Nodule 0
Rhizoplane 1.64
Rhizosphere 96.73
Stem 0
Stem Tuber 0
Unclassified 3.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_10001252 3300009147 Bacteria 33867
2 JGI24746J21847_1002357 3300001977 Bacteria 3018
3 JGI24746J21847_1047237 3300001977 Bacteria 603
4 JGI24033J26618_1022292 3300002155 Bacteria 818
5 JGI24751J29686_10056320 3300002459 Bacteria 810
6 Ga0065714_10109589 3300005288 Bacteria 1498
7 Ga0065704_10132606 3300005289 Bacteria 1610
8 Ga0065704_10464086 3300005289 Bacteria 694
9 Ga0065704_10598815 3300005289 Bacteria 608
10 Ga0065712_10005646 3300005290 Bacteria 6200
11 Ga0065712_10067944 3300005290 Bacteria 19818
12 Ga0065712_10171042 3300005290 Bacteria 1236
13 Ga0065712_10375519 3300005290 Bacteria 758
14 Ga0065712_10643653 3300005290 Bacteria 570
15 Ga0065712_10724459 3300005290 Bacteria 538
16 Ga0065715_10000380 3300005293 Bacteria 27890
17 Ga0065715_10003642 3300005293 Bacteria 4257
18 Ga0065715_10008448 3300005293 Bacteria 2870
19 Ga0065715_10203879 3300005293 Bacteria 1342
20 Ga0065715_10475158 3300005293 Bacteria 802
21 Ga0065715_10590897 3300005293 Bacteria 714
22 Ga0065715_10636497 3300005293 Bacteria 686
23 Ga0065707_10012218 3300005295 Bacteria 3265
24 Ga0065707_10086151 3300005295 Bacteria 5632
25 Ga0065707_10184040 3300005295 Bacteria 1400
26 Ga0065707_10206563 3300005295 Bacteria 1285
27 Ga0065707_10390203 3300005295 Bacteria 865
28 Ga0065707_10564939 3300005295 Bacteria 712
29 Ga0065707_10948934 3300005295 Bacteria 553
30 Ga0070658_10782587 3300005327 Bacteria 829
31 Ga0070658_11223033 3300005327 Bacteria 653
32 Ga0070676_10020457 3300005328 Bacteria 3695
33 Ga0070676_10297725 3300005328 Bacteria 1093
34 Ga0070683_100569132 3300005329 Bacteria 1084
35 Ga0070690_100004771 3300005330 Bacteria 7563
36 Ga0070690_100026899 3300005330 Bacteria 3552
37 Ga0070690_100103566 3300005330 Bacteria 1890
38 Ga0070690_100251514 3300005330 Bacteria 1250
39 Ga0070690_100256632 3300005330 Bacteria 1239
40 Ga0070670_100002351 3300005331 Bacteria 15581
41 Ga0070670_100003083 3300005331 Bacteria 13782
42 Ga0070670_100029465 3300005331 Bacteria 4726
43 Ga0070670_100124147 3300005331 Unclassified 2228
44 Ga0070670_100175608 3300005331 Bacteria 1859
45 Ga0070670_100389898 3300005331 Bacteria 1228
46 Ga0070677_10005765 3300005333 Bacteria 4096
47 Ga0070677_10027695 3300005333 Bacteria 2136
48 Ga0070677_10060147 3300005333 Bacteria 1564
49 Ga0070677_10127531 3300005333 Bacteria 1157
50 Ga0070677_10240895 3300005333 Bacteria 893
51 Ga0068869_100037129 3300005334 Bacteria 3463
52 Ga0068869_100040224 3300005334 Bacteria 3343
53 Ga0068869_100223575 3300005334 Bacteria 1493
54 Ga0070666_10007753 3300005335 Bacteria 6629
55 Ga0070666_10177654 3300005335 Bacteria 1493
56 Ga0070666_10437097 3300005335 Bacteria 944
57 Ga0070666_10685239 3300005335 Bacteria 751
58 Ga0070682_101022851 3300005337 Bacteria 687
59 Ga0068868_100022880 3300005338 Bacteria 4724
60 Ga0068868_100072709 3300005338 Bacteria 2744
61 Ga0068868_100141094 3300005338 Bacteria 1978
62 Ga0068868_100539334 3300005338 Bacteria 1027
63 Ga0068868_100677054 3300005338 Bacteria 921
64 Ga0068868_100679834 3300005338 Bacteria 919
65 Ga0070660_100518729 3300005339 Bacteria 992
66 Ga0070689_100008690 3300005340 Bacteria 7167
67 Ga0070689_100026924 3300005340 Bacteria 4332
68 Ga0070689_100053944 3300005340 Bacteria 3112
69 Ga0070689_100089827 3300005340 Bacteria 2420
70 Ga0070689_100166738 3300005340 Bacteria 1783
71 Ga0070689_100415721 3300005340 Bacteria 1139
72 Ga0070689_101418299 3300005340 Bacteria 628
73 Ga0070687_100051473 3300005343 Bacteria 2132
74 Ga0070661_100090204 3300005344 Bacteria 2270
75 Ga0070661_100141758 3300005344 Bacteria 1812
76 Ga0070661_100163269 3300005344 Bacteria 1688
77 Ga0070668_100032156 3300005347 Bacteria 3992
78 Ga0070668_100134095 3300005347 Bacteria 1990
79 Ga0070668_100480147 3300005347 Bacteria 1073
80 Ga0070668_101944342 3300005347 Bacteria 542
81 Ga0070669_100002731 3300005353 Bacteria 12736
82 Ga0070669_100041097 3300005353 Bacteria 3363
83 Ga0070669_100053127 3300005353 Bacteria 2965
84 Ga0070669_100441103 3300005353 Bacteria 1072
85 Ga0070669_101461099 3300005353 Bacteria 594
86 Ga0070675_100003337 3300005354 Bacteria 12155
87 Ga0070675_100006767 3300005354 Bacteria 8809
88 Ga0070675_100008093 3300005354 Bacteria 8151
89 Ga0070675_100021809 3300005354 Bacteria 5117
90 Ga0070675_100050787 3300005354 Bacteria 3406
91 Ga0070675_100075154 3300005354 Bacteria 2808
92 Ga0070675_100105685 3300005354 Bacteria 2376
93 Ga0070675_100113079 3300005354 Bacteria 2299
94 Ga0070675_100180139 3300005354 Bacteria 1827
95 Ga0070675_100265891 3300005354 Bacteria 1504
96 Ga0070675_100519832 3300005354 Bacteria 1074
97 Ga0070675_101680323 3300005354 Bacteria 586
98 Ga0070671_100007143 3300005355 Bacteria 8922
99 Ga0070671_100117485 3300005355 Bacteria 2236
100 Ga0070671_101513310 3300005355 Bacteria 594
101 Ga0070674_100007026 3300005356 Bacteria 6616
102 Ga0070674_100039649 3300005356 Bacteria 3182
103 Ga0070674_100061502 3300005356 Bacteria 2621
104 Ga0070674_100157325 3300005356 Bacteria 1721
105 Ga0070674_100223677 3300005356 Bacteria 1465
106 Ga0070674_100254171 3300005356 Bacteria 1381
107 Ga0070674_100263669 3300005356 Unclassified 1358
108 Ga0070674_100394910 3300005356 Bacteria 1128
109 Ga0070674_100438800 3300005356 Bacteria 1075
110 Ga0070674_102234651 3300005356 Bacteria 500
111 Ga0070673_100007888 3300005364 Bacteria 7056
112 Ga0070673_100009019 3300005364 Bacteria 6676
113 Ga0070673_100068585 3300005364 Bacteria 2840
114 Ga0070673_100201571 3300005364 Bacteria 1714
115 Ga0070673_100774558 3300005364 Bacteria 885
116 Ga0070673_101356437 3300005364 Bacteria 669
117 Ga0070688_100007684 3300005365 Bacteria 5823
118 Ga0070688_100054668 3300005365 Bacteria 2501
119 Ga0070688_100060544 3300005365 Bacteria 2391
120 Ga0070688_100087753 3300005365 Bacteria 2027
121 Ga0070688_100241625 3300005365 Bacteria 1282
122 Ga0070688_100545773 3300005365 Bacteria 880
123 Ga0070688_101011401 3300005365 Bacteria 661
124 Ga0070659_100327275 3300005366 Bacteria 1282
125 Ga0070667_100577042 3300005367 Bacteria 1035
126 Ga0070667_100590551 3300005367 Bacteria 1023
127 Ga0070667_100815733 3300005367 Bacteria 866
128 Ga0070667_101053497 3300005367 Bacteria 760
129 Ga0070667_102221244 3300005367 Bacteria 517
130 Ga0070701_10028176 3300005438 Bacteria 2760
131 Ga0070701_10063274 3300005438 Bacteria 1957
132 Ga0070701_10184798 3300005438 Bacteria 1223
133 Ga0070701_10271618 3300005438 Bacteria 1032
134 Ga0070705_100281699 3300005440 Bacteria 1182
135 Ga0070705_100905409 3300005440 Bacteria 710
136 Ga0070705_101303945 3300005440 Bacteria 602
137 Ga0070705_101394234 3300005440 Bacteria 584
138 Ga0070700_100000525 3300005441 Bacteria 19184
139 Ga0070700_100066944 3300005441 Bacteria 2281
140 Ga0070700_100855974 3300005441 Bacteria 737
141 Ga0070708_100116882 3300005445 Bacteria 2456
142 Ga0070663_100044174 3300005455 Bacteria 3140
143 Ga0070663_100140703 3300005455 Bacteria 1842
144 Ga0070678_100020326 3300005456 Bacteria 4353
145 Ga0070678_100062487 3300005456 Bacteria 2750
146 Ga0070678_100327491 3300005456 Bacteria 1310
147 Ga0070678_100511933 3300005456 Bacteria 1060
148 Ga0070678_101316330 3300005456 Bacteria 673
149 Ga0070662_100002932 3300005457 Bacteria 10608
150 Ga0070662_100573869 3300005457 Bacteria 947
151 Ga0070662_100592972 3300005457 Bacteria 931
152 Ga0070662_100802900 3300005457 Bacteria 800
153 Ga0068867_100006310 3300005459 Bacteria 8390
154 Ga0068867_100143521 3300005459 Bacteria 1868
155 Ga0068867_100356687 3300005459 Bacteria 1222
156 Ga0070685_10002042 3300005466 Bacteria 10451
157 Ga0070685_10075321 3300005466 Bacteria 2010
158 Ga0070685_10322333 3300005466 Bacteria 1048
159 Ga0070698_100400428 3300005471 Bacteria 1306
160 Ga0070698_101074236 3300005471 Bacteria 753
161 Ga0070698_101673202 3300005471 Bacteria 589
162 Ga0070684_100394439 3300005535 Bacteria 1276
163 Ga0070697_100184947 3300005536 Bacteria 1767
164 Ga0068853_100202200 3300005539 Bacteria 1808
