F483602

General Info

Members Datasets Scaffolds Average Seq Length
854 405 1708 154

Family's Representative Sequence

Representative Sequence 3300053139|Ga0500568_0000279|Ga0500568_0000279_17936_18397
Length 153
Sequence MSPQIATNTEVDRAGMEDFVRPNHQAVLITTRQDGRPQASPVTCGLDTEGRIVISTYPERAKTANARRDPQVSVVVLTERNGAEGWIQVDGDAEVIDPPDSVEPLVEYFRVISGEHPDWDEYRQAMREQGKSLIRVTPTRWSPIATGGFPAPS

Samples

Sample ID Description Type Environment
1 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
62 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
63 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
64 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
89 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
93 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
94 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
95 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
96 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
106 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
113 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
168 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
172 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
173 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
174 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
175 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
176 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
177 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
178 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
179 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
180 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
181 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
182 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
183 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
184 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
185 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
186 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
187 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
188 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
189 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
190 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
191 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
192 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
193 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
194 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
195 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
196 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
197 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
198 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
199 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
200 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
201 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
202 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
203 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
204 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
205 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
206 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
207 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
208 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
209 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
210 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
211 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
212 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
213 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
214 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
215 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
216 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
217 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
218 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
219 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
220 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
221 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
222 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
223 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
224 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
225 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
226 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
227 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
228 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
229 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
230 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
231 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
232 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
233 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
234 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
235 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
236 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
237 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
238 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
239 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
240 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
241 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
242 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
243 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
244 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
245 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
246 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
247 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
248 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
249 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
250 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
251 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
252 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
253 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
254 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
255 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
256 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
257 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
258 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
259 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
260 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
261 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
262 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
263 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
264 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
265 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
266 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
267 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
268 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
269 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
270 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
271 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
272 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
273 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
274 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
275 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
276 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
277 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
278 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
279 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
280 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
281 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
282 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
283 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
284 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
285 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
286 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
287 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
288 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
289 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
290 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
291 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
292 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
293 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
294 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
295 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
296 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
297 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
298 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
299 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
300 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
301 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
302 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
303 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
304 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
305 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
306 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
307 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
308 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
309 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
310 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
311 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
312 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
313 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
314 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
315 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
316 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
317 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
318 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
