F483602
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 854 | 405 | 1708 | 154 |
Family's Representative Sequence
| Representative Sequence | 3300053139|Ga0500568_0000279|Ga0500568_0000279_17936_18397 |
| Length | 153 |
| Sequence | MSPQIATNTEVDRAGMEDFVRPNHQAVLITTRQDGRPQASPVTCGLDTEGRIVISTYPERAKTANARRDPQVSVVVLTERNGAEGWIQVDGDAEVIDPPDSVEPLVEYFRVISGEHPDWDEYRQAMREQGKSLIRVTPTRWSPIATGGFPAPS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 5 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 6 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 39 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 46 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 47 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 48 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 50 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 51 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 52 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 53 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 54 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 55 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 56 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 57 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 58 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 59 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 60 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 62 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 63 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 64 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 68 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 69 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 70 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 71 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 72 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 73 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 74 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 75 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 77 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009993 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG | Metagenome | Rhizosphere |
| 89 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 90 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300012481 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 | Metagenome | Rhizosphere |
| 93 | 3300012494 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 | Metagenome | Rhizosphere |
| 94 | 3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Metagenome | Rhizosphere |
| 95 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 106 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 111 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 112 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 113 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 168 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 172 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 173 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 174 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 175 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 176 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 177 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 178 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 179 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 180 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 181 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 182 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 183 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 184 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 185 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 186 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 187 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 188 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 189 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 190 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 191 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 192 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 193 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 194 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 195 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 196 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 197 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 198 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 199 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 200 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 201 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 202 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 203 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 204 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 205 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 206 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 207 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 208 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 209 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 210 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 211 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 212 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 213 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 214 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 215 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 216 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 217 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 218 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 219 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 220 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 221 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 222 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 223 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 224 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 225 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 226 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 227 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 228 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 229 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 230 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 231 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 232 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 233 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 234 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 235 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 236 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 237 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 238 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 239 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 240 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 241 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 242 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 243 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 244 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 245 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 246 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 247 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 248 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 249 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 250 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 251 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 300 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 301 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 302 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 303 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 304 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 305 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 306 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 307 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 308 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 309 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 310 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 311 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 312 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 313 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 314 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 315 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 316 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 317 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 318 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 319 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 320 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 321 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 322 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 323 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 324 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 325 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 328 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 330 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 331 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 339 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 340 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 345 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 354 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 355 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 356 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 357 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 358 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 359 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 360 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 361 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 362 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 367 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 368 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 369 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 370 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 371 | 3300053100 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere | Metagenome | Endosphere |
| 372 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 373 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 374 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 375 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 376 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 377 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 378 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 379 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 380 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 381 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 382 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 384 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 385 | 2515154155 | Actinopolymorpha alba DSM 45243 | Isolate | Rhizosphere |
| 386 | 2558860112 | Pseudonocardia acaciae DSM 45401 | Isolate | Unclassified |
| 387 | 2643221567 | Phycicoccus sp. Root563 | Isolate | Unclassified |
| 388 | 2643221624 | Phycicoccus sp. Root101 | Isolate | Unclassified |
| 389 | 2675903058 | Actinopolymorpha cephalotaxi CPCC 202808 | Isolate | Rhizosphere |
| 390 | 2675903060 | Nonomuraea wenchangensis CGMCC 4.5598 | Isolate | Rhizosphere |
| 391 | 2731639228 | Motilibacter peucedani DSM 45328 | Isolate | Rhizosphere |
| 392 | 2751185782 | Actinoplanes subtropicus NRRL B-24665 | Isolate | Rhizosphere |
| 393 | 2775506925 | Saccharopolyspora phatthalungensis NRRL B-24798 | Isolate | Rhizosphere |
| 394 | 2791354901 | Actinophytocola xanthii 11-183 | Isolate | Rhizosphere |