165 Ga0070672_100005408 3300005543 Bacteria 8460
166 Ga0070672_100036030 3300005543 Bacteria 3766
167 Ga0070672_100052760 3300005543 Bacteria 3176
168 Ga0070672_100123987 3300005543 Bacteria 2118
169 Ga0070672_101025932 3300005543 Bacteria 732
170 Ga0070672_101435157 3300005543 Bacteria 618
171 Ga0070686_100004533 3300005544 Bacteria 7661
172 Ga0070686_100043855 3300005544 Bacteria 2808
173 Ga0070686_100044315 3300005544 Bacteria 2795
174 Ga0070696_100543395 3300005546 Bacteria 930
175 Ga0070696_100669582 3300005546 Bacteria 843
176 Ga0070696_100761624 3300005546 Bacteria 794
177 Ga0070665_100004309 3300005548 Bacteria 14957
178 Ga0070665_100030734 3300005548 Bacteria 5404
179 Ga0070665_100824117 3300005548 Bacteria 941
180 Ga0070704_100276707 3300005549 Bacteria 1389
181 Ga0070704_101649504 3300005549 Bacteria 592
182 Ga0070664_100003467 3300005564 Bacteria 12739
183 Ga0070664_100029088 3300005564 Bacteria 4604
184 Ga0070664_100316943 3300005564 Unclassified 1412
185 Ga0068857_100083590 3300005577 Bacteria 2852
186 Ga0068857_101547063 3300005577 Bacteria 647
187 Ga0070702_100167095 3300005615 Bacteria 1428
188 Ga0070702_100183478 3300005615 Bacteria 1371
189 Ga0068852_100138800 3300005616 Bacteria 2247
190 Ga0068852_100837685 3300005616 Bacteria 935
191 Ga0068852_101514571 3300005616 Bacteria 693
192 Ga0068859_100003208 3300005617 Bacteria 16650
193 Ga0068859_100124809 3300005617 Bacteria 2642
194 Ga0068859_100233315 3300005617 Bacteria 1929
195 Ga0068859_100377249 3300005617 Bacteria 1514
196 Ga0068859_100675676 3300005617 Bacteria 1124
197 Ga0068859_101148566 3300005617 Bacteria 855
198 Ga0068859_101305633 3300005617 Bacteria 800
199 Ga0068859_101854904 3300005617 Bacteria 666
200 Ga0068864_100002276 3300005618 Bacteria 15878
201 Ga0068864_100052826 3300005618 Bacteria 3504
202 Ga0068864_100076568 3300005618 Bacteria 2924
203 Ga0068864_100162119 3300005618 Bacteria 2033
204 Ga0068864_100288840 3300005618 Bacteria 1533
205 Ga0068864_100842524 3300005618 Bacteria 903
206 Ga0068864_100988575 3300005618 Bacteria 834
207 Ga0068864_102172403 3300005618 Bacteria 561
208 Ga0068866_10403058 3300005718 Bacteria 883
209 Ga0068866_11194797 3300005718 Bacteria 549
210 Ga0068861_100001899 3300005719 Bacteria 13450
211 Ga0068861_100023865 3300005719 Bacteria 4417
212 Ga0068861_100050937 3300005719 Bacteria 3141
213 Ga0068861_100287442 3300005719 Bacteria 1418
214 Ga0068861_101837752 3300005719 Bacteria 602
215 Ga0068851_10005417 3300005834 Bacteria 5789
216 Ga0068870_10565125 3300005840 Bacteria 768
217 Ga0068863_100016572 3300005841 Bacteria 7071
218 Ga0068863_100076335 3300005841 Bacteria 3170
219 Ga0068863_100199153 3300005841 Bacteria 1926
220 Ga0068863_100419311 3300005841 Bacteria 1311
221 Ga0068863_100641350 3300005841 Bacteria 1053
222 Ga0068863_101156947 3300005841 Bacteria 779
223 Ga0068863_101297777 3300005841 Bacteria 735
224 Ga0068858_100067486 3300005842 Bacteria 3313
225 Ga0068858_100430238 3300005842 Bacteria 1270
226 Ga0068858_101789630 3300005842 Bacteria 607
227 Ga0068858_102220475 3300005842 Bacteria 543
228 Ga0068860_100016344 3300005843 Bacteria 7235
229 Ga0068860_100163696 3300005843 Bacteria 2146
230 Ga0068862_100059922 3300005844 Bacteria 3269
231 Ga0068862_100084074 3300005844 Bacteria 2765
232 Ga0068862_100109273 3300005844 Bacteria 2426
233 Ga0068862_100125851 3300005844 Bacteria 2262
234 Ga0068862_100217674 3300005844 Bacteria 1728
235 Ga0068862_100555090 3300005844 Bacteria 1097
236 Ga0081455_10857464 3300005937 Bacteria 567
237 Ga0081539_10001090 3300005985 Bacteria 49338
238 Ga0081539_10041591 3300005985 Bacteria 2684
239 Ga0075365_10566061 3300006038 Bacteria 804
240 Ga0075368_10022563 3300006042 Bacteria 2397
241 Ga0075363_100612279 3300006048 Bacteria 653
242 Ga0070716_100076680 3300006173 Bacteria 1982
243 Ga0070712_100179415 3300006175 Bacteria 1649
244 Ga0075367_10037161 3300006178 Bacteria 2828
245 Ga0075427_10021441 3300006194 Bacteria 1028
246 Ga0075366_10027617 3300006195 Bacteria 3330
247 Ga0075366_10285371 3300006195 Bacteria 1009
248 Ga0097621_100000846 3300006237 Bacteria 21555
249 Ga0097621_100045198 3300006237 Bacteria 3556
250 Ga0097621_100087337 3300006237 Bacteria 2604
251 Ga0097621_100452452 3300006237 Bacteria 1157
252 Ga0097621_100554921 3300006237 Bacteria 1046
253 Ga0068871_100044659 3300006358 Bacteria 3565
254 Ga0068871_100050767 3300006358 Bacteria 3355
255 Ga0068871_100064706 3300006358 Bacteria 2994
256 Ga0068871_100338786 3300006358 Bacteria 1328
257 Ga0068871_100384189 3300006358 Bacteria 1248
258 Ga0075428_100000903 3300006844 Bacteria 31327
259 Ga0075428_100004820 3300006844 Bacteria 14965
260 Ga0075428_100039806 3300006844 Bacteria 5174
261 Ga0075428_100083998 3300006844 Bacteria 3474
262 Ga0075428_100126018 3300006844 Bacteria 2787
263 Ga0075428_100615837 3300006844 Bacteria 1159
264 Ga0075428_100653170 3300006844 Bacteria 1122
265 Ga0075428_100666632 3300006844 Bacteria 1109
266 Ga0075428_102234582 3300006844 Bacteria 564
267 Ga0075430_100007806 3300006846 Bacteria 9039
268 Ga0075430_100009513 3300006846 Bacteria 8216
269 Ga0075430_100012048 3300006846 Bacteria 7359
270 Ga0075430_100172750 3300006846 Bacteria 1798
271 Ga0075430_100195357 3300006846 Bacteria 1681
272 Ga0075430_100216831 3300006846 Bacteria 1588
273 Ga0075430_100241743 3300006846 Bacteria 1496
274 Ga0075430_100271651 3300006846 Bacteria 1403
275 Ga0075430_100367949 3300006846 Bacteria 1187
276 Ga0075430_100676098 3300006846 Bacteria 851
277 Ga0075431_100026967 3300006847 Bacteria 5894
278 Ga0075431_100070472 3300006847 Bacteria 3607
279 Ga0075431_100075218 3300006847 Bacteria 3485
280 Ga0075431_100263667 3300006847 Bacteria 1748
281 Ga0075433_10000571 3300006852 Bacteria 24354
282 Ga0075433_10002511 3300006852 Bacteria 13956
283 Ga0075433_10138703 3300006852 Unclassified 2161
284 Ga0075433_10159862 3300006852 Bacteria 2005
285 Ga0075433_10226809 3300006852 Bacteria 1659
286 Ga0075433_10248283 3300006852 Bacteria 1579
287 Ga0075434_100007038 3300006871 Bacteria 10377
288 Ga0075434_100023809 3300006871 Bacteria 5974
289 Ga0075434_100155769 3300006871 Bacteria 2304
290 Ga0075434_100681210 3300006871 Bacteria 1046
291 Ga0075429_100012005 3300006880 Bacteria 7510
292 Ga0075429_100027634 3300006880 Bacteria 4926
293 Ga0075429_100039819 3300006880 Bacteria 4090
294 Ga0075429_100159611 3300006880 Bacteria 1975
295 Ga0075429_100586465 3300006880 Bacteria 977
296 Ga0075429_100787347 3300006880 Bacteria 833
297 Ga0075429_101736102 3300006880 Bacteria 542
298 Ga0068865_100011211 3300006881 Bacteria 5603
299 Ga0068865_100204064 3300006881 Bacteria 1536
300 Ga0068865_100208085 3300006881 Bacteria 1523
301 Ga0068865_100232169 3300006881 Bacteria 1448
302 Ga0068865_100315524 3300006881 Bacteria 1256
303 Ga0068865_101369773 3300006881 Bacteria 631
304 Ga0075436_100736562 3300006914 Bacteria 732
305 Ga0097620_100003208 3300006931 Bacteria 16650
306 Ga0097620_100124798 3300006931 Bacteria 2642
307 Ga0097620_100233296 3300006931 Bacteria 1929
308 Ga0097620_100377245 3300006931 Bacteria 1514
309 Ga0097620_100675728 3300006931 Bacteria 1124
310 Ga0097620_101148467 3300006931 Bacteria 855
311 Ga0097620_101305622 3300006931 Bacteria 800
312 Ga0097620_101854755 3300006931 Bacteria 666
313 Ga0075435_100070483 3300007076 Bacteria 2853
314 Ga0111539_10001783 3300009094 Bacteria 28619
315 Ga0111539_10010186 3300009094 Bacteria 11846
316 Ga0111539_10017585 3300009094 Bacteria 8848
317 Ga0111539_10028684 3300009094 Bacteria 6787
318 Ga0111539_10039058 3300009094 Bacteria 5724
319 Ga0111539_10050816 3300009094 Bacteria 4939
320 Ga0111539_10066018 3300009094 Bacteria 4274
321 Ga0111539_10251432 3300009094 Bacteria 2058
322 Ga0111539_10449216 3300009094 Bacteria 1501
323 Ga0111539_10467407 3300009094 Bacteria 1469
324 Ga0111539_10479913 3300009094 Bacteria 1448
325 Ga0111539_10566409 3300009094 Bacteria 1323
326 Ga0111539_10827100 3300009094 Bacteria 1077
327 Ga0111539_10927907 3300009094 Bacteria 1012
328 Ga0111539_10981191 3300009094 Bacteria 982