319 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
320 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
321 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
322 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
323 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
324 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
325 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
326 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
327 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
328 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
329 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
330 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
331 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
332 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
333 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
334 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
335 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
336 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
337 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
338 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
339 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
340 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
341 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
342 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
343 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
344 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
345 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
346 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
347 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
348 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
349 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
350 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
351 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
352 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
353 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
354 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
355 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
356 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
357 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
358 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
359 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
360 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
361 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
362 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
363 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
364 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
365 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
366 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
367 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
368 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
369 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
370 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
371 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
372 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
373 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
374 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
375 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
376 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
377 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
378 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
379 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
380 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
381 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
382 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
383 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
384 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
385 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
386 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
387 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
388 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
389 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
390 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
391 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
392 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
393 2775506925 Saccharopolyspora phatthalungensis NRRL B-24798 Isolate Rhizosphere
394 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
395 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
396 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
397 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
398 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
399 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
400 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
401 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
402 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
403 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
404 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
405 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.19
Metatranscriptomes 0.35
Isolates 2.46

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.04
Nodule 0
Rhizoplane 5.62
Rhizosphere 83.49
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500568_0000279 3300053139 Bacteria 42452
2 JGI24740J21852_10039081 3300001979 Bacteria 1451
3 JGI24737J22298_10025955 3300001990 Bacteria 1850
4 JGI24735J21928_10066184 3300002067 Bacteria 1037
5 JGI24735J21928_10151701 3300002067 Bacteria 669
6 JGI25406J46586_10006430 3300003203 Bacteria 5407
7 JGI25406J46586_10047164 3300003203 Bacteria 1470
8 rootH2_10025380 3300003320 Bacteria 2582
9 rootH2_10032131 3300003320 Bacteria 3228
10 Ga0070658_10228614 3300005327 Bacteria 1575
11 Ga0070676_10123669 3300005328 Bacteria 1627
12 Ga0070683_100296637 3300005329 Bacteria 1537
13 Ga0070683_100650643 3300005329 Bacteria 1009
14 Ga0070683_101167091 3300005329 Bacteria 740
15 Ga0070683_101332403 3300005329 Bacteria 690
16 Ga0068869_100025111 3300005334 Bacteria 4134
17 Ga0068869_100199463 3300005334 Bacteria 1577
18 Ga0068869_100526402 3300005334 Bacteria 990
19 Ga0070666_10318144 3300005335 Bacteria 1110
20 Ga0068868_100013555 3300005338 Bacteria 5981
21 Ga0068868_100098486 3300005338 Bacteria 2364
22 Ga0068868_100497572 3300005338 Bacteria 1067
23 Ga0070660_100556154 3300005339 Bacteria 957
24 Ga0070689_100718952 3300005340 Bacteria 873
25 Ga0070689_100987152 3300005340 Bacteria 748
26 Ga0070691_10034979 3300005341 Bacteria 2365
27 Ga0070687_100089905 3300005343 Bacteria 1696
28 Ga0070687_100942635 3300005343 Bacteria 622
29 Ga0070661_100020447 3300005344 Bacteria 4721
30 Ga0070692_10002568 3300005345 Bacteria 7081
31 Ga0070668_100010835 3300005347 Bacteria 6784
32 Ga0070668_100480955 3300005347 Bacteria 1072
33 Ga0070668_100482230 3300005347 Bacteria 1071
34 Ga0070669_100170917 3300005353 Bacteria 1694
35 Ga0070669_100459275 3300005353 Bacteria 1051
36 Ga0070675_100000709 3300005354 Bacteria 23182
37 Ga0070675_100190516 3300005354 Bacteria 1776
38 Ga0070671_100068785 3300005355 Bacteria 2953
39 Ga0070674_100094375 3300005356 Bacteria 2167
40 Ga0070674_101838188 3300005356 Bacteria 550
41 Ga0070673_100870314 3300005364 Bacteria 834
42 Ga0070667_100205890 3300005367 Bacteria 1747
43 Ga0070667_100769267 3300005367 Bacteria 893
44 Ga0070709_10143765 3300005434 Bacteria 1641
45 Ga0070709_10316306 3300005434 Bacteria 1144
46 Ga0070709_10879298 3300005434 Bacteria 707
47 Ga0070714_100023518 3300005435 Bacteria 5065
48 Ga0070714_100121881 3300005435 Bacteria 2320
49 Ga0070714_100729056 3300005435 Bacteria 957
50 Ga0070710_10034440 3300005437 Bacteria 2755
51 Ga0070701_10186532 3300005438 Bacteria 1218
52 Ga0070701_10727975 3300005438 Bacteria 670
53 Ga0070711_100906630 3300005439 Bacteria 752
54 Ga0070711_101017161 3300005439 Bacteria 711
55 Ga0070711_101019916 3300005439 Bacteria 710
56 Ga0070700_100005842 3300005441 Bacteria 6533
57 Ga0070700_100352793 3300005441 Bacteria 1091
58 Ga0070663_100131697 3300005455 Bacteria 1900
59 Ga0070663_100238353 3300005455 Bacteria 1435
60 Ga0070663_100320318 3300005455 Bacteria 1246
61 Ga0070678_100078774 3300005456 Bacteria 2490
62 Ga0070678_100174028 3300005456 Bacteria 1756
63 Ga0070678_100840278 3300005456 Bacteria 836
64 Ga0070662_100214900 3300005457 Bacteria 1532
65 Ga0070685_11064398 3300005466 Bacteria 610
66 Ga0070679_100423228 3300005530 Bacteria 1277
67 Ga0070684_100166028 3300005535 Bacteria 2004
68 Ga0070684_100220184 3300005535 Bacteria 1732
69 Ga0070684_100239806 3300005535 Bacteria 1656
70 Ga0070684_100356396 3300005535 Bacteria 1346
71 Ga0070684_100817318 3300005535 Bacteria 872
72 Ga0070684_101029078 3300005535 Bacteria 773
73 Ga0068853_100494232 3300005539 Bacteria 1154
74 Ga0070672_100222370 3300005543 Bacteria 1584
75 Ga0070686_100052033 3300005544 Bacteria 2610
76 Ga0070695_100053227 3300005545 Bacteria 2602
77 Ga0070696_100155862 3300005546 Bacteria 1680
78 Ga0070696_100296868 3300005546 Bacteria 1236
79 Ga0070696_100394244 3300005546 Bacteria 1082
80 Ga0070665_100075860 3300005548 Bacteria 3369
81 Ga0070665_100134710 3300005548 Bacteria 2472
82 Ga0070665_100231308 3300005548 Bacteria 1848
83 Ga0070665_100488283 3300005548 Bacteria 1243
84 Ga0070664_100000718 3300005564 Bacteria 25389
85 Ga0070664_100444024 3300005564 Bacteria 1190
86 Ga0068857_100007375 3300005577 Bacteria 9467
87 Ga0068857_100063374 3300005577 Bacteria 3286
88 Ga0068857_100099474 3300005577 Bacteria 2609
89 Ga0068854_100038236 3300005578 Bacteria 3373
90 Ga0068854_100757836 3300005578 Bacteria 843
91 Ga0068856_100268986 3300005614 Bacteria 1720
92 Ga0070702_100113027 3300005615 Bacteria 1687
93 Ga0070702_100398093 3300005615 Bacteria 984