| 395 | 2816332119 | Kribbella amoyensis DSM 24683 | Isolate | Rhizosphere |
| 396 | 2827628540 | Actinopolymorpha cephalotaxi DSM 45117 | Isolate | Rhizosphere |
| 397 | 2861520306 | Phytomonospora endophytica DSM 45386 | Isolate | Unclassified |
| 398 | 2863067949 | Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) | Isolate | Rhizosphere |
| 399 | 2870782633 | Pseudonocardia eucalypti DSM 45351 | Isolate | Unclassified |
| 400 | 2880495981 | Micromonospora vinacea DSM 101695 | Isolate | Unclassified |
| 401 | 2891326441 | Actinokineospora pegani TRM65233 | Isolate | Unclassified |
| 402 | 2895427314 | Nonomuraea sp. PA05 | Isolate | Unclassified |
| 403 | 2899359706 | Amycolatopsis anabasis EGI 650086 | Isolate | Unclassified |
| 404 | 3006425503 | Streptomyces zingiberis PLAI1-29 | Isolate | Unclassified |
| 405 | 8054472261 | Pseudonocardia terrae RS11V-5 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.19 |
| Metatranscriptomes | 0.35 |
| Isolates | 2.46 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.04 |
| Nodule | 0 |
| Rhizoplane | 5.62 |
| Rhizosphere | 83.49 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0500568_0000279 | 3300053139 | Bacteria | 42452 |
| 2 | JGI24740J21852_10039081 | 3300001979 | Bacteria | 1451 |
| 3 | JGI24737J22298_10025955 | 3300001990 | Bacteria | 1850 |
| 4 | JGI24735J21928_10066184 | 3300002067 | Bacteria | 1037 |
| 5 | JGI24735J21928_10151701 | 3300002067 | Bacteria | 669 |
| 6 | JGI25406J46586_10006430 | 3300003203 | Bacteria | 5407 |
| 7 | JGI25406J46586_10047164 | 3300003203 | Bacteria | 1470 |
| 8 | rootH2_10025380 | 3300003320 | Bacteria | 2582 |
| 9 | rootH2_10032131 | 3300003320 | Bacteria | 3228 |
| 10 | Ga0070658_10228614 | 3300005327 | Bacteria | 1575 |
| 11 | Ga0070676_10123669 | 3300005328 | Bacteria | 1627 |
| 12 | Ga0070683_100296637 | 3300005329 | Bacteria | 1537 |
| 13 | Ga0070683_100650643 | 3300005329 | Bacteria | 1009 |
| 14 | Ga0070683_101167091 | 3300005329 | Bacteria | 740 |
| 15 | Ga0070683_101332403 | 3300005329 | Bacteria | 690 |
| 16 | Ga0068869_100025111 | 3300005334 | Bacteria | 4134 |
| 17 | Ga0068869_100199463 | 3300005334 | Bacteria | 1577 |
| 18 | Ga0068869_100526402 | 3300005334 | Bacteria | 990 |
| 19 | Ga0070666_10318144 | 3300005335 | Bacteria | 1110 |
| 20 | Ga0068868_100013555 | 3300005338 | Bacteria | 5981 |
| 21 | Ga0068868_100098486 | 3300005338 | Bacteria | 2364 |
| 22 | Ga0068868_100497572 | 3300005338 | Bacteria | 1067 |
| 23 | Ga0070660_100556154 | 3300005339 | Bacteria | 957 |
| 24 | Ga0070689_100718952 | 3300005340 | Bacteria | 873 |
| 25 | Ga0070689_100987152 | 3300005340 | Bacteria | 748 |
| 26 | Ga0070691_10034979 | 3300005341 | Bacteria | 2365 |
| 27 | Ga0070687_100089905 | 3300005343 | Bacteria | 1696 |
| 28 | Ga0070687_100942635 | 3300005343 | Bacteria | 622 |
| 29 | Ga0070661_100020447 | 3300005344 | Bacteria | 4721 |
| 30 | Ga0070692_10002568 | 3300005345 | Bacteria | 7081 |
| 31 | Ga0070668_100010835 | 3300005347 | Bacteria | 6784 |
| 32 | Ga0070668_100480955 | 3300005347 | Bacteria | 1072 |
| 33 | Ga0070668_100482230 | 3300005347 | Bacteria | 1071 |
| 34 | Ga0070669_100170917 | 3300005353 | Bacteria | 1694 |
| 35 | Ga0070669_100459275 | 3300005353 | Bacteria | 1051 |
| 36 | Ga0070675_100000709 | 3300005354 | Bacteria | 23182 |
| 37 | Ga0070675_100190516 | 3300005354 | Bacteria | 1776 |
| 38 | Ga0070671_100068785 | 3300005355 | Bacteria | 2953 |
| 39 | Ga0070674_100094375 | 3300005356 | Bacteria | 2167 |
| 40 | Ga0070674_101838188 | 3300005356 | Bacteria | 550 |
| 41 | Ga0070673_100870314 | 3300005364 | Bacteria | 834 |
| 42 | Ga0070667_100205890 | 3300005367 | Bacteria | 1747 |
| 43 | Ga0070667_100769267 | 3300005367 | Bacteria | 893 |
| 44 | Ga0070709_10143765 | 3300005434 | Bacteria | 1641 |
| 45 | Ga0070709_10316306 | 3300005434 | Bacteria | 1144 |
| 46 | Ga0070709_10879298 | 3300005434 | Bacteria | 707 |
| 47 | Ga0070714_100023518 | 3300005435 | Bacteria | 5065 |
| 48 | Ga0070714_100121881 | 3300005435 | Bacteria | 2320 |
| 49 | Ga0070714_100729056 | 3300005435 | Bacteria | 957 |
| 50 | Ga0070710_10034440 | 3300005437 | Bacteria | 2755 |
| 51 | Ga0070701_10186532 | 3300005438 | Bacteria | 1218 |
| 52 | Ga0070701_10727975 | 3300005438 | Bacteria | 670 |
| 53 | Ga0070711_100906630 | 3300005439 | Bacteria | 752 |
| 54 | Ga0070711_101017161 | 3300005439 | Bacteria | 711 |
| 55 | Ga0070711_101019916 | 3300005439 | Bacteria | 710 |
| 56 | Ga0070700_100005842 | 3300005441 | Bacteria | 6533 |
| 57 | Ga0070700_100352793 | 3300005441 | Bacteria | 1091 |
| 58 | Ga0070663_100131697 | 3300005455 | Bacteria | 1900 |
| 59 | Ga0070663_100238353 | 3300005455 | Bacteria | 1435 |
| 60 | Ga0070663_100320318 | 3300005455 | Bacteria | 1246 |
| 61 | Ga0070678_100078774 | 3300005456 | Bacteria | 2490 |
| 62 | Ga0070678_100174028 | 3300005456 | Bacteria | 1756 |
| 63 | Ga0070678_100840278 | 3300005456 | Bacteria | 836 |
| 64 | Ga0070662_100214900 | 3300005457 | Bacteria | 1532 |
| 65 | Ga0070685_11064398 | 3300005466 | Bacteria | 610 |
| 66 | Ga0070679_100423228 | 3300005530 | Bacteria | 1277 |
| 67 | Ga0070684_100166028 | 3300005535 | Bacteria | 2004 |
| 68 | Ga0070684_100220184 | 3300005535 | Bacteria | 1732 |
| 69 | Ga0070684_100239806 | 3300005535 | Bacteria | 1656 |
| 70 | Ga0070684_100356396 | 3300005535 | Bacteria | 1346 |
| 71 | Ga0070684_100817318 | 3300005535 | Bacteria | 872 |
| 72 | Ga0070684_101029078 | 3300005535 | Bacteria | 773 |
| 73 | Ga0068853_100494232 | 3300005539 | Bacteria | 1154 |
| 74 | Ga0070672_100222370 | 3300005543 | Bacteria | 1584 |
| 75 | Ga0070686_100052033 | 3300005544 | Bacteria | 2610 |
| 76 | Ga0070695_100053227 | 3300005545 | Bacteria | 2602 |
| 77 | Ga0070696_100155862 | 3300005546 | Bacteria | 1680 |
| 78 | Ga0070696_100296868 | 3300005546 | Bacteria | 1236 |
| 79 | Ga0070696_100394244 | 3300005546 | Bacteria | 1082 |
| 80 | Ga0070665_100075860 | 3300005548 | Bacteria | 3369 |
| 81 | Ga0070665_100134710 | 3300005548 | Bacteria | 2472 |
| 82 | Ga0070665_100231308 | 3300005548 | Bacteria | 1848 |
| 83 | Ga0070665_100488283 | 3300005548 | Bacteria | 1243 |
| 84 | Ga0070664_100000718 | 3300005564 | Bacteria | 25389 |
| 85 | Ga0070664_100444024 | 3300005564 | Bacteria | 1190 |
| 86 | Ga0068857_100007375 | 3300005577 | Bacteria | 9467 |
| 87 | Ga0068857_100063374 | 3300005577 | Bacteria | 3286 |
| 88 | Ga0068857_100099474 | 3300005577 | Bacteria | 2609 |
| 89 | Ga0068854_100038236 | 3300005578 | Bacteria | 3373 |
| 90 | Ga0068854_100757836 | 3300005578 | Bacteria | 843 |
| 91 | Ga0068856_100268986 | 3300005614 | Bacteria | 1720 |
| 92 | Ga0070702_100113027 | 3300005615 | Bacteria | 1687 |
| 93 | Ga0070702_100398093 | 3300005615 | Bacteria | 984 |
| 94 | Ga0068852_100134269 | 3300005616 | Bacteria | 2283 |
| 95 | Ga0068852_100407282 | 3300005616 | Bacteria | 1339 |
| 96 | Ga0068852_100580169 | 3300005616 | Bacteria | 1124 |
| 97 | Ga0068852_100848862 | 3300005616 | Bacteria | 929 |
| 98 | Ga0068859_100398305 | 3300005617 | Bacteria | 1472 |
| 99 | Ga0068859_101949322 | 3300005617 | Bacteria | 649 |
| 100 | Ga0068864_100028185 | 3300005618 | Bacteria | 4745 |
| 101 | Ga0068864_100120757 | 3300005618 | Bacteria | 2343 |
| 102 | Ga0068864_100809471 | 3300005618 | Bacteria | 921 |
| 103 | Ga0068866_10249620 | 3300005718 | Bacteria | 1085 |
| 104 | Ga0068866_10251756 | 3300005718 | Bacteria | 1081 |
| 105 | Ga0068863_100025022 | 3300005841 | Bacteria | 5693 |
| 106 | Ga0068863_100271312 | 3300005841 | Bacteria | 1642 |
| 107 | Ga0068863_100404457 | 3300005841 | Bacteria | 1336 |
| 108 | Ga0068858_100093570 | 3300005842 | Bacteria | 2798 |
| 109 | Ga0068858_100172930 | 3300005842 | Bacteria | 2037 |
| 110 | Ga0068858_100338890 | 3300005842 | Bacteria | 1439 |
| 111 | Ga0068860_100080897 | 3300005843 | Bacteria | 3089 |
| 112 | Ga0068860_100098427 | 3300005843 | Bacteria | 2789 |
| 113 | Ga0068860_101741769 | 3300005843 | Bacteria | 645 |
| 114 | Ga0068862_100076550 | 3300005844 | Bacteria | 2896 |
| 115 | Ga0068862_100250669 | 3300005844 | Bacteria | 1613 |
| 116 | Ga0081455_10028326 | 3300005937 | Bacteria | 5119 |
| 117 | Ga0081455_10211922 | 3300005937 | Bacteria | 1443 |
| 118 | Ga0081540_1000058 | 3300005983 | Bacteria | 120635 |
| 119 | Ga0081540_1021085 | 3300005983 | Bacteria | 3895 |
| 120 | Ga0081539_10000023 | 3300005985 | Bacteria | 356082 |
| 121 | Ga0081539_10001040 | 3300005985 | Bacteria | 50896 |
| 122 | Ga0081539_10006795 | 3300005985 | Bacteria | 10732 |
| 123 | Ga0081539_10010243 | 3300005985 | Bacteria | 7660 |
| 124 | Ga0081539_10015448 | 3300005985 | Bacteria | 5547 |
| 125 | Ga0081539_10120679 | 3300005985 | Bacteria | 1303 |
| 126 | Ga0070717_10137653 | 3300006028 | Bacteria | 2104 |
| 127 | Ga0070717_10189101 | 3300006028 | Bacteria | 1798 |
| 128 | Ga0075368_10084855 | 3300006042 | Bacteria | 1291 |
| 129 | Ga0075363_100475718 | 3300006048 | Bacteria | 740 |
| 130 | Ga0075364_10082107 | 3300006051 | Bacteria | 2132 |
| 131 | Ga0075364_10125684 | 3300006051 | Bacteria | 1719 |
| 132 | Ga0070715_10007916 | 3300006163 | Bacteria | 3679 |
| 133 | Ga0070716_100095811 | 3300006173 | Bacteria | 1807 |
| 134 | Ga0097621_100102751 | 3300006237 | Bacteria | 2407 |
| 135 | Ga0068871_100158310 | 3300006358 | Bacteria | 1935 |
| 136 | Ga0068871_100250138 | 3300006358 | Bacteria | 1544 |
| 137 | Ga0075428_100000928 | 3300006844 | Bacteria | 30979 |
| 138 | Ga0075430_100001813 | 3300006846 | Bacteria | 17480 |
| 139 | Ga0075431_100002633 | 3300006847 | Bacteria | 17355 |
| 140 | Ga0075434_100120747 | 3300006871 | Bacteria | 2636 |
| 141 | Ga0075429_100005321 | 3300006880 | Bacteria | 11079 |
| 142 | Ga0075429_100217633 | 3300006880 | Bacteria | 1673 |
| 143 | Ga0068865_100091338 | 3300006881 | Bacteria | 2209 |
| 144 | Ga0068865_100623422 | 3300006881 | Bacteria | 914 |
| 145 | Ga0075436_100066545 | 3300006914 | Bacteria | 2490 |
| 146 | Ga0075436_100265984 | 3300006914 | Bacteria | 1223 |
| 147 | Ga0097620_100398316 | 3300006931 | Bacteria | 1472 |
| 148 | Ga0097620_101949203 | 3300006931 | Bacteria | 649 |
| 149 | Ga0075435_100097133 | 3300007076 | Bacteria | 2437 |
| 150 | Ga0105240_10205272 | 3300009093 | Bacteria | 2307 |
| 151 | Ga0111539_10401260 | 3300009094 | Bacteria | 1597 |
| 152 | Ga0111539_11636840 | 3300009094 | Bacteria | 746 |
| 153 | Ga0105245_10018559 | 3300009098 | Bacteria | 6084 |
| 154 | Ga0105245_10097598 | 3300009098 | Bacteria | 2714 |
| 155 | Ga0105245_10258130 | 3300009098 | Bacteria | 1695 |
| 156 | Ga0105245_10486391 | 3300009098 | Bacteria | 1248 |
| 157 | Ga0105245_11447250 | 3300009098 | Bacteria | 737 |
| 158 | Ga0105247_10192019 | 3300009101 | Bacteria | 1368 |
| 159 | Ga0105247_10646038 | 3300009101 | Bacteria | 790 |
| 160 | Ga0114129_10001569 | 3300009147 | Bacteria | 31005 |
| 161 | Ga0114129_10312053 | 3300009147 | Bacteria | 2093 |
| 162 | Ga0105243_10605593 | 3300009148 | Bacteria | 1055 |
| 163 | Ga0105243_10623216 | 3300009148 | Bacteria | 1042 |
| 164 | Ga0105241_10166250 | 3300009174 | Bacteria | 1818 |
| 165 | Ga0105241_10226543 | 3300009174 | Bacteria | 1574 |
| 166 | Ga0105242_10244439 | 3300009176 | Bacteria | 1615 |
| 167 | Ga0105242_12742442 | 3300009176 | Bacteria | 543 |
| 168 | Ga0105248_10078750 | 3300009177 | Bacteria | 3705 |
| 169 | Ga0105248_11964486 | 3300009177 | Bacteria | 664 |
| 170 | Ga0105238_10023747 | 3300009551 | Bacteria | 6249 |
| 171 | Ga0105238_10878443 | 3300009551 | Bacteria | 914 |
| 172 | Ga0105249_10078389 | 3300009553 | Bacteria | 3065 |
| 173 | Ga0105249_10104596 | 3300009553 | Bacteria | 2668 |
| 174 | Ga0105249_10264401 | 3300009553 | Bacteria | 1711 |
| 175 | Ga0105249_10670663 | 3300009553 | Bacteria | 1095 |
| 176 | Ga0105249_10838177 | 3300009553 | Bacteria | 985 |
| 177 | Ga0105028_112309 | 3300009993 | Bacteria | 904 |