329 Ga0105245_12115401 3300009098 Bacteria 616
330 Ga0105245_12551057 3300009098 Bacteria 564
331 Ga0105247_10282184 3300009101 Bacteria 1146
332 Ga0114129_10001673 3300009147 Bacteria 30208
333 Ga0114129_10013583 3300009147 Bacteria 11604
334 Ga0114129_10036720 3300009147 Bacteria 6918
335 Ga0114129_10050236 3300009147 Bacteria 5858
336 Ga0114129_10052373 3300009147 Bacteria 5728
337 Ga0114129_10071373 3300009147 Bacteria 4842
338 Ga0114129_10094809 3300009147 Bacteria 4134
339 Ga0114129_10228568 3300009147 Bacteria 2506
340 Ga0114129_11824528 3300009147 Bacteria 739
341 Ga0105243_10060871 3300009148 Bacteria 3017
342 Ga0105243_10535577 3300009148 Bacteria 1116
343 Ga0105243_11144391 3300009148 Bacteria 789
344 Ga0105241_11988297 3300009174 Bacteria 572
345 Ga0105242_10001931 3300009176 Bacteria 16304
346 Ga0105242_10007270 3300009176 Bacteria 8541
347 Ga0105242_11502014 3300009176 Unclassified 704
348 Ga0105248_10008629 3300009177 Bacteria 11196
349 Ga0105248_10021966 3300009177 Bacteria 7071
350 Ga0105248_10026122 3300009177 Bacteria 6497
351 Ga0105248_10069029 3300009177 Bacteria 3968
352 Ga0105248_10439505 3300009177 Bacteria 1469
353 Ga0105248_10607716 3300009177 Bacteria 1234
354 Ga0105248_10614582 3300009177 Bacteria 1226
355 Ga0105248_10748438 3300009177 Bacteria 1103
356 Ga0105248_12091947 3300009177 Bacteria 644
357 Ga0105238_10026535 3300009551 Bacteria 5906
358 Ga0105249_10006732 3300009553 Bacteria 10012
359 Ga0105249_10014882 3300009553 Bacteria 6881
360 Ga0105249_10403296 3300009553 Bacteria 1398
361 Ga0105249_10762878 3300009553 Unclassified 1030
362 Ga0105249_12780095 3300009553 Bacteria 561
363 Ga0105239_11618136 3300010375 Bacteria 749
364 Ga0105246_10033277 3300011119 Bacteria 3425
365 Ga0105246_10053082 3300011119 Bacteria 2788
366 Ga0105246_10127829 3300011119 Bacteria 1893
367 Ga0105246_10176064 3300011119 Bacteria 1643
368 Ga0105246_10456377 3300011119 Bacteria 1075
369 Ga0105246_10979335 3300011119 Bacteria 764
370 Ga0105246_11491062 3300011119 Bacteria 635
371 Ga0157315_1003950 3300012508 Bacteria 1033
372 Ga0157374_10114133 3300013296 Bacteria 2600
373 Ga0157374_10256901 3300013296 Bacteria 1720
374 Ga0157374_10301341 3300013296 Bacteria 1586
375 Ga0157374_10351824 3300013296 Bacteria 1464
376 Ga0157374_10578782 3300013296 Bacteria 1132
377 Ga0157374_11524101 3300013296 Bacteria 692
378 Ga0157378_10076886 3300013297 Bacteria 3009
379 Ga0157378_11547854 3300013297 Bacteria 708
380 Ga0163162_10029897 3300013306 Bacteria 5394
381 Ga0163162_10141496 3300013306 Bacteria 2520
382 Ga0163162_10731597 3300013306 Bacteria 1109
383 Ga0163162_11699247 3300013306 Unclassified 721
384 Ga0157372_11326003 3300013307 Bacteria 830
385 Ga0157372_11612326 3300013307 Bacteria 747
386 Ga0157375_10090378 3300013308 Bacteria 3120
387 Ga0157375_10163031 3300013308 Bacteria 2372
388 Ga0157375_10181129 3300013308 Bacteria 2258
389 Ga0157375_10246857 3300013308 Unclassified 1946
390 Ga0157375_10383266 3300013308 Bacteria 1573
391 Ga0157375_10432969 3300013308 Bacteria 1481
392 Ga0157375_10478360 3300013308 Bacteria 1410
393 Ga0157375_10965593 3300013308 Bacteria 993
394 Ga0157375_11367657 3300013308 Bacteria 833
395 Ga0163163_10030933 3300014325 Bacteria 5162
396 Ga0163163_10045945 3300014325 Bacteria 4288
397 Ga0163163_10073992 3300014325 Bacteria 3398
398 Ga0163163_10084063 3300014325 Bacteria 3189
399 Ga0163163_10630794 3300014325 Bacteria 1135
400 Ga0163163_10797486 3300014325 Bacteria 1008
401 Ga0163163_11142461 3300014325 Bacteria 842
402 Ga0163163_11643211 3300014325 Bacteria 703
403 Ga0157380_10001869 3300014326 Bacteria 13935
404 Ga0157380_10013776 3300014326 Bacteria 5904
405 Ga0157380_10038603 3300014326 Bacteria 3709
406 Ga0157380_10084764 3300014326 Bacteria 2599
407 Ga0157380_10104198 3300014326 Bacteria 2369
408 Ga0157380_10385737 3300014326 Bacteria 1324
409 Ga0157380_10523521 3300014326 Bacteria 1157
410 Ga0157380_10531369 3300014326 Bacteria 1149
411 Ga0157380_10738920 3300014326 Bacteria 994
412 Ga0157380_10772412 3300014326 Bacteria 975
413 Ga0157380_11761221 3300014326 Bacteria 678
414 Ga0157377_10006256 3300014745 Bacteria 5667
415 Ga0157377_10032869 3300014745 Bacteria 2828
416 Ga0157377_10860838 3300014745 Bacteria 674
417 Ga0157379_10037658 3300014968 Bacteria 4314
418 Ga0157379_11230004 3300014968 Bacteria 721
419 Ga0157379_11767258 3300014968 Bacteria 607
420 Ga0157376_10030877 3300014969 Bacteria 4284
421 Ga0157376_10180536 3300014969 Bacteria 1929
422 Ga0157376_10419840 3300014969 Bacteria 1298
423 Ga0157376_10829911 3300014969 Bacteria 939
424 Ga0157376_11939660 3300014969 Bacteria 626
425 Ga0157376_11971746 3300014969 Bacteria 621
426 Ga0207697_10007053 3300025315 Bacteria 5032
427 Ga0207697_10333975 3300025315 Bacteria 673
428 Ga0207656_10002085 3300025321 Bacteria 6684
429 Ga0207682_10002886 3300025893 Bacteria 7586
430 Ga0207682_10003879 3300025893 Bacteria 6395
431 Ga0207682_10074081 3300025893 Bacteria 1447
432 Ga0207642_10011067 3300025899 Bacteria 3205
433 Ga0207642_10209849 3300025899 Bacteria 1081
434 Ga0207642_10256653 3300025899 Bacteria 995
435 Ga0207688_10000058 3300025901 Bacteria 40361
436 Ga0207688_10031082 3300025901 Bacteria 2946
437 Ga0207688_10531109 3300025901 Bacteria 738
438 Ga0207688_10956150 3300025901 Bacteria 542
439 Ga0207680_10125285 3300025903 Bacteria 1686
440 Ga0207680_10148679 3300025903 Bacteria 1560
441 Ga0207680_10377547 3300025903 Bacteria 999
442 Ga0207680_10858399 3300025903 Bacteria 651
443 Ga0207685_10254839 3300025905 Bacteria 850
444 Ga0207645_10000244 3300025907 Bacteria 45170
445 Ga0207645_10213057 3300025907 Bacteria 1273
446 Ga0207643_10000567 3300025908 Bacteria 23417
447 Ga0207643_10006597 3300025908 Bacteria 6223
448 Ga0207643_10021789 3300025908 Bacteria 3525
449 Ga0207643_10023432 3300025908 Bacteria 3403
450 Ga0207705_10561103 3300025909 Bacteria 888
451 Ga0207660_10130760 3300025917 Bacteria 1910
452 Ga0207662_10001736 3300025918 Bacteria 10690
453 Ga0207662_10121699 3300025918 Bacteria 1637
454 Ga0207662_10134813 3300025918 Bacteria 1560
455 Ga0207662_10571627 3300025918 Bacteria 784
456 Ga0207662_10610606 3300025918 Bacteria 759
457 Ga0207657_10246899 3300025919 Bacteria 1424
458 Ga0207649_10074963 3300025920 Bacteria 2173
459 Ga0207646_10709669 3300025922 Unclassified 899
460 Ga0207681_10048135 3300025923 Bacteria 2876
461 Ga0207681_10052384 3300025923 Bacteria 2768
462 Ga0207681_10130179 3300025923 Unclassified 1859
463 Ga0207681_10140026 3300025923 Bacteria 1801
464 Ga0207681_10188368 3300025923 Bacteria 1576
465 Ga0207681_10385271 3300025923 Bacteria 1129
466 Ga0207694_10022719 3300025924 Bacteria 4758
467 Ga0207650_10001935 3300025925 Bacteria 14582
468 Ga0207650_10014154 3300025925 Bacteria 5541
469 Ga0207650_10017996 3300025925 Bacteria 4953
470 Ga0207650_10146766 3300025925 Bacteria 1859
471 Ga0207650_10624694 3300025925 Bacteria 907
472 Ga0207650_11537068 3300025925 Bacteria 565
473 Ga0207659_10001200 3300025926 Bacteria 15456
474 Ga0207659_10001233 3300025926 Bacteria 15316
475 Ga0207659_10006393 3300025926 Bacteria 7216
476 Ga0207659_10030971 3300025926 Bacteria 3659
477 Ga0207659_10033965 3300025926 Bacteria 3514
478 Ga0207659_10062383 3300025926 Bacteria 2690
479 Ga0207659_10134533 3300025926 Bacteria 1912
480 Ga0207659_10212426 3300025926 Bacteria 1551
481 Ga0207659_10282238 3300025926 Bacteria 1358
482 Ga0207659_10475661 3300025926 Bacteria 1055
483 Ga0207659_11333836 3300025926 Bacteria 616
484 Ga0207659_11387152 3300025926 Bacteria 602
485 Ga0207659_11895723 3300025926 Bacteria 505
486 Ga0207687_10126141 3300025927 Bacteria 1922
487 Ga0207687_10786462 3300025927 Bacteria 811
488 Ga0207644_10025744 3300025931 Bacteria 4047
489 Ga0207644_10215624 3300025931 Bacteria 1519
490 Ga0207644_11410162 3300025931 Bacteria 585
491 Ga0207690_10286332 3300025932 Bacteria 1285
492 Ga0207706_10019108 3300025933 Bacteria 6164
493 Ga0207706_10191413 3300025933 Bacteria 1795
494 Ga0207706_10217425 3300025933 Bacteria 1674
495 Ga0207706_10556680 3300025933 Bacteria 987