94 Ga0068852_100134269 3300005616 Bacteria 2283
95 Ga0068852_100407282 3300005616 Bacteria 1339
96 Ga0068852_100580169 3300005616 Bacteria 1124
97 Ga0068852_100848862 3300005616 Bacteria 929
98 Ga0068859_100398305 3300005617 Bacteria 1472
99 Ga0068859_101949322 3300005617 Bacteria 649
100 Ga0068864_100028185 3300005618 Bacteria 4745
101 Ga0068864_100120757 3300005618 Bacteria 2343
102 Ga0068864_100809471 3300005618 Bacteria 921
103 Ga0068866_10249620 3300005718 Bacteria 1085
104 Ga0068866_10251756 3300005718 Bacteria 1081
105 Ga0068863_100025022 3300005841 Bacteria 5693
106 Ga0068863_100271312 3300005841 Bacteria 1642
107 Ga0068863_100404457 3300005841 Bacteria 1336
108 Ga0068858_100093570 3300005842 Bacteria 2798
109 Ga0068858_100172930 3300005842 Bacteria 2037
110 Ga0068858_100338890 3300005842 Bacteria 1439
111 Ga0068860_100080897 3300005843 Bacteria 3089
112 Ga0068860_100098427 3300005843 Bacteria 2789
113 Ga0068860_101741769 3300005843 Bacteria 645
114 Ga0068862_100076550 3300005844 Bacteria 2896
115 Ga0068862_100250669 3300005844 Bacteria 1613
116 Ga0081455_10028326 3300005937 Bacteria 5119
117 Ga0081455_10211922 3300005937 Bacteria 1443
118 Ga0081540_1000058 3300005983 Bacteria 120635
119 Ga0081540_1021085 3300005983 Bacteria 3895
120 Ga0081539_10000023 3300005985 Bacteria 356082
121 Ga0081539_10001040 3300005985 Bacteria 50896
122 Ga0081539_10006795 3300005985 Bacteria 10732
123 Ga0081539_10010243 3300005985 Bacteria 7660
124 Ga0081539_10015448 3300005985 Bacteria 5547
125 Ga0081539_10120679 3300005985 Bacteria 1303
126 Ga0070717_10137653 3300006028 Bacteria 2104
127 Ga0070717_10189101 3300006028 Bacteria 1798
128 Ga0075368_10084855 3300006042 Bacteria 1291
129 Ga0075363_100475718 3300006048 Bacteria 740
130 Ga0075364_10082107 3300006051 Bacteria 2132
131 Ga0075364_10125684 3300006051 Bacteria 1719
132 Ga0070715_10007916 3300006163 Bacteria 3679
133 Ga0070716_100095811 3300006173 Bacteria 1807
134 Ga0097621_100102751 3300006237 Bacteria 2407
135 Ga0068871_100158310 3300006358 Bacteria 1935
136 Ga0068871_100250138 3300006358 Bacteria 1544
137 Ga0075428_100000928 3300006844 Bacteria 30979
138 Ga0075430_100001813 3300006846 Bacteria 17480
139 Ga0075431_100002633 3300006847 Bacteria 17355
140 Ga0075434_100120747 3300006871 Bacteria 2636
141 Ga0075429_100005321 3300006880 Bacteria 11079
142 Ga0075429_100217633 3300006880 Bacteria 1673
143 Ga0068865_100091338 3300006881 Bacteria 2209
144 Ga0068865_100623422 3300006881 Bacteria 914
145 Ga0075436_100066545 3300006914 Bacteria 2490
146 Ga0075436_100265984 3300006914 Bacteria 1223
147 Ga0097620_100398316 3300006931 Bacteria 1472
148 Ga0097620_101949203 3300006931 Bacteria 649
149 Ga0075435_100097133 3300007076 Bacteria 2437
150 Ga0105240_10205272 3300009093 Bacteria 2307
151 Ga0111539_10401260 3300009094 Bacteria 1597
152 Ga0111539_11636840 3300009094 Bacteria 746
153 Ga0105245_10018559 3300009098 Bacteria 6084
154 Ga0105245_10097598 3300009098 Bacteria 2714
155 Ga0105245_10258130 3300009098 Bacteria 1695
156 Ga0105245_10486391 3300009098 Bacteria 1248
157 Ga0105245_11447250 3300009098 Bacteria 737
158 Ga0105247_10192019 3300009101 Bacteria 1368
159 Ga0105247_10646038 3300009101 Bacteria 790
160 Ga0114129_10001569 3300009147 Bacteria 31005
161 Ga0114129_10312053 3300009147 Bacteria 2093
162 Ga0105243_10605593 3300009148 Bacteria 1055
163 Ga0105243_10623216 3300009148 Bacteria 1042
164 Ga0105241_10166250 3300009174 Bacteria 1818
165 Ga0105241_10226543 3300009174 Bacteria 1574
166 Ga0105242_10244439 3300009176 Bacteria 1615
167 Ga0105242_12742442 3300009176 Bacteria 543
168 Ga0105248_10078750 3300009177 Bacteria 3705
169 Ga0105248_11964486 3300009177 Bacteria 664
170 Ga0105238_10023747 3300009551 Bacteria 6249
171 Ga0105238_10878443 3300009551 Bacteria 914
172 Ga0105249_10078389 3300009553 Bacteria 3065
173 Ga0105249_10104596 3300009553 Bacteria 2668
174 Ga0105249_10264401 3300009553 Bacteria 1711
175 Ga0105249_10670663 3300009553 Bacteria 1095
176 Ga0105249_10838177 3300009553 Bacteria 985
177 Ga0105028_112309 3300009993 Bacteria 904
178 Ga0099796_10040471 3300010159 Bacteria 1574
179 Ga0105239_10770055 3300010375 Bacteria 1102
180 Ga0105239_12560140 3300010375 Bacteria 595
181 Ga0105246_10020598 3300011119 Bacteria 4232
182 Ga0105246_10034512 3300011119 Bacteria 3372
183 Ga0157320_1000308 3300012481 Bacteria 1818
184 Ga0157341_1003899 3300012494 Bacteria 1061
185 Ga0157339_1001953 3300012505 Bacteria 1339
186 Ga0157373_11140705 3300013100 Bacteria 586
187 Ga0157370_10188776 3300013104 Bacteria 1913
188 Ga0157370_11061833 3300013104 Bacteria 732
189 Ga0157369_10172796 3300013105 Bacteria 2276
190 Ga0157369_12085429 3300013105 Bacteria 575
191 Ga0157374_10235147 3300013296 Bacteria 1801
192 Ga0157374_10909142 3300013296 Bacteria 898
193 Ga0157378_11383862 3300013297 Bacteria 746
194 Ga0157378_11837503 3300013297 Bacteria 654
195 Ga0163162_10241283 3300013306 Bacteria 1938
196 Ga0163162_11551782 3300013306 Bacteria 755
197 Ga0157372_10148226 3300013307 Bacteria 2706
198 Ga0157372_10179944 3300013307 Bacteria 2447
199 Ga0157372_10476288 3300013307 Bacteria 1455
200 Ga0157372_10497173 3300013307 Bacteria 1422
201 Ga0157372_10597538 3300013307 Bacteria 1286
202 Ga0157372_11009058 3300013307 Bacteria 964
203 Ga0157375_10202460 3300013308 Bacteria 2141
204 Ga0157375_12024999 3300013308 Bacteria 685
205 Ga0163163_10604857 3300014325 Bacteria 1159
206 Ga0157380_10843654 3300014326 Bacteria 937
207 Ga0182008_10197144 3300014497 Bacteria 1023
208 Ga0157377_10039003 3300014745 Bacteria 2626
209 Ga0157377_10506402 3300014745 Bacteria 845
210 Ga0157379_10125714 3300014968 Bacteria 2307
211 Ga0157379_10206745 3300014968 Bacteria 1776
212 Ga0157379_10212292 3300014968 Bacteria 1752
213 Ga0157379_10725004 3300014968 Bacteria 934
214 Ga0157379_11529582 3300014968 Bacteria 650
215 Ga0157376_11584318 3300014969 Bacteria 689
216 Ga0163161_10079551 3300017792 Bacteria 2410
217 Ga0206356_11814867 3300020070 Bacteria 2627
218 Ga0206354_10641417 3300020081 Bacteria 1789
219 Ga0213875_10008590 3300021388 Bacteria 5220
220 Ga0213875_10150826 3300021388 Bacteria 1089
221 Ga0207653_10005339 3300025885 Bacteria 4015
222 Ga0207692_10033785 3300025898 Bacteria 2471
223 Ga0207692_10151324 3300025898 Bacteria 1329
224 Ga0207642_10817141 3300025899 Bacteria 594
225 Ga0207642_10906420 3300025899 Bacteria 565
226 Ga0207688_10045916 3300025901 Bacteria 2438
227 Ga0207688_10080283 3300025901 Bacteria 1862
228 Ga0207688_10216207 3300025901 Bacteria 1153
229 Ga0207647_10065359 3300025904 Bacteria 2208
230 Ga0207647_10071626 3300025904 Bacteria 2091
231 Ga0207699_10035332 3300025906 Bacteria 2843
232 Ga0207699_10077768 3300025906 Bacteria 2048
233 Ga0207645_10054576 3300025907 Bacteria 2552
234 Ga0207645_10898946 3300025907 Bacteria 601
235 Ga0207643_10049315 3300025908 Bacteria 2386
236 Ga0207705_10291527 3300025909 Bacteria 1250
237 Ga0207705_10376529 3300025909 Bacteria 1096
238 Ga0207654_11141187 3300025911 Bacteria 568
239 Ga0207693_10179824 3300025915 Bacteria 1664
240 Ga0207663_10018650 3300025916 Bacteria 3893
241 Ga0207663_10089606 3300025916 Bacteria 2037
242 Ga0207660_10988948 3300025917 Bacteria 686
243 Ga0207662_10009420 3300025918 Bacteria 5374
244 Ga0207662_10434467 3300025918 Bacteria 895
245 Ga0207657_10006571 3300025919 Bacteria 12042
246 Ga0207657_10142647 3300025919 Bacteria 1956
247 Ga0207649_10253628 3300025920 Bacteria 1268
248 Ga0207649_10587485 3300025920 Bacteria 855
249 Ga0207649_11219064 3300025920 Bacteria 595
250 Ga0207652_10558377 3300025921 Bacteria 1028
251 Ga0207646_10734864 3300025922 Bacteria 881
252 Ga0207681_10065583 3300025923 Bacteria 2511
253 Ga0207681_10236556 3300025923 Bacteria 1420
254 Ga0207694_10544142 3300025924 Bacteria 974
255 Ga0207694_10617487 3300025924 Bacteria 912
256 Ga0207650_10314680 3300025925 Bacteria 1281
257 Ga0207650_10830481 3300025925 Bacteria 784
258 Ga0207650_11305686 3300025925 Bacteria 618
259 Ga0207659_10035704 3300025926 Bacteria 3439
260 Ga0207659_10162806 3300025926 Bacteria 1753
261 Ga0207687_10089049 3300025927 Bacteria 2246
262 Ga0207687_10130223 3300025927 Bacteria 1895
263 Ga0207687_10321848 3300025927 Bacteria 1252
264 Ga0207687_10343797 3300025927 Bacteria 1214
265 Ga0207700_10091384 3300025928 Bacteria 2404
266 Ga0207700_10094770 3300025928 Bacteria 2366
267 Ga0207700_10912054 3300025928 Bacteria 786
268 Ga0207700_10998145 3300025928 Bacteria 749
269 Ga0207664_10013247 3300025929 Bacteria 5910
270 Ga0207664_10021185 3300025929 Bacteria 4829
271 Ga0207664_10067283 3300025929 Bacteria 2874
272 Ga0207664_10120661 3300025929 Bacteria 2193
273 Ga0207664_10558512 3300025929 Bacteria 1027
274 Ga0207644_10834928 3300025931 Bacteria 771
275 Ga0207706_10061213 3300025933 Bacteria 3315
276 Ga0207706_10185342 3300025933 Bacteria 1828
277 Ga0207709_10040285 3300025935 Bacteria 2796
278 Ga0207709_10367046 3300025935 Bacteria 1091
279 Ga0207670_10327097 3300025936 Bacteria 1208
280 Ga0207670_11263524 3300025936 Bacteria 626
281 Ga0207669_10450389 3300025937 Bacteria 1020
282 Ga0207669_11592405 3300025937 Bacteria 557
283 Ga0207704_10457414 3300025938 Bacteria 1020
284 Ga0207665_10088785 3300025939 Bacteria 2140
285 Ga0207665_10157204 3300025939 Bacteria 1633
286 Ga0207691_10012460 3300025940 Bacteria 8154
287 Ga0207691_10446556 3300025940 Bacteria 1101
288 Ga0207711_10070924 3300025941 Bacteria 3022
289 Ga0207689_10003284 3300025942 Bacteria 14822
290 Ga0207689_10113692 3300025942 Bacteria 2225
291 Ga0207689_10215981 3300025942 Bacteria 1585
292 Ga0207661_10049090 3300025944 Bacteria 3358
293 Ga0207661_10582550 3300025944 Bacteria 1026
294 Ga0207661_11333440 3300025944 Bacteria 659
295 Ga0207679_10129882 3300025945 Bacteria 2019