| 178 | Ga0099796_10040471 | 3300010159 | Bacteria | 1574 |
| 179 | Ga0105239_10770055 | 3300010375 | Bacteria | 1102 |
| 180 | Ga0105239_12560140 | 3300010375 | Bacteria | 595 |
| 181 | Ga0105246_10020598 | 3300011119 | Bacteria | 4232 |
| 182 | Ga0105246_10034512 | 3300011119 | Bacteria | 3372 |
| 183 | Ga0157320_1000308 | 3300012481 | Bacteria | 1818 |
| 184 | Ga0157341_1003899 | 3300012494 | Bacteria | 1061 |
| 185 | Ga0157339_1001953 | 3300012505 | Bacteria | 1339 |
| 186 | Ga0157373_11140705 | 3300013100 | Bacteria | 586 |
| 187 | Ga0157370_10188776 | 3300013104 | Bacteria | 1913 |
| 188 | Ga0157370_11061833 | 3300013104 | Bacteria | 732 |
| 189 | Ga0157369_10172796 | 3300013105 | Bacteria | 2276 |
| 190 | Ga0157369_12085429 | 3300013105 | Bacteria | 575 |
| 191 | Ga0157374_10235147 | 3300013296 | Bacteria | 1801 |
| 192 | Ga0157374_10909142 | 3300013296 | Bacteria | 898 |
| 193 | Ga0157378_11383862 | 3300013297 | Bacteria | 746 |
| 194 | Ga0157378_11837503 | 3300013297 | Bacteria | 654 |
| 195 | Ga0163162_10241283 | 3300013306 | Bacteria | 1938 |
| 196 | Ga0163162_11551782 | 3300013306 | Bacteria | 755 |
| 197 | Ga0157372_10148226 | 3300013307 | Bacteria | 2706 |
| 198 | Ga0157372_10179944 | 3300013307 | Bacteria | 2447 |
| 199 | Ga0157372_10476288 | 3300013307 | Bacteria | 1455 |
| 200 | Ga0157372_10497173 | 3300013307 | Bacteria | 1422 |
| 201 | Ga0157372_10597538 | 3300013307 | Bacteria | 1286 |
| 202 | Ga0157372_11009058 | 3300013307 | Bacteria | 964 |
| 203 | Ga0157375_10202460 | 3300013308 | Bacteria | 2141 |
| 204 | Ga0157375_12024999 | 3300013308 | Bacteria | 685 |
| 205 | Ga0163163_10604857 | 3300014325 | Bacteria | 1159 |
| 206 | Ga0157380_10843654 | 3300014326 | Bacteria | 937 |
| 207 | Ga0182008_10197144 | 3300014497 | Bacteria | 1023 |
| 208 | Ga0157377_10039003 | 3300014745 | Bacteria | 2626 |
| 209 | Ga0157377_10506402 | 3300014745 | Bacteria | 845 |
| 210 | Ga0157379_10125714 | 3300014968 | Bacteria | 2307 |
| 211 | Ga0157379_10206745 | 3300014968 | Bacteria | 1776 |
| 212 | Ga0157379_10212292 | 3300014968 | Bacteria | 1752 |
| 213 | Ga0157379_10725004 | 3300014968 | Bacteria | 934 |
| 214 | Ga0157379_11529582 | 3300014968 | Bacteria | 650 |
| 215 | Ga0157376_11584318 | 3300014969 | Bacteria | 689 |
| 216 | Ga0163161_10079551 | 3300017792 | Bacteria | 2410 |
| 217 | Ga0206356_11814867 | 3300020070 | Bacteria | 2627 |
| 218 | Ga0206354_10641417 | 3300020081 | Bacteria | 1789 |
| 219 | Ga0213875_10008590 | 3300021388 | Bacteria | 5220 |
| 220 | Ga0213875_10150826 | 3300021388 | Bacteria | 1089 |
| 221 | Ga0207653_10005339 | 3300025885 | Bacteria | 4015 |
| 222 | Ga0207692_10033785 | 3300025898 | Bacteria | 2471 |
| 223 | Ga0207692_10151324 | 3300025898 | Bacteria | 1329 |
| 224 | Ga0207642_10817141 | 3300025899 | Bacteria | 594 |
| 225 | Ga0207642_10906420 | 3300025899 | Bacteria | 565 |
| 226 | Ga0207688_10045916 | 3300025901 | Bacteria | 2438 |
| 227 | Ga0207688_10080283 | 3300025901 | Bacteria | 1862 |
| 228 | Ga0207688_10216207 | 3300025901 | Bacteria | 1153 |
| 229 | Ga0207647_10065359 | 3300025904 | Bacteria | 2208 |
| 230 | Ga0207647_10071626 | 3300025904 | Bacteria | 2091 |
| 231 | Ga0207699_10035332 | 3300025906 | Bacteria | 2843 |
| 232 | Ga0207699_10077768 | 3300025906 | Bacteria | 2048 |
| 233 | Ga0207645_10054576 | 3300025907 | Bacteria | 2552 |
| 234 | Ga0207645_10898946 | 3300025907 | Bacteria | 601 |
| 235 | Ga0207643_10049315 | 3300025908 | Bacteria | 2386 |
| 236 | Ga0207705_10291527 | 3300025909 | Bacteria | 1250 |
| 237 | Ga0207705_10376529 | 3300025909 | Bacteria | 1096 |
| 238 | Ga0207654_11141187 | 3300025911 | Bacteria | 568 |
| 239 | Ga0207693_10179824 | 3300025915 | Bacteria | 1664 |
| 240 | Ga0207663_10018650 | 3300025916 | Bacteria | 3893 |
| 241 | Ga0207663_10089606 | 3300025916 | Bacteria | 2037 |
| 242 | Ga0207660_10988948 | 3300025917 | Bacteria | 686 |
| 243 | Ga0207662_10009420 | 3300025918 | Bacteria | 5374 |
| 244 | Ga0207662_10434467 | 3300025918 | Bacteria | 895 |
| 245 | Ga0207657_10006571 | 3300025919 | Bacteria | 12042 |
| 246 | Ga0207657_10142647 | 3300025919 | Bacteria | 1956 |
| 247 | Ga0207649_10253628 | 3300025920 | Bacteria | 1268 |
| 248 | Ga0207649_10587485 | 3300025920 | Bacteria | 855 |
| 249 | Ga0207649_11219064 | 3300025920 | Bacteria | 595 |
| 250 | Ga0207652_10558377 | 3300025921 | Bacteria | 1028 |
| 251 | Ga0207646_10734864 | 3300025922 | Bacteria | 881 |
| 252 | Ga0207681_10065583 | 3300025923 | Bacteria | 2511 |
| 253 | Ga0207681_10236556 | 3300025923 | Bacteria | 1420 |
| 254 | Ga0207694_10544142 | 3300025924 | Bacteria | 974 |
| 255 | Ga0207694_10617487 | 3300025924 | Bacteria | 912 |
| 256 | Ga0207650_10314680 | 3300025925 | Bacteria | 1281 |
| 257 | Ga0207650_10830481 | 3300025925 | Bacteria | 784 |
| 258 | Ga0207650_11305686 | 3300025925 | Bacteria | 618 |
| 259 | Ga0207659_10035704 | 3300025926 | Bacteria | 3439 |
| 260 | Ga0207659_10162806 | 3300025926 | Bacteria | 1753 |
| 261 | Ga0207687_10089049 | 3300025927 | Bacteria | 2246 |
| 262 | Ga0207687_10130223 | 3300025927 | Bacteria | 1895 |
| 263 | Ga0207687_10321848 | 3300025927 | Bacteria | 1252 |
| 264 | Ga0207687_10343797 | 3300025927 | Bacteria | 1214 |
| 265 | Ga0207700_10091384 | 3300025928 | Bacteria | 2404 |
| 266 | Ga0207700_10094770 | 3300025928 | Bacteria | 2366 |
| 267 | Ga0207700_10912054 | 3300025928 | Bacteria | 786 |
| 268 | Ga0207700_10998145 | 3300025928 | Bacteria | 749 |
| 269 | Ga0207664_10013247 | 3300025929 | Bacteria | 5910 |
| 270 | Ga0207664_10021185 | 3300025929 | Bacteria | 4829 |
| 271 | Ga0207664_10067283 | 3300025929 | Bacteria | 2874 |
| 272 | Ga0207664_10120661 | 3300025929 | Bacteria | 2193 |
| 273 | Ga0207664_10558512 | 3300025929 | Bacteria | 1027 |
| 274 | Ga0207644_10834928 | 3300025931 | Bacteria | 771 |
| 275 | Ga0207706_10061213 | 3300025933 | Bacteria | 3315 |
| 276 | Ga0207706_10185342 | 3300025933 | Bacteria | 1828 |
| 277 | Ga0207709_10040285 | 3300025935 | Bacteria | 2796 |
| 278 | Ga0207709_10367046 | 3300025935 | Bacteria | 1091 |
| 279 | Ga0207670_10327097 | 3300025936 | Bacteria | 1208 |
| 280 | Ga0207670_11263524 | 3300025936 | Bacteria | 626 |
| 281 | Ga0207669_10450389 | 3300025937 | Bacteria | 1020 |
| 282 | Ga0207669_11592405 | 3300025937 | Bacteria | 557 |
| 283 | Ga0207704_10457414 | 3300025938 | Bacteria | 1020 |
| 284 | Ga0207665_10088785 | 3300025939 | Bacteria | 2140 |
| 285 | Ga0207665_10157204 | 3300025939 | Bacteria | 1633 |
| 286 | Ga0207691_10012460 | 3300025940 | Bacteria | 8154 |
| 287 | Ga0207691_10446556 | 3300025940 | Bacteria | 1101 |
| 288 | Ga0207711_10070924 | 3300025941 | Bacteria | 3022 |
| 289 | Ga0207689_10003284 | 3300025942 | Bacteria | 14822 |
| 290 | Ga0207689_10113692 | 3300025942 | Bacteria | 2225 |
| 291 | Ga0207689_10215981 | 3300025942 | Bacteria | 1585 |
| 292 | Ga0207661_10049090 | 3300025944 | Bacteria | 3358 |
| 293 | Ga0207661_10582550 | 3300025944 | Bacteria | 1026 |
| 294 | Ga0207661_11333440 | 3300025944 | Bacteria | 659 |
| 295 | Ga0207679_10129882 | 3300025945 | Bacteria | 2019 |
| 296 | Ga0207679_10626234 | 3300025945 | Bacteria | 971 |
| 297 | Ga0207679_10796453 | 3300025945 | Bacteria | 861 |
| 298 | Ga0207679_10888380 | 3300025945 | Bacteria | 815 |
| 299 | Ga0207667_10534903 | 3300025949 | Bacteria | 1186 |
| 300 | Ga0207712_10141954 | 3300025961 | Bacteria | 1844 |
| 301 | Ga0207712_10197285 | 3300025961 | Bacteria | 1593 |
| 302 | Ga0207668_10057721 | 3300025972 | Bacteria | 2709 |
| 303 | Ga0207668_10070792 | 3300025972 | Bacteria | 2489 |
| 304 | Ga0207640_10336721 | 3300025981 | Bacteria | 1207 |
| 305 | Ga0207658_10089104 | 3300025986 | Bacteria | 2388 |
| 306 | Ga0207658_10236113 | 3300025986 | Bacteria | 1546 |
| 307 | Ga0207658_10361991 | 3300025986 | Bacteria | 1266 |
| 308 | Ga0207677_10009927 | 3300026023 | Bacteria | 5368 |
| 309 | Ga0207677_10075987 | 3300026023 | Bacteria | 2390 |
| 310 | Ga0207677_10729685 | 3300026023 | Bacteria | 881 |
| 311 | Ga0207703_10161248 | 3300026035 | Bacteria | 1964 |
| 312 | Ga0207703_10546636 | 3300026035 | Bacteria | 1092 |
| 313 | Ga0207639_10091369 | 3300026041 | Bacteria | 2437 |
| 314 | Ga0207678_10010287 | 3300026067 | Bacteria | 8211 |
| 315 | Ga0207678_10365084 | 3300026067 | Bacteria | 1246 |
| 316 | Ga0207678_10614245 | 3300026067 | Bacteria | 954 |
| 317 | Ga0207708_10003939 | 3300026075 | Bacteria | 10927 |
| 318 | Ga0207708_10025161 | 3300026075 | Bacteria | 4502 |
| 319 | Ga0207702_10016590 | 3300026078 | Bacteria | 6095 |
| 320 | Ga0207702_10228764 | 3300026078 | Bacteria | 1737 |
| 321 | Ga0207702_10613298 | 3300026078 | Bacteria | 1068 |
| 322 | Ga0207641_10005229 | 3300026088 | Bacteria | 11103 |
| 323 | Ga0207641_10067896 | 3300026088 | Bacteria | 3056 |
| 324 | Ga0207641_10140888 | 3300026088 | Bacteria | 2176 |
| 325 | Ga0207676_10249335 | 3300026095 | Bacteria | 1597 |
| 326 | Ga0207676_10510286 | 3300026095 | Bacteria | 1143 |
| 327 | Ga0207674_10004274 | 3300026116 | Bacteria | 17218 |
| 328 | Ga0207674_10064578 | 3300026116 | Bacteria | 3692 |
| 329 | Ga0207674_10097574 | 3300026116 | Bacteria | 2923 |
| 330 | Ga0207675_100975272 | 3300026118 | Bacteria | 865 |
| 331 | Ga0207683_10014494 | 3300026121 | Bacteria | 6712 |
| 332 | Ga0207683_10343745 | 3300026121 | Bacteria | 1369 |
| 333 | Ga0207683_10482375 | 3300026121 | Bacteria | 1144 |
| 334 | Ga0207683_10574146 | 3300026121 | Bacteria | 1043 |
| 335 | Ga0207683_10594078 | 3300026121 | Bacteria | 1024 |
| 336 | Ga0207698_10263870 | 3300026142 | Bacteria | 1584 |
| 337 | Ga0207698_10308533 | 3300026142 | Bacteria | 1476 |
| 338 | Ga0207698_10567420 | 3300026142 | Bacteria | 1115 |
| 339 | Ga0207698_10590596 | 3300026142 | Bacteria | 1094 |
| 340 | Ga0207698_11176396 | 3300026142 | Bacteria | 781 |
| 341 | Ga0207428_10178284 | 3300027907 | Bacteria | 1606 |
| 342 | Ga0268266_10273121 | 3300028379 | Bacteria | 1570 |
| 343 | Ga0268266_10427483 | 3300028379 | Bacteria | 1256 |
| 344 | Ga0268265_10591121 | 3300028380 | Bacteria | 1059 |
| 345 | Ga0268264_10099359 | 3300028381 | Bacteria | 2525 |
| 346 | Ga0268264_11642172 | 3300028381 | Bacteria | 653 |
| 347 | Ga0307517_10078795 | 3300028786 | Bacteria | 2844 |
| 348 | Ga0307517_10147816 | 3300028786 | Bacteria | 1623 |
| 349 | Ga0307517_10268775 | 3300028786 | Bacteria | 983 |
| 350 | Ga0307515_10014225 | 3300028794 | Bacteria | 14785 |
| 351 | Ga0307515_10026738 | 3300028794 | Bacteria | 9910 |
| 352 | Ga0307515_10057662 | 3300028794 | Bacteria | 5616 |
| 353 | Ga0307515_10076245 | 3300028794 | Bacteria | 4453 |
| 354 | Ga0307515_10688595 | 3300028794 | Bacteria | 637 |
| 355 | Ga0307511_10139131 | 3300030521 | Bacteria | 1433 |
| 356 | Ga0307511_10258030 | 3300030521 | Bacteria | 829 |
| 357 | Ga0307512_10005920 | 3300030522 | Bacteria | 12566 |
| 358 | Ga0307512_10017028 | 3300030522 | Bacteria | 6687 |
| 359 | Ga0307512_10022251 | 3300030522 | Bacteria | 5701 |
| 360 | Ga0307512_10039021 | 3300030522 | Bacteria | 3984 |
| 361 | Ga0307513_10019232 | 3300031456 | Bacteria | 8134 |
| 362 | Ga0307513_10197716 | 3300031456 | Bacteria | 1855 |
| 363 | Ga0307509_10032515 | 3300031507 | Bacteria | 5748 |
| 364 | Ga0307509_10056785 | 3300031507 | Bacteria | 4154 |
| 365 | Ga0307408_100072841 | 3300031548 | Bacteria | 2544 |
| 366 | Ga0307408_101122779 | 3300031548 | Bacteria | 730 |
| 367 | Ga0307408_101309660 | 3300031548 | Bacteria | 679 |
| 368 | Ga0307508_10002620 | 3300031616 | Bacteria | 18894 |
| 369 | Ga0307508_10003217 | 3300031616 | Bacteria | 16699 |
| 370 | Ga0307508_10051989 | 3300031616 | Bacteria | 3641 |
| 371 | Ga0307508_10143359 | 3300031616 | Bacteria | 1993 |
| 372 | Ga0307508_10163425 | 3300031616 | Bacteria | 1830 |
| 373 | Ga0307508_10465761 | 3300031616 | Bacteria | 857 |
| 374 | Ga0307508_10817637 | 3300031616 | Bacteria | 550 |
