F483508

General Info

Members Datasets Scaffolds Average Seq Length
852 434 722 314

Family's Representative Sequence

Representative Sequence 3300032004|Ga0307414_10019331|Ga0307414_100193314
Length 334
Sequence MNQSTLLTLPTELSAPGAAPPQWELHQIVDELRAVRERWRDGLASHQECGARQFPSRQHLRELVGALCAALFPMRLGPLDLQQESEDFFVGHTLDTTLTGLHEQVRRELAYQARQHGLPQAVSVEQQALAIVQRFARALPGIRARLDTDVAAAFHGDPAAHSVDEVLLCYPGILAIIHYRLAHALHALGAPLVARIIAEVAHSQTGIDIHPGAVIGASFFIDHGTGVVIGETAIIGERVRIYQAVTLGAKRFPAGADGVLKKGLARHPIVEDDVVIYAGATILGRVTIGQGSVIGGNVWLTRSIAAGSHVTQAHNQQEAAELPPPSHPALTHLP

Samples

Sample ID Description Type Environment
1 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
2 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
3 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
4 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
5 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
6 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
7 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
8 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
9 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
10 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
11 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
12 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
13 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
14 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
15 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
16 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
17 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
18 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
19 2519103095 Burkholderia sp. KJ006 Isolate Nodule
20 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
21 2547132374 Acidovorax radicis N35 Isolate Unclassified
22 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
23 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
24 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
25 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
26 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
27 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
28 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
29 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
30 2643221570 Acidovorax sp. Root568 Isolate Unclassified
31 2643221645 Massilia sp. Root351 Isolate Unclassified
32 2643221717 Acidovorax sp. Root267 Isolate Unclassified
33 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
34 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
35 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
36 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
37 2738541297 Duganella sp. GV083 Isolate Unclassified
38 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
39 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
40 2738541357 Duganella sp. GV053 Isolate Unclassified
41 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
42 2738543003 Duganella sp. GV066 Isolate Unclassified
43 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
44 2738543026 Duganella sp. GV089 Isolate Unclassified
45 2738543029 Duganella sp. GV039 Isolate Unclassified
46 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
47 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
48 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
49 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
50 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
51 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
52 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
53 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
54 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
55 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
56 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
57 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
58 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
59 2818991450 Burkholderia sp. 604 Isolate Unclassified
60 2818991452 Burkholderia cepacia 561 Isolate Unclassified
61 2821131069 Duganella sp. 1224 Isolate Unclassified
62 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
63 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
64 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
65 2842711865 Duganella sp. R-73148 Isolate Unclassified
66 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
67 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
68 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
69 2857558681 Duganella sp. R-74565 Isolate Unclassified
70 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
71 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
72 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
73 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
74 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
75 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
76 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
77 2904424332 Duganella sp. 1411 Isolate Rhizosphere
78 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
79 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
80 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
81 2904564687 Burkholderia sp. 571 Isolate Unclassified
82 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
83 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
84 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
85 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
86 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
87 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
88 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
89 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
90 2919476304 Duganella sp. 3397 Isolate Unclassified
91 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
92 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
93 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
94 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
95 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
96 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
97 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
98 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
99 2928163908 Burkholderia sp. 567 Isolate Unclassified
100 2928170801 Burkholderia sp. 572 Isolate Unclassified
101 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
102 2928536128 Burkholderia sola 565 Isolate Unclassified
103 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
104 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
105 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
106 2952252522 Salinicola sp. DM10 Isolate Unclassified
107 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
108 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
109 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
110 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
111 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
112 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
113 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
114 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
115 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
116 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
117 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
118 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
119 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
120 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
121 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
122 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
123 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
124 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
125 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
126 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
127 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
128 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
129 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
130 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
131 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
132 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
133 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
134 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
135 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
136 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
137 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
138 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
139 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
140 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
141 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
142 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
143 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
144 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
145 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
146 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
147 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
148 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
149 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
150 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
151 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
152 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
153 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
154 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
155 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
156 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
157 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
158 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
159 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
160 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
161 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
162 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
163 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
164 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
165 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
166 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
167 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
168 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
169 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
170 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
171 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
172 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
173 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
174 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
175 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
176 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
177 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
178 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
179 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
180 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
181 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
182 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
183 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
184 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
185 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
186 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
187 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
188 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
189 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
190 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
191 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
192 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
193 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
194 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
195 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
196 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
197 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
198 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