296 Ga0207679_10626234 3300025945 Bacteria 971
297 Ga0207679_10796453 3300025945 Bacteria 861
298 Ga0207679_10888380 3300025945 Bacteria 815
299 Ga0207667_10534903 3300025949 Bacteria 1186
300 Ga0207712_10141954 3300025961 Bacteria 1844
301 Ga0207712_10197285 3300025961 Bacteria 1593
302 Ga0207668_10057721 3300025972 Bacteria 2709
303 Ga0207668_10070792 3300025972 Bacteria 2489
304 Ga0207640_10336721 3300025981 Bacteria 1207
305 Ga0207658_10089104 3300025986 Bacteria 2388
306 Ga0207658_10236113 3300025986 Bacteria 1546
307 Ga0207658_10361991 3300025986 Bacteria 1266
308 Ga0207677_10009927 3300026023 Bacteria 5368
309 Ga0207677_10075987 3300026023 Bacteria 2390
310 Ga0207677_10729685 3300026023 Bacteria 881
311 Ga0207703_10161248 3300026035 Bacteria 1964
312 Ga0207703_10546636 3300026035 Bacteria 1092
313 Ga0207639_10091369 3300026041 Bacteria 2437
314 Ga0207678_10010287 3300026067 Bacteria 8211
315 Ga0207678_10365084 3300026067 Bacteria 1246
316 Ga0207678_10614245 3300026067 Bacteria 954
317 Ga0207708_10003939 3300026075 Bacteria 10927
318 Ga0207708_10025161 3300026075 Bacteria 4502
319 Ga0207702_10016590 3300026078 Bacteria 6095
320 Ga0207702_10228764 3300026078 Bacteria 1737
321 Ga0207702_10613298 3300026078 Bacteria 1068
322 Ga0207641_10005229 3300026088 Bacteria 11103
323 Ga0207641_10067896 3300026088 Bacteria 3056
324 Ga0207641_10140888 3300026088 Bacteria 2176
325 Ga0207676_10249335 3300026095 Bacteria 1597
326 Ga0207676_10510286 3300026095 Bacteria 1143
327 Ga0207674_10004274 3300026116 Bacteria 17218
328 Ga0207674_10064578 3300026116 Bacteria 3692
329 Ga0207674_10097574 3300026116 Bacteria 2923
330 Ga0207675_100975272 3300026118 Bacteria 865
331 Ga0207683_10014494 3300026121 Bacteria 6712
332 Ga0207683_10343745 3300026121 Bacteria 1369
333 Ga0207683_10482375 3300026121 Bacteria 1144
334 Ga0207683_10574146 3300026121 Bacteria 1043
335 Ga0207683_10594078 3300026121 Bacteria 1024
336 Ga0207698_10263870 3300026142 Bacteria 1584
337 Ga0207698_10308533 3300026142 Bacteria 1476
338 Ga0207698_10567420 3300026142 Bacteria 1115
339 Ga0207698_10590596 3300026142 Bacteria 1094
340 Ga0207698_11176396 3300026142 Bacteria 781
341 Ga0207428_10178284 3300027907 Bacteria 1606
342 Ga0268266_10273121 3300028379 Bacteria 1570
343 Ga0268266_10427483 3300028379 Bacteria 1256
344 Ga0268265_10591121 3300028380 Bacteria 1059
345 Ga0268264_10099359 3300028381 Bacteria 2525
346 Ga0268264_11642172 3300028381 Bacteria 653
347 Ga0307517_10078795 3300028786 Bacteria 2844
348 Ga0307517_10147816 3300028786 Bacteria 1623
349 Ga0307517_10268775 3300028786 Bacteria 983
350 Ga0307515_10014225 3300028794 Bacteria 14785
351 Ga0307515_10026738 3300028794 Bacteria 9910
352 Ga0307515_10057662 3300028794 Bacteria 5616
353 Ga0307515_10076245 3300028794 Bacteria 4453
354 Ga0307515_10688595 3300028794 Bacteria 637
355 Ga0307511_10139131 3300030521 Bacteria 1433
356 Ga0307511_10258030 3300030521 Bacteria 829
357 Ga0307512_10005920 3300030522 Bacteria 12566
358 Ga0307512_10017028 3300030522 Bacteria 6687
359 Ga0307512_10022251 3300030522 Bacteria 5701
360 Ga0307512_10039021 3300030522 Bacteria 3984
361 Ga0307513_10019232 3300031456 Bacteria 8134
362 Ga0307513_10197716 3300031456 Bacteria 1855
363 Ga0307509_10032515 3300031507 Bacteria 5748
364 Ga0307509_10056785 3300031507 Bacteria 4154
365 Ga0307408_100072841 3300031548 Bacteria 2544
366 Ga0307408_101122779 3300031548 Bacteria 730
367 Ga0307408_101309660 3300031548 Bacteria 679
368 Ga0307508_10002620 3300031616 Bacteria 18894
369 Ga0307508_10003217 3300031616 Bacteria 16699
370 Ga0307508_10051989 3300031616 Bacteria 3641
371 Ga0307508_10143359 3300031616 Bacteria 1993
372 Ga0307508_10163425 3300031616 Bacteria 1830
373 Ga0307508_10465761 3300031616 Bacteria 857
374 Ga0307508_10817637 3300031616 Bacteria 550
375 Ga0307514_10446923 3300031649 Bacteria 637
376 Ga0307516_10011683 3300031730 Bacteria 9528
377 Ga0307516_10031393 3300031730 Bacteria 5354
378 Ga0307516_10157059 3300031730 Bacteria 2028
379 Ga0307405_10003449 3300031731 Bacteria 7262
380 Ga0307405_10309520 3300031731 Bacteria 1202
381 Ga0307405_10333048 3300031731 Bacteria 1164
382 Ga0307405_10589693 3300031731 Bacteria 905
383 Ga0307405_11781320 3300031731 Bacteria 547
384 Ga0307413_10008086 3300031824 Bacteria 4938
385 Ga0307413_10185614 3300031824 Bacteria 1488
386 Ga0307413_10350011 3300031824 Bacteria 1140
387 Ga0307413_10513010 3300031824 Bacteria 965
388 Ga0307413_10666433 3300031824 Bacteria 860
389 Ga0307413_11578791 3300031824 Bacteria 582
390 Ga0307410_10039193 3300031852 Bacteria 3109
391 Ga0307410_10114573 3300031852 Bacteria 1956
392 Ga0307410_10191867 3300031852 Bacteria 1554
393 Ga0307406_10001217 3300031901 Bacteria 14403
394 Ga0307406_10022249 3300031901 Bacteria 3759
395 Ga0307407_10101889 3300031903 Bacteria 1784
396 Ga0307412_10096609 3300031911 Bacteria 2080
397 Ga0307412_10652425 3300031911 Bacteria 898
398 Ga0307409_100007503 3300031995 Bacteria 6533
399 Ga0307409_100014459 3300031995 Bacteria 5135
400 Ga0307409_100147555 3300031995 Bacteria 2036
401 Ga0307409_100229830 3300031995 Bacteria 1681
402 Ga0307409_101405089 3300031995 Bacteria 724
403 Ga0307409_101529572 3300031995 Bacteria 695
404 Ga0307409_101746244 3300031995 Bacteria 651
405 Ga0307416_100005854 3300032002 Bacteria 7624
406 Ga0307416_100766213 3300032002 Bacteria 1059
407 Ga0307416_100784275 3300032002 Bacteria 1048
408 Ga0307416_101427096 3300032002 Bacteria 798
409 Ga0307416_101429754 3300032002 Bacteria 797
410 Ga0307414_10053049 3300032004 Bacteria 2826
411 Ga0307414_10230000 3300032004 Bacteria 1528
412 Ga0307411_10097674 3300032005 Bacteria 2068
413 Ga0307411_11140329 3300032005 Bacteria 704
414 Ga0307415_100009542 3300032126 Bacteria 5447
415 Ga0307415_100053125 3300032126 Bacteria 2759
416 Ga0307415_100072496 3300032126 Bacteria 2426
417 Ga0307415_100152529 3300032126 Bacteria 1780
418 Ga0307415_100265113 3300032126 Bacteria 1404
419 Ga0307507_10071080 3300033179 Bacteria 3150
420 Ga0307507_10456266 3300033179 Bacteria 704
421 Ga0307510_10180942 3300033180 Bacteria 1671
422 Ga0373948_0005533 3300034817 Bacteria 2053
423 Ga0373959_0075476 3300034820 Bacteria 769
424 Ga0373938_0019014 3300034957 Bacteria 1370
425 Ga0373928_0179052 3300035084 Bacteria 601
426 Ga0373934_0023758 3300035086 Bacteria 2369
427 Ga0373934_0214613 3300035086 Bacteria 793
428 Ga0373940_0020426 3300035088 Bacteria 1683
429 Ga0373940_0032342 3300035088 Bacteria 1401
430 Ga0373944_0002054 3300035089 Bacteria 5103
431 Ga0373951_0000371 3300035091 Bacteria 13553
432 Ga0373951_0082008 3300035091 Bacteria 836
433 Ga0373952_0040997 3300035092 Bacteria 1070
434 Ga0373923_0013501 3300035111 Bacteria 3046
435 Ga0373932_0012209 3300035112 Bacteria 2112
436 Ga0373936_0001005 3300035113 Bacteria 10065
437 Ga0373936_0040596 3300035113 Bacteria 1864
438 Ga0373939_0055489 3300035114 Bacteria 1244
439 Ga0373939_0247135 3300035114 Bacteria 693
440 Ga0373941_0127054 3300035115 Bacteria 915
441 Ga0373941_0161722 3300035115 Bacteria 828
442 Ga0373945_0000810 3300035116 Bacteria 9161
443 Ga0373945_0029215 3300035116 Bacteria 1935
444 Ga0373945_0139483 3300035116 Bacteria 976
445 Ga0373953_0089847 3300035117 Bacteria 1284
446 Ga0373954_0092796 3300035118 Bacteria 1451
447 Ga0373956_0347096 3300035119 Bacteria 707
448 Ga0373943_0098315 3300035170 Bacteria 1526
449 Ga0373943_0132376 3300035170 Bacteria 1335
450 Ga0373946_0004490 3300035171 Bacteria 4996
451 Ga0373946_0080178 3300035171 Bacteria 1427
452 Ga0373955_0028107 3300035172 Bacteria 2913
453 Ga0373955_0125071 3300035172 Bacteria 1497
454 Ga0373955_0167705 3300035172 Bacteria 1298
455 Ga0373942_0000152 3300035207 Bacteria 16622
456 Ga0373942_0070451 3300035207 Bacteria 1020
457 Ga0373961_0021763 3300035241 Bacteria 1709
458 Ga0373962_0004288 3300035242 Bacteria 3444
459 Ga0373962_0039808 3300035242 Bacteria 1320
460 Ga0316574_0026378 3300035398 Bacteria 3493
461 Ga0316574_0290084 3300035398 Bacteria 1041
462 Ga0373924_0015710 3300035410 Bacteria 2881
463 Ga0373924_0050644 3300035410 Bacteria 1720
464 Ga0373931_0020989 3300035691 Bacteria 3272
465 Ga0373931_0266365 3300035691 Bacteria 1047
466 Ga0373931_0760689 3300035691 Bacteria 644
467 Ga0373935_0003808 3300035692 Bacteria 8806
468 Ga0373935_0092942 3300035692 Bacteria 1977
469 Ga0373935_0212380 3300035692 Bacteria 1341
470 Ga0373935_0688353 3300035692 Bacteria 751
471 Ga0373927_0020474 3300035695 Bacteria 4337
472 Ga0373927_0022250 3300035695 Bacteria 4153
473 Ga0373933_0027924 3300035724 Bacteria 3253
474 Ga0373933_0143947 3300035724 Bacteria 1506
475 Ga0373933_0758348 3300035724 Bacteria 638
476 Ga0373947_0003093 3300035725 Bacteria 9913
477 Ga0373937_0097794 3300036401 Bacteria 2722
478 Ga0373937_0098762 3300036401 Bacteria 2708
479 Ga0372808_013772 3300036459 Bacteria 1153
480 Ga0373925_0256178 3300037068 Bacteria 1404
481 Ga0395900_1146583 3300037418 Bacteria 694
482 Ga0395898_0096517 3300037466 Bacteria 2840
483 Ga0436364_0059219 3300037853 Bacteria 1359
484 Ga0436364_0463455 3300037853 Bacteria 3489
485 Ga0436364_0967897 3300037853 Bacteria 8258
486 Ga0395901_0105994 3300038443 Bacteria 2950
487 Ga0400483_286613 3300039062 Bacteria 4781
488 Ga0436365_1545022 3300039437 Bacteria 810
489 Ga0436363_0687920 3300039450 Bacteria 635
490 Ga0451789_0444322 3300041443 Bacteria 2599
491 Ga0451791_1439624 3300041451 Bacteria 1354
492 Ga0451793_1906183 3300041452 Bacteria 4236
493 Ga0451837_0072343 3300041494 Bacteria 1062
494 Ga0451843_1174054 3300041509 Bacteria 795
495 Ga0451853_2374562 3300041512 Bacteria 853
496 Ga0439463_080027 3300042016 Bacteria 840
497 Ga0466969_0001307 3300044656 Bacteria 13420
498 Ga0466969_0052833 3300044656 Bacteria 1995