496 Ga0207686_10002026 3300025934 Bacteria 11180
497 Ga0207686_10033347 3300025934 Bacteria 3074
498 Ga0207686_11140842 3300025934 Bacteria 637
499 Ga0207709_10036502 3300025935 Bacteria 2913
500 Ga0207670_10017396 3300025936 Bacteria 4346
501 Ga0207670_10071335 3300025936 Bacteria 2402
502 Ga0207670_10126739 3300025936 Bacteria 1864
503 Ga0207670_10211750 3300025936 Bacteria 1479
504 Ga0207670_10237928 3300025936 Bacteria 1401
505 Ga0207670_10437178 3300025936 Bacteria 1053
506 Ga0207669_10000506 3300025937 Bacteria 17008
507 Ga0207669_10186129 3300025937 Bacteria 1493
508 Ga0207669_10194543 3300025937 Bacteria 1466
509 Ga0207669_10319317 3300025937 Unclassified 1188
510 Ga0207669_10417454 3300025937 Bacteria 1055
511 Ga0207669_11439604 3300025937 Bacteria 587
512 Ga0207669_11655051 3300025937 Bacteria 546
513 Ga0207669_11865614 3300025937 Bacteria 514
514 Ga0207704_10009053 3300025938 Bacteria 4786
515 Ga0207704_10095259 3300025938 Bacteria 1968
516 Ga0207704_10314451 3300025938 Bacteria 1205
517 Ga0207704_10550646 3300025938 Bacteria 937
518 Ga0207665_10137134 3300025939 Bacteria 1742
519 Ga0207691_10013787 3300025940 Bacteria 7722
520 Ga0207691_10016806 3300025940 Bacteria 6944
521 Ga0207691_10018297 3300025940 Bacteria 6637
522 Ga0207691_10044994 3300025940 Bacteria 4060
523 Ga0207691_10108133 3300025940 Bacteria 2475
524 Ga0207691_10150798 3300025940 Bacteria 2044
525 Ga0207691_10472977 3300025940 Bacteria 1065
526 Ga0207691_10483097 3300025940 Bacteria 1053
527 Ga0207691_10879309 3300025940 Bacteria 751
528 Ga0207691_11257066 3300025940 Bacteria 612
529 Ga0207711_10007403 3300025941 Bacteria 9186
530 Ga0207711_10105921 3300025941 Bacteria 2494
531 Ga0207711_10245776 3300025941 Bacteria 1642
532 Ga0207711_10261518 3300025941 Bacteria 1591
533 Ga0207711_11875869 3300025941 Bacteria 542
534 Ga0207689_10000917 3300025942 Bacteria 28290
535 Ga0207689_10001583 3300025942 Bacteria 21569
536 Ga0207689_10182704 3300025942 Bacteria 1729
537 Ga0207661_10633034 3300025944 Bacteria 983
538 Ga0207679_10239051 3300025945 Unclassified 1538
539 Ga0207679_10500517 3300025945 Bacteria 1084
540 Ga0207679_12002753 3300025945 Bacteria 527
541 Ga0207651_10029502 3300025960 Bacteria 3476
542 Ga0207651_10037093 3300025960 Bacteria 3190
543 Ga0207651_10052979 3300025960 Bacteria 2770
544 Ga0207651_10228713 3300025960 Bacteria 1508
545 Ga0207651_10353201 3300025960 Bacteria 1238
546 Ga0207651_10416790 3300025960 Bacteria 1145
547 Ga0207651_10569387 3300025960 Bacteria 987
548 Ga0207651_10596384 3300025960 Bacteria 965
549 Ga0207651_10902353 3300025960 Bacteria 787
550 Ga0207651_11654955 3300025960 Bacteria 576
551 Ga0207712_10035216 3300025961 Bacteria 3399
552 Ga0207712_10182701 3300025961 Bacteria 1649
553 Ga0207668_10432627 3300025972 Bacteria 1119
554 Ga0207668_10787003 3300025972 Bacteria 841
555 Ga0207668_10981884 3300025972 Bacteria 754
556 Ga0207640_10522907 3300025981 Bacteria 992
557 Ga0207658_10079540 3300025986 Bacteria 2508
558 Ga0207658_11028944 3300025986 Bacteria 752
559 Ga0207677_10075542 3300026023 Bacteria 2395
560 Ga0207677_10138308 3300026023 Bacteria 1861
561 Ga0207677_10149808 3300026023 Bacteria 1798
562 Ga0207703_10267241 3300026035 Bacteria 1548
563 Ga0207703_10331144 3300026035 Bacteria 1397
564 Ga0207703_10334685 3300026035 Bacteria 1390
565 Ga0207678_10071603 3300026067 Bacteria 2972
566 Ga0207708_10007241 3300026075 Bacteria 8201
567 Ga0207708_10138667 3300026075 Bacteria 1906
568 Ga0207708_10300094 3300026075 Bacteria 1306
569 Ga0207708_10503771 3300026075 Bacteria 1015
570 Ga0207708_10854468 3300026075 Bacteria 786
571 Ga0207708_11081459 3300026075 Bacteria 699
572 Ga0207641_10008812 3300026088 Bacteria 8333
573 Ga0207641_10131283 3300026088 Bacteria 2250
574 Ga0207641_10140821 3300026088 Bacteria 2176
575 Ga0207641_10498664 3300026088 Bacteria 1182
576 Ga0207648_10000549 3300026089 Bacteria 42026
577 Ga0207648_10017234 3300026089 Bacteria 6581
578 Ga0207648_10071271 3300026089 Bacteria 3029
579 Ga0207648_10210798 3300026089 Bacteria 1725
580 Ga0207648_10235336 3300026089 Bacteria 1630
581 Ga0207648_10238481 3300026089 Bacteria 1619
582 Ga0207676_10021466 3300026095 Bacteria 4737
583 Ga0207676_10083450 3300026095 Bacteria 2602
584 Ga0207676_10111181 3300026095 Bacteria 2293
585 Ga0207676_10147209 3300026095 Bacteria 2024
586 Ga0207676_10410886 3300026095 Bacteria 1267
587 Ga0207676_10494637 3300026095 Bacteria 1160
588 Ga0207676_11047566 3300026095 Bacteria 805
589 Ga0207676_11251372 3300026095 Bacteria 736
590 Ga0207674_10107239 3300026116 Bacteria 2770
591 Ga0207674_11219702 3300026116 Bacteria 722
592 Ga0207675_100004836 3300026118 Bacteria 12974
593 Ga0207675_100011274 3300026118 Bacteria 8370
594 Ga0207675_100058714 3300026118 Bacteria 3590
595 Ga0207675_100232536 3300026118 Bacteria 1779
596 Ga0207675_100327566 3300026118 Bacteria 1497
597 Ga0207675_100513648 3300026118 Bacteria 1194
598 Ga0207675_100708794 3300026118 Bacteria 1016
599 Ga0207683_10004379 3300026121 Bacteria 12201
600 Ga0207683_10043159 3300026121 Bacteria 3940
601 Ga0207683_10076166 3300026121 Bacteria 2970
602 Ga0207683_10199259 3300026121 Bacteria 1819
603 Ga0207683_10253098 3300026121 Bacteria 1607
604 Ga0207683_10304297 3300026121 Bacteria 1459
605 Ga0207683_10312984 3300026121 Bacteria 1437
606 Ga0207683_10382100 3300026121 Bacteria 1294
607 Ga0207683_11301836 3300026121 Bacteria 673
608 Ga0207683_11453250 3300026121 Bacteria 633
609 Ga0207698_10760019 3300026142 Bacteria 969
610 Ga0207698_12028985 3300026142 Bacteria 589
611 Ga0207698_12611114 3300026142 Bacteria 514
612 Ga0209967_1029329 3300027364 Bacteria 821
613 Ga0209996_1038239 3300027395 Bacteria 710
614 Ga0210002_1027508 3300027617 Bacteria 936
615 Ga0209813_10050929 3300027866 Bacteria 1294
616 Ga0209974_10135624 3300027876 Bacteria 880
617 Ga0209974_10340772 3300027876 Bacteria 580
618 Ga0207428_10000910 3300027907 Bacteria 33053
619 Ga0207428_10001542 3300027907 Bacteria 24109
620 Ga0207428_10001583 3300027907 Bacteria 23694
621 Ga0207428_10010206 3300027907 Bacteria 8395
622 Ga0207428_10119889 3300027907 Bacteria 2018
623 Ga0207428_10251141 3300027907 Bacteria 1319
624 Ga0207428_10282337 3300027907 Bacteria 1232
625 Ga0207428_10412752 3300027907 Bacteria 988
626 Ga0207428_10732900 3300027907 Bacteria 705
627 Ga0207428_10984518 3300027907 Bacteria 593
628 Ga0268266_10013401 3300028379 Bacteria 7061
629 Ga0268266_10129313 3300028379 Bacteria 2257
630 Ga0268266_10614236 3300028379 Bacteria 1045
631 Ga0268265_10009888 3300028380 Bacteria 6444
632 Ga0268265_10033389 3300028380 Bacteria 3741
633 Ga0268265_10154991 3300028380 Bacteria 1937
634 Ga0268265_10302934 3300028380 Bacteria 1440
635 Ga0268265_10599714 3300028380 Bacteria 1052
636 Ga0268265_10872868 3300028380 Bacteria 882
637 Ga0268265_11770586 3300028380 Bacteria 624
638 Ga0268264_10037088 3300028381 Bacteria 4018
639 Ga0268264_10380656 3300028381 Bacteria 1351
640 Ga0268264_11082361 3300028381 Bacteria 810
641 Ga0268264_11622789 3300028381 Bacteria 657
642 Ga0307408_100169066 3300031548 Bacteria 1744
643 Ga0307413_10051168 3300031824 Bacteria 2488
644 Ga0307410_10139571 3300031852 Bacteria 1791
645 Ga0307410_10163097 3300031852 Bacteria 1672
646 Ga0307410_11356432 3300031852 Bacteria 623
647 Ga0307406_10115779 3300031901 Bacteria 1854
648 Ga0307407_10538748 3300031903 Bacteria 861
649 Ga0307412_10579592 3300031911 Bacteria 947
650 Ga0307412_10659975 3300031911 Bacteria 893
651 Ga0307409_100171835 3300031995 Bacteria 1908
652 Ga0307409_100395741 3300031995 Bacteria 1318
653 Ga0307416_100097692 3300032002 Bacteria 2544
654 Ga0307416_100301085 3300032002 Unclassified 1594
655 Ga0307416_100664028 3300032002 Bacteria 1128
656 Ga0307416_103097350 3300032002 Bacteria 556
657 Ga0307414_10117591 3300032004 Bacteria 2037
658 Ga0307414_10248902 3300032004 Unclassified 1476
659 Ga0307414_10323846 3300032004 Bacteria 1313
660 Ga0307414_10339279 3300032004 Bacteria 1286
661 Ga0307411_10058290 3300032005 Bacteria 2555