199 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
200 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
201 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
202 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
203 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
204 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
205 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
206 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
207 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
208 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
209 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
210 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
211 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
212 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
213 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
214 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
215 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
216 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
243 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
244 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
246 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
247 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
248 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
249 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
250 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
251 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
252 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
253 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
254 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
255 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
256 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
257 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
258 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
259 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
260 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
261 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
262 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
263 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
264 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
265 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
266 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
267 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
268 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
269 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
270 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
271 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
272 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
273 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
274 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
275 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
276 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
277 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
278 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
279 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
280 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
281 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
282 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
283 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
284 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
285 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
286 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
287 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
288 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
289 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
290 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
291 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
292 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
293 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
294 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
295 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
296 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
297 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
298 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
299 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
300 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
301 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
302 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
303 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
304 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
305 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
306 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
307 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
308 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
309 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
310 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
311 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
312 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
313 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
314 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
315 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
316 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
317 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
318 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
319 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
320 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
321 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
322 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
323 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
324 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
325 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
326 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
327 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
328 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
329 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
330 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
331 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
332 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
333 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
334 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
335 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
336 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
337 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
338 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
339 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
340 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
341 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
342 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
343 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
344 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
345 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
346 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
347 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
348 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
349 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
350 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
351 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
352 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
353 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
354 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
355 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
356 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
357 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
358 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
359 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
360 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
361 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
362 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
363 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
364 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
365 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
366 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
367 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
368 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
369 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
370 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
371 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
372 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
373 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
374 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
375 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
376 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
377 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
378 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
379 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
380 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
381 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
382 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
383 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
384 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
385 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
386 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
387 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
388 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
389 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
390 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
391 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
392 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
393 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
394 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
395 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
396 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
397 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
398 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
399 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
400 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
401 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
402 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
403 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
404 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
405 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
406 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
407 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
408 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
409 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
410 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
411 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
412 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
413 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
414 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
415 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
416 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
417 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
418 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
419 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
420 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
421 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
422 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
423 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified
424 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
425 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
426 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
427 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
428 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
429 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
430 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
431 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