| 375 | Ga0307514_10446923 | 3300031649 | Bacteria | 637 |
| 376 | Ga0307516_10011683 | 3300031730 | Bacteria | 9528 |
| 377 | Ga0307516_10031393 | 3300031730 | Bacteria | 5354 |
| 378 | Ga0307516_10157059 | 3300031730 | Bacteria | 2028 |
| 379 | Ga0307405_10003449 | 3300031731 | Bacteria | 7262 |
| 380 | Ga0307405_10309520 | 3300031731 | Bacteria | 1202 |
| 381 | Ga0307405_10333048 | 3300031731 | Bacteria | 1164 |
| 382 | Ga0307405_10589693 | 3300031731 | Bacteria | 905 |
| 383 | Ga0307405_11781320 | 3300031731 | Bacteria | 547 |
| 384 | Ga0307413_10008086 | 3300031824 | Bacteria | 4938 |
| 385 | Ga0307413_10185614 | 3300031824 | Bacteria | 1488 |
| 386 | Ga0307413_10350011 | 3300031824 | Bacteria | 1140 |
| 387 | Ga0307413_10513010 | 3300031824 | Bacteria | 965 |
| 388 | Ga0307413_10666433 | 3300031824 | Bacteria | 860 |
| 389 | Ga0307413_11578791 | 3300031824 | Bacteria | 582 |
| 390 | Ga0307410_10039193 | 3300031852 | Bacteria | 3109 |
| 391 | Ga0307410_10114573 | 3300031852 | Bacteria | 1956 |
| 392 | Ga0307410_10191867 | 3300031852 | Bacteria | 1554 |
| 393 | Ga0307406_10001217 | 3300031901 | Bacteria | 14403 |
| 394 | Ga0307406_10022249 | 3300031901 | Bacteria | 3759 |
| 395 | Ga0307407_10101889 | 3300031903 | Bacteria | 1784 |
| 396 | Ga0307412_10096609 | 3300031911 | Bacteria | 2080 |
| 397 | Ga0307412_10652425 | 3300031911 | Bacteria | 898 |
| 398 | Ga0307409_100007503 | 3300031995 | Bacteria | 6533 |
| 399 | Ga0307409_100014459 | 3300031995 | Bacteria | 5135 |
| 400 | Ga0307409_100147555 | 3300031995 | Bacteria | 2036 |
| 401 | Ga0307409_100229830 | 3300031995 | Bacteria | 1681 |
| 402 | Ga0307409_101405089 | 3300031995 | Bacteria | 724 |
| 403 | Ga0307409_101529572 | 3300031995 | Bacteria | 695 |
| 404 | Ga0307409_101746244 | 3300031995 | Bacteria | 651 |
| 405 | Ga0307416_100005854 | 3300032002 | Bacteria | 7624 |
| 406 | Ga0307416_100766213 | 3300032002 | Bacteria | 1059 |
| 407 | Ga0307416_100784275 | 3300032002 | Bacteria | 1048 |
| 408 | Ga0307416_101427096 | 3300032002 | Bacteria | 798 |
| 409 | Ga0307416_101429754 | 3300032002 | Bacteria | 797 |
| 410 | Ga0307414_10053049 | 3300032004 | Bacteria | 2826 |
| 411 | Ga0307414_10230000 | 3300032004 | Bacteria | 1528 |
| 412 | Ga0307411_10097674 | 3300032005 | Bacteria | 2068 |
| 413 | Ga0307411_11140329 | 3300032005 | Bacteria | 704 |
| 414 | Ga0307415_100009542 | 3300032126 | Bacteria | 5447 |
| 415 | Ga0307415_100053125 | 3300032126 | Bacteria | 2759 |
| 416 | Ga0307415_100072496 | 3300032126 | Bacteria | 2426 |
| 417 | Ga0307415_100152529 | 3300032126 | Bacteria | 1780 |
| 418 | Ga0307415_100265113 | 3300032126 | Bacteria | 1404 |
| 419 | Ga0307507_10071080 | 3300033179 | Bacteria | 3150 |
| 420 | Ga0307507_10456266 | 3300033179 | Bacteria | 704 |
| 421 | Ga0307510_10180942 | 3300033180 | Bacteria | 1671 |
| 422 | Ga0373948_0005533 | 3300034817 | Bacteria | 2053 |
| 423 | Ga0373959_0075476 | 3300034820 | Bacteria | 769 |
| 424 | Ga0373938_0019014 | 3300034957 | Bacteria | 1370 |
| 425 | Ga0373928_0179052 | 3300035084 | Bacteria | 601 |
| 426 | Ga0373934_0023758 | 3300035086 | Bacteria | 2369 |
| 427 | Ga0373934_0214613 | 3300035086 | Bacteria | 793 |
| 428 | Ga0373940_0020426 | 3300035088 | Bacteria | 1683 |
| 429 | Ga0373940_0032342 | 3300035088 | Bacteria | 1401 |
| 430 | Ga0373944_0002054 | 3300035089 | Bacteria | 5103 |
| 431 | Ga0373951_0000371 | 3300035091 | Bacteria | 13553 |
| 432 | Ga0373951_0082008 | 3300035091 | Bacteria | 836 |
| 433 | Ga0373952_0040997 | 3300035092 | Bacteria | 1070 |
| 434 | Ga0373923_0013501 | 3300035111 | Bacteria | 3046 |
| 435 | Ga0373932_0012209 | 3300035112 | Bacteria | 2112 |
| 436 | Ga0373936_0001005 | 3300035113 | Bacteria | 10065 |
| 437 | Ga0373936_0040596 | 3300035113 | Bacteria | 1864 |
| 438 | Ga0373939_0055489 | 3300035114 | Bacteria | 1244 |
| 439 | Ga0373939_0247135 | 3300035114 | Bacteria | 693 |
| 440 | Ga0373941_0127054 | 3300035115 | Bacteria | 915 |
| 441 | Ga0373941_0161722 | 3300035115 | Bacteria | 828 |
| 442 | Ga0373945_0000810 | 3300035116 | Bacteria | 9161 |
| 443 | Ga0373945_0029215 | 3300035116 | Bacteria | 1935 |
| 444 | Ga0373945_0139483 | 3300035116 | Bacteria | 976 |
| 445 | Ga0373953_0089847 | 3300035117 | Bacteria | 1284 |
| 446 | Ga0373954_0092796 | 3300035118 | Bacteria | 1451 |
| 447 | Ga0373956_0347096 | 3300035119 | Bacteria | 707 |
| 448 | Ga0373943_0098315 | 3300035170 | Bacteria | 1526 |
| 449 | Ga0373943_0132376 | 3300035170 | Bacteria | 1335 |
| 450 | Ga0373946_0004490 | 3300035171 | Bacteria | 4996 |
| 451 | Ga0373946_0080178 | 3300035171 | Bacteria | 1427 |
| 452 | Ga0373955_0028107 | 3300035172 | Bacteria | 2913 |
| 453 | Ga0373955_0125071 | 3300035172 | Bacteria | 1497 |
| 454 | Ga0373955_0167705 | 3300035172 | Bacteria | 1298 |
| 455 | Ga0373942_0000152 | 3300035207 | Bacteria | 16622 |
| 456 | Ga0373942_0070451 | 3300035207 | Bacteria | 1020 |
| 457 | Ga0373961_0021763 | 3300035241 | Bacteria | 1709 |
| 458 | Ga0373962_0004288 | 3300035242 | Bacteria | 3444 |
| 459 | Ga0373962_0039808 | 3300035242 | Bacteria | 1320 |
| 460 | Ga0316574_0026378 | 3300035398 | Bacteria | 3493 |
| 461 | Ga0316574_0290084 | 3300035398 | Bacteria | 1041 |
| 462 | Ga0373924_0015710 | 3300035410 | Bacteria | 2881 |
| 463 | Ga0373924_0050644 | 3300035410 | Bacteria | 1720 |
| 464 | Ga0373931_0020989 | 3300035691 | Bacteria | 3272 |
| 465 | Ga0373931_0266365 | 3300035691 | Bacteria | 1047 |
| 466 | Ga0373931_0760689 | 3300035691 | Bacteria | 644 |
| 467 | Ga0373935_0003808 | 3300035692 | Bacteria | 8806 |
| 468 | Ga0373935_0092942 | 3300035692 | Bacteria | 1977 |
| 469 | Ga0373935_0212380 | 3300035692 | Bacteria | 1341 |
| 470 | Ga0373935_0688353 | 3300035692 | Bacteria | 751 |
| 471 | Ga0373927_0020474 | 3300035695 | Bacteria | 4337 |
| 472 | Ga0373927_0022250 | 3300035695 | Bacteria | 4153 |
| 473 | Ga0373933_0027924 | 3300035724 | Bacteria | 3253 |
| 474 | Ga0373933_0143947 | 3300035724 | Bacteria | 1506 |
| 475 | Ga0373933_0758348 | 3300035724 | Bacteria | 638 |
| 476 | Ga0373947_0003093 | 3300035725 | Bacteria | 9913 |
| 477 | Ga0373937_0097794 | 3300036401 | Bacteria | 2722 |
| 478 | Ga0373937_0098762 | 3300036401 | Bacteria | 2708 |
| 479 | Ga0372808_013772 | 3300036459 | Bacteria | 1153 |
| 480 | Ga0373925_0256178 | 3300037068 | Bacteria | 1404 |
| 481 | Ga0395900_1146583 | 3300037418 | Bacteria | 694 |
| 482 | Ga0395898_0096517 | 3300037466 | Bacteria | 2840 |
| 483 | Ga0436364_0059219 | 3300037853 | Bacteria | 1359 |
| 484 | Ga0436364_0463455 | 3300037853 | Bacteria | 3489 |
| 485 | Ga0436364_0967897 | 3300037853 | Bacteria | 8258 |
| 486 | Ga0395901_0105994 | 3300038443 | Bacteria | 2950 |
| 487 | Ga0400483_286613 | 3300039062 | Bacteria | 4781 |
| 488 | Ga0436365_1545022 | 3300039437 | Bacteria | 810 |
| 489 | Ga0436363_0687920 | 3300039450 | Bacteria | 635 |
| 490 | Ga0451789_0444322 | 3300041443 | Bacteria | 2599 |
| 491 | Ga0451791_1439624 | 3300041451 | Bacteria | 1354 |
| 492 | Ga0451793_1906183 | 3300041452 | Bacteria | 4236 |
| 493 | Ga0451837_0072343 | 3300041494 | Bacteria | 1062 |
| 494 | Ga0451843_1174054 | 3300041509 | Bacteria | 795 |
| 495 | Ga0451853_2374562 | 3300041512 | Bacteria | 853 |
| 496 | Ga0439463_080027 | 3300042016 | Bacteria | 840 |
| 497 | Ga0466969_0001307 | 3300044656 | Bacteria | 13420 |
| 498 | Ga0466969_0052833 | 3300044656 | Bacteria | 1995 |
| 499 | Ga0466969_0157359 | 3300044656 | Bacteria | 1045 |
| 500 | Ga0466966_0007574 | 3300044684 | Bacteria | 7192 |
| 501 | Ga0466966_0033264 | 3300044684 | Bacteria | 3338 |
| 502 | Ga0466971_0000689 | 3300044719 | Bacteria | 13519 |
| 503 | Ga0466970_0014607 | 3300044765 | Bacteria | 4033 |
| 504 | Ga0466970_0243869 | 3300044765 | Bacteria | 1006 |
| 505 | Ga0466957_0216347 | 3300044842 | Bacteria | 1264 |
| 506 | Ga0466957_0222345 | 3300044842 | Bacteria | 1247 |
| 507 | Ga0466957_0456150 | 3300044842 | Bacteria | 881 |
| 508 | Ga0466960_0136205 | 3300044901 | Bacteria | 1300 |
| 509 | Ga0466959_0001910 | 3300045049 | Bacteria | 13108 |
| 510 | Ga0466959_0010087 | 3300045049 | Bacteria | 6736 |
| 511 | Ga0466958_0034614 | 3300045836 | Bacteria | 3014 |
| 512 | Ga0466967_0022798 | 3300045976 | Bacteria | 5119 |
| 513 | Ga0466967_0040767 | 3300045976 | Bacteria | 3999 |
| 514 | Ga0466967_0518550 | 3300045976 | Bacteria | 1171 |
| 515 | Ga0466967_1555098 | 3300045976 | Bacteria | 659 |
| 516 | Ga0495592_0058909 | 3300046454 | Bacteria | 2830 |
| 517 | Ga0495592_0100191 | 3300046454 | Bacteria | 2066 |
| 518 | Ga0495592_0327403 | 3300046454 | Bacteria | 988 |
| 519 | Ga0495592_0420778 | 3300046454 | Bacteria | 842 |
| 520 | Ga0495603_0209235 | 3300046455 | Bacteria | 1126 |
| 521 | Ga0495603_0544640 | 3300046455 | Bacteria | 664 |
| 522 | Ga0495629_0301801 | 3300046459 | Bacteria | 1097 |
| 523 | Ga0495629_0308940 | 3300046459 | Bacteria | 1082 |
| 524 | Ga0495638_0300799 | 3300046460 | Bacteria | 864 |
| 525 | Ga0495641_0029319 | 3300046461 | Bacteria | 2652 |
| 526 | Ga0495641_0315867 | 3300046461 | Bacteria | 705 |
| 527 | Ga0495651_0000405 | 3300046462 | Bacteria | 33331 |
| 528 | Ga0495651_0013939 | 3300046462 | Bacteria | 6216 |
| 529 | Ga0495651_0075538 | 3300046462 | Bacteria | 2554 |
| 530 | Ga0495651_0090423 | 3300046462 | Bacteria | 2296 |
| 531 | Ga0495651_0160001 | 3300046462 | Bacteria | 1614 |
| 532 | Ga0495651_0451519 | 3300046462 | Bacteria | 830 |
| 533 | Ga0495653_0006045 | 3300046463 | Bacteria | 9912 |
| 534 | Ga0495653_0011270 | 3300046463 | Bacteria | 7306 |
| 535 | Ga0495653_0013551 | 3300046463 | Bacteria | 6645 |
| 536 | Ga0495653_0107397 | 3300046463 | Bacteria | 2011 |
| 537 | Ga0495653_0159293 | 3300046463 | Bacteria | 1568 |
| 538 | Ga0495650_0056882 | 3300046471 | Bacteria | 1585 |
| 539 | Ga0495580_0005058 | 3300046472 | Bacteria | 10992 |
| 540 | Ga0495580_0151518 | 3300046472 | Bacteria | 1606 |
| 541 | Ga0495582_0382542 | 3300046473 | Bacteria | 811 |
| 542 | Ga0495639_0026978 | 3300046475 | Bacteria | 2541 |
| 543 | Ga0495639_0114505 | 3300046475 | Bacteria | 1282 |
| 544 | Ga0495662_0004185 | 3300046476 | Bacteria | 7268 |
| 545 | Ga0495662_0006172 | 3300046476 | Bacteria | 5990 |
| 546 | Ga0495664_0000745 | 3300046477 | Bacteria | 16653 |
| 547 | Ga0495664_0001527 | 3300046477 | Bacteria | 12255 |
| 548 | Ga0495664_0041249 | 3300046477 | Bacteria | 2730 |
| 549 | Ga0495664_0136782 | 3300046477 | Bacteria | 1485 |
| 550 | Ga0495664_0439908 | 3300046477 | Bacteria | 781 |
| 551 | Ga0495664_0499466 | 3300046477 | Bacteria | 726 |
| 552 | Ga0495585_0023340 | 3300046492 | Bacteria | 3550 |
| 553 | Ga0495608_0000431 | 3300046511 | Bacteria | 29189 |
| 554 | Ga0495608_0078506 | 3300046511 | Bacteria | 2147 |
| 555 | Ga0495608_0127813 | 3300046511 | Bacteria | 1627 |
| 556 | Ga0495608_0240078 | 3300046511 | Bacteria | 1132 |
| 557 | Ga0495618_0064778 | 3300046514 | Bacteria | 2322 |
| 558 | Ga0495618_0068246 | 3300046514 | Bacteria | 2261 |
| 559 | Ga0495618_0088579 | 3300046514 | Bacteria | 1979 |
| 560 | Ga0495618_0195845 | 3300046514 | Bacteria | 1280 |
| 561 | Ga0495618_0219780 | 3300046514 | Bacteria | 1199 |
| 562 | Ga0495618_0635205 | 3300046514 | Bacteria | 633 |
| 563 | Ga0495628_0017144 | 3300046516 | Bacteria | 6033 |
| 564 | Ga0495628_0149694 | 3300046516 | Bacteria | 1778 |
| 565 | Ga0495628_0187568 | 3300046516 | Bacteria | 1562 |
| 566 | Ga0495630_0407635 | 3300046517 | Bacteria | 1041 |
| 567 | Ga0495666_0066344 | 3300046526 | Bacteria | 1720 |
| 568 | Ga0495666_0199341 | 3300046526 | Bacteria | 920 |
| 569 | Ga0495652_0006521 | 3300046529 | Bacteria | 10850 |
| 570 | Ga0495652_0070028 | 3300046529 | Bacteria | 2934 |
| 571 | Ga0495652_0100903 | 3300046529 | Bacteria | 2340 |
| 572 | Ga0495652_0118080 | 3300046529 | Bacteria | 2120 |
| 573 | Ga0495652_0185953 | 3300046529 | Bacteria | 1589 |