499 Ga0466969_0157359 3300044656 Bacteria 1045
500 Ga0466966_0007574 3300044684 Bacteria 7192
501 Ga0466966_0033264 3300044684 Bacteria 3338
502 Ga0466971_0000689 3300044719 Bacteria 13519
503 Ga0466970_0014607 3300044765 Bacteria 4033
504 Ga0466970_0243869 3300044765 Bacteria 1006
505 Ga0466957_0216347 3300044842 Bacteria 1264
506 Ga0466957_0222345 3300044842 Bacteria 1247
507 Ga0466957_0456150 3300044842 Bacteria 881
508 Ga0466960_0136205 3300044901 Bacteria 1300
509 Ga0466959_0001910 3300045049 Bacteria 13108
510 Ga0466959_0010087 3300045049 Bacteria 6736
511 Ga0466958_0034614 3300045836 Bacteria 3014
512 Ga0466967_0022798 3300045976 Bacteria 5119
513 Ga0466967_0040767 3300045976 Bacteria 3999
514 Ga0466967_0518550 3300045976 Bacteria 1171
515 Ga0466967_1555098 3300045976 Bacteria 659
516 Ga0495592_0058909 3300046454 Bacteria 2830
517 Ga0495592_0100191 3300046454 Bacteria 2066
518 Ga0495592_0327403 3300046454 Bacteria 988
519 Ga0495592_0420778 3300046454 Bacteria 842
520 Ga0495603_0209235 3300046455 Bacteria 1126
521 Ga0495603_0544640 3300046455 Bacteria 664
522 Ga0495629_0301801 3300046459 Bacteria 1097
523 Ga0495629_0308940 3300046459 Bacteria 1082
524 Ga0495638_0300799 3300046460 Bacteria 864
525 Ga0495641_0029319 3300046461 Bacteria 2652
526 Ga0495641_0315867 3300046461 Bacteria 705
527 Ga0495651_0000405 3300046462 Bacteria 33331
528 Ga0495651_0013939 3300046462 Bacteria 6216
529 Ga0495651_0075538 3300046462 Bacteria 2554
530 Ga0495651_0090423 3300046462 Bacteria 2296
531 Ga0495651_0160001 3300046462 Bacteria 1614
532 Ga0495651_0451519 3300046462 Bacteria 830
533 Ga0495653_0006045 3300046463 Bacteria 9912
534 Ga0495653_0011270 3300046463 Bacteria 7306
535 Ga0495653_0013551 3300046463 Bacteria 6645
536 Ga0495653_0107397 3300046463 Bacteria 2011
537 Ga0495653_0159293 3300046463 Bacteria 1568
538 Ga0495650_0056882 3300046471 Bacteria 1585
539 Ga0495580_0005058 3300046472 Bacteria 10992
540 Ga0495580_0151518 3300046472 Bacteria 1606
541 Ga0495582_0382542 3300046473 Bacteria 811
542 Ga0495639_0026978 3300046475 Bacteria 2541
543 Ga0495639_0114505 3300046475 Bacteria 1282
544 Ga0495662_0004185 3300046476 Bacteria 7268
545 Ga0495662_0006172 3300046476 Bacteria 5990
546 Ga0495664_0000745 3300046477 Bacteria 16653
547 Ga0495664_0001527 3300046477 Bacteria 12255
548 Ga0495664_0041249 3300046477 Bacteria 2730
549 Ga0495664_0136782 3300046477 Bacteria 1485
550 Ga0495664_0439908 3300046477 Bacteria 781
551 Ga0495664_0499466 3300046477 Bacteria 726
552 Ga0495585_0023340 3300046492 Bacteria 3550
553 Ga0495608_0000431 3300046511 Bacteria 29189
554 Ga0495608_0078506 3300046511 Bacteria 2147
555 Ga0495608_0127813 3300046511 Bacteria 1627
556 Ga0495608_0240078 3300046511 Bacteria 1132
557 Ga0495618_0064778 3300046514 Bacteria 2322
558 Ga0495618_0068246 3300046514 Bacteria 2261
559 Ga0495618_0088579 3300046514 Bacteria 1979
560 Ga0495618_0195845 3300046514 Bacteria 1280
561 Ga0495618_0219780 3300046514 Bacteria 1199
562 Ga0495618_0635205 3300046514 Bacteria 633
563 Ga0495628_0017144 3300046516 Bacteria 6033
564 Ga0495628_0149694 3300046516 Bacteria 1778
565 Ga0495628_0187568 3300046516 Bacteria 1562
566 Ga0495630_0407635 3300046517 Bacteria 1041
567 Ga0495666_0066344 3300046526 Bacteria 1720
568 Ga0495666_0199341 3300046526 Bacteria 920
569 Ga0495652_0006521 3300046529 Bacteria 10850
570 Ga0495652_0070028 3300046529 Bacteria 2934
571 Ga0495652_0100903 3300046529 Bacteria 2340
572 Ga0495652_0118080 3300046529 Bacteria 2120
573 Ga0495652_0185953 3300046529 Bacteria 1589
574 Ga0495652_0188998 3300046529 Bacteria 1573
575 Ga0495665_0052942 3300046531 Bacteria 2148
576 Ga0495665_0117299 3300046531 Bacteria 1394
577 Ga0495640_0029937 3300046533 Bacteria 3901
578 Ga0495640_0256905 3300046533 Bacteria 1092
579 Ga0495640_0281541 3300046533 Bacteria 1035
580 Ga0495640_0546963 3300046533 Bacteria 702
581 Ga0495586_0318085 3300046535 Bacteria 892
582 Ga0495586_0519520 3300046535 Bacteria 687
583 Ga0495587_0016509 3300046536 Bacteria 4592
584 Ga0495587_0019470 3300046536 Bacteria 4199
585 Ga0495587_0260782 3300046536 Bacteria 973
586 Ga0495587_0265335 3300046536 Bacteria 964
587 Ga0495645_0010765 3300046543 Bacteria 6425
588 Ga0495645_0047000 3300046543 Bacteria 3145
589 Ga0495645_0104243 3300046543 Bacteria 2014
590 Ga0495645_0194716 3300046543 Bacteria 1379
591 Ga0495667_0003511 3300046559 Bacteria 10519
592 Ga0495667_0014710 3300046559 Bacteria 5288
593 Ga0495667_0036911 3300046559 Bacteria 3258
594 Ga0495667_0132197 3300046559 Bacteria 1609
595 Ga0495667_0261102 3300046559 Bacteria 1101
596 Ga0495667_0461491 3300046559 Bacteria 797
597 Ga0495667_0508361 3300046559 Bacteria 754
598 Ga0495634_0073127 3300046642 Bacteria 2254
599 Ga0495634_0155191 3300046642 Bacteria 1445
600 Ga0495634_0232856 3300046642 Bacteria 1132
601 Ga0495634_0407808 3300046642 Bacteria 806
602 Ga0495634_0521400 3300046642 Bacteria 695
603 Ga0495634_0562614 3300046642 Bacteria 664
604 Ga0495635_0003994 3300046663 Bacteria 10250
605 Ga0495635_0009208 3300046663 Bacteria 6898
606 Ga0495635_0050515 3300046663 Bacteria 2866
607 Ga0495635_0058901 3300046663 Bacteria 2641
608 Ga0495635_0659190 3300046663 Bacteria 680
609 Ga0495588_0364945 3300046674 Bacteria 759
610 Ga0495657_0001154 3300046675 Bacteria 23164
611 Ga0495657_0105121 3300046675 Bacteria 1794
612 Ga0495657_0117485 3300046675 Bacteria 1678
613 Ga0495657_0307401 3300046675 Bacteria 944
614 Ga0495657_0383718 3300046675 Bacteria 829
615 Ga0495599_0022538 3300046678 Bacteria 3933
616 Ga0495599_0038651 3300046678 Bacteria 2998
617 Ga0495599_0261807 3300046678 Bacteria 1050
618 Ga0495599_0419636 3300046678 Bacteria 795
619 Ga0495623_0054028 3300046679 Bacteria 2535
620 Ga0495623_0057366 3300046679 Bacteria 2449
621 Ga0495623_0284564 3300046679 Bacteria 918
622 Ga0495623_0376069 3300046679 Bacteria 769
623 Ga0495623_0517301 3300046679 Bacteria 628
624 Ga0495646_0024112 3300046680 Bacteria 3831
625 Ga0495646_0038869 3300046680 Bacteria 2935
626 Ga0495646_0094283 3300046680 Bacteria 1723
627 Ga0495658_0024522 3300046683 Bacteria 3214
628 Ga0495613_0003259 3300046689 Bacteria 12139
629 Ga0495624_0029094 3300046690 Bacteria 3606
630 Ga0495624_0229135 3300046690 Bacteria 1125
631 Ga0495649_0305138 3300046694 Bacteria 810
632 Ga0495600_0011040 3300046809 Bacteria 5621
633 Ga0495600_0150905 3300046809 Bacteria 1504
634 Ga0495600_0152173 3300046809 Bacteria 1497
635 Ga0495600_0396599 3300046809 Bacteria 859
636 Ga0495600_0581878 3300046809 Bacteria 682
637 Ga0495581_0004922 3300047315 Bacteria 7728
638 Ga0495581_0156201 3300047315 Bacteria 1333
639 Ga0495581_0404344 3300047315 Bacteria 796
640 Ga0495604_0000492 3300047317 Bacteria 34661
641 Ga0495604_0119296 3300047317 Bacteria 1911
642 Ga0495604_0195783 3300047317 Bacteria 1405
643 Ga0495604_0332429 3300047317 Bacteria 1013
644 Ga0495674_0005651 3300047319 Bacteria 11977
645 Ga0495674_0074284 3300047319 Bacteria 2928
646 Ga0495674_0132379 3300047319 Bacteria 2100
647 Ga0495674_0442565 3300047319 Bacteria 1045
648 Ga0495676_0004827 3300047321 Bacteria 12361
649 Ga0495680_0009063 3300047322 Bacteria 8985
650 Ga0495680_0010693 3300047322 Bacteria 8183
651 Ga0495680_0162876 3300047322 Bacteria 1618
652 Ga0495675_0108524 3300047444 Bacteria 1733
653 Ga0495675_0144843 3300047444 Bacteria 1471
654 Ga0495684_0046062 3300047471 Bacteria 3337
655 Ga0495684_0121751 3300047471 Bacteria 1964
656 Ga0495684_0260351 3300047471 Bacteria 1258
657 Ga0495684_0337450 3300047471 Bacteria 1073
658 Ga0495593_0034588 3300047673 Bacteria 2747
659 Ga0495593_0134907 3300047673 Bacteria 1252
660 Ga0495593_0142423 3300047673 Bacteria 1214
661 Ga0495602_0051310 3300048088 Bacteria 3674
662 Ga0495602_0100208 3300048088 Bacteria 2379
663 Ga0495602_0105002 3300048088 Bacteria 2310
664 Ga0495614_0033792 3300048089 Bacteria 2199
665 Ga0496100_0002440 3300048903 Bacteria 9424
666 Ga0496100_1433529 3300048903 Bacteria 545
667 Ga0496101_0002674 3300048904 Bacteria 10939
668 Ga0496101_0388120 3300048904 Bacteria 1099
669 Ga0496101_0900381 3300048904 Bacteria 697
670 Ga0496102_0000147 3300048905 Bacteria 96295
671 Ga0496102_0049087 3300048905 Bacteria 3838
672 Ga0496102_0144993 3300048905 Bacteria 2228
673 Ga0496102_0513147 3300048905 Bacteria 1121
674 Ga0496102_1229486 3300048905 Bacteria 668
675 Ga0496103_0000261 3300048906 Bacteria 50634
676 Ga0496104_0028477 3300048907 Bacteria 5178
677 Ga0496104_0093449 3300048907 Bacteria 2877
678 Ga0496104_0596379 3300048907 Bacteria 1015
679 Ga0496104_0773714 3300048907 Bacteria 866
680 Ga0496105_0019842 3300048908 Bacteria 5424
681 Ga0496105_0037598 3300048908 Bacteria 3986
682 Ga0496105_0045106 3300048908 Bacteria 3637
683 Ga0496105_0540032 3300048908 Bacteria 911
684 Ga0496106_0277091 3300048909 Bacteria 1343
685 Ga0496107_0205881 3300048910 Bacteria 1462
686 Ga0496107_0316413 3300048910 Bacteria 1162
687 Ga0496107_0586482 3300048910 Bacteria 824
688 Ga0496108_0000418 3300048911 Bacteria 34816
689 Ga0496108_0134684 3300048911 Bacteria 2124
690 Ga0496108_0166642 3300048911 Bacteria 1905
691 Ga0496109_0163086 3300048912 Bacteria 2088
692 Ga0496109_0284669 3300048912 Bacteria 1558
693 Ga0496109_0474566 3300048912 Bacteria 1181
694 Ga0496109_0775991 3300048912 Bacteria 896
695 Ga0496110_0037383 3300048913 Bacteria 4220
696 Ga0496110_0158883 3300048913 Bacteria 2048
697 Ga0496110_0514397 3300048913 Bacteria 1089
698 Ga0496111_0060195 3300048914 Bacteria 2752
699 Ga0496111_0248373 3300048914 Bacteria 1321
700 Ga0496112_0642281 3300048915 Bacteria 991
701 Ga0496113_0148331 3300048916 Bacteria 1849
702 Ga0496113_0155667 3300048916 Bacteria 1804
703 Ga0496114_0002172 3300048917 Bacteria 14936
704 Ga0496114_0003886 3300048917 Bacteria 11518