432 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
433 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
434 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 84.27
Metatranscriptomes 0.47
Isolates 15.26

Biome Distribution

Category Percentage (%)
Aerial Root 0.23
Bulb 0
Endosphere 8.33
Nodule 2.46
Rhizoplane 6.46
Rhizosphere 67.84
Stem 0
Stem Tuber 0
Unclassified 14.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10010996 3300001979 Bacteria 3460
2 JGI24739J22299_10001081 3300001989 Bacteria 10146
3 JGI24739J22299_10014841 3300001989 Bacteria 2833
4 JGI24735J21928_10001124 3300002067 Bacteria 9570
5 JGI24735J21928_10001745 3300002067 Bacteria 7668
6 JGI24735J21928_10006683 3300002067 Bacteria 3785
7 JGI24735J21928_10030652 3300002067 Bacteria 1597
8 JGI24738J21930_10001012 3300002075 Bacteria 8041
9 JGI25156J39149_1000135 3300002705 Bacteria 53930
10 JGI25156J39149_1000388 3300002705 Bacteria 27622
11 JGI25156J39149_1000971 3300002705 Bacteria 13657
12 JGI25165J46597_1002248 3300003214 Bacteria 6694
13 JGI25153J46596_10000022 3300003215 Bacteria 251919
14 rootL2_10159651 3300003322 Bacteria 1547
15 Ga0055538_1000002 3300003751 Bacteria 999437
16 Ga0055539_1000002 3300003752 Bacteria 999437
17 Ga0055533_1000004 3300003756 Bacteria 999437
18 Ga0055533_1000094 3300003756 Bacteria 115741
19 Ga0055532_1000003 3300003758 Bacteria 494004
20 Ga0055532_1002121 3300003758 Bacteria 4496
21 Ga0055532_1002497 3300003758 Bacteria 3767
22 Ga0055532_1002749 3300003758 Bacteria 3426
23 Ga0055525_1000002 3300003759 Bacteria 999437
24 Ga0055527_1000006 3300003760 Bacteria 494004
25 Ga0055527_1000567 3300003760 Bacteria 12206
26 Ga0055535_1000003 3300003761 Bacteria 494004
27 Ga0055535_1000523 3300003761 Bacteria 33415
28 Ga0055535_1001427 3300003761 Bacteria 12206
29 Ga0055542_1000007 3300003762 Bacteria 494004
30 Ga0055542_1000541 3300003762 Bacteria 33561
31 Ga0055542_1002728 3300003762 Bacteria 5386
32 Ga0055529_1000003 3300003763 Bacteria 494004
33 Ga0055529_1000521 3300003763 Bacteria 33561
34 Ga0055524_1000003 3300003775 Bacteria 399748
35 Ga0055528_1001920 3300003790 Bacteria 11801
36 Ga0055541_1000002 3300003841 Bacteria 896405
37 Ga0058692_1004101 3300003856 Bacteria 4374
38 Ga0065165_1002241 3300005262 Bacteria 17172
39 Ga0065165_1016609 3300005262 Bacteria 2748
40 Ga0065714_10074278 3300005288 Bacteria 3059
41 Ga0070658_10063001 3300005327 Bacteria 3022
42 Ga0070658_10213133 3300005327 Bacteria 1632
43 Ga0070690_100000275 3300005330 Bacteria 26334
44 Ga0070680_100514102 3300005336 Bacteria 1025
45 Ga0070682_100061331 3300005337 Bacteria 2380
46 Ga0070660_100000159 3300005339 Bacteria 43943
47 Ga0070660_100002227 3300005339 Bacteria 13358
48 Ga0070660_100006481 3300005339 Bacteria 8116
49 Ga0070660_100025183 3300005339 Bacteria 4421
50 Ga0070689_100000376 3300005340 Bacteria 26278
51 Ga0070661_100058214 3300005344 Bacteria 2832
52 Ga0070688_100007098 3300005365 Bacteria 6029
53 Ga0070659_100000223 3300005366 Bacteria 44089
54 Ga0070659_100034980 3300005366 Bacteria 3910
55 Ga0070701_10000088 3300005438 Bacteria 25619
56 Ga0070700_100000542 3300005441 Bacteria 18937
57 Ga0070694_100045181 3300005444 Bacteria 2951
58 Ga0070663_100001049 3300005455 Bacteria 15125
59 Ga0070685_10000777 3300005466 Bacteria 17368
60 Ga0068853_100458756 3300005539 Bacteria 1199
61 Ga0070686_100000294 3300005544 Bacteria 33575
62 Ga0068855_100029854 3300005563 Bacteria 6520
63 Ga0068855_100234974 3300005563 Bacteria 2050
64 Ga0070664_100035576 3300005564 Bacteria 4181
65 Ga0068856_100058492 3300005614 Bacteria 3807
66 Ga0068852_100030497 3300005616 Bacteria 4440
67 Ga0068859_100000481 3300005617 Bacteria 39283
68 Ga0068861_100036148 3300005719 Bacteria 3664
69 Ga0068862_100001216 3300005844 Bacteria 24301
70 Ga0075368_10015920 3300006042 Bacteria 2794
71 Ga0075364_10060848 3300006051 Bacteria 2476
72 Ga0075367_10017516 3300006178 Bacteria 3933
73 Ga0075366_10102184 3300006195 Bacteria 1721
74 Ga0068865_100243119 3300006881 Bacteria 1417
75 Ga0097620_100000481 3300006931 Bacteria 39283
76 Ga0099826_10000002 3300006948 Bacteria 1125830
77 Ga0105251_10001186 3300009011 Bacteria 22567
78 Ga0105244_10001991 3300009036 Bacteria 15758
79 Ga0105244_10021819 3300009036 Bacteria 3532
80 Ga0105240_10003656 3300009093 Bacteria 23815
81 Ga0105240_10088845 3300009093 Bacteria 3780
82 Ga0105240_10103540 3300009093 Bacteria 3458
83 Ga0105240_10191118 3300009093 Bacteria 2407
84 Ga0105240_10239861 3300009093 Bacteria 2102
85 Ga0105247_10062765 3300009101 Bacteria 2305
86 Ga0105243_10050427 3300009148 Bacteria 3288
87 Ga0105241_10029822 3300009174 Bacteria 4072
88 Ga0105242_10005895 3300009176 Bacteria 9447
89 Ga0105242_10096020 3300009176 Bacteria 2503
90 Ga0105248_10057346 3300009177 Bacteria 4372
91 Ga0105248_10279160 3300009177 Bacteria 1881
92 Ga0105237_10013944 3300009545 Bacteria 8410
93 Ga0105237_10193823 3300009545 Bacteria 2032
94 Ga0105238_10030204 3300009551 Bacteria 5514
95 Ga0105238_10033930 3300009551 Bacteria 5193
96 Ga0105238_10218198 3300009551 Bacteria 1883
97 Ga0105239_10005842 3300010375 Bacteria 14341
98 Ga0105239_10021326 3300010375 Bacteria 7143
99 Ga0157371_10341236 3300013102 Bacteria 1089
100 Ga0157370_10000632 3300013104 Bacteria 43893
101 Ga0157370_10000999 3300013104 Bacteria 35689
102 Ga0157369_10001964 3300013105 Bacteria 24791
103 Ga0157369_10004136 3300013105 Bacteria 17186
104 Ga0157369_10013941 3300013105 Bacteria 9083
105 Ga0157369_10103875 3300013105 Bacteria 3027
106 Ga0157369_10255189 3300013105 Bacteria 1829
107 Ga0157369_10356285 3300013105 Bacteria 1519
108 Ga0157369_10365969 3300013105 Bacteria 1497
109 Ga0157374_10000050 3300013296 Bacteria 132127
110 Ga0157378_10104470 3300013297 Bacteria 2589
111 Ga0163162_10024825 3300013306 Bacteria 5920
112 Ga0157372_10000364 3300013307 Bacteria 50077
113 Ga0157380_10021946 3300014326 Bacteria 4795
114 Ga0182008_10000827 3300014497 Bacteria 21580
115 Ga0182008_10043489 3300014497 Bacteria 2236
116 Ga0182008_10070716 3300014497 Bacteria 1717
117 Ga0157376_10011117 3300014969 Bacteria 6621
118 Ga0157376_10070466 3300014969 Bacteria 2968
119 Ga0182006_1000033 3300015261 Bacteria 238180
120 Ga0182006_1000529 3300015261 Bacteria 28957
121 Ga0182006_1019112 3300015261 Bacteria 2888
122 Ga0182007_10000198 3300015262 Bacteria 40280
123 Ga0182007_10000281 3300015262 Bacteria 33821
124 Ga0182007_10026510 3300015262 Bacteria 2007
125 Ga0182005_1000024 3300015265 Bacteria 238256
126 Ga0183361_10002 3300016635 Bacteria 907642
127 Ga0163161_10006140 3300017792 Bacteria 8321
128 Ga0197907_10060606 3300020069 Bacteria 1616
129 Ga0206356_10471300 3300020070 Bacteria 7064
130 Ga0206353_11405814 3300020082 Bacteria 6718
131 Ga0213872_10009130 3300021361 Bacteria 4765
132 Ga0213872_10027618 3300021361 Bacteria 2604
133 Ga0224712_10000024 3300022467 Bacteria 22697
134 Ga0209435_104465 3300025206 Bacteria 1582
135 Ga0209784_100002 3300025224 Bacteria 1753105
136 Ga0209566_100003 3300025225 Bacteria 1753105
137 Ga0209566_100443 3300025225 Bacteria 30572
138 Ga0209674_100004 3300025226 Bacteria 1753105
139 Ga0209674_100025 3300025226 Bacteria 515942
140 Ga0209674_100144 3300025226 Bacteria 107160
141 Ga0209672_100002 3300025228 Bacteria 1733325
142 Ga0209672_100012 3300025228 Bacteria 795742
143 Ga0209672_100063 3300025228 Bacteria 204903
144 Ga0209147_100003 3300025229 Bacteria 1733325
145 Ga0209147_100007 3300025229 Bacteria 795684
146 Ga0209147_100077 3300025229 Bacteria 205964
147 Ga0209147_100119 3300025229 Bacteria 142860
148 Ga0209563_100006 3300025230 Bacteria 1753105
149 Ga0209563_101098 3300025230 Bacteria 7751
150 Ga0207427_100538 3300025231 Bacteria 19709
151 Ga0209258_100005 3300025242 Bacteria 1087938
152 Ga0209258_100014 3300025242 Bacteria 720132
153 Ga0209258_100105 3300025242 Bacteria 207862
154 Ga0209677_100003 3300025253 Bacteria 1753105
155 Ga0209148_1000006 3300025254 Bacteria 1733325
156 Ga0209148_1000107 3300025254 Bacteria 207862
157 Ga0209148_1002224 3300025254 Bacteria 7101
158 Ga0209759_1000008 3300025256 Bacteria 461395
159 Ga0209759_1000014 3300025256 Bacteria 396291
160 Ga0209759_1000094 3300025256 Bacteria 159426
161 Ga0209759_1008521 3300025256 Bacteria 3185
162 Ga0209759_1013849 3300025256 Bacteria 2163
163 Ga0209759_1019850 3300025256 Bacteria 1580
164 Ga0209233_1000018 3300025261 Bacteria 886857
165 Ga0209455_1000003 3300025272 Bacteria 1471893
166 Ga0209455_1000100 3300025272 Bacteria 207862
167 Ga0209455_1000220 3300025272 Bacteria 79809
168 Ga0209455_1001676 3300025272 Bacteria 9524
169 Ga0209673_1000101 3300025273 Bacteria 190230
170 Ga0209564_1003180 3300025295 Bacteria 11534
171 Ga0209758_1000005 3300025297 Bacteria 1368918
172 Ga0209256_1000007 3300025299 Bacteria 1136599
173 Ga0207426_1000180 3300025302 Bacteria 158321
174 Ga0207426_1001127 3300025302 Bacteria 24293
175 Ga0207426_1001753 3300025302 Bacteria 16453
176 Ga0207713_1000590 3300025735 Bacteria 35946
177 Ga0207713_1003582 3300025735 Bacteria 10487
178 Ga0207647_10000145 3300025904 Bacteria 56900
179 Ga0207647_10003580 3300025904 Bacteria 11644
180 Ga0207647_10013282 3300025904 Bacteria 5716
181 Ga0207647_10048340 3300025904 Bacteria 2642
182 Ga0207647_10138665 3300025904 Bacteria 1426
183 Ga0207705_10001623 3300025909 Bacteria 17837
184 Ga0207705_10007441 3300025909 Bacteria 8052
185 Ga0207705_10009968 3300025909 Bacteria 6919
186 Ga0207705_10138342 3300025909 Bacteria 1817
187 Ga0207654_10004588 3300025911 Bacteria 6977
188 Ga0207707_10178503 3300025912 Bacteria 1854
189 Ga0207695_10000368 3300025913 Bacteria 103176
190 Ga0207695_10020889 3300025913 Bacteria 7482
191 Ga0207695_10120922 3300025913 Bacteria 2586
192 Ga0207671_10036256 3300025914 Bacteria 3657
193 Ga0207671_10113107 3300025914 Bacteria 2067
194 Ga0207660_10404331 3300025917 Bacteria 1100
195 Ga0207657_10000442 3300025919 Bacteria 43937
196 Ga0207657_10006101 3300025919 Bacteria 12528
197 Ga0207657_10061594 3300025919 Bacteria 3216
198 Ga0207657_10156726 3300025919 Bacteria 1852
199 Ga0207649_10012810 3300025920 Bacteria 4666
200 Ga0207694_10209671 3300025924 Bacteria 1587
201 Ga0207694_10215677 3300025924 Bacteria 1564
202 Ga0207690_10000037 3300025932 Bacteria 142658
203 Ga0207690_10006058 3300025932 Bacteria 7163
204 Ga0207690_10200759 3300025932 Bacteria 1514
205 Ga0207706_10096897 3300025933 Bacteria 2594
206 Ga0207686_10007886 3300025934 Bacteria 5739
207 Ga0207686_10056102 3300025934 Bacteria 2475
208 Ga0207670_10000079 3300025936 Bacteria 67061
209 Ga0207711_10010149 3300025941 Bacteria 7820
210 Ga0207711_10034469 3300025941 Bacteria 4287
211 Ga0207689_10211609 3300025942 Bacteria 1602
212 Ga0207679_10036895 3300025945 Bacteria 3470
213 Ga0207679_10055898 3300025945 Bacteria 2912
214 Ga0207667_10008527 3300025949 Bacteria 12169
215 Ga0207667_10065063 3300025949 Bacteria 3804
216 Ga0207667_10119869 3300025949 Bacteria 2711
217 Ga0207658_10090765 3300025986 Bacteria 2369
218 Ga0207678_10000317 3300026067 Bacteria 43506
219 Ga0207708_10000652 3300026075 Bacteria 26611
220 Ga0207648_10001111 3300026089 Bacteria 30179
221 Ga0207674_10364764 3300026116 Bacteria 1396
222 Ga0207675_100057508 3300026118 Bacteria 3629
223 Ga0207698_10014639 3300026142 Bacteria 5222
224 Ga0207698_10029747 3300026142 Bacteria 3916
225 Ga0209371_1000080 3300027312 Bacteria 185771
226 Ga0209371_1000781 3300027312 Bacteria 26294
227 Ga0209371_1005060 3300027312 Bacteria 5415
228 Ga0209282_1000001 3300027666 Bacteria 2450367
229 Ga0268265_10001163 3300028380 Bacteria 23049
230 Ga0268265_10009141 3300028380 Bacteria 6697
231 Ga0265318_10000127 3300028577 Bacteria 70203
232 Ga0265318_10000504 3300028577 Bacteria 28393
233 Ga0265338_10000092 3300028800 Bacteria 168538
234 Ga0265338_10000159 3300028800 Bacteria 123495
235 Ga0265338_10037915 3300028800 Bacteria 4576
236 Ga0268256_1000160 3300030500 Bacteria 86682
237 Ga0268256_1000366 3300030500 Bacteria 42885
238 Ga0268256_1006624 3300030500 Bacteria 4270
239 Ga0265330_10000112 3300031235 Bacteria 66619