| 574 | Ga0495652_0188998 | 3300046529 | Bacteria | 1573 |
| 575 | Ga0495665_0052942 | 3300046531 | Bacteria | 2148 |
| 576 | Ga0495665_0117299 | 3300046531 | Bacteria | 1394 |
| 577 | Ga0495640_0029937 | 3300046533 | Bacteria | 3901 |
| 578 | Ga0495640_0256905 | 3300046533 | Bacteria | 1092 |
| 579 | Ga0495640_0281541 | 3300046533 | Bacteria | 1035 |
| 580 | Ga0495640_0546963 | 3300046533 | Bacteria | 702 |
| 581 | Ga0495586_0318085 | 3300046535 | Bacteria | 892 |
| 582 | Ga0495586_0519520 | 3300046535 | Bacteria | 687 |
| 583 | Ga0495587_0016509 | 3300046536 | Bacteria | 4592 |
| 584 | Ga0495587_0019470 | 3300046536 | Bacteria | 4199 |
| 585 | Ga0495587_0260782 | 3300046536 | Bacteria | 973 |
| 586 | Ga0495587_0265335 | 3300046536 | Bacteria | 964 |
| 587 | Ga0495645_0010765 | 3300046543 | Bacteria | 6425 |
| 588 | Ga0495645_0047000 | 3300046543 | Bacteria | 3145 |
| 589 | Ga0495645_0104243 | 3300046543 | Bacteria | 2014 |
| 590 | Ga0495645_0194716 | 3300046543 | Bacteria | 1379 |
| 591 | Ga0495667_0003511 | 3300046559 | Bacteria | 10519 |
| 592 | Ga0495667_0014710 | 3300046559 | Bacteria | 5288 |
| 593 | Ga0495667_0036911 | 3300046559 | Bacteria | 3258 |
| 594 | Ga0495667_0132197 | 3300046559 | Bacteria | 1609 |
| 595 | Ga0495667_0261102 | 3300046559 | Bacteria | 1101 |
| 596 | Ga0495667_0461491 | 3300046559 | Bacteria | 797 |
| 597 | Ga0495667_0508361 | 3300046559 | Bacteria | 754 |
| 598 | Ga0495634_0073127 | 3300046642 | Bacteria | 2254 |
| 599 | Ga0495634_0155191 | 3300046642 | Bacteria | 1445 |
| 600 | Ga0495634_0232856 | 3300046642 | Bacteria | 1132 |
| 601 | Ga0495634_0407808 | 3300046642 | Bacteria | 806 |
| 602 | Ga0495634_0521400 | 3300046642 | Bacteria | 695 |
| 603 | Ga0495634_0562614 | 3300046642 | Bacteria | 664 |
| 604 | Ga0495635_0003994 | 3300046663 | Bacteria | 10250 |
| 605 | Ga0495635_0009208 | 3300046663 | Bacteria | 6898 |
| 606 | Ga0495635_0050515 | 3300046663 | Bacteria | 2866 |
| 607 | Ga0495635_0058901 | 3300046663 | Bacteria | 2641 |
| 608 | Ga0495635_0659190 | 3300046663 | Bacteria | 680 |
| 609 | Ga0495588_0364945 | 3300046674 | Bacteria | 759 |
| 610 | Ga0495657_0001154 | 3300046675 | Bacteria | 23164 |
| 611 | Ga0495657_0105121 | 3300046675 | Bacteria | 1794 |
| 612 | Ga0495657_0117485 | 3300046675 | Bacteria | 1678 |
| 613 | Ga0495657_0307401 | 3300046675 | Bacteria | 944 |
| 614 | Ga0495657_0383718 | 3300046675 | Bacteria | 829 |
| 615 | Ga0495599_0022538 | 3300046678 | Bacteria | 3933 |
| 616 | Ga0495599_0038651 | 3300046678 | Bacteria | 2998 |
| 617 | Ga0495599_0261807 | 3300046678 | Bacteria | 1050 |
| 618 | Ga0495599_0419636 | 3300046678 | Bacteria | 795 |
| 619 | Ga0495623_0054028 | 3300046679 | Bacteria | 2535 |
| 620 | Ga0495623_0057366 | 3300046679 | Bacteria | 2449 |
| 621 | Ga0495623_0284564 | 3300046679 | Bacteria | 918 |
| 622 | Ga0495623_0376069 | 3300046679 | Bacteria | 769 |
| 623 | Ga0495623_0517301 | 3300046679 | Bacteria | 628 |
| 624 | Ga0495646_0024112 | 3300046680 | Bacteria | 3831 |
| 625 | Ga0495646_0038869 | 3300046680 | Bacteria | 2935 |
| 626 | Ga0495646_0094283 | 3300046680 | Bacteria | 1723 |
| 627 | Ga0495658_0024522 | 3300046683 | Bacteria | 3214 |
| 628 | Ga0495613_0003259 | 3300046689 | Bacteria | 12139 |
| 629 | Ga0495624_0029094 | 3300046690 | Bacteria | 3606 |
| 630 | Ga0495624_0229135 | 3300046690 | Bacteria | 1125 |
| 631 | Ga0495649_0305138 | 3300046694 | Bacteria | 810 |
| 632 | Ga0495600_0011040 | 3300046809 | Bacteria | 5621 |
| 633 | Ga0495600_0150905 | 3300046809 | Bacteria | 1504 |
| 634 | Ga0495600_0152173 | 3300046809 | Bacteria | 1497 |
| 635 | Ga0495600_0396599 | 3300046809 | Bacteria | 859 |
| 636 | Ga0495600_0581878 | 3300046809 | Bacteria | 682 |
| 637 | Ga0495581_0004922 | 3300047315 | Bacteria | 7728 |
| 638 | Ga0495581_0156201 | 3300047315 | Bacteria | 1333 |
| 639 | Ga0495581_0404344 | 3300047315 | Bacteria | 796 |
| 640 | Ga0495604_0000492 | 3300047317 | Bacteria | 34661 |
| 641 | Ga0495604_0119296 | 3300047317 | Bacteria | 1911 |
| 642 | Ga0495604_0195783 | 3300047317 | Bacteria | 1405 |
| 643 | Ga0495604_0332429 | 3300047317 | Bacteria | 1013 |
| 644 | Ga0495674_0005651 | 3300047319 | Bacteria | 11977 |
| 645 | Ga0495674_0074284 | 3300047319 | Bacteria | 2928 |
| 646 | Ga0495674_0132379 | 3300047319 | Bacteria | 2100 |
| 647 | Ga0495674_0442565 | 3300047319 | Bacteria | 1045 |
| 648 | Ga0495676_0004827 | 3300047321 | Bacteria | 12361 |
| 649 | Ga0495680_0009063 | 3300047322 | Bacteria | 8985 |
| 650 | Ga0495680_0010693 | 3300047322 | Bacteria | 8183 |
| 651 | Ga0495680_0162876 | 3300047322 | Bacteria | 1618 |
| 652 | Ga0495675_0108524 | 3300047444 | Bacteria | 1733 |
| 653 | Ga0495675_0144843 | 3300047444 | Bacteria | 1471 |
| 654 | Ga0495684_0046062 | 3300047471 | Bacteria | 3337 |
| 655 | Ga0495684_0121751 | 3300047471 | Bacteria | 1964 |
| 656 | Ga0495684_0260351 | 3300047471 | Bacteria | 1258 |
| 657 | Ga0495684_0337450 | 3300047471 | Bacteria | 1073 |
| 658 | Ga0495593_0034588 | 3300047673 | Bacteria | 2747 |
| 659 | Ga0495593_0134907 | 3300047673 | Bacteria | 1252 |
| 660 | Ga0495593_0142423 | 3300047673 | Bacteria | 1214 |
| 661 | Ga0495602_0051310 | 3300048088 | Bacteria | 3674 |
| 662 | Ga0495602_0100208 | 3300048088 | Bacteria | 2379 |
| 663 | Ga0495602_0105002 | 3300048088 | Bacteria | 2310 |
| 664 | Ga0495614_0033792 | 3300048089 | Bacteria | 2199 |
| 665 | Ga0496100_0002440 | 3300048903 | Bacteria | 9424 |
| 666 | Ga0496100_1433529 | 3300048903 | Bacteria | 545 |
| 667 | Ga0496101_0002674 | 3300048904 | Bacteria | 10939 |
| 668 | Ga0496101_0388120 | 3300048904 | Bacteria | 1099 |
| 669 | Ga0496101_0900381 | 3300048904 | Bacteria | 697 |
| 670 | Ga0496102_0000147 | 3300048905 | Bacteria | 96295 |
| 671 | Ga0496102_0049087 | 3300048905 | Bacteria | 3838 |
| 672 | Ga0496102_0144993 | 3300048905 | Bacteria | 2228 |
| 673 | Ga0496102_0513147 | 3300048905 | Bacteria | 1121 |
| 674 | Ga0496102_1229486 | 3300048905 | Bacteria | 668 |
| 675 | Ga0496103_0000261 | 3300048906 | Bacteria | 50634 |
| 676 | Ga0496104_0028477 | 3300048907 | Bacteria | 5178 |
| 677 | Ga0496104_0093449 | 3300048907 | Bacteria | 2877 |
| 678 | Ga0496104_0596379 | 3300048907 | Bacteria | 1015 |
| 679 | Ga0496104_0773714 | 3300048907 | Bacteria | 866 |
| 680 | Ga0496105_0019842 | 3300048908 | Bacteria | 5424 |
| 681 | Ga0496105_0037598 | 3300048908 | Bacteria | 3986 |
| 682 | Ga0496105_0045106 | 3300048908 | Bacteria | 3637 |
| 683 | Ga0496105_0540032 | 3300048908 | Bacteria | 911 |
| 684 | Ga0496106_0277091 | 3300048909 | Bacteria | 1343 |
| 685 | Ga0496107_0205881 | 3300048910 | Bacteria | 1462 |
| 686 | Ga0496107_0316413 | 3300048910 | Bacteria | 1162 |
| 687 | Ga0496107_0586482 | 3300048910 | Bacteria | 824 |
| 688 | Ga0496108_0000418 | 3300048911 | Bacteria | 34816 |
| 689 | Ga0496108_0134684 | 3300048911 | Bacteria | 2124 |
| 690 | Ga0496108_0166642 | 3300048911 | Bacteria | 1905 |
| 691 | Ga0496109_0163086 | 3300048912 | Bacteria | 2088 |
| 692 | Ga0496109_0284669 | 3300048912 | Bacteria | 1558 |
| 693 | Ga0496109_0474566 | 3300048912 | Bacteria | 1181 |
| 694 | Ga0496109_0775991 | 3300048912 | Bacteria | 896 |
| 695 | Ga0496110_0037383 | 3300048913 | Bacteria | 4220 |
| 696 | Ga0496110_0158883 | 3300048913 | Bacteria | 2048 |
| 697 | Ga0496110_0514397 | 3300048913 | Bacteria | 1089 |
| 698 | Ga0496111_0060195 | 3300048914 | Bacteria | 2752 |
| 699 | Ga0496111_0248373 | 3300048914 | Bacteria | 1321 |
| 700 | Ga0496112_0642281 | 3300048915 | Bacteria | 991 |
| 701 | Ga0496113_0148331 | 3300048916 | Bacteria | 1849 |
| 702 | Ga0496113_0155667 | 3300048916 | Bacteria | 1804 |
| 703 | Ga0496114_0002172 | 3300048917 | Bacteria | 14936 |
| 704 | Ga0496114_0003886 | 3300048917 | Bacteria | 11518 |
| 705 | Ga0496114_0050779 | 3300048917 | Bacteria | 3452 |
| 706 | Ga0496114_0181625 | 3300048917 | Bacteria | 1837 |
| 707 | Ga0496114_0463974 | 3300048917 | Bacteria | 1121 |
| 708 | Ga0496115_0158234 | 3300048918 | Bacteria | 1872 |
| 709 | Ga0496115_0366547 | 3300048918 | Bacteria | 1173 |
| 710 | Ga0496116_0000425 | 3300048919 | Bacteria | 59407 |
| 711 | Ga0496117_0000274 | 3300048920 | Bacteria | 96150 |
| 712 | Ga0496118_0000602 | 3300048921 | Bacteria | 59438 |
| 713 | Ga0496119_0000957 | 3300048922 | Bacteria | 37132 |
| 714 | Ga0496120_0008239 | 3300048923 | Bacteria | 7616 |
| 715 | Ga0496121_0057363 | 3300048924 | Bacteria | 3228 |
| 716 | Ga0496124_0054816 | 3300048927 | Bacteria | 3372 |
| 717 | Ga0496125_0012303 | 3300048928 | Bacteria | 8502 |
| 718 | Ga0496126_0000419 | 3300048929 | Bacteria | 85931 |
| 719 | Ga0496126_0283434 | 3300048929 | Bacteria | 1372 |
| 720 | Ga0496126_0423034 | 3300048929 | Bacteria | 1077 |
| 721 | Ga0501031_0073510 | 3300049568 | Bacteria | 2226 |
| 722 | Ga0501031_0357829 | 3300049568 | Bacteria | 945 |
| 723 | Ga0501032_0192105 | 3300049569 | Bacteria | 1334 |
| 724 | Ga0501032_0466218 | 3300049569 | Bacteria | 808 |
| 725 | Ga0501032_0871417 | 3300049569 | Bacteria | 567 |
| 726 | Ga0501033_0021747 | 3300049570 | Bacteria | 4841 |
| 727 | Ga0501033_0133444 | 3300049570 | Bacteria | 1797 |
| 728 | Ga0501033_0573202 | 3300049570 | Bacteria | 776 |
| 729 | Ga0501036_0037640 | 3300049572 | Bacteria | 4092 |
| 730 | Ga0501036_0310307 | 3300049572 | Bacteria | 1319 |
| 731 | Ga0501036_0326942 | 3300049572 | Bacteria | 1281 |
| 732 | Ga0501036_1253173 | 3300049572 | Bacteria | 603 |
| 733 | Ga0501037_0042754 | 3300049573 | Bacteria | 3330 |
| 734 | Ga0501037_0058261 | 3300049573 | Bacteria | 2819 |
| 735 | Ga0501038_0017635 | 3300049574 | Bacteria | 6452 |
| 736 | Ga0501038_0500144 | 3300049574 | Bacteria | 929 |
| 737 | Ga0501038_0998672 | 3300049574 | Bacteria | 614 |
| 738 | Ga0501039_0009026 | 3300049575 | Bacteria | 7596 |
| 739 | Ga0501039_0039192 | 3300049575 | Bacteria | 3660 |
| 740 | Ga0501039_0410704 | 3300049575 | Bacteria | 1063 |
| 741 | Ga0501040_0069482 | 3300049576 | Bacteria | 2429 |
| 742 | Ga0501040_0154560 | 3300049576 | Bacteria | 1620 |
| 743 | Ga0501041_0019691 | 3300049577 | Bacteria | 4032 |
| 744 | Ga0501041_0142411 | 3300049577 | Bacteria | 1495 |
| 745 | Ga0501042_0117316 | 3300049578 | Bacteria | 1916 |
| 746 | Ga0501042_0189325 | 3300049578 | Bacteria | 1484 |
| 747 | Ga0501043_0156203 | 3300049579 | Bacteria | 1784 |
| 748 | Ga0501043_0162373 | 3300049579 | Bacteria | 1745 |
| 749 | Ga0501043_0387615 | 3300049579 | Bacteria | 1057 |
| 750 | Ga0501043_0448114 | 3300049579 | Bacteria | 970 |
| 751 | Ga0501046_0014581 | 3300049580 | Bacteria | 6624 |
| 752 | Ga0501046_0026166 | 3300049580 | Bacteria | 4766 |
| 753 | Ga0501046_0088918 | 3300049580 | Bacteria | 2378 |
| 754 | Ga0501046_0877366 | 3300049580 | Bacteria | 626 |
| 755 | Ga0501047_0063580 | 3300049581 | Bacteria | 3560 |
| 756 | Ga0501047_0110688 | 3300049581 | Bacteria | 2629 |
| 757 | Ga0501048_0004968 | 3300049582 | Bacteria | 10147 |
| 758 | Ga0501067_0100823 | 3300049583 | Bacteria | 1604 |
| 759 | Ga0501067_0540024 | 3300049583 | Bacteria | 653 |
| 760 | Ga0501068_0042422 | 3300049584 | Bacteria | 2736 |
| 761 | Ga0501070_0897781 | 3300049586 | Bacteria | 691 |
| 762 | Ga0501071_0102894 | 3300049587 | Bacteria | 2106 |
| 763 | Ga0501072_0010531 | 3300049588 | Bacteria | 7040 |
| 764 | Ga0501072_0139873 | 3300049588 | Bacteria | 1930 |
| 765 | Ga0501073_0161030 | 3300049589 | Bacteria | 1555 |
| 766 | Ga0501075_0012160 | 3300049591 | Bacteria | 6111 |
| 767 | Ga0501076_0068378 | 3300049592 | Bacteria | 2837 |
| 768 | Ga0501076_0269725 | 3300049592 | Bacteria | 1393 |
| 769 | Ga0501077_0341395 | 3300049593 | Bacteria | 955 |
| 770 | Ga0501079_0335389 | 3300049741 | Bacteria | 1184 |
| 771 | Ga0501080_0936976 | 3300049742 | Bacteria | 753 |
| 772 | Ga0501081_0041917 | 3300049743 | Bacteria | 3136 |
| 773 | Ga0501035_0042721 | 3300049822 | Bacteria | 4088 |