705 Ga0496114_0050779 3300048917 Bacteria 3452
706 Ga0496114_0181625 3300048917 Bacteria 1837
707 Ga0496114_0463974 3300048917 Bacteria 1121
708 Ga0496115_0158234 3300048918 Bacteria 1872
709 Ga0496115_0366547 3300048918 Bacteria 1173
710 Ga0496116_0000425 3300048919 Bacteria 59407
711 Ga0496117_0000274 3300048920 Bacteria 96150
712 Ga0496118_0000602 3300048921 Bacteria 59438
713 Ga0496119_0000957 3300048922 Bacteria 37132
714 Ga0496120_0008239 3300048923 Bacteria 7616
715 Ga0496121_0057363 3300048924 Bacteria 3228
716 Ga0496124_0054816 3300048927 Bacteria 3372
717 Ga0496125_0012303 3300048928 Bacteria 8502
718 Ga0496126_0000419 3300048929 Bacteria 85931
719 Ga0496126_0283434 3300048929 Bacteria 1372
720 Ga0496126_0423034 3300048929 Bacteria 1077
721 Ga0501031_0073510 3300049568 Bacteria 2226
722 Ga0501031_0357829 3300049568 Bacteria 945
723 Ga0501032_0192105 3300049569 Bacteria 1334
724 Ga0501032_0466218 3300049569 Bacteria 808
725 Ga0501032_0871417 3300049569 Bacteria 567
726 Ga0501033_0021747 3300049570 Bacteria 4841
727 Ga0501033_0133444 3300049570 Bacteria 1797
728 Ga0501033_0573202 3300049570 Bacteria 776
729 Ga0501036_0037640 3300049572 Bacteria 4092
730 Ga0501036_0310307 3300049572 Bacteria 1319
731 Ga0501036_0326942 3300049572 Bacteria 1281
732 Ga0501036_1253173 3300049572 Bacteria 603
733 Ga0501037_0042754 3300049573 Bacteria 3330
734 Ga0501037_0058261 3300049573 Bacteria 2819
735 Ga0501038_0017635 3300049574 Bacteria 6452
736 Ga0501038_0500144 3300049574 Bacteria 929
737 Ga0501038_0998672 3300049574 Bacteria 614
738 Ga0501039_0009026 3300049575 Bacteria 7596
739 Ga0501039_0039192 3300049575 Bacteria 3660
740 Ga0501039_0410704 3300049575 Bacteria 1063
741 Ga0501040_0069482 3300049576 Bacteria 2429
742 Ga0501040_0154560 3300049576 Bacteria 1620
743 Ga0501041_0019691 3300049577 Bacteria 4032
744 Ga0501041_0142411 3300049577 Bacteria 1495
745 Ga0501042_0117316 3300049578 Bacteria 1916
746 Ga0501042_0189325 3300049578 Bacteria 1484
747 Ga0501043_0156203 3300049579 Bacteria 1784
748 Ga0501043_0162373 3300049579 Bacteria 1745
749 Ga0501043_0387615 3300049579 Bacteria 1057
750 Ga0501043_0448114 3300049579 Bacteria 970
751 Ga0501046_0014581 3300049580 Bacteria 6624
752 Ga0501046_0026166 3300049580 Bacteria 4766
753 Ga0501046_0088918 3300049580 Bacteria 2378
754 Ga0501046_0877366 3300049580 Bacteria 626
755 Ga0501047_0063580 3300049581 Bacteria 3560
756 Ga0501047_0110688 3300049581 Bacteria 2629
757 Ga0501048_0004968 3300049582 Bacteria 10147
758 Ga0501067_0100823 3300049583 Bacteria 1604
759 Ga0501067_0540024 3300049583 Bacteria 653
760 Ga0501068_0042422 3300049584 Bacteria 2736
761 Ga0501070_0897781 3300049586 Bacteria 691
762 Ga0501071_0102894 3300049587 Bacteria 2106
763 Ga0501072_0010531 3300049588 Bacteria 7040
764 Ga0501072_0139873 3300049588 Bacteria 1930
765 Ga0501073_0161030 3300049589 Bacteria 1555
766 Ga0501075_0012160 3300049591 Bacteria 6111
767 Ga0501076_0068378 3300049592 Bacteria 2837
768 Ga0501076_0269725 3300049592 Bacteria 1393
769 Ga0501077_0341395 3300049593 Bacteria 955
770 Ga0501079_0335389 3300049741 Bacteria 1184
771 Ga0501080_0936976 3300049742 Bacteria 753
772 Ga0501081_0041917 3300049743 Bacteria 3136
773 Ga0501035_0042721 3300049822 Bacteria 4088
774 Ga0501035_0240625 3300049822 Bacteria 1539
775 Ga0501035_0545952 3300049822 Bacteria 950
776 Ga0501044_0747312 3300049823 Bacteria 860
777 Ga0501044_0778102 3300049823 Bacteria 837
778 Ga0501045_0013683 3300049824 Bacteria 5735
779 Ga0501045_0055604 3300049824 Bacteria 2894
780 Ga0501045_0381442 3300049824 Bacteria 1049
781 nmdc:mga03n38_119743_c1 3300050490 Bacteria 1292
782 nmdc:mga03n38_508189_c1 3300050490 Bacteria 677
783 nmdc:mga00v17_72724_c1 3300050491 Bacteria 2133
784 nmdc:mga05p37_35185_c1 3300050507 Bacteria 6140
785 nmdc:mga09592_16039_c1 3300050508 Bacteria 6125
786 nmdc:mga09592_176038_c1 3300050508 Bacteria 1850
787 nmdc:mga09592_195263_c1 3300050508 Bacteria 1752
788 nmdc:mga0qj67_2330_c1 3300050509 Bacteria 13500
789 nmdc:mga06r32_13370_c1 3300050510 Bacteria 7434
790 nmdc:mga06r32_398_c4 3300050510 Bacteria 11026
791 nmdc:mga06r32_421140_c1 3300050510 Bacteria 1316
792 nmdc:mga08y16_1330028_c1 3300050511 Bacteria 684
793 nmdc:mga08y16_294144_c1 3300050511 Bacteria 1674
794 nmdc:mga08y16_320527_c1 3300050511 Bacteria 1596
795 nmdc:mga0n895_1382982_c1 3300050512 Bacteria 673
796 nmdc:mga0rr50_532722_c1 3300050513 Bacteria 1000
797 Ga0495601_0003897 3300053077 Bacteria 8591
798 Ga0495601_0016298 3300053077 Bacteria 4503
799 Ga0495601_0063428 3300053077 Bacteria 2348
800 Ga0495601_0459971 3300053077 Bacteria 822
801 Ga0495612_0002389 3300053078 Bacteria 7741
802 Ga0495612_0068056 3300053078 Bacteria 1481
803 Ga0495612_0187116 3300053078 Bacteria 911
804 Ga0495612_0197704 3300053078 Bacteria 886
805 Ga0495595_0086079 3300053084 Bacteria 1503
806 Ga0495595_0311624 3300053084 Bacteria 792
807 Ga0495619_0193903 3300053085 Bacteria 1406
808 Ga0500644_0005542 3300053088 Bacteria 3192
809 Ga0500644_0068611 3300053088 Bacteria 1271
810 Ga0500644_0185998 3300053088 Bacteria 853
811 Ga0500583_0445195 3300053092 Bacteria 616
812 Ga0500651_0071771 3300053093 Bacteria 2154
813 Ga0500641_0055998 3300053096 Bacteria 1633
814 Ga0500650_0069159 3300053098 Bacteria 1650
815 Ga0500660_168703 3300053100 Bacteria 814
816 Ga0500569_028595 3300053109 Bacteria 1547
817 Ga0500594_0002769 3300053118 Bacteria 3816
818 Ga0500652_199585 3300053131 Bacteria 812
819 Ga0500655_016924 3300053133 Bacteria 1345
820 Ga0500579_162325 3300053143 Bacteria 938
821 Ga0500600_0244098 3300053149 Bacteria 809
822 Ga0500616_0001593 3300053153 Bacteria 21161
823 Ga0500616_0014227 3300053153 Bacteria 4579
824 Ga0500630_173951 3300053159 Bacteria 878
825 Ga0500634_0261412 3300053161 Bacteria 712
826 Ga0501084_0006561 3300054114 Bacteria 9561
827 Ga0501084_0036505 3300054114 Bacteria 4105
828 Ga0501082_0020922 3300060353 Bacteria 5643
829 Ga0501082_0099440 3300060353 Bacteria 2515
830 Ga0466962_0009413 3300061719 Bacteria 4682
831 Ga0530510_0007434 3300061734 Bacteria 7626
832 Ga0530510_0353839 3300061734 Bacteria 1103
833 Ga0530510_0439937 3300061734 Bacteria 985
834 2515854704 2515154155 Bacteria 7985436
835 2558909071 2558860112 Bacteria 9931328
836 2643849734 2643221567 Bacteria 4163945
837 2644135736 2643221624 Bacteria 4384879
838 2676474125 2675903058 Bacteria 6822861
839 2676495804 2675903060 Bacteria 10051191
840 2731906028 2731639228 Bacteria 4187555
841 2753268449 2751185782 Bacteria 11227053
842 2776372367 2775506925 Bacteria 7237746
843 2791916133 2791354901 Bacteria 8322202
844 2816425537 2816332119 Bacteria 8120218
845 2827629016 2827628540 Bacteria 6858585
846 2861521993 2861520306 Bacteria 8348283
847 2863074805 2863067949 Bacteria 8541735
848 2870786244 2870782633 Bacteria 9624083
849 2880498981 2880495981 Bacteria 7340502
850 2891329077 2891326441 Bacteria 6439512
851 2895438576 2895427314 Bacteria 13147766
852 2899363611 2899359706 Bacteria 10940472
853 3006429396 3006425503 Bacteria 6491253
854 8054476398 8054472261 Bacteria 7464355
855 Ga0500568_0000279
856 JGI24740J21852_10039081
857 JGI24737J22298_10025955
858 JGI24735J21928_10066184
859 JGI24735J21928_10151701
860 JGI25406J46586_10006430
861 JGI25406J46586_10047164
862 rootH2_10025380
863 rootH2_10032131
864 Ga0070658_10228614
865 Ga0070676_10123669
866 Ga0070683_100296637
867 Ga0070683_100650643
868 Ga0070683_101167091
869 Ga0070683_101332403
870 Ga0068869_100025111
871 Ga0068869_100199463
872 Ga0068869_100526402
873 Ga0070666_10318144
874 Ga0068868_100013555
875 Ga0068868_100098486
876 Ga0068868_100497572
877 Ga0070660_100556154
878 Ga0070689_100718952
879 Ga0070689_100987152
880 Ga0070691_10034979
881 Ga0070687_100089905
882 Ga0070687_100942635
883 Ga0070661_100020447
884 Ga0070692_10002568
885 Ga0070668_100010835
886 Ga0070668_100480955
887 Ga0070668_100482230
888 Ga0070669_100170917
889 Ga0070669_100459275
890 Ga0070675_100000709
891 Ga0070675_100190516
892 Ga0070671_100068785
893 Ga0070674_100094375
894 Ga0070674_101838188
895 Ga0070673_100870314
896 Ga0070667_100205890
897 Ga0070667_100769267
898 Ga0070709_10143765
899 Ga0070709_10316306
900 Ga0070709_10879298
901 Ga0070714_100023518
902 Ga0070714_100121881
903 Ga0070714_100729056
904 Ga0070710_10034440
905 Ga0070701_10186532
906 Ga0070701_10727975
907 Ga0070711_100906630
908 Ga0070711_101017161
909 Ga0070711_101019916
910 Ga0070700_100005842
911 Ga0070700_100352793
912 Ga0070663_100131697
913 Ga0070663_100238353
914 Ga0070663_100320318
915 Ga0070678_100078774
916 Ga0070678_100174028
917 Ga0070678_100840278
918 Ga0070662_100214900
919 Ga0070685_11064398
920 Ga0070679_100423228
921 Ga0070684_100166028
922 Ga0070684_100220184
923 Ga0070684_100239806
924 Ga0070684_100356396
925 Ga0070684_100817318
926 Ga0070684_101029078
927 Ga0068853_100494232
928 Ga0070672_100222370
929 Ga0070686_100052033
930 Ga0070695_100053227
931 Ga0070696_100155862
932 Ga0070696_100296868
933 Ga0070696_100394244
934 Ga0070665_100075860
935 Ga0070665_100134710
936 Ga0070665_100231308
937 Ga0070665_100488283
938 Ga0070664_100000718
939 Ga0070664_100444024
940 Ga0068857_100007375
941 Ga0068857_100063374
942 Ga0068857_100099474
943 Ga0068854_100038236
944 Ga0068854_100757836
945 Ga0068856_100268986
946 Ga0070702_100113027
947 Ga0070702_100398093
948 Ga0068852_100134269
949 Ga0068852_100407282
950 Ga0068852_100580169
951 Ga0068852_100848862
952 Ga0068859_100398305
953 Ga0068859_101949322
954 Ga0068864_100028185
955 Ga0068864_100120757
956 Ga0068864_100809471
957 Ga0068866_10249620
958 Ga0068866_10251756
959 Ga0068863_100025022
960 Ga0068863_100271312
961 Ga0068863_100404457
962 Ga0068858_100093570
963 Ga0068858_100172930
964 Ga0068858_100338890