662 Ga0307411_10113685 3300032005 Bacteria 1943
663 Ga0307415_100024446 3300032126 Bacteria 3772
664 Ga0307415_100350121 3300032126 Bacteria 1243
665 Ga0307415_100393614 3300032126 Bacteria 1181
666 Ga0307415_100409818 3300032126 Unclassified 1160
667 Ga0307415_101914532 3300032126 Bacteria 576
668 Ga0373934_0057636 3300035086 Bacteria 1545
669 Ga0373940_0011906 3300035088 Bacteria 2076
670 Ga0373952_0022031 3300035092 Bacteria 1350
671 Ga0373923_0345092 3300035111 Bacteria 710
672 Ga0373932_0021038 3300035112 Bacteria 1718
673 Ga0373939_0041253 3300035114 Bacteria 1390
674 Ga0373941_0044823 3300035115 Bacteria 1382
675 Ga0373954_0020458 3300035118 Bacteria 2994
676 Ga0373956_0098457 3300035119 Bacteria 1354
677 Ga0373957_0002842 3300035120 Bacteria 5001
678 Ga0373960_0322435 3300035121 Bacteria 579
679 Ga0373960_0359328 3300035121 Bacteria 554
680 Ga0373955_0009609 3300035172 Bacteria 4539
681 Ga0373961_0194302 3300035241 Bacteria 713
682 Ga0373962_0070417 3300035242 Bacteria 1044
683 Ga0373933_0007742 3300035724 Bacteria 5868
684 Ga0373937_0015524 3300036401 Bacteria 6738
685 Ga0373937_0485402 3300036401 Bacteria 1174
686 Ga0436365_1860590 3300039437 Bacteria 1770
687 Ga0439436_0065929 3300041404 Bacteria 1011
688 Ga0451849_0949651 3300041505 Bacteria 607
689 Ga0451853_0239223 3300041512 Bacteria 678
690 Ga0439450_060439 3300042008 Bacteria 915
691 Ga0439446_0013485 3300042156 Bacteria 2244
692 Ga0439435_0195140 3300042436 Bacteria 666
693 Ga0451577_0195126 3300042876 Archaea 1827
694 Ga0439440_0034364 3300042993 Bacteria 1212
695 Ga0439440_0257140 3300042993 Bacteria 533
696 Ga0453684_0000058 3300044712 Archaea 503665
697 Ga0451576_0256883 3300045051 Bacteria 1826
698 Ga0451576_1871291 3300045051 Bacteria 619
699 Ga0495592_0073933 3300046454 Bacteria 2477
700 Ga0495603_0074505 3300046455 Bacteria 1993
701 Ga0495629_0008199 3300046459 Bacteria 7683
702 Ga0495651_0317465 3300046462 Bacteria 1040
703 Ga0495594_0141850 3300046499 Bacteria 1363
704 Ga0495643_0009974 3300046522 Bacteria 5868
705 Ga0495598_0113780 3300046537 Bacteria 910
706 Ga0495621_0018477 3300046539 Bacteria 2264
707 Ga0495621_0512183 3300046539 Bacteria 518
708 Ga0495667_0382341 3300046559 Bacteria 888
709 Ga0495656_0643197 3300046615 Bacteria 569
710 Ga0495656_0701244 3300046615 Bacteria 545
711 Ga0495635_0903809 3300046663 Bacteria 565
712 Ga0495635_1065489 3300046663 Bacteria 513
713 Ga0495659_0275622 3300046664 Bacteria 706
714 Ga0495599_0333713 3300046678 Bacteria 911
715 Ga0495599_0545985 3300046678 Bacteria 679
716 Ga0495646_0461707 3300046680 Bacteria 655
717 Ga0495613_0976878 3300046689 Bacteria 545
718 Ga0495613_1077559 3300046689 Bacteria 514
719 Ga0495670_0109559 3300046691 Bacteria 1428
720 Ga0495670_0156038 3300046691 Bacteria 1198
721 Ga0495677_0273693 3300047445 Bacteria 662
722 Ga0495684_0296747 3300047471 Bacteria 1162
723 Ga0495602_1040576 3300048088 Bacteria 539
724 Ga0496101_0597214 3300048904 Bacteria 873
725 Ga0496104_0024201 3300048907 Bacteria 5586
726 Ga0496105_0701201 3300048908 Bacteria 777
727 Ga0496106_0353482 3300048909 Bacteria 1180
728 Ga0496108_0002813 3300048911 Bacteria 13963
729 Ga0496108_0080043 3300048911 Bacteria 2767
730 Ga0496109_0002172 3300048912 Bacteria 16298
731 Ga0496110_0007883 3300048913 Bacteria 8529
732 Ga0496110_0267703 3300048913 Bacteria 1556
733 Ga0496110_1630562 3300048913 Bacteria 555
734 Ga0496112_0000823 3300048915 Bacteria 22013
735 Ga0496112_0500730 3300048915 Bacteria 1150
736 Ga0496113_0003704 3300048916 Bacteria 9213
737 Ga0496114_0140195 3300048917 Bacteria 2093
738 Ga0501292_038142 3300049515 Unclassified 823
739 Ga0501298_025395 3300049521 Bacteria 1134
740 Ga0501034_0401478 3300049571 Bacteria 1293
741 Ga0501039_0104414 3300049575 Bacteria 2212
742 Ga0501040_0263218 3300049576 Bacteria 1231
743 Ga0501040_0305851 3300049576 Bacteria 1136
744 Ga0501041_0002303 3300049577 Bacteria 10800
745 Ga0501042_0046472 3300049578 Bacteria 3095
746 Ga0501042_0070689 3300049578 Bacteria 2497
747 Ga0501043_0134234 3300049579 Bacteria 1939
748 Ga0501043_0649832 3300049579 Bacteria 775
749 Ga0501046_0291518 3300049580 Bacteria 1193
750 Ga0501046_0762084 3300049580 Unclassified 680
751 Ga0501048_0138579 3300049582 Bacteria 1720
752 Ga0501070_0101083 3300049586 Bacteria 2385
753 Ga0501072_0038352 3300049588 Unclassified 3760
754 Ga0501072_0347622 3300049588 Bacteria 1177
755 Ga0501075_0025957 3300049591 Bacteria 4307
756 Ga0501076_0008907 3300049592 Bacteria 7384
757 Ga0501076_0132424 3300049592 Bacteria 2022
758 Ga0501216_053062 3300049660 Bacteria 801
759 Ga0501217_023246 3300049661 Unclassified 1476
760 Ga0501223_081903 3300049663 Unclassified 647
761 Ga0501227_244351 3300049665 Unclassified 511
762 Ga0501238_061190 3300049671 Bacteria 575
763 Ga0501239_063614 3300049672 Bacteria 560
764 Ga0501247_035977 3300049677 Unclassified 693
765 Ga0501249_017454 3300049679 Unclassified 1547
766 Ga0501253_118814 3300049683 Bacteria 638
767 Ga0501225_0078042 3300049705 Bacteria 948
768 Ga0501079_0018855 3300049741 Bacteria 5273
769 Ga0501079_0215397 3300049741 Bacteria 1500
770 Ga0501080_0228086 3300049742 Bacteria 1703
771 Ga0501080_0493993 3300049742 Bacteria 1094
772 Ga0501081_0044743 3300049743 Bacteria 3040
773 Ga0501262_031422 3300049759 Bacteria 766
774 Ga0501270_014104 3300049767 Unclassified 1119
775 Ga0501283_005683 3300049779 Unclassified 1723
776 Ga0501035_0738622 3300049822 Bacteria 791
777 Ga0501045_0026829 3300049824 Bacteria 4146
778 Ga0501045_0204292 3300049824 Bacteria 1472
779 nmdc:mga0k408_191901_c1 3300050493 Unclassified 1219
780 nmdc:mga0k408_268591_c1 3300050493 Bacteria 1018
781 nmdc:mga04h51_45691_c1 3300050495 Bacteria 1449
782 nmdc:mga05p37_123159_c1 3300050507 Bacteria 3185
783 nmdc:mga05p37_1356_c1 3300050507 Bacteria 28472
784 nmdc:mga05p37_146938_c1 3300050507 Bacteria 2885
785 nmdc:mga05p37_1557635_c1 3300050507 Bacteria 654
786 nmdc:mga05p37_261182_c1 3300050507 Bacteria 2072
787 nmdc:mga05p37_39_c1 3300050507 Bacteria 108676
788 nmdc:mga05p37_53283_c1 3300050507 Bacteria 4975
789 nmdc:mga05p37_533731_c1 3300050507 Bacteria 1339
790 nmdc:mga05p37_53866_c1 3300050507 Bacteria 4949
791 nmdc:mga05p37_64794_c1 3300050507 Bacteria 4496
792 nmdc:mga05p37_769196_c1 3300050507 Bacteria 1058
793 nmdc:mga09592_112929_c2 3300050508 Bacteria 1601
794 nmdc:mga09592_11687_c1 3300050508 Bacteria 7141
795 nmdc:mga09592_120248_c1 3300050508 Bacteria 2256
796 nmdc:mga09592_1275674_c1 3300050508 Bacteria 605
797 nmdc:mga09592_1433066_c1 3300050508 Bacteria 564
798 nmdc:mga09592_169729_c1 3300050508 Bacteria 1886
799 nmdc:mga09592_55477_c1 3300050508 Bacteria 3348
800 nmdc:mga09592_9285_c1 3300050508 Bacteria 7994
801 nmdc:mga0qj67_1331882_c1 3300050509 Bacteria 556
802 nmdc:mga0qj67_153654_c1 3300050509 Bacteria 1867
803 nmdc:mga0qj67_31738_c1 3300050509 Bacteria 4117
804 nmdc:mga0qj67_318114_c1 3300050509 Bacteria 1260
805 nmdc:mga0qj67_442760_c1 3300050509 Bacteria 1047
806 nmdc:mga0qj67_49339_c2 3300050509 Bacteria 2085
807 nmdc:mga0qj67_6854_c1 3300050509 Bacteria 8377
808 nmdc:mga06r32_1269_c1 3300050510 Bacteria 22696
809 nmdc:mga06r32_261778_c1 3300050510 Bacteria 1717
810 nmdc:mga06r32_40429_c1 3300050510 Bacteria 4427
811 nmdc:mga06r32_42335_c1 3300050510 Bacteria 4330
812 nmdc:mga06r32_493243_c1 3300050510 Bacteria 1202
813 nmdc:mga06r32_577940_c1 3300050510 Unclassified 1096
814 nmdc:mga06r32_698405_c1 3300050510 Bacteria 980
815 nmdc:mga08y16_12561_c1 3300050511 Bacteria 8911
816 nmdc:mga08y16_157524_c1 3300050511 Bacteria 2360
817 nmdc:mga08y16_16051_c1 3300050511 Bacteria 7874
818 nmdc:mga08y16_169116_c1 3300050511 Bacteria 2270
819 nmdc:mga08y16_1780_c1 3300050511 Bacteria 21816
820 nmdc:mga08y16_236447_c1 3300050511 Bacteria 1889
821 nmdc:mga08y16_2527_c1 3300050511 Bacteria 18803
822 nmdc:mga08y16_301445_c1 3300050511 Bacteria 1652
823 nmdc:mga08y16_333801_c1 3300050511 Bacteria 1559
824 nmdc:mga08y16_41447_c1 3300050511 Bacteria 4823
825 nmdc:mga08y16_480558_c1 3300050511 Bacteria 1264