| 774 | Ga0501035_0240625 | 3300049822 | Bacteria | 1539 |
| 775 | Ga0501035_0545952 | 3300049822 | Bacteria | 950 |
| 776 | Ga0501044_0747312 | 3300049823 | Bacteria | 860 |
| 777 | Ga0501044_0778102 | 3300049823 | Bacteria | 837 |
| 778 | Ga0501045_0013683 | 3300049824 | Bacteria | 5735 |
| 779 | Ga0501045_0055604 | 3300049824 | Bacteria | 2894 |
| 780 | Ga0501045_0381442 | 3300049824 | Bacteria | 1049 |
| 781 | nmdc:mga03n38_119743_c1 | 3300050490 | Bacteria | 1292 |
| 782 | nmdc:mga03n38_508189_c1 | 3300050490 | Bacteria | 677 |
| 783 | nmdc:mga00v17_72724_c1 | 3300050491 | Bacteria | 2133 |
| 784 | nmdc:mga05p37_35185_c1 | 3300050507 | Bacteria | 6140 |
| 785 | nmdc:mga09592_16039_c1 | 3300050508 | Bacteria | 6125 |
| 786 | nmdc:mga09592_176038_c1 | 3300050508 | Bacteria | 1850 |
| 787 | nmdc:mga09592_195263_c1 | 3300050508 | Bacteria | 1752 |
| 788 | nmdc:mga0qj67_2330_c1 | 3300050509 | Bacteria | 13500 |
| 789 | nmdc:mga06r32_13370_c1 | 3300050510 | Bacteria | 7434 |
| 790 | nmdc:mga06r32_398_c4 | 3300050510 | Bacteria | 11026 |
| 791 | nmdc:mga06r32_421140_c1 | 3300050510 | Bacteria | 1316 |
| 792 | nmdc:mga08y16_1330028_c1 | 3300050511 | Bacteria | 684 |
| 793 | nmdc:mga08y16_294144_c1 | 3300050511 | Bacteria | 1674 |
| 794 | nmdc:mga08y16_320527_c1 | 3300050511 | Bacteria | 1596 |
| 795 | nmdc:mga0n895_1382982_c1 | 3300050512 | Bacteria | 673 |
| 796 | nmdc:mga0rr50_532722_c1 | 3300050513 | Bacteria | 1000 |
| 797 | Ga0495601_0003897 | 3300053077 | Bacteria | 8591 |
| 798 | Ga0495601_0016298 | 3300053077 | Bacteria | 4503 |
| 799 | Ga0495601_0063428 | 3300053077 | Bacteria | 2348 |
| 800 | Ga0495601_0459971 | 3300053077 | Bacteria | 822 |
| 801 | Ga0495612_0002389 | 3300053078 | Bacteria | 7741 |
| 802 | Ga0495612_0068056 | 3300053078 | Bacteria | 1481 |
| 803 | Ga0495612_0187116 | 3300053078 | Bacteria | 911 |
| 804 | Ga0495612_0197704 | 3300053078 | Bacteria | 886 |
| 805 | Ga0495595_0086079 | 3300053084 | Bacteria | 1503 |
| 806 | Ga0495595_0311624 | 3300053084 | Bacteria | 792 |
| 807 | Ga0495619_0193903 | 3300053085 | Bacteria | 1406 |
| 808 | Ga0500644_0005542 | 3300053088 | Bacteria | 3192 |
| 809 | Ga0500644_0068611 | 3300053088 | Bacteria | 1271 |
| 810 | Ga0500644_0185998 | 3300053088 | Bacteria | 853 |
| 811 | Ga0500583_0445195 | 3300053092 | Bacteria | 616 |
| 812 | Ga0500651_0071771 | 3300053093 | Bacteria | 2154 |
| 813 | Ga0500641_0055998 | 3300053096 | Bacteria | 1633 |
| 814 | Ga0500650_0069159 | 3300053098 | Bacteria | 1650 |
| 815 | Ga0500660_168703 | 3300053100 | Bacteria | 814 |
| 816 | Ga0500569_028595 | 3300053109 | Bacteria | 1547 |
| 817 | Ga0500594_0002769 | 3300053118 | Bacteria | 3816 |
| 818 | Ga0500652_199585 | 3300053131 | Bacteria | 812 |
| 819 | Ga0500655_016924 | 3300053133 | Bacteria | 1345 |
| 820 | Ga0500579_162325 | 3300053143 | Bacteria | 938 |
| 821 | Ga0500600_0244098 | 3300053149 | Bacteria | 809 |
| 822 | Ga0500616_0001593 | 3300053153 | Bacteria | 21161 |
| 823 | Ga0500616_0014227 | 3300053153 | Bacteria | 4579 |
| 824 | Ga0500630_173951 | 3300053159 | Bacteria | 878 |
| 825 | Ga0500634_0261412 | 3300053161 | Bacteria | 712 |
| 826 | Ga0501084_0006561 | 3300054114 | Bacteria | 9561 |
| 827 | Ga0501084_0036505 | 3300054114 | Bacteria | 4105 |
| 828 | Ga0501082_0020922 | 3300060353 | Bacteria | 5643 |
| 829 | Ga0501082_0099440 | 3300060353 | Bacteria | 2515 |
| 830 | Ga0466962_0009413 | 3300061719 | Bacteria | 4682 |
| 831 | Ga0530510_0007434 | 3300061734 | Bacteria | 7626 |
| 832 | Ga0530510_0353839 | 3300061734 | Bacteria | 1103 |
| 833 | Ga0530510_0439937 | 3300061734 | Bacteria | 985 |
| 834 | 2515854704 | 2515154155 | Bacteria | 7985436 |
| 835 | 2558909071 | 2558860112 | Bacteria | 9931328 |
| 836 | 2643849734 | 2643221567 | Bacteria | 4163945 |
| 837 | 2644135736 | 2643221624 | Bacteria | 4384879 |
| 838 | 2676474125 | 2675903058 | Bacteria | 6822861 |
| 839 | 2676495804 | 2675903060 | Bacteria | 10051191 |
| 840 | 2731906028 | 2731639228 | Bacteria | 4187555 |
| 841 | 2753268449 | 2751185782 | Bacteria | 11227053 |
| 842 | 2776372367 | 2775506925 | Bacteria | 7237746 |
| 843 | 2791916133 | 2791354901 | Bacteria | 8322202 |
| 844 | 2816425537 | 2816332119 | Bacteria | 8120218 |
| 845 | 2827629016 | 2827628540 | Bacteria | 6858585 |
| 846 | 2861521993 | 2861520306 | Bacteria | 8348283 |
| 847 | 2863074805 | 2863067949 | Bacteria | 8541735 |
| 848 | 2870786244 | 2870782633 | Bacteria | 9624083 |
| 849 | 2880498981 | 2880495981 | Bacteria | 7340502 |
| 850 | 2891329077 | 2891326441 | Bacteria | 6439512 |
| 851 | 2895438576 | 2895427314 | Bacteria | 13147766 |
| 852 | 2899363611 | 2899359706 | Bacteria | 10940472 |
| 853 | 3006429396 | 3006425503 | Bacteria | 6491253 |
| 854 | 8054476398 | 8054472261 | Bacteria | 7464355 |
| 855 | Ga0500568_0000279 | |||
| 856 | JGI24740J21852_10039081 | |||
| 857 | JGI24737J22298_10025955 | |||
| 858 | JGI24735J21928_10066184 | |||
| 859 | JGI24735J21928_10151701 | |||
| 860 | JGI25406J46586_10006430 | |||
| 861 | JGI25406J46586_10047164 | |||
| 862 | rootH2_10025380 | |||
| 863 | rootH2_10032131 | |||
| 864 | Ga0070658_10228614 | |||
| 865 | Ga0070676_10123669 | |||
| 866 | Ga0070683_100296637 | |||
| 867 | Ga0070683_100650643 | |||
| 868 | Ga0070683_101167091 | |||
| 869 | Ga0070683_101332403 | |||
| 870 | Ga0068869_100025111 | |||
| 871 | Ga0068869_100199463 | |||
| 872 | Ga0068869_100526402 | |||
| 873 | Ga0070666_10318144 | |||
| 874 | Ga0068868_100013555 | |||
| 875 | Ga0068868_100098486 | |||
| 876 | Ga0068868_100497572 | |||
| 877 | Ga0070660_100556154 | |||
| 878 | Ga0070689_100718952 | |||
| 879 | Ga0070689_100987152 | |||
| 880 | Ga0070691_10034979 | |||
| 881 | Ga0070687_100089905 | |||
| 882 | Ga0070687_100942635 | |||
| 883 | Ga0070661_100020447 | |||
| 884 | Ga0070692_10002568 | |||
| 885 | Ga0070668_100010835 | |||
| 886 | Ga0070668_100480955 | |||
| 887 | Ga0070668_100482230 | |||
| 888 | Ga0070669_100170917 | |||
| 889 | Ga0070669_100459275 | |||
| 890 | Ga0070675_100000709 | |||
| 891 | Ga0070675_100190516 | |||
| 892 | Ga0070671_100068785 | |||
| 893 | Ga0070674_100094375 | |||
| 894 | Ga0070674_101838188 | |||
| 895 | Ga0070673_100870314 | |||
| 896 | Ga0070667_100205890 | |||
| 897 | Ga0070667_100769267 | |||
| 898 | Ga0070709_10143765 | |||
| 899 | Ga0070709_10316306 | |||
| 900 | Ga0070709_10879298 | |||
| 901 | Ga0070714_100023518 | |||
| 902 | Ga0070714_100121881 | |||
| 903 | Ga0070714_100729056 | |||
| 904 | Ga0070710_10034440 | |||
| 905 | Ga0070701_10186532 | |||
| 906 | Ga0070701_10727975 | |||
| 907 | Ga0070711_100906630 | |||
| 908 | Ga0070711_101017161 | |||
| 909 | Ga0070711_101019916 | |||
| 910 | Ga0070700_100005842 | |||
| 911 | Ga0070700_100352793 | |||
| 912 | Ga0070663_100131697 | |||
| 913 | Ga0070663_100238353 | |||
| 914 | Ga0070663_100320318 | |||
| 915 | Ga0070678_100078774 | |||
| 916 | Ga0070678_100174028 | |||
| 917 | Ga0070678_100840278 | |||
| 918 | Ga0070662_100214900 | |||
| 919 | Ga0070685_11064398 | |||
| 920 | Ga0070679_100423228 | |||
| 921 | Ga0070684_100166028 | |||
| 922 | Ga0070684_100220184 | |||
| 923 | Ga0070684_100239806 | |||
| 924 | Ga0070684_100356396 | |||
| 925 | Ga0070684_100817318 | |||
| 926 | Ga0070684_101029078 | |||
| 927 | Ga0068853_100494232 | |||
| 928 | Ga0070672_100222370 | |||
| 929 | Ga0070686_100052033 | |||
| 930 | Ga0070695_100053227 | |||
| 931 | Ga0070696_100155862 | |||
| 932 | Ga0070696_100296868 | |||
| 933 | Ga0070696_100394244 | |||
| 934 | Ga0070665_100075860 | |||
| 935 | Ga0070665_100134710 | |||
| 936 | Ga0070665_100231308 | |||
| 937 | Ga0070665_100488283 | |||
| 938 | Ga0070664_100000718 | |||
| 939 | Ga0070664_100444024 | |||
| 940 | Ga0068857_100007375 | |||
| 941 | Ga0068857_100063374 | |||
| 942 | Ga0068857_100099474 | |||
| 943 | Ga0068854_100038236 | |||
| 944 | Ga0068854_100757836 | |||
| 945 | Ga0068856_100268986 | |||
| 946 | Ga0070702_100113027 | |||
| 947 | Ga0070702_100398093 | |||
| 948 | Ga0068852_100134269 | |||
| 949 | Ga0068852_100407282 | |||
| 950 | Ga0068852_100580169 | |||
| 951 | Ga0068852_100848862 | |||
| 952 | Ga0068859_100398305 | |||
| 953 | Ga0068859_101949322 | |||
| 954 | Ga0068864_100028185 | |||
| 955 | Ga0068864_100120757 | |||
| 956 | Ga0068864_100809471 | |||
| 957 | Ga0068866_10249620 | |||
| 958 | Ga0068866_10251756 | |||
| 959 | Ga0068863_100025022 | |||
| 960 | Ga0068863_100271312 | |||
| 961 | Ga0068863_100404457 | |||
| 962 | Ga0068858_100093570 | |||
| 963 | Ga0068858_100172930 | |||
| 964 | Ga0068858_100338890 | |||
| 965 | Ga0068860_100080897 | |||
| 966 | Ga0068860_100098427 | |||
| 967 | Ga0068860_101741769 | |||
| 968 | Ga0068862_100076550 | |||
| 969 | Ga0068862_100250669 | |||
| 970 | Ga0081455_10028326 | |||
| 971 | Ga0081455_10211922 | |||
| 972 | Ga0081540_1000058 | |||
| 973 | Ga0081540_1021085 | |||
| 974 | Ga0081539_10000023 | |||
| 975 | Ga0081539_10001040 | |||
| 976 | Ga0081539_10006795 | |||
| 977 | Ga0081539_10010243 | |||
| 978 | Ga0081539_10015448 | |||
| 979 | Ga0081539_10120679 | |||
| 980 | Ga0070717_10137653 | |||
| 981 | Ga0070717_10189101 | |||
| 982 | Ga0075368_10084855 | |||
| 983 | Ga0075363_100475718 | |||
| 984 | Ga0075364_10082107 | |||
| 985 | Ga0075364_10125684 | |||
| 986 | Ga0070715_10007916 | |||
| 987 | Ga0070716_100095811 | |||
| 988 | Ga0097621_100102751 | |||
| 989 | Ga0068871_100158310 | |||
| 990 | Ga0068871_100250138 | |||
| 991 | Ga0075428_100000928 | |||
| 992 | Ga0075430_100001813 | |||
| 993 | Ga0075431_100002633 | |||
| 994 | Ga0075434_100120747 | |||
| 995 | Ga0075429_100005321 | |||
| 996 | Ga0075429_100217633 | |||
| 997 | Ga0068865_100091338 | |||
| 998 | Ga0068865_100623422 | |||
| 999 | Ga0075436_100066545 | |||
| 1000 | Ga0075436_100265984 | |||
| 1001 | Ga0097620_100398316 | |||
| 1002 | Ga0097620_101949203 | |||
| 1003 | Ga0075435_100097133 | |||
| 1004 | Ga0105240_10205272 | |||
| 1005 | Ga0111539_10401260 | |||
| 1006 | Ga0111539_11636840 | |||
| 1007 | Ga0105245_10018559 | |||
| 1008 | Ga0105245_10097598 | |||
| 1009 | Ga0105245_10258130 | |||
| 1010 | Ga0105245_10486391 | |||
| 1011 | Ga0105245_11447250 | |||
| 1012 | Ga0105247_10192019 | |||
| 1013 | Ga0105247_10646038 | |||
| 1014 | Ga0114129_10001569 | |||
| 1015 | Ga0114129_10312053 | |||
| 1016 | Ga0105243_10605593 | |||
| 1017 | Ga0105243_10623216 | |||
| 1018 | Ga0105241_10166250 | |||
| 1019 | Ga0105241_10226543 | |||
| 1020 | Ga0105242_10244439 | |||
| 1021 | Ga0105242_12742442 | |||
| 1022 | Ga0105248_10078750 | |||
| 1023 | Ga0105248_11964486 | |||
| 1024 | Ga0105238_10023747 | |||
| 1025 | Ga0105238_10878443 | |||
| 1026 | Ga0105249_10078389 | |||
| 1027 | Ga0105249_10104596 | |||
| 1028 | Ga0105249_10264401 | |||
| 1029 | Ga0105249_10670663 | |||
| 1030 | Ga0105249_10838177 | |||
| 1031 | Ga0105028_112309 | |||
| 1032 | Ga0099796_10040471 | |||
| 1033 | Ga0105239_10770055 | |||
| 1034 | Ga0105239_12560140 | |||
| 1035 | Ga0105246_10020598 | |||
| 1036 | Ga0105246_10034512 | |||
| 1037 | Ga0157320_1000308 | |||
| 1038 | Ga0157341_1003899 | |||
| 1039 | Ga0157339_1001953 | |||
| 1040 | Ga0157373_11140705 | |||
| 1041 | Ga0157370_10188776 | |||
| 1042 | Ga0157370_11061833 | |||
| 1043 | Ga0157369_10172796 | |||
| 1044 | Ga0157369_12085429 | |||
| 1045 | Ga0157374_10235147 | |||
| 1046 | Ga0157374_10909142 | |||
| 1047 | Ga0157378_11383862 | |||
| 1048 | Ga0157378_11837503 | |||
| 1049 | Ga0163162_10241283 | |||
| 1050 | Ga0163162_11551782 | |||
| 1051 | Ga0157372_10148226 | |||
| 1052 | Ga0157372_10179944 | |||
| 1053 | Ga0157372_10476288 | |||
| 1054 | Ga0157372_10497173 | |||
| 1055 | Ga0157372_10597538 | |||
| 1056 | Ga0157372_11009058 | |||
| 1057 | Ga0157375_10202460 | |||
| 1058 | Ga0157375_12024999 | |||
| 1059 | Ga0163163_10604857 | |||
| 1060 | Ga0157380_10843654 | |||
| 1061 | Ga0182008_10197144 | |||