240 Ga0265332_10001836 3300031238 Bacteria 11330
241 Ga0265328_10000104 3300031239 Bacteria 41156
242 Ga0265328_10006581 3300031239 Bacteria 4897
243 Ga0265320_10000232 3300031240 Bacteria 45736
244 Ga0265320_10000969 3300031240 Bacteria 21356
245 Ga0265325_10004573 3300031241 Bacteria 8701
246 Ga0265325_10005819 3300031241 Bacteria 7555
247 Ga0265325_10069384 3300031241 Bacteria 1773
248 Ga0265329_10001427 3300031242 Bacteria 11542
249 Ga0265329_10012504 3300031242 Bacteria 3048
250 Ga0265340_10006288 3300031247 Bacteria 6547
251 Ga0265339_10003001 3300031249 Bacteria 11897
252 Ga0265331_10000178 3300031250 Bacteria 77277
253 Ga0265331_10000591 3300031250 Bacteria 32363
254 Ga0265331_10004787 3300031250 Bacteria 8331
255 Ga0265327_10000908 3300031251 Bacteria 43447
256 Ga0265327_10013812 3300031251 Bacteria 5334
257 Ga0265316_10000731 3300031344 Bacteria 36246
258 Ga0265316_10001736 3300031344 Bacteria 23119
259 Ga0265316_10008481 3300031344 Bacteria 9531
260 Ga0307513_10260098 3300031456 Bacteria 1526
261 Ga0307408_100064190 3300031548 Bacteria 2688
262 Ga0265313_10000056 3300031595 Bacteria 109106
263 Ga0265313_10000604 3300031595 Bacteria 37364
264 Ga0265314_10005145 3300031711 Bacteria 11889
265 Ga0265342_10000472 3300031712 Bacteria 43635
266 Ga0307405_10079987 3300031731 Bacteria 2132
267 Ga0307413_10178399 3300031824 Bacteria 1511
268 Ga0307410_10089845 3300031852 Bacteria 2177
269 Ga0307412_10000039 3300031911 Bacteria 182976
270 Ga0307412_10046127 3300031911 Bacteria 2853
271 Ga0307416_100088004 3300032002 Bacteria 2654
272 Ga0307414_10019331 3300032004 Bacteria 4218
273 Ga0307411_10008361 3300032005 Bacteria 5354
274 Ga0395899_0000065 3300037312 Bacteria 205510
275 Ga0395899_0110795 3300037312 Bacteria 1974
276 Ga0395900_0000015 3300037418 Bacteria 384313
277 Ga0395900_0014346 3300037418 Bacteria 8089
278 Ga0395900_0029868 3300037418 Bacteria 5594
279 Ga0395900_0036316 3300037418 Bacteria 5080
280 Ga0395900_0068435 3300037418 Bacteria 3649
281 Ga0395900_0133779 3300037418 Bacteria 2540
282 Ga0395898_0000201 3300037466 Bacteria 153821
283 Ga0395898_0003375 3300037466 Bacteria 17890
284 Ga0395898_0027791 3300037466 Bacteria 5672
285 Ga0395898_0049751 3300037466 Bacteria 4105
286 Ga0395898_0108313 3300037466 Bacteria 2664
287 Ga0395905_0000052 3300037471 Bacteria 215018
288 Ga0395905_0008919 3300037471 Bacteria 9848
289 Ga0395905_0014187 3300037471 Bacteria 7612
290 Ga0395905_0016137 3300037471 Bacteria 7100
291 Ga0395905_0019654 3300037471 Bacteria 6401
292 Ga0395905_0119849 3300037471 Bacteria 2473
293 Ga0395901_0000009 3300038443 Bacteria 479396
294 Ga0395901_0000150 3300038443 Bacteria 90505
295 Ga0395901_0000556 3300038443 Bacteria 43174
296 Ga0395901_0000824 3300038443 Bacteria 34332
297 Ga0395901_0144508 3300038443 Bacteria 2500
298 Ga0395901_0144610 3300038443 Bacteria 2499
299 Ga0436365_0357678 3300039437 Bacteria 4447
300 Ga0436361_0061959 3300039447 Bacteria 13613
301 Ga0436361_0580152 3300039447 Bacteria 3453
302 Ga0436361_0678907 3300039447 Bacteria 2315
303 Ga0436361_0746079 3300039447 Bacteria 4090
304 Ga0451853_3073345 3300041512 Bacteria 1342
305 Ga0439448_0001039 3300042005 Bacteria 6942
306 Ga0439448_0002423 3300042005 Bacteria 5069
307 Ga0439450_017898 3300042008 Bacteria 1483
308 Ga0450906_006299 3300042145 Bacteria 2402
309 Ga0439458_0003074 3300042157 Bacteria 3977
310 Ga0450918_001218 3300042531 Bacteria 5231
311 Ga0466969_0001231 3300044656 Bacteria 13843
312 Ga0466969_0060021 3300044656 Bacteria 1849
313 Ga0466972_0064390 3300044658 Bacteria 1755
314 Ga0466965_0002305 3300044683 Bacteria 8054
315 Ga0466965_0006181 3300044683 Bacteria 5418
316 Ga0466965_0068246 3300044683 Bacteria 1785
317 Ga0466965_0134116 3300044683 Bacteria 1285
318 Ga0466966_0002365 3300044684 Bacteria 12323
319 Ga0466966_0033234 3300044684 Bacteria 3340
320 Ga0466961_0000238 3300044693 Bacteria 37000
321 Ga0466961_0039421 3300044693 Bacteria 3028
322 Ga0466961_0041622 3300044693 Bacteria 2945
323 Ga0466961_0062638 3300044693 Bacteria 2363
324 Ga0466963_0001623 3300044694 Bacteria 12238
325 Ga0466963_0005529 3300044694 Bacteria 7397
326 Ga0466963_0070685 3300044694 Bacteria 2348
327 Ga0466964_0099185 3300044706 Bacteria 1281
328 Ga0466971_0001253 3300044719 Bacteria 10578
329 Ga0466971_0003561 3300044719 Bacteria 6656
330 Ga0466968_0000357 3300044735 Bacteria 14800
331 Ga0466970_0029996 3300044765 Bacteria 2867
332 Ga0466970_0036574 3300044765 Bacteria 2601
333 Ga0466957_0000032 3300044842 Bacteria 51211
334 Ga0466957_0020077 3300044842 Bacteria 3933
335 Ga0466957_0041778 3300044842 Bacteria 2773
336 Ga0466957_0051012 3300044842 Bacteria 2518
337 Ga0466957_0056093 3300044842 Bacteria 2408
338 Ga0466957_0080413 3300044842 Bacteria 2029
339 Ga0466960_0102983 3300044901 Bacteria 1473
340 Ga0466959_0004706 3300045049 Bacteria 9190
341 Ga0466959_0075518 3300045049 Bacteria 2434
342 Ga0466958_0009905 3300045836 Bacteria 5322
343 Ga0466958_0040295 3300045836 Bacteria 2807
344 Ga0466958_0047467 3300045836 Bacteria 2592
345 Ga0466958_0047862 3300045836 Bacteria 2582
346 Ga0466958_0075325 3300045836 Bacteria 2070
347 Ga0466967_0042855 3300045976 Bacteria 3914
348 Ga0466967_0177408 3300045976 Bacteria 2007
349 Ga0466967_0218047 3300045976 Bacteria 1812
350 Ga0495592_0007730 3300046454 Bacteria 8052
351 Ga0495592_0055966 3300046454 Bacteria 2916
352 Ga0495592_0090329 3300046454 Bacteria 2198
353 Ga0495592_0090907 3300046454 Bacteria 2189
354 Ga0495603_0001030 3300046455 Bacteria 16099
355 Ga0495603_0001565 3300046455 Bacteria 13380
356 Ga0495603_0002175 3300046455 Bacteria 11534
357 Ga0495603_0004485 3300046455 Bacteria 8331
358 Ga0495590_0006595 3300046457 Bacteria 4523
359 Ga0495590_0007224 3300046457 Bacteria 4293
360 Ga0495590_0010145 3300046457 Bacteria 3552
361 Ga0495591_015253 3300046458 Bacteria 2723
362 Ga0495629_0000045 3300046459 Bacteria 110283
363 Ga0495629_0000088 3300046459 Bacteria 80848
364 Ga0495629_0000704 3300046459 Bacteria 27097
365 Ga0495629_0008639 3300046459 Bacteria 7502
366 Ga0495629_0014480 3300046459 Bacteria 5674
367 Ga0495629_0035997 3300046459 Bacteria 3497
368 Ga0495629_0049934 3300046459 Bacteria 2931
369 Ga0495629_0073392 3300046459 Bacteria 2389
370 Ga0495638_0009449 3300046460 Bacteria 6843
371 Ga0495641_0026997 3300046461 Bacteria 2796
372 Ga0495651_0004391 3300046462 Bacteria 10795
373 Ga0495651_0020669 3300046462 Bacteria 5111
374 Ga0495651_0083711 3300046462 Bacteria 2405
375 Ga0495651_0173334 3300046462 Bacteria 1534
376 Ga0495653_0001472 3300046463 Bacteria 18364
377 Ga0495653_0002197 3300046463 Bacteria 15431
378 Ga0495653_0014385 3300046463 Bacteria 6457
379 Ga0495653_0016500 3300046463 Bacteria 6010
380 Ga0495653_0041108 3300046463 Bacteria 3610
381 Ga0495653_0118495 3300046463 Bacteria 1890
382 Ga0495650_0000549 3300046471 Bacteria 53534
383 Ga0495650_0001527 3300046471 Bacteria 21978
384 Ga0495650_0003550 3300046471 Bacteria 11291
385 Ga0495650_0007850 3300046471 Bacteria 6339
386 Ga0495650_0015568 3300046471 Bacteria 3894
387 Ga0495580_0000008 3300046472 Bacteria 102421
388 Ga0495580_0001335 3300046472 Bacteria 21761
389 Ga0495580_0010284 3300046472 Bacteria 7297
390 Ga0495580_0017278 3300046472 Bacteria 5399
391 Ga0495580_0035670 3300046472 Bacteria 3575
392 Ga0495580_0042778 3300046472 Bacteria 3225
393 Ga0495582_0000202 3300046473 Bacteria 33047
394 Ga0495582_0008636 3300046473 Bacteria 5618
395 Ga0495582_0012847 3300046473 Bacteria 4613
396 Ga0495582_0020021 3300046473 Bacteria 3659
397 Ga0495605_0009179 3300046474 Bacteria 5561
398 Ga0495605_0012770 3300046474 Bacteria 4650
399 Ga0495605_0012959 3300046474 Bacteria 4610
400 Ga0495605_0092941 3300046474 Bacteria 1396
401 Ga0495639_0039876 3300046475 Bacteria 2112
402 Ga0495662_0006350 3300046476 Bacteria 5908
403 Ga0495662_0022356 3300046476 Bacteria 3054
404 Ga0495662_0065863 3300046476 Bacteria 1751
405 Ga0495664_0000389 3300046477 Bacteria 21485
406 Ga0495664_0012294 3300046477 Bacteria 4847
407 Ga0495664_0112956 3300046477 Bacteria 1640
408 Ga0495664_0163531 3300046477 Bacteria 1350
409 Ga0495584_0006971 3300046491 Bacteria 5903
410 Ga0495584_0019480 3300046491 Bacteria 3446
411 Ga0495585_0061255 3300046492 Bacteria 2069
412 Ga0495585_0105755 3300046492 Bacteria 1501
413 Ga0495594_0009835 3300046499 Bacteria 4954
414 Ga0495594_0091877 3300046499 Bacteria 1701
415 Ga0495596_0002063 3300046500 Bacteria 11033
416 Ga0495596_0006629 3300046500 Bacteria 5307
417 Ga0495596_0008968 3300046500 Bacteria 4419
418 Ga0495596_0025745 3300046500 Bacteria 2376
419 Ga0495583_0004383 3300046506 Bacteria 10142
420 Ga0495606_0011856 3300046507 Bacteria 7055
421 Ga0495606_0011920 3300046507 Bacteria 7031
422 Ga0495606_0052857 3300046507 Bacteria 2639
423 Ga0495608_0007702 3300046511 Bacteria 7588
424 Ga0495610_0009859 3300046512 Bacteria 5982
425 Ga0495616_0026028 3300046513 Bacteria 3118
426 Ga0495616_0045571 3300046513 Bacteria 2218
427 Ga0495618_0002329 3300046514 Bacteria 12275
428 Ga0495618_0011733 3300046514 Bacteria 5319
429 Ga0495620_0013968 3300046515 Bacteria 4095
430 Ga0495628_0002415 3300046516 Bacteria 16855
431 Ga0495628_0021289 3300046516 Bacteria 5337
432 Ga0495628_0032206 3300046516 Bacteria 4233
433 Ga0495628_0109822 3300046516 Bacteria 2122
434 Ga0495628_0128017 3300046516 Bacteria 1944
435 Ga0495630_0001539 3300046517 Bacteria 16004
436 Ga0495630_0007406 3300046517 Bacteria 7843
437 Ga0495630_0013682 3300046517 Bacteria 5899
438 Ga0495630_0052055 3300046517 Bacteria 3065
439 Ga0495631_0039899 3300046518 Bacteria 2080
440 Ga0495644_0010933 3300046523 Bacteria 3497
441 Ga0495648_0019102 3300046524 Bacteria 4832
442 Ga0495648_0152403 3300046524 Bacteria 1204
443 Ga0495666_0000247 3300046526 Bacteria 23327
444 Ga0495666_0002749 3300046526 Bacteria 8790
445 Ga0495666_0042441 3300046526 Bacteria 2199
446 Ga0495666_0076575 3300046526 Bacteria 1586
447 Ga0495642_0004221 3300046528 Bacteria 5596
448 Ga0495642_0007985 3300046528 Bacteria 4050
449 Ga0495642_0013271 3300046528 Bacteria 3184
450 Ga0495642_0072561 3300046528 Bacteria 1441
451 Ga0495642_0086749 3300046528 Bacteria 1322
452 Ga0495652_0025529 3300046529 Bacteria 5225
453 Ga0495652_0027681 3300046529 Bacteria 4993
454 Ga0495652_0100968 3300046529 Bacteria 2339
455 Ga0495654_0008980 3300046530 Bacteria 5488
456 Ga0495654_0022582 3300046530 Bacteria 3265
457 Ga0495665_0000978 3300046531 Bacteria 15148
458 Ga0495665_0005187 3300046531 Bacteria 7023
459 Ga0495665_0048037 3300046531 Bacteria 2263
460 Ga0495640_0013871 3300046533 Bacteria 6118
461 Ga0495640_0016625 3300046533 Bacteria 5501
462 Ga0495640_0033431 3300046533 Bacteria 3652
463 Ga0495586_0008140 3300046535 Bacteria 5587
464 Ga0495586_0150422 3300046535 Bacteria 1309
465 Ga0495587_0004211 3300046536 Bacteria 9519
466 Ga0495587_0022486 3300046536 Bacteria 3882
467 Ga0495609_0014989 3300046538 Bacteria 3634
468 Ga0495597_0008640 3300046542 Bacteria 5094
469 Ga0495597_0019255 3300046542 Bacteria 3196
470 Ga0495597_0023728 3300046542 Bacteria 2836
471 Ga0495645_0000728 3300046543 Bacteria 22551
472 Ga0495645_0000886 3300046543 Bacteria 20409
473 Ga0495645_0002412 3300046543 Bacteria 12683
474 Ga0495645_0027927 3300046543 Bacteria 4099
475 Ga0495645_0047783 3300046543 Bacteria 3117
476 Ga0495622_0000140 3300046557 Bacteria 62347
477 Ga0495622_0072620 3300046557 Bacteria 1588
478 Ga0495633_0000353 3300046558 Bacteria 50204
479 Ga0495667_0264496 3300046559 Bacteria 1093
480 Ga0495668_0167612 3300046616 Bacteria 1203
481 Ga0495634_0004526 3300046642 Bacteria 10891
482 Ga0495634_0022640 3300046642 Bacteria 4426
483 Ga0495625_0035464 3300046660 Bacteria 3677
484 Ga0495635_0002465 3300046663 Bacteria 12635
485 Ga0495635_0023014 3300046663 Bacteria 4343
486 Ga0495635_0164820 3300046663 Bacteria 1508
487 Ga0495661_0003608 3300046665 Bacteria 11396
488 Ga0495661_0008447 3300046665 Bacteria 7122
489 Ga0495661_0046385 3300046665 Bacteria 2653
490 Ga0495661_0050512 3300046665 Bacteria 2517
491 Ga0495588_0020489 3300046674 Bacteria 3251
492 Ga0495588_0106198 3300046674 Bacteria 1478