826 nmdc:mga08y16_505522_c1 3300050511 Bacteria 1227
827 nmdc:mga08y16_921252_c1 3300050511 Bacteria 859
828 nmdc:mga0n895_11208_c1 3300050512 Bacteria 7984
829 nmdc:mga0n895_218101_c1 3300050512 Bacteria 1937
830 nmdc:mga0n895_26191_c1 3300050512 Bacteria 5519
831 nmdc:mga0n895_337037_c1 3300050512 Bacteria 1528
832 nmdc:mga0rr50_42135_c1 3300050513 Bacteria 3331
833 nmdc:mga0a205_11716_c1 3300050515 Bacteria 8089
834 nmdc:mga0a205_139_c1 3300050515 Bacteria 46008
835 nmdc:mga0a205_17547_c1 3300050515 Bacteria 6714
836 nmdc:mga0a205_252155_c1 3300050515 Bacteria 1644
837 nmdc:mga0a205_480697_c1 3300050515 Bacteria 1100
838 nmdc:mga0a205_4954_c1 3300050515 Bacteria 3844
839 nmdc:mga0a205_653538_c1 3300050515 Bacteria 903
840 Ga0495601_0526063 3300053077 Bacteria 762
841 Ga0495595_0179293 3300053084 Bacteria 1050
842 Ga0495619_0128170 3300053085 Bacteria 1743
843 Ga0500628_012481 3300053129 Bacteria 1566
844 Ga0501084_0120704 3300054114 Bacteria 2204
845 Ga0501084_1012829 3300054114 Bacteria 698
846 Ga0501084_1776374 3300054114 Bacteria 515
847 Ga0590071_031382 3300059421 Bacteria 1267
848 Ga0590075_025765 3300059424 Bacteria 1479
849 Ga0590075_040890 3300059424 Bacteria 1185
850 Ga0590075_057462 3300059424 Bacteria 1001
851 Ga0590077_007721 3300059426 Bacteria 2198
852 Ga0501082_0169592 3300060353 Bacteria 1897
853 Ga0501082_0472156 3300060353 Bacteria 1096
854 Ga0530510_0136858 3300061734 Bacteria 1803
855 Ga0530510_0383586 3300061734 Bacteria 1058
856 Ga0114129_10001252
857 JGI24746J21847_1002357
858 JGI24746J21847_1047237
859 JGI24033J26618_1022292
860 JGI24751J29686_10056320
861 Ga0065714_10109589
862 Ga0065704_10132606
863 Ga0065704_10464086
864 Ga0065704_10598815
865 Ga0065712_10005646
866 Ga0065712_10067944
867 Ga0065712_10171042
868 Ga0065712_10375519
869 Ga0065712_10643653
870 Ga0065712_10724459
871 Ga0065715_10000380
872 Ga0065715_10003642
873 Ga0065715_10008448
874 Ga0065715_10203879
875 Ga0065715_10475158
876 Ga0065715_10590897
877 Ga0065715_10636497
878 Ga0065707_10012218
879 Ga0065707_10086151
880 Ga0065707_10184040
881 Ga0065707_10206563
882 Ga0065707_10390203
883 Ga0065707_10564939
884 Ga0065707_10948934
885 Ga0070658_10782587
886 Ga0070658_11223033
887 Ga0070676_10020457
888 Ga0070676_10297725
889 Ga0070683_100569132
890 Ga0070690_100004771
891 Ga0070690_100026899
892 Ga0070690_100103566
893 Ga0070690_100251514
894 Ga0070690_100256632
895 Ga0070670_100002351
896 Ga0070670_100003083
897 Ga0070670_100029465
898 Ga0070670_100124147
899 Ga0070670_100175608
900 Ga0070670_100389898
901 Ga0070677_10005765
902 Ga0070677_10027695
903 Ga0070677_10060147
904 Ga0070677_10127531
905 Ga0070677_10240895
906 Ga0068869_100037129
907 Ga0068869_100040224
908 Ga0068869_100223575
909 Ga0070666_10007753
910 Ga0070666_10177654
911 Ga0070666_10437097
912 Ga0070666_10685239
913 Ga0070682_101022851
914 Ga0068868_100022880
915 Ga0068868_100072709
916 Ga0068868_100141094
917 Ga0068868_100539334
918 Ga0068868_100677054
919 Ga0068868_100679834
920 Ga0070660_100518729
921 Ga0070689_100008690
922 Ga0070689_100026924
923 Ga0070689_100053944
924 Ga0070689_100089827
925 Ga0070689_100166738
926 Ga0070689_100415721
927 Ga0070689_101418299
928 Ga0070687_100051473
929 Ga0070661_100090204
930 Ga0070661_100141758
931 Ga0070661_100163269
932 Ga0070668_100032156
933 Ga0070668_100134095
934 Ga0070668_100480147
935 Ga0070668_101944342
936 Ga0070669_100002731
937 Ga0070669_100041097
938 Ga0070669_100053127
939 Ga0070669_100441103
940 Ga0070669_101461099
941 Ga0070675_100003337
942 Ga0070675_100006767
943 Ga0070675_100008093
944 Ga0070675_100021809
945 Ga0070675_100050787
946 Ga0070675_100075154
947 Ga0070675_100105685
948 Ga0070675_100113079
949 Ga0070675_100180139
950 Ga0070675_100265891
951 Ga0070675_100519832
952 Ga0070675_101680323
953 Ga0070671_100007143
954 Ga0070671_100117485
955 Ga0070671_101513310
956 Ga0070674_100007026
957 Ga0070674_100039649
958 Ga0070674_100061502
959 Ga0070674_100157325
960 Ga0070674_100223677
961 Ga0070674_100254171
962 Ga0070674_100263669
963 Ga0070674_100394910
964 Ga0070674_100438800
965 Ga0070674_102234651
966 Ga0070673_100007888
967 Ga0070673_100009019
968 Ga0070673_100068585
969 Ga0070673_100201571
970 Ga0070673_100774558
971 Ga0070673_101356437
972 Ga0070688_100007684
973 Ga0070688_100054668
974 Ga0070688_100060544
975 Ga0070688_100087753
976 Ga0070688_100241625
977 Ga0070688_100545773
978 Ga0070688_101011401
979 Ga0070659_100327275
980 Ga0070667_100577042
981 Ga0070667_100590551
982 Ga0070667_100815733
983 Ga0070667_101053497
984 Ga0070667_102221244
985 Ga0070701_10028176
986 Ga0070701_10063274
987 Ga0070701_10184798
988 Ga0070701_10271618
989 Ga0070705_100281699
990 Ga0070705_100905409
991 Ga0070705_101303945
992 Ga0070705_101394234
993 Ga0070700_100000525
994 Ga0070700_100066944
995 Ga0070700_100855974
996 Ga0070708_100116882
997 Ga0070663_100044174
998 Ga0070663_100140703
999 Ga0070678_100020326
1000 Ga0070678_100062487
1001 Ga0070678_100327491
1002 Ga0070678_100511933
1003 Ga0070678_101316330
1004 Ga0070662_100002932
1005 Ga0070662_100573869
1006 Ga0070662_100592972
1007 Ga0070662_100802900
1008 Ga0068867_100006310
1009 Ga0068867_100143521
1010 Ga0068867_100356687
1011 Ga0070685_10002042
1012 Ga0070685_10075321
1013 Ga0070685_10322333
1014 Ga0070698_100400428
1015 Ga0070698_101074236
1016 Ga0070698_101673202
1017 Ga0070684_100394439
1018 Ga0070697_100184947
1019 Ga0068853_100202200
1020 Ga0070672_100005408
1021 Ga0070672_100036030
1022 Ga0070672_100052760
1023 Ga0070672_100123987
1024 Ga0070672_101025932
1025 Ga0070672_101435157
1026 Ga0070686_100004533
1027 Ga0070686_100043855
1028 Ga0070686_100044315
1029 Ga0070696_100543395
1030 Ga0070696_100669582
1031 Ga0070696_100761624
1032 Ga0070665_100004309
1033 Ga0070665_100030734
1034 Ga0070665_100824117
1035 Ga0070704_100276707
1036 Ga0070704_101649504
1037 Ga0070664_100003467
1038 Ga0070664_100029088
1039 Ga0070664_100316943
1040 Ga0068857_100083590
1041 Ga0068857_101547063
1042 Ga0070702_100167095
1043 Ga0070702_100183478
1044 Ga0068852_100138800
1045 Ga0068852_100837685
1046 Ga0068852_101514571
1047 Ga0068859_100003208
1048 Ga0068859_100124809
1049 Ga0068859_100233315
1050 Ga0068859_100377249
1051 Ga0068859_100675676
1052 Ga0068859_101148566
1053 Ga0068859_101305633
1054 Ga0068859_101854904
1055 Ga0068864_100002276
1056 Ga0068864_100052826
1057 Ga0068864_100076568
1058 Ga0068864_100162119
1059 Ga0068864_100288840
1060 Ga0068864_100842524
1061 Ga0068864_100988575
1062 Ga0068864_102172403
1063 Ga0068866_10403058
1064 Ga0068866_11194797
1065 Ga0068861_100001899
1066 Ga0068861_100023865
1067 Ga0068861_100050937
1068 Ga0068861_100287442
1069 Ga0068861_101837752
1070 Ga0068851_10005417
1071 Ga0068870_10565125
1072 Ga0068863_100016572
1073 Ga0068863_100076335
1074 Ga0068863_100199153
1075 Ga0068863_100419311
1076 Ga0068863_100641350
1077 Ga0068863_101156947
1078 Ga0068863_101297777
1079 Ga0068858_100067486
1080 Ga0068858_100430238
1081 Ga0068858_101789630
1082 Ga0068858_102220475
1083 Ga0068860_100016344
1084 Ga0068860_100163696
1085 Ga0068862_100059922
1086 Ga0068862_100084074
1087 Ga0068862_100109273
1088 Ga0068862_100125851
1089 Ga0068862_100217674
1090 Ga0068862_100555090
1091 Ga0081455_10857464
1092 Ga0081539_10001090
1093 Ga0081539_10041591
1094 Ga0075365_10566061
1095 Ga0075368_10022563
1096 Ga0075363_100612279
1097 Ga0070716_100076680
1098 Ga0070712_100179415
1099 Ga0075367_10037161
1100 Ga0075427_10021441
1101 Ga0075366_10027617
1102 Ga0075366_10285371
1103 Ga0097621_100000846
1104 Ga0097621_100045198
1105 Ga0097621_100087337
1106 Ga0097621_100452452
1107 Ga0097621_100554921
1108 Ga0068871_100044659
1109 Ga0068871_100050767
1110 Ga0068871_100064706
1111 Ga0068871_100338786
1112 Ga0068871_100384189
1113 Ga0075428_100000903
1114 Ga0075428_100004820
1115 Ga0075428_100039806
1116 Ga0075428_100083998
1117 Ga0075428_100126018
1118 Ga0075428_100615837
1119 Ga0075428_100653170
1120 Ga0075428_100666632
1121 Ga0075428_102234582
1122 Ga0075430_100007806
1123 Ga0075430_100009513
1124 Ga0075430_100012048