965 Ga0068860_100080897
966 Ga0068860_100098427
967 Ga0068860_101741769
968 Ga0068862_100076550
969 Ga0068862_100250669
970 Ga0081455_10028326
971 Ga0081455_10211922
972 Ga0081540_1000058
973 Ga0081540_1021085
974 Ga0081539_10000023
975 Ga0081539_10001040
976 Ga0081539_10006795
977 Ga0081539_10010243
978 Ga0081539_10015448
979 Ga0081539_10120679
980 Ga0070717_10137653
981 Ga0070717_10189101
982 Ga0075368_10084855
983 Ga0075363_100475718
984 Ga0075364_10082107
985 Ga0075364_10125684
986 Ga0070715_10007916
987 Ga0070716_100095811
988 Ga0097621_100102751
989 Ga0068871_100158310
990 Ga0068871_100250138
991 Ga0075428_100000928
992 Ga0075430_100001813
993 Ga0075431_100002633
994 Ga0075434_100120747
995 Ga0075429_100005321
996 Ga0075429_100217633
997 Ga0068865_100091338
998 Ga0068865_100623422
999 Ga0075436_100066545
1000 Ga0075436_100265984
1001 Ga0097620_100398316
1002 Ga0097620_101949203
1003 Ga0075435_100097133
1004 Ga0105240_10205272
1005 Ga0111539_10401260
1006 Ga0111539_11636840
1007 Ga0105245_10018559
1008 Ga0105245_10097598
1009 Ga0105245_10258130
1010 Ga0105245_10486391
1011 Ga0105245_11447250
1012 Ga0105247_10192019
1013 Ga0105247_10646038
1014 Ga0114129_10001569
1015 Ga0114129_10312053
1016 Ga0105243_10605593
1017 Ga0105243_10623216
1018 Ga0105241_10166250
1019 Ga0105241_10226543
1020 Ga0105242_10244439
1021 Ga0105242_12742442
1022 Ga0105248_10078750
1023 Ga0105248_11964486
1024 Ga0105238_10023747
1025 Ga0105238_10878443
1026 Ga0105249_10078389
1027 Ga0105249_10104596
1028 Ga0105249_10264401
1029 Ga0105249_10670663
1030 Ga0105249_10838177
1031 Ga0105028_112309
1032 Ga0099796_10040471
1033 Ga0105239_10770055
1034 Ga0105239_12560140
1035 Ga0105246_10020598
1036 Ga0105246_10034512
1037 Ga0157320_1000308
1038 Ga0157341_1003899
1039 Ga0157339_1001953
1040 Ga0157373_11140705
1041 Ga0157370_10188776
1042 Ga0157370_11061833
1043 Ga0157369_10172796
1044 Ga0157369_12085429
1045 Ga0157374_10235147
1046 Ga0157374_10909142
1047 Ga0157378_11383862
1048 Ga0157378_11837503
1049 Ga0163162_10241283
1050 Ga0163162_11551782
1051 Ga0157372_10148226
1052 Ga0157372_10179944
1053 Ga0157372_10476288
1054 Ga0157372_10497173
1055 Ga0157372_10597538
1056 Ga0157372_11009058
1057 Ga0157375_10202460
1058 Ga0157375_12024999
1059 Ga0163163_10604857
1060 Ga0157380_10843654
1061 Ga0182008_10197144
1062 Ga0157377_10039003
1063 Ga0157377_10506402
1064 Ga0157379_10125714
1065 Ga0157379_10206745
1066 Ga0157379_10212292
1067 Ga0157379_10725004
1068 Ga0157379_11529582
1069 Ga0157376_11584318
1070 Ga0163161_10079551
1071 Ga0206356_11814867
1072 Ga0206354_10641417
1073 Ga0213875_10008590
1074 Ga0213875_10150826
1075 Ga0207653_10005339
1076 Ga0207692_10033785
1077 Ga0207692_10151324
1078 Ga0207642_10817141
1079 Ga0207642_10906420
1080 Ga0207688_10045916
1081 Ga0207688_10080283
1082 Ga0207688_10216207
1083 Ga0207647_10065359
1084 Ga0207647_10071626
1085 Ga0207699_10035332
1086 Ga0207699_10077768
1087 Ga0207645_10054576
1088 Ga0207645_10898946
1089 Ga0207643_10049315
1090 Ga0207705_10291527
1091 Ga0207705_10376529
1092 Ga0207654_11141187
1093 Ga0207693_10179824
1094 Ga0207663_10018650
1095 Ga0207663_10089606
1096 Ga0207660_10988948
1097 Ga0207662_10009420
1098 Ga0207662_10434467
1099 Ga0207657_10006571
1100 Ga0207657_10142647
1101 Ga0207649_10253628
1102 Ga0207649_10587485
1103 Ga0207649_11219064
1104 Ga0207652_10558377
1105 Ga0207646_10734864
1106 Ga0207681_10065583
1107 Ga0207681_10236556
1108 Ga0207694_10544142
1109 Ga0207694_10617487
1110 Ga0207650_10314680
1111 Ga0207650_10830481
1112 Ga0207650_11305686
1113 Ga0207659_10035704
1114 Ga0207659_10162806
1115 Ga0207687_10089049
1116 Ga0207687_10130223
1117 Ga0207687_10321848
1118 Ga0207687_10343797
1119 Ga0207700_10091384
1120 Ga0207700_10094770
1121 Ga0207700_10912054
1122 Ga0207700_10998145
1123 Ga0207664_10013247
1124 Ga0207664_10021185
1125 Ga0207664_10067283
1126 Ga0207664_10120661
1127 Ga0207664_10558512
1128 Ga0207644_10834928
1129 Ga0207706_10061213
1130 Ga0207706_10185342
1131 Ga0207709_10040285
1132 Ga0207709_10367046
1133 Ga0207670_10327097
1134 Ga0207670_11263524
1135 Ga0207669_10450389
1136 Ga0207669_11592405
1137 Ga0207704_10457414
1138 Ga0207665_10088785
1139 Ga0207665_10157204
1140 Ga0207691_10012460
1141 Ga0207691_10446556
1142 Ga0207711_10070924
1143 Ga0207689_10003284
1144 Ga0207689_10113692
1145 Ga0207689_10215981
1146 Ga0207661_10049090
1147 Ga0207661_10582550
1148 Ga0207661_11333440
1149 Ga0207679_10129882
1150 Ga0207679_10626234
1151 Ga0207679_10796453
1152 Ga0207679_10888380
1153 Ga0207667_10534903
1154 Ga0207712_10141954
1155 Ga0207712_10197285
1156 Ga0207668_10057721
1157 Ga0207668_10070792
1158 Ga0207640_10336721
1159 Ga0207658_10089104
1160 Ga0207658_10236113
1161 Ga0207658_10361991
1162 Ga0207677_10009927
1163 Ga0207677_10075987
1164 Ga0207677_10729685
1165 Ga0207703_10161248
1166 Ga0207703_10546636
1167 Ga0207639_10091369
1168 Ga0207678_10010287
1169 Ga0207678_10365084
1170 Ga0207678_10614245
1171 Ga0207708_10003939
1172 Ga0207708_10025161
1173 Ga0207702_10016590
1174 Ga0207702_10228764
1175 Ga0207702_10613298
1176 Ga0207641_10005229
1177 Ga0207641_10067896
1178 Ga0207641_10140888
1179 Ga0207676_10249335
1180 Ga0207676_10510286
1181 Ga0207674_10004274
1182 Ga0207674_10064578
1183 Ga0207674_10097574
1184 Ga0207675_100975272
1185 Ga0207683_10014494
1186 Ga0207683_10343745
1187 Ga0207683_10482375
1188 Ga0207683_10574146
1189 Ga0207683_10594078
1190 Ga0207698_10263870
1191 Ga0207698_10308533
1192 Ga0207698_10567420
1193 Ga0207698_10590596
1194 Ga0207698_11176396
1195 Ga0207428_10178284
1196 Ga0268266_10273121
1197 Ga0268266_10427483
1198 Ga0268265_10591121
1199 Ga0268264_10099359
1200 Ga0268264_11642172
1201 Ga0307517_10078795
1202 Ga0307517_10147816
1203 Ga0307517_10268775
1204 Ga0307515_10014225
1205 Ga0307515_10026738
1206 Ga0307515_10057662
1207 Ga0307515_10076245
1208 Ga0307515_10688595
1209 Ga0307511_10139131
1210 Ga0307511_10258030
1211 Ga0307512_10005920
1212 Ga0307512_10017028
1213 Ga0307512_10022251
1214 Ga0307512_10039021
1215 Ga0307513_10019232
1216 Ga0307513_10197716
1217 Ga0307509_10032515
1218 Ga0307509_10056785
1219 Ga0307408_100072841
1220 Ga0307408_101122779
1221 Ga0307408_101309660
1222 Ga0307508_10002620
1223 Ga0307508_10003217
1224 Ga0307508_10051989
1225 Ga0307508_10143359
1226 Ga0307508_10163425
1227 Ga0307508_10465761
1228 Ga0307508_10817637
1229 Ga0307514_10446923
1230 Ga0307516_10011683
1231 Ga0307516_10031393
1232 Ga0307516_10157059
1233 Ga0307405_10003449
1234 Ga0307405_10309520
1235 Ga0307405_10333048
1236 Ga0307405_10589693
1237 Ga0307405_11781320
1238 Ga0307413_10008086
1239 Ga0307413_10185614
1240 Ga0307413_10350011
1241 Ga0307413_10513010
1242 Ga0307413_10666433
1243 Ga0307413_11578791
1244 Ga0307410_10039193
1245 Ga0307410_10114573
1246 Ga0307410_10191867
1247 Ga0307406_10001217
1248 Ga0307406_10022249
1249 Ga0307407_10101889
1250 Ga0307412_10096609
1251 Ga0307412_10652425
1252 Ga0307409_100007503
1253 Ga0307409_100014459
1254 Ga0307409_100147555
1255 Ga0307409_100229830
1256 Ga0307409_101405089
1257 Ga0307409_101529572
1258 Ga0307409_101746244
1259 Ga0307416_100005854
1260 Ga0307416_100766213
1261 Ga0307416_100784275
1262 Ga0307416_101427096
1263 Ga0307416_101429754
1264 Ga0307414_10053049
1265 Ga0307414_10230000
1266 Ga0307411_10097674
1267 Ga0307411_11140329
1268 Ga0307415_100009542
1269 Ga0307415_100053125
1270 Ga0307415_100072496
1271 Ga0307415_100152529
1272 Ga0307415_100265113
1273 Ga0307507_10071080
1274 Ga0307507_10456266
1275 Ga0307510_10180942
1276 Ga0373948_0005533
1277 Ga0373959_0075476
1278 Ga0373938_0019014
1279 Ga0373928_0179052
1280 Ga0373934_0023758
1281 Ga0373934_0214613
1282 Ga0373940_0020426
1283 Ga0373940_0032342
1284 Ga0373944_0002054
1285 Ga0373951_0000371
1286 Ga0373951_0082008
1287 Ga0373952_0040997
1288 Ga0373923_0013501
1289 Ga0373932_0012209
1290 Ga0373936_0001005
1291 Ga0373936_0040596
1292 Ga0373939_0055489
1293 Ga0373939_0247135
1294 Ga0373941_0127054
1295 Ga0373941_0161722
1296 Ga0373945_0000810
1297 Ga0373945_0029215
1298 Ga0373945_0139483
1299 Ga0373953_0089847
1300 Ga0373954_0092796
1301 Ga0373956_0347096
1302 Ga0373943_0098315
1303 Ga0373943_0132376
1304 Ga0373946_0004490
1305 Ga0373946_0080178
1306 Ga0373955_0028107
1307 Ga0373955_0125071
1308 Ga0373955_0167705
1309 Ga0373942_0000152
1310 Ga0373942_0070451
1311 Ga0373961_0021763
1312 Ga0373962_0004288
1313 Ga0373962_0039808
1314 Ga0316574_0026378
1315 Ga0316574_0290084
1316 Ga0373924_0015710
1317 Ga0373924_0050644
1318 Ga0373931_0020989
1319 Ga0373931_0266365
1320 Ga0373931_0760689
1321 Ga0373935_0003808
1322 Ga0373935_0092942
1323 Ga0373935_0212380
1324 Ga0373935_0688353
1325 Ga0373927_0020474
1326 Ga0373927_0022250
1327 Ga0373933_0027924
1328 Ga0373933_0143947
1329 Ga0373933_0758348
1330 Ga0373947_0003093
1331 Ga0373937_0097794
1332 Ga0373937_0098762
1333 Ga0372808_013772
1334 Ga0373925_0256178
1335 Ga0395900_1146583
1336 Ga0395898_0096517
1337 Ga0436364_0059219
1338 Ga0436364_0463455
1339 Ga0436364_0967897
1340 Ga0395901_0105994
1341 Ga0400483_286613
1342 Ga0436365_1545022
1343 Ga0436363_0687920
1344 Ga0451789_0444322
1345 Ga0451791_1439624
1346 Ga0451793_1906183
1347 Ga0451837_0072343
1348 Ga0451843_1174054
1349 Ga0451853_2374562
1350 Ga0439463_080027
1351 Ga0466969_0001307
1352 Ga0466969_0052833
1353 Ga0466969_0157359
1354 Ga0466966_0007574
1355 Ga0466966_0033264
1356 Ga0466971_0000689
1357 Ga0466970_0014607
1358 Ga0466970_0243869
1359 Ga0466957_0216347
1360 Ga0466957_0222345
1361 Ga0466957_0456150
1362 Ga0466960_0136205
1363 Ga0466959_0001910
1364 Ga0466959_0010087
1365 Ga0466958_0034614
1366 Ga0466967_0022798
1367 Ga0466967_0040767
1368 Ga0466967_0518550
1369 Ga0466967_1555098
1370 Ga0495592_0058909
1371 Ga0495592_0100191