| 1062 | Ga0157377_10039003 | |||
| 1063 | Ga0157377_10506402 | |||
| 1064 | Ga0157379_10125714 | |||
| 1065 | Ga0157379_10206745 | |||
| 1066 | Ga0157379_10212292 | |||
| 1067 | Ga0157379_10725004 | |||
| 1068 | Ga0157379_11529582 | |||
| 1069 | Ga0157376_11584318 | |||
| 1070 | Ga0163161_10079551 | |||
| 1071 | Ga0206356_11814867 | |||
| 1072 | Ga0206354_10641417 | |||
| 1073 | Ga0213875_10008590 | |||
| 1074 | Ga0213875_10150826 | |||
| 1075 | Ga0207653_10005339 | |||
| 1076 | Ga0207692_10033785 | |||
| 1077 | Ga0207692_10151324 | |||
| 1078 | Ga0207642_10817141 | |||
| 1079 | Ga0207642_10906420 | |||
| 1080 | Ga0207688_10045916 | |||
| 1081 | Ga0207688_10080283 | |||
| 1082 | Ga0207688_10216207 | |||
| 1083 | Ga0207647_10065359 | |||
| 1084 | Ga0207647_10071626 | |||
| 1085 | Ga0207699_10035332 | |||
| 1086 | Ga0207699_10077768 | |||
| 1087 | Ga0207645_10054576 | |||
| 1088 | Ga0207645_10898946 | |||
| 1089 | Ga0207643_10049315 | |||
| 1090 | Ga0207705_10291527 | |||
| 1091 | Ga0207705_10376529 | |||
| 1092 | Ga0207654_11141187 | |||
| 1093 | Ga0207693_10179824 | |||
| 1094 | Ga0207663_10018650 | |||
| 1095 | Ga0207663_10089606 | |||
| 1096 | Ga0207660_10988948 | |||
| 1097 | Ga0207662_10009420 | |||
| 1098 | Ga0207662_10434467 | |||
| 1099 | Ga0207657_10006571 | |||
| 1100 | Ga0207657_10142647 | |||
| 1101 | Ga0207649_10253628 | |||
| 1102 | Ga0207649_10587485 | |||
| 1103 | Ga0207649_11219064 | |||
| 1104 | Ga0207652_10558377 | |||
| 1105 | Ga0207646_10734864 | |||
| 1106 | Ga0207681_10065583 | |||
| 1107 | Ga0207681_10236556 | |||
| 1108 | Ga0207694_10544142 | |||
| 1109 | Ga0207694_10617487 | |||
| 1110 | Ga0207650_10314680 | |||
| 1111 | Ga0207650_10830481 | |||
| 1112 | Ga0207650_11305686 | |||
| 1113 | Ga0207659_10035704 | |||
| 1114 | Ga0207659_10162806 | |||
| 1115 | Ga0207687_10089049 | |||
| 1116 | Ga0207687_10130223 | |||
| 1117 | Ga0207687_10321848 | |||
| 1118 | Ga0207687_10343797 | |||
| 1119 | Ga0207700_10091384 | |||
| 1120 | Ga0207700_10094770 | |||
| 1121 | Ga0207700_10912054 | |||
| 1122 | Ga0207700_10998145 | |||
| 1123 | Ga0207664_10013247 | |||
| 1124 | Ga0207664_10021185 | |||
| 1125 | Ga0207664_10067283 | |||
| 1126 | Ga0207664_10120661 | |||
| 1127 | Ga0207664_10558512 | |||
| 1128 | Ga0207644_10834928 | |||
| 1129 | Ga0207706_10061213 | |||
| 1130 | Ga0207706_10185342 | |||
| 1131 | Ga0207709_10040285 | |||
| 1132 | Ga0207709_10367046 | |||
| 1133 | Ga0207670_10327097 | |||
| 1134 | Ga0207670_11263524 | |||
| 1135 | Ga0207669_10450389 | |||
| 1136 | Ga0207669_11592405 | |||
| 1137 | Ga0207704_10457414 | |||
| 1138 | Ga0207665_10088785 | |||
| 1139 | Ga0207665_10157204 | |||
| 1140 | Ga0207691_10012460 | |||
| 1141 | Ga0207691_10446556 | |||
| 1142 | Ga0207711_10070924 | |||
| 1143 | Ga0207689_10003284 | |||
| 1144 | Ga0207689_10113692 | |||
| 1145 | Ga0207689_10215981 | |||
| 1146 | Ga0207661_10049090 | |||
| 1147 | Ga0207661_10582550 | |||
| 1148 | Ga0207661_11333440 | |||
| 1149 | Ga0207679_10129882 | |||
| 1150 | Ga0207679_10626234 | |||
| 1151 | Ga0207679_10796453 | |||
| 1152 | Ga0207679_10888380 | |||
| 1153 | Ga0207667_10534903 | |||
| 1154 | Ga0207712_10141954 | |||
| 1155 | Ga0207712_10197285 | |||
| 1156 | Ga0207668_10057721 | |||
| 1157 | Ga0207668_10070792 | |||
| 1158 | Ga0207640_10336721 | |||
| 1159 | Ga0207658_10089104 | |||
| 1160 | Ga0207658_10236113 | |||
| 1161 | Ga0207658_10361991 | |||
| 1162 | Ga0207677_10009927 | |||
| 1163 | Ga0207677_10075987 | |||
| 1164 | Ga0207677_10729685 | |||
| 1165 | Ga0207703_10161248 | |||
| 1166 | Ga0207703_10546636 | |||
| 1167 | Ga0207639_10091369 | |||
| 1168 | Ga0207678_10010287 | |||
| 1169 | Ga0207678_10365084 | |||
| 1170 | Ga0207678_10614245 | |||
| 1171 | Ga0207708_10003939 | |||
| 1172 | Ga0207708_10025161 | |||
| 1173 | Ga0207702_10016590 | |||
| 1174 | Ga0207702_10228764 | |||
| 1175 | Ga0207702_10613298 | |||
| 1176 | Ga0207641_10005229 | |||
| 1177 | Ga0207641_10067896 | |||
| 1178 | Ga0207641_10140888 | |||
| 1179 | Ga0207676_10249335 | |||
| 1180 | Ga0207676_10510286 | |||
| 1181 | Ga0207674_10004274 | |||
| 1182 | Ga0207674_10064578 | |||
| 1183 | Ga0207674_10097574 | |||
| 1184 | Ga0207675_100975272 | |||
| 1185 | Ga0207683_10014494 | |||
| 1186 | Ga0207683_10343745 | |||
| 1187 | Ga0207683_10482375 | |||
| 1188 | Ga0207683_10574146 | |||
| 1189 | Ga0207683_10594078 | |||
| 1190 | Ga0207698_10263870 | |||
| 1191 | Ga0207698_10308533 | |||
| 1192 | Ga0207698_10567420 | |||
| 1193 | Ga0207698_10590596 | |||
| 1194 | Ga0207698_11176396 | |||
| 1195 | Ga0207428_10178284 | |||
| 1196 | Ga0268266_10273121 | |||
| 1197 | Ga0268266_10427483 | |||
| 1198 | Ga0268265_10591121 | |||
| 1199 | Ga0268264_10099359 | |||
| 1200 | Ga0268264_11642172 | |||
| 1201 | Ga0307517_10078795 | |||
| 1202 | Ga0307517_10147816 | |||
| 1203 | Ga0307517_10268775 | |||
| 1204 | Ga0307515_10014225 | |||
| 1205 | Ga0307515_10026738 | |||
| 1206 | Ga0307515_10057662 | |||
| 1207 | Ga0307515_10076245 | |||
| 1208 | Ga0307515_10688595 | |||
| 1209 | Ga0307511_10139131 | |||
| 1210 | Ga0307511_10258030 | |||
| 1211 | Ga0307512_10005920 | |||
| 1212 | Ga0307512_10017028 | |||
| 1213 | Ga0307512_10022251 | |||
| 1214 | Ga0307512_10039021 | |||
| 1215 | Ga0307513_10019232 | |||
| 1216 | Ga0307513_10197716 | |||
| 1217 | Ga0307509_10032515 | |||
| 1218 | Ga0307509_10056785 | |||
| 1219 | Ga0307408_100072841 | |||
| 1220 | Ga0307408_101122779 | |||
| 1221 | Ga0307408_101309660 | |||
| 1222 | Ga0307508_10002620 | |||
| 1223 | Ga0307508_10003217 | |||
| 1224 | Ga0307508_10051989 | |||
| 1225 | Ga0307508_10143359 | |||
| 1226 | Ga0307508_10163425 | |||
| 1227 | Ga0307508_10465761 | |||
| 1228 | Ga0307508_10817637 | |||
| 1229 | Ga0307514_10446923 | |||
| 1230 | Ga0307516_10011683 | |||
| 1231 | Ga0307516_10031393 | |||
| 1232 | Ga0307516_10157059 | |||
| 1233 | Ga0307405_10003449 | |||
| 1234 | Ga0307405_10309520 | |||
| 1235 | Ga0307405_10333048 | |||
| 1236 | Ga0307405_10589693 | |||
| 1237 | Ga0307405_11781320 | |||
| 1238 | Ga0307413_10008086 | |||
| 1239 | Ga0307413_10185614 | |||
| 1240 | Ga0307413_10350011 | |||
| 1241 | Ga0307413_10513010 | |||
| 1242 | Ga0307413_10666433 | |||
| 1243 | Ga0307413_11578791 | |||
| 1244 | Ga0307410_10039193 | |||
| 1245 | Ga0307410_10114573 | |||
| 1246 | Ga0307410_10191867 | |||
| 1247 | Ga0307406_10001217 | |||
| 1248 | Ga0307406_10022249 | |||
| 1249 | Ga0307407_10101889 | |||
| 1250 | Ga0307412_10096609 | |||
| 1251 | Ga0307412_10652425 | |||
| 1252 | Ga0307409_100007503 | |||
| 1253 | Ga0307409_100014459 | |||
| 1254 | Ga0307409_100147555 | |||
| 1255 | Ga0307409_100229830 | |||
| 1256 | Ga0307409_101405089 | |||
| 1257 | Ga0307409_101529572 | |||
| 1258 | Ga0307409_101746244 | |||
| 1259 | Ga0307416_100005854 | |||
| 1260 | Ga0307416_100766213 | |||
| 1261 | Ga0307416_100784275 | |||
| 1262 | Ga0307416_101427096 | |||
| 1263 | Ga0307416_101429754 | |||
| 1264 | Ga0307414_10053049 | |||
| 1265 | Ga0307414_10230000 | |||
| 1266 | Ga0307411_10097674 | |||
| 1267 | Ga0307411_11140329 | |||
| 1268 | Ga0307415_100009542 | |||
| 1269 | Ga0307415_100053125 | |||
| 1270 | Ga0307415_100072496 | |||
| 1271 | Ga0307415_100152529 | |||
| 1272 | Ga0307415_100265113 | |||
| 1273 | Ga0307507_10071080 | |||
| 1274 | Ga0307507_10456266 | |||
| 1275 | Ga0307510_10180942 | |||
| 1276 | Ga0373948_0005533 | |||
| 1277 | Ga0373959_0075476 | |||
| 1278 | Ga0373938_0019014 | |||
| 1279 | Ga0373928_0179052 | |||
| 1280 | Ga0373934_0023758 | |||
| 1281 | Ga0373934_0214613 | |||
| 1282 | Ga0373940_0020426 | |||
| 1283 | Ga0373940_0032342 | |||
| 1284 | Ga0373944_0002054 | |||
| 1285 | Ga0373951_0000371 | |||
| 1286 | Ga0373951_0082008 | |||
| 1287 | Ga0373952_0040997 | |||
| 1288 | Ga0373923_0013501 | |||
| 1289 | Ga0373932_0012209 | |||
| 1290 | Ga0373936_0001005 | |||
| 1291 | Ga0373936_0040596 | |||
| 1292 | Ga0373939_0055489 | |||
| 1293 | Ga0373939_0247135 | |||
| 1294 | Ga0373941_0127054 | |||
| 1295 | Ga0373941_0161722 | |||
| 1296 | Ga0373945_0000810 | |||
| 1297 | Ga0373945_0029215 | |||
| 1298 | Ga0373945_0139483 | |||
| 1299 | Ga0373953_0089847 | |||
| 1300 | Ga0373954_0092796 | |||
| 1301 | Ga0373956_0347096 | |||
| 1302 | Ga0373943_0098315 | |||
| 1303 | Ga0373943_0132376 | |||
| 1304 | Ga0373946_0004490 | |||
| 1305 | Ga0373946_0080178 | |||
| 1306 | Ga0373955_0028107 | |||
| 1307 | Ga0373955_0125071 | |||
| 1308 | Ga0373955_0167705 | |||
| 1309 | Ga0373942_0000152 | |||
| 1310 | Ga0373942_0070451 | |||
| 1311 | Ga0373961_0021763 | |||
| 1312 | Ga0373962_0004288 | |||
| 1313 | Ga0373962_0039808 | |||
| 1314 | Ga0316574_0026378 | |||
| 1315 | Ga0316574_0290084 | |||
| 1316 | Ga0373924_0015710 | |||
| 1317 | Ga0373924_0050644 | |||
| 1318 | Ga0373931_0020989 | |||
| 1319 | Ga0373931_0266365 | |||
| 1320 | Ga0373931_0760689 | |||
| 1321 | Ga0373935_0003808 | |||
| 1322 | Ga0373935_0092942 | |||
| 1323 | Ga0373935_0212380 | |||
| 1324 | Ga0373935_0688353 | |||
| 1325 | Ga0373927_0020474 | |||
| 1326 | Ga0373927_0022250 | |||
| 1327 | Ga0373933_0027924 | |||
| 1328 | Ga0373933_0143947 | |||
| 1329 | Ga0373933_0758348 | |||
| 1330 | Ga0373947_0003093 | |||
| 1331 | Ga0373937_0097794 | |||
| 1332 | Ga0373937_0098762 | |||
| 1333 | Ga0372808_013772 | |||
| 1334 | Ga0373925_0256178 | |||
| 1335 | Ga0395900_1146583 | |||
| 1336 | Ga0395898_0096517 | |||
| 1337 | Ga0436364_0059219 | |||
| 1338 | Ga0436364_0463455 | |||
| 1339 | Ga0436364_0967897 | |||
| 1340 | Ga0395901_0105994 | |||
| 1341 | Ga0400483_286613 | |||
| 1342 | Ga0436365_1545022 | |||
| 1343 | Ga0436363_0687920 | |||
| 1344 | Ga0451789_0444322 | |||
| 1345 | Ga0451791_1439624 | |||
| 1346 | Ga0451793_1906183 | |||
| 1347 | Ga0451837_0072343 | |||
| 1348 | Ga0451843_1174054 | |||
| 1349 | Ga0451853_2374562 | |||
| 1350 | Ga0439463_080027 | |||
| 1351 | Ga0466969_0001307 | |||
| 1352 | Ga0466969_0052833 | |||
| 1353 | Ga0466969_0157359 | |||
| 1354 | Ga0466966_0007574 | |||
| 1355 | Ga0466966_0033264 | |||
| 1356 | Ga0466971_0000689 | |||
| 1357 | Ga0466970_0014607 | |||
| 1358 | Ga0466970_0243869 | |||
| 1359 | Ga0466957_0216347 | |||
| 1360 | Ga0466957_0222345 | |||
| 1361 | Ga0466957_0456150 | |||
| 1362 | Ga0466960_0136205 | |||
| 1363 | Ga0466959_0001910 | |||
| 1364 | Ga0466959_0010087 | |||
| 1365 | Ga0466958_0034614 | |||
| 1366 | Ga0466967_0022798 | |||
| 1367 | Ga0466967_0040767 | |||
| 1368 | Ga0466967_0518550 | |||
| 1369 | Ga0466967_1555098 | |||
| 1370 | Ga0495592_0058909 | |||
| 1371 | Ga0495592_0100191 | |||
| 1372 | Ga0495592_0327403 | |||
| 1373 | Ga0495592_0420778 | |||
| 1374 | Ga0495603_0209235 | |||
| 1375 | Ga0495603_0544640 | |||
| 1376 | Ga0495629_0301801 | |||
| 1377 | Ga0495629_0308940 | |||
| 1378 | Ga0495638_0300799 | |||
| 1379 | Ga0495641_0029319 | |||
| 1380 | Ga0495641_0315867 | |||
| 1381 | Ga0495651_0000405 | |||
| 1382 | Ga0495651_0013939 | |||
| 1383 | Ga0495651_0075538 | |||
| 1384 | Ga0495651_0090423 | |||
| 1385 | Ga0495651_0160001 | |||
| 1386 | Ga0495651_0451519 | |||
| 1387 | Ga0495653_0006045 | |||
| 1388 | Ga0495653_0011270 | |||
| 1389 | Ga0495653_0013551 | |||
| 1390 | Ga0495653_0107397 | |||
| 1391 | Ga0495653_0159293 | |||
| 1392 | Ga0495650_0056882 | |||
| 1393 | Ga0495580_0005058 | |||
| 1394 | Ga0495580_0151518 | |||
| 1395 | Ga0495582_0382542 | |||
| 1396 | Ga0495639_0026978 | |||
| 1397 | Ga0495639_0114505 | |||
| 1398 | Ga0495662_0004185 | |||
| 1399 | Ga0495662_0006172 | |||
| 1400 | Ga0495664_0000745 | |||
| 1401 | Ga0495664_0001527 | |||
| 1402 | Ga0495664_0041249 | |||
| 1403 | Ga0495664_0136782 | |||
| 1404 | Ga0495664_0439908 | |||
| 1405 | Ga0495664_0499466 | |||
| 1406 | Ga0495585_0023340 | |||
| 1407 | Ga0495608_0000431 | |||
| 1408 | Ga0495608_0078506 | |||
| 1409 | Ga0495608_0127813 | |||
| 1410 | Ga0495608_0240078 | |||
| 1411 | Ga0495618_0064778 | |||