1125 Ga0075430_100172750
1126 Ga0075430_100195357
1127 Ga0075430_100216831
1128 Ga0075430_100241743
1129 Ga0075430_100271651
1130 Ga0075430_100367949
1131 Ga0075430_100676098
1132 Ga0075431_100026967
1133 Ga0075431_100070472
1134 Ga0075431_100075218
1135 Ga0075431_100263667
1136 Ga0075433_10000571
1137 Ga0075433_10002511
1138 Ga0075433_10138703
1139 Ga0075433_10159862
1140 Ga0075433_10226809
1141 Ga0075433_10248283
1142 Ga0075434_100007038
1143 Ga0075434_100023809
1144 Ga0075434_100155769
1145 Ga0075434_100681210
1146 Ga0075429_100012005
1147 Ga0075429_100027634
1148 Ga0075429_100039819
1149 Ga0075429_100159611
1150 Ga0075429_100586465
1151 Ga0075429_100787347
1152 Ga0075429_101736102
1153 Ga0068865_100011211
1154 Ga0068865_100204064
1155 Ga0068865_100208085
1156 Ga0068865_100232169
1157 Ga0068865_100315524
1158 Ga0068865_101369773
1159 Ga0075436_100736562
1160 Ga0097620_100003208
1161 Ga0097620_100124798
1162 Ga0097620_100233296
1163 Ga0097620_100377245
1164 Ga0097620_100675728
1165 Ga0097620_101148467
1166 Ga0097620_101305622
1167 Ga0097620_101854755
1168 Ga0075435_100070483
1169 Ga0111539_10001783
1170 Ga0111539_10010186
1171 Ga0111539_10017585
1172 Ga0111539_10028684
1173 Ga0111539_10039058
1174 Ga0111539_10050816
1175 Ga0111539_10066018
1176 Ga0111539_10251432
1177 Ga0111539_10449216
1178 Ga0111539_10467407
1179 Ga0111539_10479913
1180 Ga0111539_10566409
1181 Ga0111539_10827100
1182 Ga0111539_10927907
1183 Ga0111539_10981191
1184 Ga0105245_12115401
1185 Ga0105245_12551057
1186 Ga0105247_10282184
1187 Ga0114129_10001673
1188 Ga0114129_10013583
1189 Ga0114129_10036720
1190 Ga0114129_10050236
1191 Ga0114129_10052373
1192 Ga0114129_10071373
1193 Ga0114129_10094809
1194 Ga0114129_10228568
1195 Ga0114129_11824528
1196 Ga0105243_10060871
1197 Ga0105243_10535577
1198 Ga0105243_11144391
1199 Ga0105241_11988297
1200 Ga0105242_10001931
1201 Ga0105242_10007270
1202 Ga0105242_11502014
1203 Ga0105248_10008629
1204 Ga0105248_10021966
1205 Ga0105248_10026122
1206 Ga0105248_10069029
1207 Ga0105248_10439505
1208 Ga0105248_10607716
1209 Ga0105248_10614582
1210 Ga0105248_10748438
1211 Ga0105248_12091947
1212 Ga0105238_10026535
1213 Ga0105249_10006732
1214 Ga0105249_10014882
1215 Ga0105249_10403296
1216 Ga0105249_10762878
1217 Ga0105249_12780095
1218 Ga0105239_11618136
1219 Ga0105246_10033277
1220 Ga0105246_10053082
1221 Ga0105246_10127829
1222 Ga0105246_10176064
1223 Ga0105246_10456377
1224 Ga0105246_10979335
1225 Ga0105246_11491062
1226 Ga0157315_1003950
1227 Ga0157374_10114133
1228 Ga0157374_10256901
1229 Ga0157374_10301341
1230 Ga0157374_10351824
1231 Ga0157374_10578782
1232 Ga0157374_11524101
1233 Ga0157378_10076886
1234 Ga0157378_11547854
1235 Ga0163162_10029897
1236 Ga0163162_10141496
1237 Ga0163162_10731597
1238 Ga0163162_11699247
1239 Ga0157372_11326003
1240 Ga0157372_11612326
1241 Ga0157375_10090378
1242 Ga0157375_10163031
1243 Ga0157375_10181129
1244 Ga0157375_10246857
1245 Ga0157375_10383266
1246 Ga0157375_10432969
1247 Ga0157375_10478360
1248 Ga0157375_10965593
1249 Ga0157375_11367657
1250 Ga0163163_10030933
1251 Ga0163163_10045945
1252 Ga0163163_10073992
1253 Ga0163163_10084063
1254 Ga0163163_10630794
1255 Ga0163163_10797486
1256 Ga0163163_11142461
1257 Ga0163163_11643211
1258 Ga0157380_10001869
1259 Ga0157380_10013776
1260 Ga0157380_10038603
1261 Ga0157380_10084764
1262 Ga0157380_10104198
1263 Ga0157380_10385737
1264 Ga0157380_10523521
1265 Ga0157380_10531369
1266 Ga0157380_10738920
1267 Ga0157380_10772412
1268 Ga0157380_11761221
1269 Ga0157377_10006256
1270 Ga0157377_10032869
1271 Ga0157377_10860838
1272 Ga0157379_10037658
1273 Ga0157379_11230004
1274 Ga0157379_11767258
1275 Ga0157376_10030877
1276 Ga0157376_10180536
1277 Ga0157376_10419840
1278 Ga0157376_10829911
1279 Ga0157376_11939660
1280 Ga0157376_11971746
1281 Ga0207697_10007053
1282 Ga0207697_10333975
1283 Ga0207656_10002085
1284 Ga0207682_10002886
1285 Ga0207682_10003879
1286 Ga0207682_10074081
1287 Ga0207642_10011067
1288 Ga0207642_10209849
1289 Ga0207642_10256653
1290 Ga0207688_10000058
1291 Ga0207688_10031082
1292 Ga0207688_10531109
1293 Ga0207688_10956150
1294 Ga0207680_10125285
1295 Ga0207680_10148679
1296 Ga0207680_10377547
1297 Ga0207680_10858399
1298 Ga0207685_10254839
1299 Ga0207645_10000244
1300 Ga0207645_10213057
1301 Ga0207643_10000567
1302 Ga0207643_10006597
1303 Ga0207643_10021789
1304 Ga0207643_10023432
1305 Ga0207705_10561103
1306 Ga0207660_10130760
1307 Ga0207662_10001736
1308 Ga0207662_10121699
1309 Ga0207662_10134813
1310 Ga0207662_10571627
1311 Ga0207662_10610606
1312 Ga0207657_10246899
1313 Ga0207649_10074963
1314 Ga0207646_10709669
1315 Ga0207681_10048135
1316 Ga0207681_10052384
1317 Ga0207681_10130179
1318 Ga0207681_10140026
1319 Ga0207681_10188368
1320 Ga0207681_10385271
1321 Ga0207694_10022719
1322 Ga0207650_10001935
1323 Ga0207650_10014154
1324 Ga0207650_10017996
1325 Ga0207650_10146766
1326 Ga0207650_10624694
1327 Ga0207650_11537068
1328 Ga0207659_10001200
1329 Ga0207659_10001233
1330 Ga0207659_10006393
1331 Ga0207659_10030971
1332 Ga0207659_10033965
1333 Ga0207659_10062383
1334 Ga0207659_10134533
1335 Ga0207659_10212426
1336 Ga0207659_10282238
1337 Ga0207659_10475661
1338 Ga0207659_11333836
1339 Ga0207659_11387152
1340 Ga0207659_11895723
1341 Ga0207687_10126141
1342 Ga0207687_10786462
1343 Ga0207644_10025744
1344 Ga0207644_10215624
1345 Ga0207644_11410162
1346 Ga0207690_10286332
1347 Ga0207706_10019108
1348 Ga0207706_10191413
1349 Ga0207706_10217425
1350 Ga0207706_10556680
1351 Ga0207686_10002026
1352 Ga0207686_10033347
1353 Ga0207686_11140842
1354 Ga0207709_10036502
1355 Ga0207670_10017396
1356 Ga0207670_10071335
1357 Ga0207670_10126739
1358 Ga0207670_10211750
1359 Ga0207670_10237928
1360 Ga0207670_10437178
1361 Ga0207669_10000506
1362 Ga0207669_10186129
1363 Ga0207669_10194543
1364 Ga0207669_10319317
1365 Ga0207669_10417454
1366 Ga0207669_11439604
1367 Ga0207669_11655051
1368 Ga0207669_11865614
1369 Ga0207704_10009053
1370 Ga0207704_10095259
1371 Ga0207704_10314451
1372 Ga0207704_10550646
1373 Ga0207665_10137134
1374 Ga0207691_10013787
1375 Ga0207691_10016806
1376 Ga0207691_10018297
1377 Ga0207691_10044994
1378 Ga0207691_10108133
1379 Ga0207691_10150798
1380 Ga0207691_10472977
1381 Ga0207691_10483097
1382 Ga0207691_10879309
1383 Ga0207691_11257066
1384 Ga0207711_10007403
1385 Ga0207711_10105921
1386 Ga0207711_10245776
1387 Ga0207711_10261518
1388 Ga0207711_11875869
1389 Ga0207689_10000917
1390 Ga0207689_10001583
1391 Ga0207689_10182704
1392 Ga0207661_10633034
1393 Ga0207679_10239051
1394 Ga0207679_10500517
1395 Ga0207679_12002753
1396 Ga0207651_10029502
1397 Ga0207651_10037093
1398 Ga0207651_10052979
1399 Ga0207651_10228713
1400 Ga0207651_10353201
1401 Ga0207651_10416790
1402 Ga0207651_10569387
1403 Ga0207651_10596384
1404 Ga0207651_10902353
1405 Ga0207651_11654955
1406 Ga0207712_10035216
1407 Ga0207712_10182701
1408 Ga0207668_10432627
1409 Ga0207668_10787003
1410 Ga0207668_10981884
1411 Ga0207640_10522907
1412 Ga0207658_10079540
1413 Ga0207658_11028944
1414 Ga0207677_10075542
1415 Ga0207677_10138308
1416 Ga0207677_10149808
1417 Ga0207703_10267241
1418 Ga0207703_10331144
1419 Ga0207703_10334685
1420 Ga0207678_10071603
1421 Ga0207708_10007241
1422 Ga0207708_10138667
1423 Ga0207708_10300094
1424 Ga0207708_10503771
1425 Ga0207708_10854468
1426 Ga0207708_11081459
1427 Ga0207641_10008812
1428 Ga0207641_10131283
1429 Ga0207641_10140821
1430 Ga0207641_10498664
1431 Ga0207648_10000549
1432 Ga0207648_10017234
1433 Ga0207648_10071271
1434 Ga0207648_10210798
1435 Ga0207648_10235336
1436 Ga0207648_10238481
1437 Ga0207676_10021466
1438 Ga0207676_10083450
1439 Ga0207676_10111181
1440 Ga0207676_10147209
1441 Ga0207676_10410886
1442 Ga0207676_10494637
1443 Ga0207676_11047566
1444 Ga0207676_11251372
1445 Ga0207674_10107239
1446 Ga0207674_11219702
1447 Ga0207675_100004836
1448 Ga0207675_100011274
1449 Ga0207675_100058714
1450 Ga0207675_100232536
1451 Ga0207675_100327566
1452 Ga0207675_100513648
1453 Ga0207675_100708794
1454 Ga0207683_10004379
1455 Ga0207683_10043159