1372 Ga0495592_0327403
1373 Ga0495592_0420778
1374 Ga0495603_0209235
1375 Ga0495603_0544640
1376 Ga0495629_0301801
1377 Ga0495629_0308940
1378 Ga0495638_0300799
1379 Ga0495641_0029319
1380 Ga0495641_0315867
1381 Ga0495651_0000405
1382 Ga0495651_0013939
1383 Ga0495651_0075538
1384 Ga0495651_0090423
1385 Ga0495651_0160001
1386 Ga0495651_0451519
1387 Ga0495653_0006045
1388 Ga0495653_0011270
1389 Ga0495653_0013551
1390 Ga0495653_0107397
1391 Ga0495653_0159293
1392 Ga0495650_0056882
1393 Ga0495580_0005058
1394 Ga0495580_0151518
1395 Ga0495582_0382542
1396 Ga0495639_0026978
1397 Ga0495639_0114505
1398 Ga0495662_0004185
1399 Ga0495662_0006172
1400 Ga0495664_0000745
1401 Ga0495664_0001527
1402 Ga0495664_0041249
1403 Ga0495664_0136782
1404 Ga0495664_0439908
1405 Ga0495664_0499466
1406 Ga0495585_0023340
1407 Ga0495608_0000431
1408 Ga0495608_0078506
1409 Ga0495608_0127813
1410 Ga0495608_0240078
1411 Ga0495618_0064778
1412 Ga0495618_0068246
1413 Ga0495618_0088579
1414 Ga0495618_0195845
1415 Ga0495618_0219780
1416 Ga0495618_0635205
1417 Ga0495628_0017144
1418 Ga0495628_0149694
1419 Ga0495628_0187568
1420 Ga0495630_0407635
1421 Ga0495666_0066344
1422 Ga0495666_0199341
1423 Ga0495652_0006521
1424 Ga0495652_0070028
1425 Ga0495652_0100903
1426 Ga0495652_0118080
1427 Ga0495652_0185953
1428 Ga0495652_0188998
1429 Ga0495665_0052942
1430 Ga0495665_0117299
1431 Ga0495640_0029937
1432 Ga0495640_0256905
1433 Ga0495640_0281541
1434 Ga0495640_0546963
1435 Ga0495586_0318085
1436 Ga0495586_0519520
1437 Ga0495587_0016509
1438 Ga0495587_0019470
1439 Ga0495587_0260782
1440 Ga0495587_0265335
1441 Ga0495645_0010765
1442 Ga0495645_0047000
1443 Ga0495645_0104243
1444 Ga0495645_0194716
1445 Ga0495667_0003511
1446 Ga0495667_0014710
1447 Ga0495667_0036911
1448 Ga0495667_0132197
1449 Ga0495667_0261102
1450 Ga0495667_0461491
1451 Ga0495667_0508361
1452 Ga0495634_0073127
1453 Ga0495634_0155191
1454 Ga0495634_0232856
1455 Ga0495634_0407808
1456 Ga0495634_0521400
1457 Ga0495634_0562614
1458 Ga0495635_0003994
1459 Ga0495635_0009208
1460 Ga0495635_0050515
1461 Ga0495635_0058901
1462 Ga0495635_0659190
1463 Ga0495588_0364945
1464 Ga0495657_0001154
1465 Ga0495657_0105121
1466 Ga0495657_0117485
1467 Ga0495657_0307401
1468 Ga0495657_0383718
1469 Ga0495599_0022538
1470 Ga0495599_0038651
1471 Ga0495599_0261807
1472 Ga0495599_0419636
1473 Ga0495623_0054028
1474 Ga0495623_0057366
1475 Ga0495623_0284564
1476 Ga0495623_0376069
1477 Ga0495623_0517301
1478 Ga0495646_0024112
1479 Ga0495646_0038869
1480 Ga0495646_0094283
1481 Ga0495658_0024522
1482 Ga0495613_0003259
1483 Ga0495624_0029094
1484 Ga0495624_0229135
1485 Ga0495649_0305138
1486 Ga0495600_0011040
1487 Ga0495600_0150905
1488 Ga0495600_0152173
1489 Ga0495600_0396599
1490 Ga0495600_0581878
1491 Ga0495581_0004922
1492 Ga0495581_0156201
1493 Ga0495581_0404344
1494 Ga0495604_0000492
1495 Ga0495604_0119296
1496 Ga0495604_0195783
1497 Ga0495604_0332429
1498 Ga0495674_0005651
1499 Ga0495674_0074284
1500 Ga0495674_0132379
1501 Ga0495674_0442565
1502 Ga0495676_0004827
1503 Ga0495680_0009063
1504 Ga0495680_0010693
1505 Ga0495680_0162876
1506 Ga0495675_0108524
1507 Ga0495675_0144843
1508 Ga0495684_0046062
1509 Ga0495684_0121751
1510 Ga0495684_0260351
1511 Ga0495684_0337450
1512 Ga0495593_0034588
1513 Ga0495593_0134907
1514 Ga0495593_0142423
1515 Ga0495602_0051310
1516 Ga0495602_0100208
1517 Ga0495602_0105002
1518 Ga0495614_0033792
1519 Ga0496100_0002440
1520 Ga0496100_1433529
1521 Ga0496101_0002674
1522 Ga0496101_0388120
1523 Ga0496101_0900381
1524 Ga0496102_0000147
1525 Ga0496102_0049087
1526 Ga0496102_0144993
1527 Ga0496102_0513147
1528 Ga0496102_1229486
1529 Ga0496103_0000261
1530 Ga0496104_0028477
1531 Ga0496104_0093449
1532 Ga0496104_0596379
1533 Ga0496104_0773714
1534 Ga0496105_0019842
1535 Ga0496105_0037598
1536 Ga0496105_0045106
1537 Ga0496105_0540032
1538 Ga0496106_0277091
1539 Ga0496107_0205881
1540 Ga0496107_0316413
1541 Ga0496107_0586482
1542 Ga0496108_0000418
1543 Ga0496108_0134684
1544 Ga0496108_0166642
1545 Ga0496109_0163086
1546 Ga0496109_0284669
1547 Ga0496109_0474566
1548 Ga0496109_0775991
1549 Ga0496110_0037383
1550 Ga0496110_0158883
1551 Ga0496110_0514397
1552 Ga0496111_0060195
1553 Ga0496111_0248373
1554 Ga0496112_0642281
1555 Ga0496113_0148331
1556 Ga0496113_0155667
1557 Ga0496114_0002172
1558 Ga0496114_0003886
1559 Ga0496114_0050779
1560 Ga0496114_0181625
1561 Ga0496114_0463974
1562 Ga0496115_0158234
1563 Ga0496115_0366547
1564 Ga0496116_0000425
1565 Ga0496117_0000274
1566 Ga0496118_0000602
1567 Ga0496119_0000957
1568 Ga0496120_0008239
1569 Ga0496121_0057363
1570 Ga0496124_0054816
1571 Ga0496125_0012303
1572 Ga0496126_0000419
1573 Ga0496126_0283434
1574 Ga0496126_0423034
1575 Ga0501031_0073510
1576 Ga0501031_0357829
1577 Ga0501032_0192105
1578 Ga0501032_0466218
1579 Ga0501032_0871417
1580 Ga0501033_0021747
1581 Ga0501033_0133444
1582 Ga0501033_0573202
1583 Ga0501036_0037640
1584 Ga0501036_0310307
1585 Ga0501036_0326942
1586 Ga0501036_1253173
1587 Ga0501037_0042754
1588 Ga0501037_0058261
1589 Ga0501038_0017635
1590 Ga0501038_0500144
1591 Ga0501038_0998672
1592 Ga0501039_0009026
1593 Ga0501039_0039192
1594 Ga0501039_0410704
1595 Ga0501040_0069482
1596 Ga0501040_0154560
1597 Ga0501041_0019691
1598 Ga0501041_0142411
1599 Ga0501042_0117316
1600 Ga0501042_0189325
1601 Ga0501043_0156203
1602 Ga0501043_0162373
1603 Ga0501043_0387615
1604 Ga0501043_0448114
1605 Ga0501046_0014581
1606 Ga0501046_0026166
1607 Ga0501046_0088918
1608 Ga0501046_0877366
1609 Ga0501047_0063580
1610 Ga0501047_0110688
1611 Ga0501048_0004968
1612 Ga0501067_0100823
1613 Ga0501067_0540024
1614 Ga0501068_0042422
1615 Ga0501070_0897781
1616 Ga0501071_0102894
1617 Ga0501072_0010531
1618 Ga0501072_0139873
1619 Ga0501073_0161030
1620 Ga0501075_0012160
1621 Ga0501076_0068378
1622 Ga0501076_0269725
1623 Ga0501077_0341395
1624 Ga0501079_0335389
1625 Ga0501080_0936976
1626 Ga0501081_0041917
1627 Ga0501035_0042721
1628 Ga0501035_0240625
1629 Ga0501035_0545952
1630 Ga0501044_0747312
1631 Ga0501044_0778102
1632 Ga0501045_0013683
1633 Ga0501045_0055604
1634 Ga0501045_0381442
1635 nmdc:mga03n38_119743_c1
1636 nmdc:mga03n38_508189_c1
1637 nmdc:mga00v17_72724_c1
1638 nmdc:mga05p37_35185_c1
1639 nmdc:mga09592_16039_c1
1640 nmdc:mga09592_176038_c1
1641 nmdc:mga09592_195263_c1
1642 nmdc:mga0qj67_2330_c1
1643 nmdc:mga06r32_13370_c1
1644 nmdc:mga06r32_398_c4
1645 nmdc:mga06r32_421140_c1
1646 nmdc:mga08y16_1330028_c1
1647 nmdc:mga08y16_294144_c1
1648 nmdc:mga08y16_320527_c1
1649 nmdc:mga0n895_1382982_c1
1650 nmdc:mga0rr50_532722_c1
1651 Ga0495601_0003897
1652 Ga0495601_0016298
1653 Ga0495601_0063428
1654 Ga0495601_0459971
1655 Ga0495612_0002389
1656 Ga0495612_0068056
1657 Ga0495612_0187116
1658 Ga0495612_0197704
1659 Ga0495595_0086079
1660 Ga0495595_0311624
1661 Ga0495619_0193903
1662 Ga0500644_0005542
1663 Ga0500644_0068611
1664 Ga0500644_0185998
1665 Ga0500583_0445195
1666 Ga0500651_0071771
1667 Ga0500641_0055998
1668 Ga0500650_0069159
1669 Ga0500660_168703
1670 Ga0500569_028595
1671 Ga0500594_0002769
1672 Ga0500652_199585
1673 Ga0500655_016924
1674 Ga0500579_162325
1675 Ga0500600_0244098
1676 Ga0500616_0001593
1677 Ga0500616_0014227
1678 Ga0500630_173951
1679 Ga0500634_0261412
1680 Ga0501084_0006561
1681 Ga0501084_0036505
1682 Ga0501082_0020922
1683 Ga0501082_0099440
1684 Ga0466962_0009413
1685 Ga0530510_0007434
1686 Ga0530510_0353839
1687 Ga0530510_0439937
1688 2515854704
1689 2558909071
1690 2643849734
1691 2644135736
1692 2676474125
1693 2676495804
1694 2731906028
1695 2753268449
1696 2776372367
1697 2791916133
1698 2816425537
1699 2827629016
1700 2861521993
1701 2863074805
1702 2870786244
1703 2880498981
1704 2891329077
1705 2895438576
1706 2899363611
1707 3006429396
1708 8054476398

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01243

Putative_PNPOx

Pyridoxamine 5'-phosphate oxidase

13

100

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
2d5m-assembly1.cif.gz_A-2 flavoredoxin of desulfovibrio vulgaris (miyazaki f) 0.8561 23 79
2aq6-assembly1.cif.gz_B x-ray crystal structure of mycobacterium tuberculosis pyridoxine 5'-phosphate oxidase complexed with pyridoxal 5'-phosphate at 1.7 a resolution 0.8051 11 146
2i02-assembly1.cif.gz_A crystal structure of a pyridoxamine 5'-phosphate oxidase-like family protein (npun_r6570) from nostoc punctiforme pcc 73102 at 1.80 a resolution 0.8008 13 140
5jab-assembly1.cif.gz_B structure of the biliverdin reductase rv2074 from mycobacterium tuberculosis in complex with f420 0.7831 10 146
1rfe-assembly1.cif.gz_A crystal structure of conserved hypothetical protein rv2991 from mycobacterium tuberculosis 0.7819 4 143
ID Description Score Start End Superfamily
2d5mA00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8561 23 79 2.30.110.10
2arzB01 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8231 15 140 2.30.110.10
af_O07754_2_147_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8105 22 146 2.30.110.10
1w9aB00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7867 14 151 2.30.110.10
6eciG00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7797 6 146 2.30.110.10
ID Description Score Start End GO Terms
AF-A0A7I7Y322-F1-model_v4 PPOX class F420-dependent enzyme 0.997 1 150 GO:0005829
GO:0016627
GO:0070967
AF-A0A2U3NSW0-F1-model_v4 Pyridoxamine 5'-phosphate oxidase N-terminal domain-containing protein 0.9967 1 149 GO:0005829
GO:0016627
GO:0070967
AF-A0A132PG41-F1-model_v4 Pyridoxamine 5'-phosphate oxidase 0.9966 1 149 GO:0005829
GO:0016627
GO:0070967
AF-A0A117JTT6-F1-model_v4 Pyridoxamine 5'-phosphate oxidase 0.9961 1 149 GO:0005829
GO:0016627
GO:0070967
AF-A0A286ELS3-F1-model_v4 PPOX class probable F420-dependent enzyme 0.9959 1 149 GO:0005829
GO:0016627
GO:0070967

Map