493 Ga0495657_0084847 3300046675 Bacteria 2042
494 Ga0495599_0026652 3300046678 Bacteria 3623
495 Ga0495599_0036027 3300046678 Bacteria 3106
496 Ga0495623_0004544 3300046679 Bacteria 9111
497 Ga0495623_0006073 3300046679 Bacteria 7851
498 Ga0495623_0019998 3300046679 Bacteria 4328
499 Ga0495646_0003240 3300046680 Bacteria 10117
500 Ga0495646_0006087 3300046680 Bacteria 7651
501 Ga0495646_0015998 3300046680 Bacteria 4761
502 Ga0495646_0016386 3300046680 Bacteria 4702
503 Ga0495646_0016650 3300046680 Bacteria 4668
504 Ga0495669_0000228 3300046684 Bacteria 33234
505 Ga0495669_0013602 3300046684 Bacteria 3471
506 Ga0495669_0044426 3300046684 Bacteria 1979
507 Ga0495613_0007006 3300046689 Bacteria 8396
508 Ga0495613_0052317 3300046689 Bacteria 3008
509 Ga0495624_0000346 3300046690 Bacteria 36774
510 Ga0495624_0002771 3300046690 Bacteria 13171
511 Ga0495624_0010869 3300046690 Bacteria 6274
512 Ga0495624_0043231 3300046690 Bacteria 2874
513 Ga0495624_0044109 3300046690 Bacteria 2843
514 Ga0495670_0050516 3300046691 Bacteria 2082
515 Ga0495671_0013009 3300046692 Bacteria 4525
516 Ga0495671_0014195 3300046692 Bacteria 4293
517 Ga0495671_0060469 3300046692 Bacteria 1870
518 Ga0495649_0006454 3300046694 Bacteria 7303
519 Ga0495649_0015713 3300046694 Bacteria 4304
520 Ga0495649_0016992 3300046694 Bacteria 4117
521 Ga0495649_0017374 3300046694 Bacteria 4059
522 Ga0495649_0021983 3300046694 Bacteria 3572
523 Ga0495649_0027574 3300046694 Bacteria 3150
524 Ga0495649_0111342 3300046694 Bacteria 1452
525 Ga0495649_0127063 3300046694 Bacteria 1346
526 Ga0495589_0008041 3300046794 Bacteria 5516
527 Ga0495589_0011191 3300046794 Bacteria 4656
528 Ga0495589_0011609 3300046794 Bacteria 4573
529 Ga0495589_0042293 3300046794 Bacteria 2271
530 Ga0495589_0083086 3300046794 Bacteria 1557
531 Ga0495589_0127314 3300046794 Bacteria 1224
532 Ga0495600_0007206 3300046809 Bacteria 6789
533 Ga0495581_0000497 3300047315 Bacteria 20079
534 Ga0495581_0003779 3300047315 Bacteria 8709
535 Ga0495581_0005780 3300047315 Bacteria 7171
536 Ga0495581_0013341 3300047315 Bacteria 4764
537 Ga0495581_0041335 3300047315 Bacteria 2668
538 Ga0495581_0041636 3300047315 Bacteria 2659
539 Ga0495604_0002218 3300047317 Bacteria 15548
540 Ga0495604_0002466 3300047317 Bacteria 14788
541 Ga0495604_0010126 3300047317 Bacteria 7468
542 Ga0495604_0017290 3300047317 Bacteria 5771
543 Ga0495604_0049126 3300047317 Bacteria 3279
544 Ga0495604_0158176 3300047317 Bacteria 1603
545 Ga0495674_0003027 3300047319 Bacteria 16366
546 Ga0495674_0015099 3300047319 Bacteria 7225
547 Ga0495674_0032791 3300047319 Bacteria 4707
548 Ga0495674_0045197 3300047319 Bacteria 3910
549 Ga0495674_0102222 3300047319 Bacteria 2437
550 Ga0495674_0118513 3300047319 Bacteria 2238
551 Ga0495672_0022883 3300047320 Bacteria 4054
552 Ga0495672_0028495 3300047320 Bacteria 3532
553 Ga0495672_0028953 3300047320 Bacteria 3495
554 Ga0495672_0057945 3300047320 Bacteria 2247
555 Ga0495672_0083369 3300047320 Bacteria 1776
556 Ga0495676_0000180 3300047321 Bacteria 49779
557 Ga0495676_0003897 3300047321 Bacteria 13565
558 Ga0495676_0028906 3300047321 Bacteria 4727
559 Ga0495676_0080548 3300047321 Bacteria 2472
560 Ga0495676_0124642 3300047321 Bacteria 1868
561 Ga0495680_0003480 3300047322 Bacteria 15478
562 Ga0495680_0003540 3300047322 Bacteria 15308
563 Ga0495680_0015815 3300047322 Bacteria 6495
564 Ga0495683_0004510 3300047323 Bacteria 7889
565 Ga0495683_0005695 3300047323 Bacteria 6882
566 Ga0495683_0006341 3300047323 Bacteria 6465
567 Ga0495683_0010772 3300047323 Bacteria 4822
568 Ga0495683_0026301 3300047323 Bacteria 2978
569 Ga0495683_0036522 3300047323 Bacteria 2493
570 Ga0495683_0115056 3300047323 Bacteria 1281
571 Ga0495687_000029 3300047443 Bacteria 293244
572 Ga0495687_000069 3300047443 Bacteria 159852
573 Ga0495687_008012 3300047443 Bacteria 6115
574 Ga0495687_033147 3300047443 Bacteria 2347
575 Ga0495687_041609 3300047443 Bacteria 2014
576 Ga0495687_054910 3300047443 Bacteria 1668
577 Ga0495675_0001013 3300047444 Bacteria 17088
578 Ga0495675_0004530 3300047444 Bacteria 8426
579 Ga0495675_0005353 3300047444 Bacteria 7821
580 Ga0495675_0007707 3300047444 Bacteria 6639
581 Ga0495675_0048610 3300047444 Bacteria 2698
582 Ga0495679_000117 3300047446 Bacteria 69653
583 Ga0495679_001343 3300047446 Bacteria 14201
584 Ga0495679_004804 3300047446 Bacteria 6114
585 Ga0495673_0006174 3300047469 Bacteria 7096
586 Ga0495673_0013634 3300047469 Bacteria 4258
587 Ga0495673_0015893 3300047469 Bacteria 3863
588 Ga0495681_0034390 3300047470 Bacteria 2526
589 Ga0495681_0042134 3300047470 Bacteria 2212
590 Ga0495686_0000143 3300047472 Bacteria 143037
591 Ga0495686_0056666 3300047472 Bacteria 2448
592 Ga0495686_0214417 3300047472 Bacteria 1098
593 Ga0495593_0001204 3300047673 Bacteria 15122
594 Ga0495593_0002984 3300047673 Bacteria 10188
595 Ga0495593_0003439 3300047673 Bacteria 9479
596 Ga0495593_0005141 3300047673 Bacteria 7735
597 Ga0495593_0033182 3300047673 Bacteria 2812
598 Ga0495602_0000199 3300048088 Bacteria 55862
599 Ga0495602_0002585 3300048088 Bacteria 18476
600 Ga0495602_0006600 3300048088 Bacteria 12159
601 Ga0495602_0022235 3300048088 Bacteria 6213
602 Ga0495602_0062536 3300048088 Bacteria 3229
603 Ga0495602_0076516 3300048088 Bacteria 2835
604 Ga0495602_0190589 3300048088 Bacteria 1572
605 Ga0495614_0002425 3300048089 Bacteria 8282
606 Ga0495614_0003403 3300048089 Bacteria 7116
607 Ga0495614_0006988 3300048089 Bacteria 5040
608 Ga0495614_0010970 3300048089 Bacteria 3986
609 Ga0495614_0015459 3300048089 Bacteria 3327
610 Ga0495626_0015983 3300048091 Bacteria 3826
611 Ga0495626_0018709 3300048091 Bacteria 3471
612 Ga0495626_0024851 3300048091 Bacteria 2933
613 Ga0496100_0003210 3300048903 Bacteria 8486
614 Ga0496100_0006374 3300048903 Bacteria 6430
615 Ga0496100_0034221 3300048903 Bacteria 3186
616 Ga0496101_0002176 3300048904 Bacteria 11960
617 Ga0496101_0002632 3300048904 Bacteria 11027
618 Ga0496101_0006655 3300048904 Bacteria 7453
619 Ga0496101_0031118 3300048904 Bacteria 3749
620 Ga0496101_0424503 3300048904 Bacteria 1048
621 Ga0496102_0000955 3300048905 Bacteria 27231
622 Ga0496102_0015162 3300048905 Bacteria 6708
623 Ga0496102_0022810 3300048905 Bacteria 5550
624 Ga0496102_0045231 3300048905 Bacteria 3996
625 Ga0496102_0115125 3300048905 Bacteria 2509
626 Ga0496102_0149240 3300048905 Bacteria 2196
627 Ga0496103_0000338 3300048906 Bacteria 42786
628 Ga0496103_0004052 3300048906 Bacteria 8906
629 Ga0496103_0006828 3300048906 Bacteria 6812
630 Ga0496103_0013968 3300048906 Bacteria 4766
631 Ga0496104_0095561 3300048907 Bacteria 2843
632 Ga0496105_0024010 3300048908 Bacteria 4952
633 Ga0496105_0024408 3300048908 Bacteria 4911
634 Ga0496105_0026268 3300048908 Bacteria 4748
635 Ga0496105_0049948 3300048908 Bacteria 3455
636 Ga0496105_0072622 3300048908 Bacteria 2843
637 Ga0496106_0000001 3300048909 Bacteria 497458
638 Ga0496106_0001944 3300048909 Bacteria 15500
639 Ga0496106_0309513 3300048909 Bacteria 1267
640 Ga0496107_0002965 3300048910 Bacteria 11239
641 Ga0496107_0063063 3300048910 Bacteria 2685
642 Ga0496107_0218764 3300048910 Bacteria 1417
643 Ga0496109_0052376 3300048912 Bacteria 3720
644 Ga0496109_0577087 3300048912 Bacteria 1060
645 Ga0496110_0117344 3300048913 Bacteria 2396
646 Ga0496110_0166694 3300048913 Bacteria 1998
647 Ga0496110_0187716 3300048913 Bacteria 1877
648 Ga0496110_0209218 3300048913 Bacteria 1773
649 Ga0496110_0315172 3300048913 Bacteria 1424
650 Ga0496111_0011970 3300048914 Bacteria 5863
651 Ga0496111_0051941 3300048914 Bacteria 2960
652 Ga0496112_0039003 3300048915 Bacteria 4640
653 Ga0496113_0109919 3300048916 Bacteria 2144
654 Ga0496114_0005431 3300048917 Bacteria 9972
655 Ga0496114_0079787 3300048917 Bacteria 2763
656 Ga0496114_0242643 3300048917 Bacteria 1585
657 Ga0496114_0366820 3300048917 Bacteria 1274
658 Ga0496114_0542224 3300048917 Bacteria 1028
659 Ga0496115_0037391 3300048918 Bacteria 3847
660 Ga0496115_0180048 3300048918 Bacteria 1748
661 Ga0496115_0193580 3300048918 Bacteria 1680
662 Ga0496116_0002490 3300048919 Bacteria 19299
663 Ga0496116_0023479 3300048919 Bacteria 4591
664 Ga0496116_0064789 3300048919 Bacteria 2347
665 Ga0496117_0000005 3300048920 Bacteria 777468
666 Ga0496117_0002765 3300048920 Bacteria 21479
667 Ga0496117_0003919 3300048920 Bacteria 16853
668 Ga0496117_0007290 3300048920 Bacteria 10863
669 Ga0496117_0017379 3300048920 Bacteria 6006
670 Ga0496117_0025441 3300048920 Bacteria 4654
671 Ga0496117_0027959 3300048920 Bacteria 4375
672 Ga0496118_0000031 3300048921 Bacteria 339329
673 Ga0496118_0000215 3300048921 Bacteria 100753
674 Ga0496118_0001206 3300048921 Bacteria 39812
675 Ga0496118_0003051 3300048921 Bacteria 21551
676 Ga0496118_0006556 3300048921 Bacteria 12726
677 Ga0496118_0015186 3300048921 Bacteria 7150
678 Ga0496118_0035740 3300048921 Bacteria 4028
679 Ga0496118_0096852 3300048921 Bacteria 2009
680 Ga0496118_0100916 3300048921 Bacteria 1950
681 Ga0496119_0033957 3300048922 Bacteria 3370
682 Ga0496121_0001279 3300048924 Bacteria 43329
683 Ga0496121_0002026 3300048924 Bacteria 32144
684 Ga0496121_0004114 3300048924 Bacteria 19942
685 Ga0496121_0008458 3300048924 Bacteria 12085
686 Ga0496121_0009536 3300048924 Bacteria 11121
687 Ga0496121_0010944 3300048924 Bacteria 10133
688 Ga0496121_0014329 3300048924 Bacteria 8425
689 Ga0496121_0015334 3300048924 Bacteria 8040
690 Ga0496122_0001300 3300048925 Bacteria 41219
691 Ga0496122_0012369 3300048925 Bacteria 8512
692 Ga0496122_0030969 3300048925 Bacteria 4466
693 Ga0496122_0052429 3300048925 Bacteria 3088
694 Ga0496123_0003538 3300048926 Bacteria 17374
695 Ga0496123_0020942 3300048926 Bacteria 5097
696 Ga0496123_0057080 3300048926 Bacteria 2545
697 Ga0496124_0029873 3300048927 Bacteria 4848
698 Ga0496124_0043284 3300048927 Bacteria 3871
699 Ga0496124_0124513 3300048927 Bacteria 2055
700 Ga0496124_0146946 3300048927 Bacteria 1854
701 Ga0496124_0177307 3300048927 Bacteria 1644
702 Ga0496125_0006279 3300048928 Bacteria 12915
703 Ga0496126_0000032 3300048929 Bacteria 372456
704 Ga0496126_0002361 3300048929 Bacteria 25765
705 Ga0496126_0002530 3300048929 Bacteria 24476
706 Ga0496126_0021102 3300048929 Bacteria 6369
707 Ga0496126_0231437 3300048929 Bacteria 1548
708 Ga0495682_0008882 3300049460 Bacteria 3944
709 Ga0501031_0069401 3300049568 Bacteria 2295
710 Ga0501032_0012186 3300049569 Bacteria 6156
711 Ga0501039_0155001 3300049575 Bacteria 1799
712 Ga0501041_0010572 3300049577 Bacteria 5442
713 Ga0501266_000285 3300049763 Bacteria 6659
714 nmdc:mga00v17_5260_c1 3300050491 Bacteria 2503
715 nmdc:mga06z11_3711_c1 3300050494 Bacteria 5932
716 Ga0500651_0014592 3300053093 Bacteria 4809
717 Ga0500641_0021153 3300053096 Bacteria 2475
718 Ga0500556_0058478 3300053104 Bacteria 1414
719 Ga0500609_001160 3300053731 Bacteria 3920
720 Ga0466962_0001441 3300061719 Bacteria 11091
721 Ga0466962_0003879 3300061719 Bacteria 7145
722 Ga0466962_0042067 3300061719 Bacteria 2186

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009036 Ga0105244_10001991 Ga0105244_1000199114 274
2 3300048927 Ga0496124_0146946 Ga0496124_0146946_673_1650 274
3 3300046507 Ga0495606_0011920 Ga0495606_0011920_2552_3511 286
4 3300046459 Ga0495629_0073392 Ga0495629_0073392_1113_2048 287
5 3300046473 Ga0495582_0012847 Ga0495582_0012847_1255_2190 287
6 3300046491 Ga0495584_0006971 Ga0495584_0006971_3012_3944 287
7 3300046492 Ga0495585_0061255 Ga0495585_0061255_763_1698 287
8 3300046499 Ga0495594_0009835 Ga0495594_0009835_593_1528 287
9 3300046500 Ga0495596_0006629 Ga0495596_0006629_1859_2791 287
10 3300046513 Ga0495616_0045571 Ga0495616_0045571_298_1233 287
11 3300046518 Ga0495631_0039899 Ga0495631_0039899_227_1162 287
12 3300046523 Ga0495644_0010933 Ga0495644_0010933_1014_1949 287
13 3300046660 Ga0495625_0035464 Ga0495625_0035464_1221_2156 287
14 3300046665 Ga0495661_0046385 Ga0495661_0046385_478_1413 287
15 3300046684 Ga0495669_0000228 Ga0495669_0000228_24572_25504 287
16 3300046691 Ga0495670_0050516 Ga0495670_0050516_35_970 287