1456 Ga0207683_10076166
1457 Ga0207683_10199259
1458 Ga0207683_10253098
1459 Ga0207683_10304297
1460 Ga0207683_10312984
1461 Ga0207683_10382100
1462 Ga0207683_11301836
1463 Ga0207683_11453250
1464 Ga0207698_10760019
1465 Ga0207698_12028985
1466 Ga0207698_12611114
1467 Ga0209967_1029329
1468 Ga0209996_1038239
1469 Ga0210002_1027508
1470 Ga0209813_10050929
1471 Ga0209974_10135624
1472 Ga0209974_10340772
1473 Ga0207428_10000910
1474 Ga0207428_10001542
1475 Ga0207428_10001583
1476 Ga0207428_10010206
1477 Ga0207428_10119889
1478 Ga0207428_10251141
1479 Ga0207428_10282337
1480 Ga0207428_10412752
1481 Ga0207428_10732900
1482 Ga0207428_10984518
1483 Ga0268266_10013401
1484 Ga0268266_10129313
1485 Ga0268266_10614236
1486 Ga0268265_10009888
1487 Ga0268265_10033389
1488 Ga0268265_10154991
1489 Ga0268265_10302934
1490 Ga0268265_10599714
1491 Ga0268265_10872868
1492 Ga0268265_11770586
1493 Ga0268264_10037088
1494 Ga0268264_10380656
1495 Ga0268264_11082361
1496 Ga0268264_11622789
1497 Ga0307408_100169066
1498 Ga0307413_10051168
1499 Ga0307410_10139571
1500 Ga0307410_10163097
1501 Ga0307410_11356432
1502 Ga0307406_10115779
1503 Ga0307407_10538748
1504 Ga0307412_10579592
1505 Ga0307412_10659975
1506 Ga0307409_100171835
1507 Ga0307409_100395741
1508 Ga0307416_100097692
1509 Ga0307416_100301085
1510 Ga0307416_100664028
1511 Ga0307416_103097350
1512 Ga0307414_10117591
1513 Ga0307414_10248902
1514 Ga0307414_10323846
1515 Ga0307414_10339279
1516 Ga0307411_10058290
1517 Ga0307411_10113685
1518 Ga0307415_100024446
1519 Ga0307415_100350121
1520 Ga0307415_100393614
1521 Ga0307415_100409818
1522 Ga0307415_101914532
1523 Ga0373934_0057636
1524 Ga0373940_0011906
1525 Ga0373952_0022031
1526 Ga0373923_0345092
1527 Ga0373932_0021038
1528 Ga0373939_0041253
1529 Ga0373941_0044823
1530 Ga0373954_0020458
1531 Ga0373956_0098457
1532 Ga0373957_0002842
1533 Ga0373960_0322435
1534 Ga0373960_0359328
1535 Ga0373955_0009609
1536 Ga0373961_0194302
1537 Ga0373962_0070417
1538 Ga0373933_0007742
1539 Ga0373937_0015524
1540 Ga0373937_0485402
1541 Ga0436365_1860590
1542 Ga0439436_0065929
1543 Ga0451849_0949651
1544 Ga0451853_0239223
1545 Ga0439450_060439
1546 Ga0439446_0013485
1547 Ga0439435_0195140
1548 Ga0451577_0195126
1549 Ga0439440_0034364
1550 Ga0439440_0257140
1551 Ga0453684_0000058
1552 Ga0451576_0256883
1553 Ga0451576_1871291
1554 Ga0495592_0073933
1555 Ga0495603_0074505
1556 Ga0495629_0008199
1557 Ga0495651_0317465
1558 Ga0495594_0141850
1559 Ga0495643_0009974
1560 Ga0495598_0113780
1561 Ga0495621_0018477
1562 Ga0495621_0512183
1563 Ga0495667_0382341
1564 Ga0495656_0643197
1565 Ga0495656_0701244
1566 Ga0495635_0903809
1567 Ga0495635_1065489
1568 Ga0495659_0275622
1569 Ga0495599_0333713
1570 Ga0495599_0545985
1571 Ga0495646_0461707
1572 Ga0495613_0976878
1573 Ga0495613_1077559
1574 Ga0495670_0109559
1575 Ga0495670_0156038
1576 Ga0495677_0273693
1577 Ga0495684_0296747
1578 Ga0495602_1040576
1579 Ga0496101_0597214
1580 Ga0496104_0024201
1581 Ga0496105_0701201
1582 Ga0496106_0353482
1583 Ga0496108_0002813
1584 Ga0496108_0080043
1585 Ga0496109_0002172
1586 Ga0496110_0007883
1587 Ga0496110_0267703
1588 Ga0496110_1630562
1589 Ga0496112_0000823
1590 Ga0496112_0500730
1591 Ga0496113_0003704
1592 Ga0496114_0140195
1593 Ga0501292_038142
1594 Ga0501298_025395
1595 Ga0501034_0401478
1596 Ga0501039_0104414
1597 Ga0501040_0263218
1598 Ga0501040_0305851
1599 Ga0501041_0002303
1600 Ga0501042_0046472
1601 Ga0501042_0070689
1602 Ga0501043_0134234
1603 Ga0501043_0649832
1604 Ga0501046_0291518
1605 Ga0501046_0762084
1606 Ga0501048_0138579
1607 Ga0501070_0101083
1608 Ga0501072_0038352
1609 Ga0501072_0347622
1610 Ga0501075_0025957
1611 Ga0501076_0008907
1612 Ga0501076_0132424
1613 Ga0501216_053062
1614 Ga0501217_023246
1615 Ga0501223_081903
1616 Ga0501227_244351
1617 Ga0501238_061190
1618 Ga0501239_063614
1619 Ga0501247_035977
1620 Ga0501249_017454
1621 Ga0501253_118814
1622 Ga0501225_0078042
1623 Ga0501079_0018855
1624 Ga0501079_0215397
1625 Ga0501080_0228086
1626 Ga0501080_0493993
1627 Ga0501081_0044743
1628 Ga0501262_031422
1629 Ga0501270_014104
1630 Ga0501283_005683
1631 Ga0501035_0738622
1632 Ga0501045_0026829
1633 Ga0501045_0204292
1634 nmdc:mga0k408_191901_c1
1635 nmdc:mga0k408_268591_c1
1636 nmdc:mga04h51_45691_c1
1637 nmdc:mga05p37_123159_c1
1638 nmdc:mga05p37_1356_c1
1639 nmdc:mga05p37_146938_c1
1640 nmdc:mga05p37_1557635_c1
1641 nmdc:mga05p37_261182_c1
1642 nmdc:mga05p37_39_c1
1643 nmdc:mga05p37_53283_c1
1644 nmdc:mga05p37_533731_c1
1645 nmdc:mga05p37_53866_c1
1646 nmdc:mga05p37_64794_c1
1647 nmdc:mga05p37_769196_c1
1648 nmdc:mga09592_112929_c2
1649 nmdc:mga09592_11687_c1
1650 nmdc:mga09592_120248_c1
1651 nmdc:mga09592_1275674_c1
1652 nmdc:mga09592_1433066_c1
1653 nmdc:mga09592_169729_c1
1654 nmdc:mga09592_55477_c1
1655 nmdc:mga09592_9285_c1
1656 nmdc:mga0qj67_1331882_c1
1657 nmdc:mga0qj67_153654_c1
1658 nmdc:mga0qj67_31738_c1
1659 nmdc:mga0qj67_318114_c1
1660 nmdc:mga0qj67_442760_c1
1661 nmdc:mga0qj67_49339_c2
1662 nmdc:mga0qj67_6854_c1
1663 nmdc:mga06r32_1269_c1
1664 nmdc:mga06r32_261778_c1
1665 nmdc:mga06r32_40429_c1
1666 nmdc:mga06r32_42335_c1
1667 nmdc:mga06r32_493243_c1
1668 nmdc:mga06r32_577940_c1
1669 nmdc:mga06r32_698405_c1
1670 nmdc:mga08y16_12561_c1
1671 nmdc:mga08y16_157524_c1
1672 nmdc:mga08y16_16051_c1
1673 nmdc:mga08y16_169116_c1
1674 nmdc:mga08y16_1780_c1
1675 nmdc:mga08y16_236447_c1
1676 nmdc:mga08y16_2527_c1
1677 nmdc:mga08y16_301445_c1
1678 nmdc:mga08y16_333801_c1
1679 nmdc:mga08y16_41447_c1
1680 nmdc:mga08y16_480558_c1
1681 nmdc:mga08y16_505522_c1
1682 nmdc:mga08y16_921252_c1
1683 nmdc:mga0n895_11208_c1
1684 nmdc:mga0n895_218101_c1
1685 nmdc:mga0n895_26191_c1
1686 nmdc:mga0n895_337037_c1
1687 nmdc:mga0rr50_42135_c1
1688 nmdc:mga0a205_11716_c1
1689 nmdc:mga0a205_139_c1
1690 nmdc:mga0a205_17547_c1
1691 nmdc:mga0a205_252155_c1
1692 nmdc:mga0a205_480697_c1
1693 nmdc:mga0a205_4954_c1
1694 nmdc:mga0a205_653538_c1
1695 Ga0495601_0526063
1696 Ga0495595_0179293
1697 Ga0495619_0128170
1698 Ga0500628_012481
1699 Ga0501084_0120704
1700 Ga0501084_1012829
1701 Ga0501084_1776374
1702 Ga0590071_031382
1703 Ga0590075_025765
1704 Ga0590075_040890
1705 Ga0590075_057462
1706 Ga0590077_007721
1707 Ga0501082_0169592
1708 Ga0501082_0472156
1709 Ga0530510_0136858
1710 Ga0530510_0383586

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01894

UPF0047

Uncharacterised protein family UPF0047

47

161

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2p6c-assembly1.cif.gz_A crystal structure of hypothetical protein aq_2013 from aquifex aeolicus vf5. 0.9728 1 137
1vmj-assembly1.cif.gz_A crystal structure of a putative thiamin phosphate synthase (tm0723) from thermotoga maritima msb8 at 1.52 a resolution 0.9679 1 137
1vmj-assembly1.cif.gz_A crystal structure of a putative thiamin phosphate synthase (tm0723) from thermotoga maritima msb8 at 1.52 a resolution 0.961 1 137
1xbf-assembly1.cif.gz_C x-ray structure northeast structural genomics consortium target car10 from c. acetobutylicum 0.9567 4 135
1vph-assembly2.cif.gz_E crystal structure of a ybjq-like protein of unknown function (sso2532) from sulfolobus solfataricus p2 at 1.76 a resolution 0.9532 3 137
ID Description Score Start End Superfamily
2p6cB00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.973 1 137 2.60.120.460
1vphC00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9518 2 137 2.60.120.460
2p6hB00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9437 4 137 2.60.120.460
1xbfB00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9391 6 135 2.60.120.460
1vphC00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9385 2 137 2.60.120.460
ID Description Score Start End GO Terms
AF-H2J4V7-F1-model_v4 Secondary thiamine-phosphate synthase enzyme 0.9872 3 136
AF-A0A1L6L9R6-F1-model_v4 deleted 0.9854 2 137
AF-A0A7V8WEF2-F1-model_v4 YjbQ family protein 0.9852 3 137
AF-A0A1G3AQ06-F1-model_v4 Secondary thiamine-phosphate synthase enzyme 0.9844 1 123
AF-A0A7C2L2Z4-F1-model_v4 YjbQ family protein 0.9836 27 137

Map