| 1412 | Ga0495618_0068246 | |||
| 1413 | Ga0495618_0088579 | |||
| 1414 | Ga0495618_0195845 | |||
| 1415 | Ga0495618_0219780 | |||
| 1416 | Ga0495618_0635205 | |||
| 1417 | Ga0495628_0017144 | |||
| 1418 | Ga0495628_0149694 | |||
| 1419 | Ga0495628_0187568 | |||
| 1420 | Ga0495630_0407635 | |||
| 1421 | Ga0495666_0066344 | |||
| 1422 | Ga0495666_0199341 | |||
| 1423 | Ga0495652_0006521 | |||
| 1424 | Ga0495652_0070028 | |||
| 1425 | Ga0495652_0100903 | |||
| 1426 | Ga0495652_0118080 | |||
| 1427 | Ga0495652_0185953 | |||
| 1428 | Ga0495652_0188998 | |||
| 1429 | Ga0495665_0052942 | |||
| 1430 | Ga0495665_0117299 | |||
| 1431 | Ga0495640_0029937 | |||
| 1432 | Ga0495640_0256905 | |||
| 1433 | Ga0495640_0281541 | |||
| 1434 | Ga0495640_0546963 | |||
| 1435 | Ga0495586_0318085 | |||
| 1436 | Ga0495586_0519520 | |||
| 1437 | Ga0495587_0016509 | |||
| 1438 | Ga0495587_0019470 | |||
| 1439 | Ga0495587_0260782 | |||
| 1440 | Ga0495587_0265335 | |||
| 1441 | Ga0495645_0010765 | |||
| 1442 | Ga0495645_0047000 | |||
| 1443 | Ga0495645_0104243 | |||
| 1444 | Ga0495645_0194716 | |||
| 1445 | Ga0495667_0003511 | |||
| 1446 | Ga0495667_0014710 | |||
| 1447 | Ga0495667_0036911 | |||
| 1448 | Ga0495667_0132197 | |||
| 1449 | Ga0495667_0261102 | |||
| 1450 | Ga0495667_0461491 | |||
| 1451 | Ga0495667_0508361 | |||
| 1452 | Ga0495634_0073127 | |||
| 1453 | Ga0495634_0155191 | |||
| 1454 | Ga0495634_0232856 | |||
| 1455 | Ga0495634_0407808 | |||
| 1456 | Ga0495634_0521400 | |||
| 1457 | Ga0495634_0562614 | |||
| 1458 | Ga0495635_0003994 | |||
| 1459 | Ga0495635_0009208 | |||
| 1460 | Ga0495635_0050515 | |||
| 1461 | Ga0495635_0058901 | |||
| 1462 | Ga0495635_0659190 | |||
| 1463 | Ga0495588_0364945 | |||
| 1464 | Ga0495657_0001154 | |||
| 1465 | Ga0495657_0105121 | |||
| 1466 | Ga0495657_0117485 | |||
| 1467 | Ga0495657_0307401 | |||
| 1468 | Ga0495657_0383718 | |||
| 1469 | Ga0495599_0022538 | |||
| 1470 | Ga0495599_0038651 | |||
| 1471 | Ga0495599_0261807 | |||
| 1472 | Ga0495599_0419636 | |||
| 1473 | Ga0495623_0054028 | |||
| 1474 | Ga0495623_0057366 | |||
| 1475 | Ga0495623_0284564 | |||
| 1476 | Ga0495623_0376069 | |||
| 1477 | Ga0495623_0517301 | |||
| 1478 | Ga0495646_0024112 | |||
| 1479 | Ga0495646_0038869 | |||
| 1480 | Ga0495646_0094283 | |||
| 1481 | Ga0495658_0024522 | |||
| 1482 | Ga0495613_0003259 | |||
| 1483 | Ga0495624_0029094 | |||
| 1484 | Ga0495624_0229135 | |||
| 1485 | Ga0495649_0305138 | |||
| 1486 | Ga0495600_0011040 | |||
| 1487 | Ga0495600_0150905 | |||
| 1488 | Ga0495600_0152173 | |||
| 1489 | Ga0495600_0396599 | |||
| 1490 | Ga0495600_0581878 | |||
| 1491 | Ga0495581_0004922 | |||
| 1492 | Ga0495581_0156201 | |||
| 1493 | Ga0495581_0404344 | |||
| 1494 | Ga0495604_0000492 | |||
| 1495 | Ga0495604_0119296 | |||
| 1496 | Ga0495604_0195783 | |||
| 1497 | Ga0495604_0332429 | |||
| 1498 | Ga0495674_0005651 | |||
| 1499 | Ga0495674_0074284 | |||
| 1500 | Ga0495674_0132379 | |||
| 1501 | Ga0495674_0442565 | |||
| 1502 | Ga0495676_0004827 | |||
| 1503 | Ga0495680_0009063 | |||
| 1504 | Ga0495680_0010693 | |||
| 1505 | Ga0495680_0162876 | |||
| 1506 | Ga0495675_0108524 | |||
| 1507 | Ga0495675_0144843 | |||
| 1508 | Ga0495684_0046062 | |||
| 1509 | Ga0495684_0121751 | |||
| 1510 | Ga0495684_0260351 | |||
| 1511 | Ga0495684_0337450 | |||
| 1512 | Ga0495593_0034588 | |||
| 1513 | Ga0495593_0134907 | |||
| 1514 | Ga0495593_0142423 | |||
| 1515 | Ga0495602_0051310 | |||
| 1516 | Ga0495602_0100208 | |||
| 1517 | Ga0495602_0105002 | |||
| 1518 | Ga0495614_0033792 | |||
| 1519 | Ga0496100_0002440 | |||
| 1520 | Ga0496100_1433529 | |||
| 1521 | Ga0496101_0002674 | |||
| 1522 | Ga0496101_0388120 | |||
| 1523 | Ga0496101_0900381 | |||
| 1524 | Ga0496102_0000147 | |||
| 1525 | Ga0496102_0049087 | |||
| 1526 | Ga0496102_0144993 | |||
| 1527 | Ga0496102_0513147 | |||
| 1528 | Ga0496102_1229486 | |||
| 1529 | Ga0496103_0000261 | |||
| 1530 | Ga0496104_0028477 | |||
| 1531 | Ga0496104_0093449 | |||
| 1532 | Ga0496104_0596379 | |||
| 1533 | Ga0496104_0773714 | |||
| 1534 | Ga0496105_0019842 | |||
| 1535 | Ga0496105_0037598 | |||
| 1536 | Ga0496105_0045106 | |||
| 1537 | Ga0496105_0540032 | |||
| 1538 | Ga0496106_0277091 | |||
| 1539 | Ga0496107_0205881 | |||
| 1540 | Ga0496107_0316413 | |||
| 1541 | Ga0496107_0586482 | |||
| 1542 | Ga0496108_0000418 | |||
| 1543 | Ga0496108_0134684 | |||
| 1544 | Ga0496108_0166642 | |||
| 1545 | Ga0496109_0163086 | |||
| 1546 | Ga0496109_0284669 | |||
| 1547 | Ga0496109_0474566 | |||
| 1548 | Ga0496109_0775991 | |||
| 1549 | Ga0496110_0037383 | |||
| 1550 | Ga0496110_0158883 | |||
| 1551 | Ga0496110_0514397 | |||
| 1552 | Ga0496111_0060195 | |||
| 1553 | Ga0496111_0248373 | |||
| 1554 | Ga0496112_0642281 | |||
| 1555 | Ga0496113_0148331 | |||
| 1556 | Ga0496113_0155667 | |||
| 1557 | Ga0496114_0002172 | |||
| 1558 | Ga0496114_0003886 | |||
| 1559 | Ga0496114_0050779 | |||
| 1560 | Ga0496114_0181625 | |||
| 1561 | Ga0496114_0463974 | |||
| 1562 | Ga0496115_0158234 | |||
| 1563 | Ga0496115_0366547 | |||
| 1564 | Ga0496116_0000425 | |||
| 1565 | Ga0496117_0000274 | |||
| 1566 | Ga0496118_0000602 | |||
| 1567 | Ga0496119_0000957 | |||
| 1568 | Ga0496120_0008239 | |||
| 1569 | Ga0496121_0057363 | |||
| 1570 | Ga0496124_0054816 | |||
| 1571 | Ga0496125_0012303 | |||
| 1572 | Ga0496126_0000419 | |||
| 1573 | Ga0496126_0283434 | |||
| 1574 | Ga0496126_0423034 | |||
| 1575 | Ga0501031_0073510 | |||
| 1576 | Ga0501031_0357829 | |||
| 1577 | Ga0501032_0192105 | |||
| 1578 | Ga0501032_0466218 | |||
| 1579 | Ga0501032_0871417 | |||
| 1580 | Ga0501033_0021747 | |||
| 1581 | Ga0501033_0133444 | |||
| 1582 | Ga0501033_0573202 | |||
| 1583 | Ga0501036_0037640 | |||
| 1584 | Ga0501036_0310307 | |||
| 1585 | Ga0501036_0326942 | |||
| 1586 | Ga0501036_1253173 | |||
| 1587 | Ga0501037_0042754 | |||
| 1588 | Ga0501037_0058261 | |||
| 1589 | Ga0501038_0017635 | |||
| 1590 | Ga0501038_0500144 | |||
| 1591 | Ga0501038_0998672 | |||
| 1592 | Ga0501039_0009026 | |||
| 1593 | Ga0501039_0039192 | |||
| 1594 | Ga0501039_0410704 | |||
| 1595 | Ga0501040_0069482 | |||
| 1596 | Ga0501040_0154560 | |||
| 1597 | Ga0501041_0019691 | |||
| 1598 | Ga0501041_0142411 | |||
| 1599 | Ga0501042_0117316 | |||
| 1600 | Ga0501042_0189325 | |||
| 1601 | Ga0501043_0156203 | |||
| 1602 | Ga0501043_0162373 | |||
| 1603 | Ga0501043_0387615 | |||
| 1604 | Ga0501043_0448114 | |||
| 1605 | Ga0501046_0014581 | |||
| 1606 | Ga0501046_0026166 | |||
| 1607 | Ga0501046_0088918 | |||
| 1608 | Ga0501046_0877366 | |||
| 1609 | Ga0501047_0063580 | |||
| 1610 | Ga0501047_0110688 | |||
| 1611 | Ga0501048_0004968 | |||
| 1612 | Ga0501067_0100823 | |||
| 1613 | Ga0501067_0540024 | |||
| 1614 | Ga0501068_0042422 | |||
| 1615 | Ga0501070_0897781 | |||
| 1616 | Ga0501071_0102894 | |||
| 1617 | Ga0501072_0010531 | |||
| 1618 | Ga0501072_0139873 | |||
| 1619 | Ga0501073_0161030 | |||
| 1620 | Ga0501075_0012160 | |||
| 1621 | Ga0501076_0068378 | |||
| 1622 | Ga0501076_0269725 | |||
| 1623 | Ga0501077_0341395 | |||
| 1624 | Ga0501079_0335389 | |||
| 1625 | Ga0501080_0936976 | |||
| 1626 | Ga0501081_0041917 | |||
| 1627 | Ga0501035_0042721 | |||
| 1628 | Ga0501035_0240625 | |||
| 1629 | Ga0501035_0545952 | |||
| 1630 | Ga0501044_0747312 | |||
| 1631 | Ga0501044_0778102 | |||
| 1632 | Ga0501045_0013683 | |||
| 1633 | Ga0501045_0055604 | |||
| 1634 | Ga0501045_0381442 | |||
| 1635 | nmdc:mga03n38_119743_c1 | |||
| 1636 | nmdc:mga03n38_508189_c1 | |||
| 1637 | nmdc:mga00v17_72724_c1 | |||
| 1638 | nmdc:mga05p37_35185_c1 | |||
| 1639 | nmdc:mga09592_16039_c1 | |||
| 1640 | nmdc:mga09592_176038_c1 | |||
| 1641 | nmdc:mga09592_195263_c1 | |||
| 1642 | nmdc:mga0qj67_2330_c1 | |||
| 1643 | nmdc:mga06r32_13370_c1 | |||
| 1644 | nmdc:mga06r32_398_c4 | |||
| 1645 | nmdc:mga06r32_421140_c1 | |||
| 1646 | nmdc:mga08y16_1330028_c1 | |||
| 1647 | nmdc:mga08y16_294144_c1 | |||
| 1648 | nmdc:mga08y16_320527_c1 | |||
| 1649 | nmdc:mga0n895_1382982_c1 | |||
| 1650 | nmdc:mga0rr50_532722_c1 | |||
| 1651 | Ga0495601_0003897 | |||
| 1652 | Ga0495601_0016298 | |||
| 1653 | Ga0495601_0063428 | |||
| 1654 | Ga0495601_0459971 | |||
| 1655 | Ga0495612_0002389 | |||
| 1656 | Ga0495612_0068056 | |||
| 1657 | Ga0495612_0187116 | |||
| 1658 | Ga0495612_0197704 | |||
| 1659 | Ga0495595_0086079 | |||
| 1660 | Ga0495595_0311624 | |||
| 1661 | Ga0495619_0193903 | |||
| 1662 | Ga0500644_0005542 | |||
| 1663 | Ga0500644_0068611 | |||
| 1664 | Ga0500644_0185998 | |||
| 1665 | Ga0500583_0445195 | |||
| 1666 | Ga0500651_0071771 | |||
| 1667 | Ga0500641_0055998 | |||
| 1668 | Ga0500650_0069159 | |||
| 1669 | Ga0500660_168703 | |||
| 1670 | Ga0500569_028595 | |||
| 1671 | Ga0500594_0002769 | |||
| 1672 | Ga0500652_199585 | |||
| 1673 | Ga0500655_016924 | |||
| 1674 | Ga0500579_162325 | |||
| 1675 | Ga0500600_0244098 | |||
| 1676 | Ga0500616_0001593 | |||
| 1677 | Ga0500616_0014227 | |||
| 1678 | Ga0500630_173951 | |||
| 1679 | Ga0500634_0261412 | |||
| 1680 | Ga0501084_0006561 | |||
| 1681 | Ga0501084_0036505 | |||
| 1682 | Ga0501082_0020922 | |||
| 1683 | Ga0501082_0099440 | |||
| 1684 | Ga0466962_0009413 | |||
| 1685 | Ga0530510_0007434 | |||
| 1686 | Ga0530510_0353839 | |||
| 1687 | Ga0530510_0439937 | |||
| 1688 | 2515854704 | |||
| 1689 | 2558909071 | |||
| 1690 | 2643849734 | |||
| 1691 | 2644135736 | |||
| 1692 | 2676474125 | |||
| 1693 | 2676495804 | |||
| 1694 | 2731906028 | |||
| 1695 | 2753268449 | |||
| 1696 | 2776372367 | |||
| 1697 | 2791916133 | |||
| 1698 | 2816425537 | |||
| 1699 | 2827629016 | |||
| 1700 | 2861521993 | |||
| 1701 | 2863074805 | |||
| 1702 | 2870786244 | |||
| 1703 | 2880498981 | |||
| 1704 | 2891329077 | |||
| 1705 | 2895438576 | |||
| 1706 | 2899363611 | |||
| 1707 | 3006429396 | |||
| 1708 | 8054476398 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2d5m-assembly1.cif.gz_A-2 | flavoredoxin of desulfovibrio vulgaris (miyazaki f) | 0.8561 | 23 | 79 |
| 2aq6-assembly1.cif.gz_B | x-ray crystal structure of mycobacterium tuberculosis pyridoxine 5'-phosphate oxidase complexed with pyridoxal 5'-phosphate at 1.7 a resolution | 0.8051 | 11 | 146 |
| 2i02-assembly1.cif.gz_A | crystal structure of a pyridoxamine 5'-phosphate oxidase-like family protein (npun_r6570) from nostoc punctiforme pcc 73102 at 1.80 a resolution | 0.8008 | 13 | 140 |
| 5jab-assembly1.cif.gz_B | structure of the biliverdin reductase rv2074 from mycobacterium tuberculosis in complex with f420 | 0.7831 | 10 | 146 |
| 1rfe-assembly1.cif.gz_A | crystal structure of conserved hypothetical protein rv2991 from mycobacterium tuberculosis | 0.7819 | 4 | 143 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2d5mA00 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.8561 | 23 | 79 | 2.30.110.10 |
| 2arzB01 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.8231 | 15 | 140 | 2.30.110.10 |
| af_O07754_2_147_2.30.110.10 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.8105 | 22 | 146 | 2.30.110.10 |
| 1w9aB00 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.7867 | 14 | 151 | 2.30.110.10 |
| 6eciG00 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.7797 | 6 | 146 | 2.30.110.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7I7Y322-F1-model_v4 | PPOX class F420-dependent enzyme | 0.997 | 1 | 150 |
GO:0005829
GO:0016627 GO:0070967 |
| AF-A0A2U3NSW0-F1-model_v4 | Pyridoxamine 5'-phosphate oxidase N-terminal domain-containing protein | 0.9967 | 1 | 149 |
GO:0005829
GO:0016627 GO:0070967 |
| AF-A0A132PG41-F1-model_v4 | Pyridoxamine 5'-phosphate oxidase | 0.9966 | 1 | 149 |
GO:0005829
GO:0016627 GO:0070967 |
| AF-A0A117JTT6-F1-model_v4 | Pyridoxamine 5'-phosphate oxidase | 0.9961 | 1 | 149 |
GO:0005829
GO:0016627 GO:0070967 |
| AF-A0A286ELS3-F1-model_v4 | PPOX class probable F420-dependent enzyme | 0.9959 | 1 | 149 |
GO:0005829
GO:0016627 GO:0070967 |