17 3300046694 Ga0495649_0016992 Ga0495649_0016992_1418_2353 287
18 3300047315 Ga0495581_0003779 Ga0495581_0003779_4467_5402 287
19 3300047320 Ga0495672_0022883 Ga0495672_0022883_1627_2562 287
20 3300047323 Ga0495683_0036522 Ga0495683_0036522_400_1335 287
21 3300048089 Ga0495614_0006988 Ga0495614_0006988_2999_3934 287
22 3300048091 Ga0495626_0018709 Ga0495626_0018709_2519_3451 287
23 3300003322 rootL2_10159651 rootL2_101596512 289
24 3300028800 Ga0265338_10000092 Ga0265338_100000929 289
25 3300046557 Ga0495622_0072620 Ga0495622_0072620_454_1386 289
26 3300047321 Ga0495676_0000180 Ga0495676_0000180_23417_24349 289
27 3300049763 Ga0501266_000285 Ga0501266_000285_490_1422 289
28 iso_pu_bacteria 2857357740 2857357936 289
29 3300025919 Ga0207657_10156726 Ga0207657_101567263 290
30 3300025932 Ga0207690_10200759 Ga0207690_102007592 290
31 3300026116 Ga0207674_10364764 Ga0207674_103647642 290
32 3300031251 Ga0265327_10000908 Ga0265327_1000090816 290
33 3300042008 Ga0439450_017898 Ga0439450_017898_518_1444 290
34 3300042157 Ga0439458_0003074 Ga0439458_0003074_1412_2335 290
35 3300003775 Ga0055524_1000003 Ga0055524_1000003152 291
36 3300005262 Ga0065165_1016609 Ga0065165_10166092 291
37 3300006948 Ga0099826_10000002 Ga0099826_10000002599 291
38 3300025299 Ga0209256_1000007 Ga0209256_1000007212 291
39 3300027666 Ga0209282_1000001 Ga0209282_1000001554 291
40 3300046542 Ga0495597_0019255 Ga0495597_0019255_300_1397 291
41 3300046616 Ga0495668_0167612 Ga0495668_0167612_235_1179 291
42 3300047443 Ga0495687_054910 Ga0495687_054910_41_1138 291
43 iso_pu_bacteria 2952252522 2952253515 291
44 3300037471 Ga0395905_0008919 Ga0395905_0008919_259_1203 292
45 3300044683 Ga0466965_0068246 Ga0466965_0068246_180_1118 292
46 3300048913 Ga0496110_0315172 Ga0496110_0315172_113_1042 292
47 3300048917 Ga0496114_0242643 Ga0496114_0242643_539_1468 292
48 3300046474 Ga0495605_0012770 Ga0495605_0012770_1054_1995 293
49 3300046491 Ga0495584_0019480 Ga0495584_0019480_1923_2864 293
50 3300046528 Ga0495642_0007985 Ga0495642_0007985_579_1520 293
51 3300046530 Ga0495654_0022582 Ga0495654_0022582_1405_2346 293
52 3300046538 Ga0495609_0014989 Ga0495609_0014989_166_1107 293
53 3300046542 Ga0495597_0023728 Ga0495597_0023728_407_1348 293
54 3300047320 Ga0495672_0028495 Ga0495672_0028495_1563_2504 293
55 iso_pu_bacteria 2808606418 2809144003 293
56 3300003215 JGI25153J46596_10000022 JGI25153J46596_1000002289 294
57 3300005844 Ga0068862_100001216 Ga0068862_10000121612 294
58 3300009176 Ga0105242_10096020 Ga0105242_100960203 294
59 3300025297 Ga0209758_1000005 Ga0209758_1000005473 294
60 3300025934 Ga0207686_10056102 Ga0207686_100561023 294
61 3300028380 Ga0268265_10001163 Ga0268265_1000116315 294
62 3300048927 Ga0496124_0124513 Ga0496124_0124513_52_975 294
63 3300053731 Ga0500609_001160 Ga0500609_001160_547_1467 294
64 iso_pu_bacteria 2547132374 2548500584 294
65 iso_pu_bacteria 2551306416 2553003466 294
66 iso_pu_bacteria 2643221570 2643864416 294
67 iso_pu_bacteria 2643221717 2644646868 294
68 iso_pu_bacteria 2811994881 2812367490 294
69 iso_pu_bacteria 2818991449 2819614423 294
70 iso_pu_bacteria 2904530477 2904534047 294
71 iso_pu_bacteria 2904584206 2904589112 294
72 iso_pu_bacteria 2904589729 2904590406 294
73 iso_pu_bacteria 2904601388 2904603725 294
74 iso_pu_bacteria 2919079590 2919080269 294
75 iso_pu_bacteria 2923510766 2923511587 294
76 iso_pu_bacteria 2923519811 2923521539 294
77 iso_pu_bacteria 2928115317 2928119915 294
78 iso_pu_bacteria 2928130867 2928131518 294
79 iso_pu_bacteria 2510065055 2510291445 295
80 iso_pu_bacteria 2510065058 2510310518 295
81 iso_pu_bacteria 2773857672 2774131035 295
82 iso_pu_bacteria 2917832318 2917835644 295
83 iso_pu_bacteria 2919125081 2919129866 295
84 iso_pu_bacteria 2984499530 2984502196 295
85 iso_pu_bacteria 2984504281 2984509154 295
86 iso_pu_bacteria 3007252601 3007256655 295
87 iso_pu_bacteria 3007315729 3007319104 295
88 iso_pu_bacteria 8016728285 8016728521 295
89 3300005288 Ga0065714_10074278 Ga0065714_100742783 296
90 3300006195 Ga0075366_10102184 Ga0075366_101021843 296
91 3300014497 Ga0182008_10000827 Ga0182008_1000082722 296
92 3300015261 Ga0182006_1000033 Ga0182006_1000033116 296
93 3300015262 Ga0182007_10000281 Ga0182007_1000028121 296
94 3300015265 Ga0182005_1000024 Ga0182005_1000024107 296
95 3300031548 Ga0307408_100064190 Ga0307408_1000641902 296
96 3300031731 Ga0307405_10079987 Ga0307405_100799871 296
97 3300031824 Ga0307413_10178399 Ga0307413_101783991 296
98 3300031852 Ga0307410_10089845 Ga0307410_100898452 296
99 3300031911 Ga0307412_10046127 Ga0307412_100461272 296
100 3300032002 Ga0307416_100088004 Ga0307416_1000880041 296
101 3300032005 Ga0307411_10008361 Ga0307411_100083613 296
102 3300039447 Ga0436361_0580152 Ga0436361_0580152_1610_2530 296
103 3300042145 Ga0450906_006299 Ga0450906_006299_618_1532 296
104 3300042531 Ga0450918_001218 Ga0450918_001218_3542_4456 296
105 3300048914 Ga0496111_0051941 Ga0496111_0051941_165_1151 296
106 3300048920 Ga0496117_0000005 Ga0496117_0000005_643448_644434 296
107 3300048921 Ga0496118_0000031 Ga0496118_0000031_133035_134021 296
108 3300048924 Ga0496121_0009536 Ga0496121_0009536_9007_9993 296
109 3300048925 Ga0496122_0001300 Ga0496122_0001300_13504_14490 296
110 3300048926 Ga0496123_0003538 Ga0496123_0003538_1996_2982 296
111 3300048927 Ga0496124_0043284 Ga0496124_0043284_2487_3473 296
112 iso_pu_bacteria 2738541297 2738829961 296
113 iso_pu_bacteria 2738541357 2739153757 296
114 iso_pu_bacteria 2738543003 2739195677 296
115 iso_pu_bacteria 2738543026 2739322153 296
116 iso_pu_bacteria 2738543029 2739340394 296
117 iso_pu_bacteria 2821131069 2821131904 296
118 iso_pu_bacteria 2842711865 2842715608 296
119 iso_pu_bacteria 2857558681 2857561749 296
120 iso_pu_bacteria 2904424332 2904425648 296
121 iso_pu_bacteria 2919476304 2919478212 296
122 3300005539 Ga0068853_100458756 Ga0068853_1004587561 297
123 3300046694 Ga0495649_0111342 Ga0495649_0111342_366_1316 297
124 3300053093 Ga0500651_0014592 Ga0500651_0014592_3349_4299 297
125 3300053096 Ga0500641_0021153 Ga0500641_0021153_480_1451 297
126 3300053104 Ga0500556_0058478 Ga0500556_0058478_138_1088 297
127 iso_pu_bacteria 2643221645 2644251547 297
128 3300003751 Ga0055538_1000002 Ga0055538_1000002219 298
129 3300003752 Ga0055539_1000002 Ga0055539_1000002219 298
130 3300003756 Ga0055533_1000004 Ga0055533_1000004219 298
131 3300003759 Ga0055525_1000002 Ga0055525_1000002219 298
132 3300003841 Ga0055541_1000002 Ga0055541_1000002623 298
133 3300005339 Ga0070660_100006481 Ga0070660_1000064815 298
134 3300005564 Ga0070664_100035576 Ga0070664_1000355765 298
135 3300009148 Ga0105243_10050427 Ga0105243_100504274 298
136 3300009174 Ga0105241_10029822 Ga0105241_100298223 298
137 3300009176 Ga0105242_10005895 Ga0105242_1000589511 298
138 3300009545 Ga0105237_10193823 Ga0105237_101938233 298
139 3300013102 Ga0157371_10341236 Ga0157371_103412362 298
140 3300015261 Ga0182006_1000529 Ga0182006_100052924 298
141 3300015261 Ga0182006_1019112 Ga0182006_10191122 298
142 3300021361 Ga0213872_10009130 Ga0213872_100091303 298
143 3300025224 Ga0209784_100002 Ga0209784_100002452 298
144 3300025225 Ga0209566_100003 Ga0209566_100003452 298
145 3300025226 Ga0209674_100004 Ga0209674_100004452 298
146 3300025230 Ga0209563_100006 Ga0209563_100006452 298
147 3300025253 Ga0209677_100003 Ga0209677_100003452 298
148 3300025909 Ga0207705_10007441 Ga0207705_100074417 298
149 3300025911 Ga0207654_10004588 Ga0207654_100045886 298
150 3300025919 Ga0207657_10061594 Ga0207657_100615943 298
151 3300025920 Ga0207649_10012810 Ga0207649_100128103 298
152 3300025933 Ga0207706_10096897 Ga0207706_100968971 298
153 3300025934 Ga0207686_10007886 Ga0207686_100078864 298
154 3300025942 Ga0207689_10211609 Ga0207689_102116092 298
155 3300025945 Ga0207679_10036895 Ga0207679_100368953 298
156 3300025949 Ga0207667_10065063 Ga0207667_100650633 298
157 3300026142 Ga0207698_10014639 Ga0207698_100146395 298
158 3300027312 Ga0209371_1000781 Ga0209371_100078112 298
159 3300028380 Ga0268265_10009141 Ga0268265_100091414 298
160 3300030500 Ga0268256_1000366 Ga0268256_100036627 298
161 3300031250 Ga0265331_10000178 Ga0265331_1000017833 298
162 3300037418 Ga0395900_0029868 Ga0395900_0029868_3791_4717 298
163 3300037418 Ga0395900_0133779 Ga0395900_0133779_130_1053 298
164 3300037466 Ga0395898_0027791 Ga0395898_0027791_977_1903 298
165 3300037466 Ga0395898_0108313 Ga0395898_0108313_736_1659 298
166 3300037471 Ga0395905_0014187 Ga0395905_0014187_3791_4717 298
167 3300037471 Ga0395905_0016137 Ga0395905_0016137_965_1900 298
168 3300038443 Ga0395901_0000824 Ga0395901_0000824_19596_20522 298
169 3300039447 Ga0436361_0061959 Ga0436361_0061959_6651_7577 298
170 3300041512 Ga0451853_3073345 Ga0451853_3073345_180_1136 298
171 3300042005 Ga0439448_0002423 Ga0439448_0002423_563_1489 298
172 3300044656 Ga0466969_0060021 Ga0466969_0060021_413_1339 298
173 3300044683 Ga0466965_0134116 Ga0466965_0134116_97_1023 298
174 3300044693 Ga0466961_0039421 Ga0466961_0039421_1170_2096 298
175 3300044694 Ga0466963_0070685 Ga0466963_0070685_348_1274 298
176 3300044706 Ga0466964_0099185 Ga0466964_0099185_168_1091 298
177 3300044735 Ga0466968_0000357 Ga0466968_0000357_4369_5295 298
178 3300044842 Ga0466957_0000032 Ga0466957_0000032_38939_39865 298
179 3300044842 Ga0466957_0020077 Ga0466957_0020077_2148_3074 298
180 3300045836 Ga0466958_0047862 Ga0466958_0047862_1343_2266 298
181 3300045976 Ga0466967_0042855 Ga0466967_0042855_438_1364 298
182 3300045976 Ga0466967_0177408 Ga0466967_0177408_272_1198 298
183 3300046455 Ga0495603_0004485 Ga0495603_0004485_6499_7443 298
184 3300046459 Ga0495629_0000088 Ga0495629_0000088_34685_35629 298
185 3300046471 Ga0495650_0001527 Ga0495650_0001527_19937_20881 298
186 3300046473 Ga0495582_0020021 Ga0495582_0020021_795_1739 298
187 3300046476 Ga0495662_0065863 Ga0495662_0065863_75_1019 298
188 3300046492 Ga0495585_0105755 Ga0495585_0105755_76_1020 298
189 3300046528 Ga0495642_0013271 Ga0495642_0013271_837_1781 298
190 3300046530 Ga0495654_0008980 Ga0495654_0008980_3735_4679 298
191 3300046543 Ga0495645_0047783 Ga0495645_0047783_868_1812 298
192 3300046684 Ga0495669_0044426 Ga0495669_0044426_237_1181 298
193 3300046692 Ga0495671_0060469 Ga0495671_0060469_679_1623 298
194 3300046694 Ga0495649_0017374 Ga0495649_0017374_1536_2480 298
195 3300046694 Ga0495649_0127063 Ga0495649_0127063_178_1122 298
196 3300046794 Ga0495589_0011609 Ga0495589_0011609_1437_2381 298
197 3300047315 Ga0495581_0041335 Ga0495581_0041335_730_1674 298
198 3300047443 Ga0495687_000069 Ga0495687_000069_128081_129025 298
199 3300047444 Ga0495675_0048610 Ga0495675_0048610_721_1665 298
200 3300047470 Ga0495681_0042134 Ga0495681_0042134_546_1490 298
201 3300048904 Ga0496101_0006655 Ga0496101_0006655_5153_6097 298
202 3300048908 Ga0496105_0024010 Ga0496105_0024010_3792_4715 298
203 3300048909 Ga0496106_0309513 Ga0496106_0309513_149_1093 298
204 3300048913 Ga0496110_0166694 Ga0496110_0166694_227_1171 298
205 3300048917 Ga0496114_0079787 Ga0496114_0079787_694_1638 298
206 3300048917 Ga0496114_0542224 Ga0496114_0542224_11_934 298
207 3300006051 Ga0075364_10060848 Ga0075364_100608484 299
208 3300021361 Ga0213872_10027618 Ga0213872_100276184 299
209 3300050491 nmdc:mga00v17_5260_c1 nmdc:mga00v17_5260_c1_1442_2353 299
210 iso_pu_bacteria 2599185239 2599740352 299
211 iso_pu_bacteria 2599185240 2599748988 299
212 iso_pu_bacteria 2599185355 2600211065 299
213 iso_pu_bacteria 2675903129 2676747194 299
214 iso_pu_bacteria 2818991452 2819635378 299
215 iso_pu_bacteria 2863421361 2863425192 299
216 iso_pu_bacteria 2870068957 2870074141 299
217 iso_pu_bacteria 2904564687 2904571596 299
218 iso_pu_bacteria 2904571731 2904578652 299
219 iso_pu_bacteria 2928157003 2928161024 299
220 iso_pu_bacteria 2928163908 2928166040 299
221 iso_pu_bacteria 2928170801 2928171051 299
222 iso_pu_bacteria 2928536128 2928536515 299
223 iso_pu_bacteria 2981990288 2981991303 299
224 iso_pu_bacteria 641736154 642413931 299
225 iso_pu_bacteria 8018845410 8018849176 299
226 iso_pu_bacteria 8020938398 8020942050 299
227 iso_pu_bacteria 8020945358 8020950047 299
228 iso_pu_bacteria 8020953355 8020957272 299
229 iso_pu_bacteria 8021120328 8021123223 299
230 iso_pu_bacteria 8039098773 8039103012 299
231 3300031239 Ga0265328_10000104 Ga0265328_1000010423 300
232 3300031240 Ga0265320_10000232 Ga0265320_1000023241 300
233 3300031241 Ga0265325_10005819 Ga0265325_100058195 300
234 3300031242 Ga0265329_10012504 Ga0265329_100125043 300
235 3300031250 Ga0265331_10004787 Ga0265331_100047876 300
236 3300031251 Ga0265327_10013812 Ga0265327_100138121 300
237 3300031344 Ga0265316_10008481 Ga0265316_100084813 300
238 3300046674 Ga0495588_0106198 Ga0495588_0106198_94_1023 300
239 3300048905 Ga0496102_0022810 Ga0496102_0022810_751_1680 300
240 3300048910 Ga0496107_0218764 Ga0496107_0218764_435_1364 300
241 3300028577 Ga0265318_10000504 Ga0265318_1000050411 301
242 3300028800 Ga0265338_10037915 Ga0265338_100379152 301
243 3300031241 Ga0265325_10004573 Ga0265325_100045733 301
244 3300031247 Ga0265340_10006288 Ga0265340_100062883 301
245 3300031344 Ga0265316_10001736 Ga0265316_100017364 301
246 3300031595 Ga0265313_10000604 Ga0265313_100006046 301
247 3300044683 Ga0466965_0006181 Ga0466965_0006181_3231_4175 301
248 3300044693 Ga0466961_0000238 Ga0466961_0000238_22988_23998 301
249 3300044719 Ga0466971_0003561 Ga0466971_0003561_3346_4356 301
250 3300044842 Ga0466957_0041778 Ga0466957_0041778_91_1101 301
251 3300045836 Ga0466958_0009905 Ga0466958_0009905_4303_5247 301
252 3300061719 Ga0466962_0003879 Ga0466962_0003879_5087_6097 301
253 3300001989 JGI24739J22299_10014841 JGI24739J22299_100148414 302
254 3300003758 Ga0055532_1002121 Ga0055532_10021212 302
255 3300003758 Ga0055532_1002497 Ga0055532_10024974 302
256 3300003758 Ga0055532_1002749 Ga0055532_10027494 302
257 3300003760 Ga0055527_1000567 Ga0055527_100056713 302
258 3300003761 Ga0055535_1000523 Ga0055535_100052330 302
259 3300003761 Ga0055535_1001427 Ga0055535_100142713 302
260 3300003762 Ga0055542_1000541 Ga0055542_10005413 302
261 3300003762 Ga0055542_1002728 Ga0055542_10027283 302
262 3300003763 Ga0055529_1000521 Ga0055529_10005213 302
263 3300003790 Ga0055528_1001920 Ga0055528_10019209 302
264 3300003856 Ga0058692_1004101 Ga0058692_10041014 302
265 3300005327 Ga0070658_10063001 Ga0070658_100630013 302
266 3300005339 Ga0070660_100000159 Ga0070660_10000015930 302
267 3300005344 Ga0070661_100058214 Ga0070661_1000582141 302
268 3300005366 Ga0070659_100000223 Ga0070659_10000022316 302
269 3300005455 Ga0070663_100001049 Ga0070663_10000104915 302
270 3300005614 Ga0068856_100058492 Ga0068856_1000584923 302
271 3300005616 Ga0068852_100030497 Ga0068852_1000304974 302
272 3300005617 Ga0068859_100000481 Ga0068859_10000048135 302
273 3300005719 Ga0068861_100036148 Ga0068861_1000361482 302
274 3300006881 Ga0068865_100243119 Ga0068865_1002431191 302
275 3300006931 Ga0097620_100000481 Ga0097620_10000048126 302
276 3300009093 Ga0105240_10003656 Ga0105240_1000365622 302
277 3300009093 Ga0105240_10191118 Ga0105240_101911182 302
278 3300010375 Ga0105239_10021326 Ga0105239_100213267 302
279 3300013105 Ga0157369_10356285 Ga0157369_103562852 302
280 3300015262 Ga0182007_10026510 Ga0182007_100265102 302
281 3300025225 Ga0209566_100443 Ga0209566_1004439 302
282 3300025228 Ga0209672_100012 Ga0209672_100012444 302
283 3300025228 Ga0209672_100063 Ga0209672_100063186 302
284 3300025229 Ga0209147_100007 Ga0209147_100007327 302
285 3300025229 Ga0209147_100077 Ga0209147_100077186 302
286 3300025229 Ga0209147_100119 Ga0209147_10011995 302
287 3300025242 Ga0209258_100014 Ga0209258_100014375 302
288 3300025242 Ga0209258_100105 Ga0209258_100105186 302
289 3300025254 Ga0209148_1000107 Ga0209148_1000107186 302
290 3300025254 Ga0209148_1002224 Ga0209148_10022248 302
291 3300025256 Ga0209759_1019850 Ga0209759_10198502 302
292 3300025272 Ga0209455_1000100 Ga0209455_1000100186 302
293 3300025272 Ga0209455_1000220 Ga0209455_10002203 302
294 3300025272 Ga0209455_1001676 Ga0209455_100167610 302
295 3300025273 Ga0209673_1000101 Ga0209673_1000101154 302
296 3300025295 Ga0209564_1003180 Ga0209564_10031806 302
297 3300025904 Ga0207647_10003580 Ga0207647_1000358012 302
298 3300025909 Ga0207705_10009968 Ga0207705_100099687 302
299 3300025913 Ga0207695_10000368 Ga0207695_1000036821 302
300 3300025919 Ga0207657_10000442 Ga0207657_1000044231 302
301 3300025924 Ga0207694_10215677 Ga0207694_102156772 302
302 3300025932 Ga0207690_10000037 Ga0207690_10000037119 302
303 3300025936 Ga0207670_10000079 Ga0207670_1000007966 302
304 3300025941 Ga0207711_10010149 Ga0207711_100101492 302
305 3300025945 Ga0207679_10055898 Ga0207679_100558983 302
306 3300025949 Ga0207667_10119869 Ga0207667_101198692 302
307 3300026067 Ga0207678_10000317 Ga0207678_1000031715 302
308 3300026075 Ga0207708_10000652 Ga0207708_1000065220 302
309 3300026089 Ga0207648_10001111 Ga0207648_1000111125 302
310 3300026118 Ga0207675_100057508 Ga0207675_1000575082 302
311 3300026142 Ga0207698_10029747 Ga0207698_100297473 302
312 3300027312 Ga0209371_1000080 Ga0209371_100008079 302
313 3300028577 Ga0265318_10000127 Ga0265318_1000012743 302
314 3300030500 Ga0268256_1000160 Ga0268256_100016055 302
315 3300031235 Ga0265330_10000112 Ga0265330_1000011251 302
316 3300031238 Ga0265332_10001836 Ga0265332_100018363 302
317 3300031239 Ga0265328_10006581 Ga0265328_100065811 302
318 3300031240 Ga0265320_10000969 Ga0265320_1000096917 302
319 3300031241 Ga0265325_10069384 Ga0265325_100693842 302
320 3300031242 Ga0265329_10001427 Ga0265329_100014275 302
321 3300031249 Ga0265339_10003001 Ga0265339_100030015 302
322 3300031250 Ga0265331_10000591 Ga0265331_1000059121 302
323 3300031344 Ga0265316_10000731 Ga0265316_100007318 302
324 3300031595 Ga0265313_10000056 Ga0265313_1000005629 302
325 3300031711 Ga0265314_10005145 Ga0265314_100051453 302
326 3300031712 Ga0265342_10000472 Ga0265342_100004728 302
327 3300037312 Ga0395899_0000065 Ga0395899_0000065_84622_85566 302
328 3300037418 Ga0395900_0014346 Ga0395900_0014346_2724_3668 302
329 3300037466 Ga0395898_0003375 Ga0395898_0003375_12525_13469 302
330 3300039437 Ga0436365_0357678 Ga0436365_0357678_544_1464 302
331 iso_pu_bacteria 2519103095 2519460695 302
332 iso_pu_bacteria 2582581311 2585293149 302
333 iso_pu_bacteria 2600255292 2601672177 302
334 iso_pu_bacteria 2816332253 2817257551 302
335 iso_pu_bacteria 2816332256 2817282045 302
336 iso_pu_bacteria 2816332286 2817451494 302
337 iso_pu_bacteria 2857547612 2857549209 302
338 iso_pu_bacteria 2885080285 2885082322 302
339 iso_pu_bacteria 2932410948 2932416253 302
340 iso_pu_bacteria 2932416698 2932422353 302
341 iso_pu_bacteria 8020807995 8020811160 302
342 iso_pu_bacteria 8040167225 8040168267 302
343 iso_pu_bacteria 8040173305 8040175947 302
344 3300009551 Ga0105238_10033930 Ga0105238_100339303 303
345 3300025302 Ga0207426_1001127 Ga0207426_10011272 303
346 3300046477 Ga0495664_0163531 Ga0495664_0163531_154_1095 303
347 3300047319 Ga0495674_0003027 Ga0495674_0003027_5657_6598 303
348 3300048903 Ga0496100_0003210 Ga0496100_0003210_2984_3988 303
349 3300048904 Ga0496101_0002176 Ga0496101_0002176_5178_6182 303
350 3300048905 Ga0496102_0015162 Ga0496102_0015162_3306_4310 303
351 3300048906 Ga0496103_0006828 Ga0496103_0006828_2068_3072 303
352 3300048909 Ga0496106_0001944 Ga0496106_0001944_7407_8411 303
353 3300048910 Ga0496107_0063063 Ga0496107_0063063_811_1815 303
354 3300048912 Ga0496109_0577087 Ga0496109_0577087_28_1032 303
355 3300048918 Ga0496115_0180048 Ga0496115_0180048_115_1119 303
356 3300048919 Ga0496116_0002490 Ga0496116_0002490_4423_5427 303
357 3300048920 Ga0496117_0027959 Ga0496117_0027959_2050_3054 303
358 3300048921 Ga0496118_0003051 Ga0496118_0003051_10109_11113 303
359 3300048924 Ga0496121_0008458 Ga0496121_0008458_10663_11667 303
360 3300048924 Ga0496121_0014329 Ga0496121_0014329_815_1810 303
361 3300048925 Ga0496122_0030969 Ga0496122_0030969_1239_2243 303
362 3300048926 Ga0496123_0020942 Ga0496123_0020942_3196_4200 303
363 iso_pu_bacteria 2501025502 2501085868 303
364 iso_pu_bacteria 2508501125 2509126504 303
365 iso_pu_bacteria 2510917013 2511088400 303
366 iso_pu_bacteria 2513237151 2513958267 303
367 iso_pu_bacteria 2856287931 2856289049 303
368 iso_pu_bacteria 2857357740 2857358597 303
369 iso_pu_bacteria 2904479285 2904482057 303
370 3300031456 Ga0307513_10260098 Ga0307513_102600982 304
371 iso_pu_bacteria 2501025501 2501076142 304
372 iso_pu_bacteria 2501025504 2501411995 304
373 iso_pu_bacteria 2510917014 2511100989 304
374 iso_pu_bacteria 2510917015 2511107265 304
375 iso_pu_bacteria 2512047030 2512349231 304
376 iso_pu_bacteria 2513237082 2513557296 304
377 iso_pu_bacteria 2513237083 2513564933 304
378 iso_pu_bacteria 2513237166 2514053692 304
379 iso_pu_bacteria 2515154122 2515680085 304
380 iso_pu_bacteria 2515154123 2515690157 304
381 iso_pu_bacteria 2515154189 2516022042 304
382 iso_pu_bacteria 2526164713 2527077234 304
383 iso_pu_bacteria 2562617112 2563060591 304
384 iso_pu_bacteria 2600255067 2600811195 304
385 iso_pu_bacteria 2711768613 2713475768 304
386 iso_pu_bacteria 2738541296 2738819359 304
387 iso_pu_bacteria 2738541298 2738831838 304
388 iso_pu_bacteria 2738541306 2738873366 304
389 iso_pu_bacteria 2738543002 2739184996 304
390 iso_pu_bacteria 2738543008 2739219965 304
391 iso_pu_bacteria 2744054900 2746087172 304
392 iso_pu_bacteria 2744054901 2746096625 304
393 iso_pu_bacteria 2751185846 2753571584 304
394 iso_pu_bacteria 2791355137 2792838806 304
395 iso_pu_bacteria 2818991450 2819619392 304
396 iso_pu_bacteria 2842324504 2842326650 304
397 iso_pu_bacteria 2842348783 2842350254 304
398 iso_pu_bacteria 2842454564 2842456974 304
399 iso_pu_bacteria 2883087390 2883089449 304
400 iso_pu_bacteria 2885270888 2885278192 304
401 iso_pu_bacteria 2900634093 2900638648 304
402 iso_pu_bacteria 2902682994 2902688070 304
403 iso_pu_bacteria 2904483920 2904486860 304
404 iso_pu_bacteria 2904615490 2904625185 304
405 iso_pu_bacteria 2919527303 2919528192 304
406 iso_pu_bacteria 2928108538 2928111585 304
407 iso_pu_bacteria 2928135762 2928138387 304
408 iso_pu_bacteria 2928503688 2928504804 304
409 iso_pu_bacteria 2945934425 2945940373 304
410 iso_pu_bacteria 2990703756 2990707501 304
411 iso_pu_bacteria 641736151 642423942 304
412 iso_pu_bacteria 642555112 642596204 304
413 iso_pu_bacteria 642555113 642615381 304
414 iso_pu_bacteria 8003955200 8003960423 304
415 iso_pu_bacteria 8055266321 8055272095 304
416 iso_pu_bacteria 8055301274 8055304879 304
417 3300005330 Ga0070690_100000275 Ga0070690_10000027533 305
418 3300005336 Ga0070680_100514102 Ga0070680_1005141021 305
419 3300005337 Ga0070682_100061331 Ga0070682_1000613311 305
420 3300005340 Ga0070689_100000376 Ga0070689_1000003765 305
421 3300005365 Ga0070688_100007098 Ga0070688_1000070986 305
422 3300005438 Ga0070701_10000088 Ga0070701_1000008810 305
423 3300005441 Ga0070700_100000542 Ga0070700_10000054220 305
424 3300005444 Ga0070694_100045181 Ga0070694_1000451812 305
425 3300005466 Ga0070685_10000777 Ga0070685_1000077717 305
426 3300005544 Ga0070686_100000294 Ga0070686_10000029431 305
427 3300009177 Ga0105248_10057346 Ga0105248_100573465 305
428 3300013297 Ga0157378_10104470 Ga0157378_101044702 305
429 3300013306 Ga0163162_10024825 Ga0163162_100248258 305
430 3300014326 Ga0157380_10021946 Ga0157380_100219465 305
431 3300014969 Ga0157376_10011117 Ga0157376_100111174 305
432 3300017792 Ga0163161_10006140 Ga0163161_100061409 305
433 3300025912 Ga0207707_10178503 Ga0207707_101785033 305
434 3300025917 Ga0207660_10404331 Ga0207660_104043311 305
435 3300032004 Ga0307414_10019331 Ga0307414_100193314 305
436 3300046516 Ga0495628_0128017 Ga0495628_0128017_606_1559 305
437 3300046558 Ga0495633_0000353 Ga0495633_0000353_8231_9217 305
438 3300046694 Ga0495649_0021983 Ga0495649_0021983_360_1277 305
439 3300047323 Ga0495683_0004510 Ga0495683_0004510_5450_6367 305
440 3300047472 Ga0495686_0000143 Ga0495686_0000143_3492_4445 305
441 3300049568 Ga0501031_0069401 Ga0501031_0069401_1249_2259 305
442 3300049569 Ga0501032_0012186 Ga0501032_0012186_377_1387 305
443 3300049575 Ga0501039_0155001 Ga0501039_0155001_37_1047 305
444 3300049577 Ga0501041_0010572 Ga0501041_0010572_4084_5073 305
445 3300006042 Ga0075368_10015920 Ga0075368_100159205 306
446 3300006178 Ga0075367_10017516 Ga0075367_100175163 306
447 3300050494 nmdc:mga06z11_3711_c1 nmdc:mga06z11_3711_c1_1560_2576 306
448 3300002067 JGI24735J21928_10001124 JGI24735J21928_100011244 307
449 3300009036 Ga0105244_10021819 Ga0105244_100218196 307
450 3300009093 Ga0105240_10088845 Ga0105240_100888456 307
451 3300009101 Ga0105247_10062765 Ga0105247_100627654 307
452 3300013105 Ga0157369_10103875 Ga0157369_101038754 307
453 3300013105 Ga0157369_10365969 Ga0157369_103659692 307
454 3300025206 Ga0209435_104465 Ga0209435_1044652 307
455 3300025302 Ga0207426_1001753 Ga0207426_100175313 307
456 3300025735 Ga0207713_1003582 Ga0207713_10035827 307
457 3300025904 Ga0207647_10048340 Ga0207647_100483403 307
458 3300025909 Ga0207705_10138342 Ga0207705_101383422 307
459 3300027312 Ga0209371_1005060 Ga0209371_10050603 307
460 3300030500 Ga0268256_1006624 Ga0268256_10066244 307
461 3300037471 Ga0395905_0019654 Ga0395905_0019654_162_1154 307
462 3300044693 Ga0466961_0041622 Ga0466961_0041622_659_1774 307
463 3300044765 Ga0466970_0029996 Ga0466970_0029996_51_1112 307
464 3300046454 Ga0495592_0090329 Ga0495592_0090329_796_1785 307
465 3300046455 Ga0495603_0001030 Ga0495603_0001030_10149_11138 307
466 3300046457 Ga0495590_0006595 Ga0495590_0006595_1993_2994 307
467 3300046458 Ga0495591_015253 Ga0495591_015253_530_1519 307
468 3300046459 Ga0495629_0000045 Ga0495629_0000045_72469_73458 307
469 3300046459 Ga0495629_0000704 Ga0495629_0000704_17420_18343 307
470 3300046459 Ga0495629_0035997 Ga0495629_0035997_2112_3113 307
471 3300046462 Ga0495651_0083711 Ga0495651_0083711_1045_2034 307
472 3300046463 Ga0495653_0001472 Ga0495653_0001472_15593_16516 307
473 3300046463 Ga0495653_0016500 Ga0495653_0016500_4900_5901 307
474 3300046471 Ga0495650_0000549 Ga0495650_0000549_3095_4084 307
475 3300046471 Ga0495650_0003550 Ga0495650_0003550_9074_10003 307
476 3300046471 Ga0495650_0015568 Ga0495650_0015568_2623_3546 307
477 3300046472 Ga0495580_0010284 Ga0495580_0010284_5145_6080 307
478 3300046472 Ga0495580_0017278 Ga0495580_0017278_1245_2168 307
479 3300046475 Ga0495639_0039876 Ga0495639_0039876_426_1415 307
480 3300046476 Ga0495662_0022356 Ga0495662_0022356_623_1612 307
481 3300046477 Ga0495664_0112956 Ga0495664_0112956_398_1363 307
482 3300046507 Ga0495606_0011856 Ga0495606_0011856_4519_5484 307
483 3300046516 Ga0495628_0021289 Ga0495628_0021289_366_1289 307
484 3300046516 Ga0495628_0032206 Ga0495628_0032206_2538_3539 307
485 3300046516 Ga0495628_0109822 Ga0495628_0109822_88_1053 307
486 3300046528 Ga0495642_0072561 Ga0495642_0072561_357_1358 307
487 3300046529 Ga0495652_0027681 Ga0495652_0027681_3957_4958 307
488 3300046531 Ga0495665_0000978 Ga0495665_0000978_9847_10848 307
489 3300046542 Ga0495597_0008640 Ga0495597_0008640_1371_2372 307
490 3300046543 Ga0495645_0000728 Ga0495645_0000728_17172_18161 307
491 3300046543 Ga0495645_0002412 Ga0495645_0002412_1554_2519 307
492 3300046663 Ga0495635_0164820 Ga0495635_0164820_455_1444 307
493 3300046678 Ga0495599_0036027 Ga0495599_0036027_1918_2883 307
494 3300046679 Ga0495623_0004544 Ga0495623_0004544_3328_4329 307
495 3300046680 Ga0495646_0006087 Ga0495646_0006087_3794_4795 307
496 3300046680 Ga0495646_0016386 Ga0495646_0016386_3627_4550 307
497 3300046684 Ga0495669_0013602 Ga0495669_0013602_1094_2059 307
498 3300046690 Ga0495624_0002771 Ga0495624_0002771_3494_4417 307
499 3300046690 Ga0495624_0010869 Ga0495624_0010869_3931_4932 307
500 3300046694 Ga0495649_0006454 Ga0495649_0006454_2501_3466 307
501 3300046794 Ga0495589_0011191 Ga0495589_0011191_687_1676 307
502 3300046794 Ga0495589_0042293 Ga0495589_0042293_48_1013 307
503 3300047315 Ga0495581_0005780 Ga0495581_0005780_5283_6272 307
504 3300047317 Ga0495604_0002466 Ga0495604_0002466_12624_13625 307
505 3300047319 Ga0495674_0032791 Ga0495674_0032791_3654_4655 307
506 3300047319 Ga0495674_0118513 Ga0495674_0118513_1062_2027 307
507 3300047320 Ga0495672_0083369 Ga0495672_0083369_349_1350 307
508 3300047322 Ga0495680_0003480 Ga0495680_0003480_10805_11806 307
509 3300047323 Ga0495683_0010772 Ga0495683_0010772_1055_2056 307
510 3300047323 Ga0495683_0115056 Ga0495683_0115056_250_1215 307
511 3300047472 Ga0495686_0214417 Ga0495686_0214417_77_1000 307
512 3300047673 Ga0495593_0001204 Ga0495593_0001204_9085_10086 307
513 3300047673 Ga0495593_0002984 Ga0495593_0002984_7433_8356 307
514 3300048088 Ga0495602_0000199 Ga0495602_0000199_26428_27429 307
515 3300048088 Ga0495602_0076516 Ga0495602_0076516_1807_2808 307
516 3300048089 Ga0495614_0015459 Ga0495614_0015459_1809_2798 307
517 3300048903 Ga0496100_0006374 Ga0496100_0006374_2952_3953 307
518 3300048904 Ga0496101_0031118 Ga0496101_0031118_1934_2923 307
519 3300048905 Ga0496102_0045231 Ga0496102_0045231_1948_2949 307
520 3300048905 Ga0496102_0115125 Ga0496102_0115125_953_1954 307
521 3300048906 Ga0496103_0004052 Ga0496103_0004052_5958_6959 307
522 3300048907 Ga0496104_0095561 Ga0496104_0095561_942_1943 307
523 3300048908 Ga0496105_0024408 Ga0496105_0024408_3092_4093 307
524 3300048908 Ga0496105_0072622 Ga0496105_0072622_496_1497 307
525 3300048910 Ga0496107_0002965 Ga0496107_0002965_6740_7741 307
526 3300048912 Ga0496109_0052376 Ga0496109_0052376_1379_2380 307
527 3300048913 Ga0496110_0117344 Ga0496110_0117344_704_1705 307
528 3300048914 Ga0496111_0011970 Ga0496111_0011970_1714_2715 307
529 3300048916 Ga0496113_0109919 Ga0496113_0109919_62_1063 307
530 3300048917 Ga0496114_0005431 Ga0496114_0005431_6449_7438 307
531 3300048918 Ga0496115_0037391 Ga0496115_0037391_205_1206 307
532 3300048918 Ga0496115_0193580 Ga0496115_0193580_674_1663 307
533 3300048919 Ga0496116_0064789 Ga0496116_0064789_642_1643 307
534 3300048920 Ga0496117_0025441 Ga0496117_0025441_3557_4558 307
535 3300048924 Ga0496121_0010944 Ga0496121_0010944_2706_3707 307
536 3300048925 Ga0496122_0012369 Ga0496122_0012369_2504_3505 307
537 3300048927 Ga0496124_0029873 Ga0496124_0029873_2147_3148 307
538 3300048928 Ga0496125_0006279 Ga0496125_0006279_10993_11994 307
539 3300048929 Ga0496126_0231437 Ga0496126_0231437_52_1053 307
540 3300001979 JGI24740J21852_10010996 JGI24740J21852_100109964 308
541 3300001989 JGI24739J22299_10001081 JGI24739J22299_100010814 308
542 3300002067 JGI24735J21928_10001745 JGI24735J21928_100017455 308
543 3300002067 JGI24735J21928_10006683 JGI24735J21928_100066835 308
544 3300002067 JGI24735J21928_10030652 JGI24735J21928_100306521 308
545 3300002075 JGI24738J21930_10001012 JGI24738J21930_100010125 308
546 3300002705 JGI25156J39149_1000135 JGI25156J39149_10001352 308
547 3300002705 JGI25156J39149_1000388 JGI25156J39149_100038813 308
548 3300002705 JGI25156J39149_1000971 JGI25156J39149_10009719 308
549 3300003214 JGI25165J46597_1002248 JGI25165J46597_10022487 308
550 3300003756 Ga0055533_1000094 Ga0055533_100009435 308
551 3300003758 Ga0055532_1000003 Ga0055532_1000003205 308
552 3300003760 Ga0055527_1000006 Ga0055527_1000006250 308
553 3300003761 Ga0055535_1000003 Ga0055535_1000003205 308
554 3300003762 Ga0055542_1000007 Ga0055542_1000007205 308
555 3300003763 Ga0055529_1000003 Ga0055529_1000003250 308
556 3300005262 Ga0065165_1002241 Ga0065165_100224115 308
557 3300005327 Ga0070658_10213133 Ga0070658_102131332 308
558 3300005339 Ga0070660_100002227 Ga0070660_10000222710 308
559 3300005339 Ga0070660_100025183 Ga0070660_1000251832 308
560 3300005366 Ga0070659_100034980 Ga0070659_1000349804 308
561 3300005563 Ga0068855_100029854 Ga0068855_1000298542 308
562 3300005563 Ga0068855_100234974 Ga0068855_1002349742 308
563 3300009011 Ga0105251_10001186 Ga0105251_1000118618 308
564 3300009093 Ga0105240_10103540 Ga0105240_101035403 308
565 3300009093 Ga0105240_10239861 Ga0105240_102398613 308
566 3300009177 Ga0105248_10279160 Ga0105248_102791602 308
567 3300009545 Ga0105237_10013944 Ga0105237_100139448 308
568 3300009551 Ga0105238_10030204 Ga0105238_100302042 308
569 3300009551 Ga0105238_10218198 Ga0105238_102181982 308
570 3300010375 Ga0105239_10005842 Ga0105239_100058426 308
571 3300013104 Ga0157370_10000632 Ga0157370_1000063225 308
572 3300013104 Ga0157370_10000999 Ga0157370_1000099923 308
573 3300013105 Ga0157369_10001964 Ga0157369_1000196411 308
574 3300013105 Ga0157369_10004136 Ga0157369_1000413613 308
575 3300013105 Ga0157369_10013941 Ga0157369_100139416 308
576 3300013105 Ga0157369_10255189 Ga0157369_102551892 308
577 3300013296 Ga0157374_10000050 Ga0157374_1000005080 308
578 3300013307 Ga0157372_10000364 Ga0157372_1000036442 308
579 3300014497 Ga0182008_10043489 Ga0182008_100434892 308
580 3300014497 Ga0182008_10070716 Ga0182008_100707162 308
581 3300014969 Ga0157376_10070466 Ga0157376_100704663 308
582 3300015262 Ga0182007_10000198 Ga0182007_1000019826 308
583 3300016635 Ga0183361_10002 Ga0183361_10002482 308
584 3300020069 Ga0197907_10060606 Ga0197907_100606062 308
585 3300020070 Ga0206356_10471300 Ga0206356_104713002 308
586 3300020082 Ga0206353_11405814 Ga0206353_114058143 308
587 3300022467 Ga0224712_10000024 Ga0224712_100000242 308
588 3300025226 Ga0209674_100025 Ga0209674_100025199 308
589 3300025226 Ga0209674_100144 Ga0209674_10014480 308
590 3300025228 Ga0209672_100002 Ga0209672_1000021102 308
591 3300025229 Ga0209147_100003 Ga0209147_1000031102 308
592 3300025230 Ga0209563_101098 Ga0209563_1010984 308
593 3300025231 Ga0207427_100538 Ga0207427_1005383 308
594 3300025242 Ga0209258_100005 Ga0209258_100005744 308
595 3300025254 Ga0209148_1000006 Ga0209148_10000061102 308
596 3300025256 Ga0209759_1000008 Ga0209759_100000827 308
597 3300025256 Ga0209759_1000014 Ga0209759_1000014253 308
598 3300025256 Ga0209759_1000094 Ga0209759_100009417 308
599 3300025256 Ga0209759_1008521 Ga0209759_10085214 308
600 3300025256 Ga0209759_1013849 Ga0209759_10138492 308
601 3300025261 Ga0209233_1000018 Ga0209233_1000018251 308
602 3300025272 Ga0209455_1000003 Ga0209455_10000031102 308
603 3300025302 Ga0207426_1000180 Ga0207426_10001805 308
604 3300025735 Ga0207713_1000590 Ga0207713_100059028 308
605 3300025904 Ga0207647_10000145 Ga0207647_1000014519 308
606 3300025904 Ga0207647_10013282 Ga0207647_100132822 308
607 3300025904 Ga0207647_10138665 Ga0207647_101386652 308
608 3300025909 Ga0207705_10001623 Ga0207705_1000162310 308
609 3300025913 Ga0207695_10020889 Ga0207695_100208896 308
610 3300025913 Ga0207695_10120922 Ga0207695_101209223 308
611 3300025914 Ga0207671_10036256 Ga0207671_100362563 308
612 3300025914 Ga0207671_10113107 Ga0207671_101131072 308
613 3300025919 Ga0207657_10006101 Ga0207657_100061018 308
614 3300025924 Ga0207694_10209671 Ga0207694_102096712 308
615 3300025932 Ga0207690_10006058 Ga0207690_100060588 308
616 3300025941 Ga0207711_10034469 Ga0207711_100344692 308
617 3300025949 Ga0207667_10008527 Ga0207667_1000852711 308
618 3300025986 Ga0207658_10090765 Ga0207658_100907652 308
619 3300028800 Ga0265338_10000159 Ga0265338_1000015953 308
620 3300031911 Ga0307412_10000039 Ga0307412_1000003918 308
621 3300037312 Ga0395899_0110795 Ga0395899_0110795_993_1937 308
622 3300037418 Ga0395900_0000015 Ga0395900_0000015_118588_119532 308
623 3300037418 Ga0395900_0036316 Ga0395900_0036316_1820_2764 308
624 3300037418 Ga0395900_0068435 Ga0395900_0068435_2154_3098 308
625 3300037466 Ga0395898_0000201 Ga0395898_0000201_5663_6607 308
626 3300037466 Ga0395898_0049751 Ga0395898_0049751_60_1004 308
627 3300037471 Ga0395905_0000052 Ga0395905_0000052_107511_108443 308
628 3300037471 Ga0395905_0119849 Ga0395905_0119849_1397_2329 308
629 3300038443 Ga0395901_0000009 Ga0395901_0000009_25107_26054 308
630 3300038443 Ga0395901_0000150 Ga0395901_0000150_41808_42752 308
631 3300038443 Ga0395901_0000556 Ga0395901_0000556_33160_34104 308
632 3300038443 Ga0395901_0144508 Ga0395901_0144508_98_1042 308
633 3300038443 Ga0395901_0144610 Ga0395901_0144610_1458_2402 308
634 3300039447 Ga0436361_0678907 Ga0436361_0678907_100_1050 308
635 3300039447 Ga0436361_0746079 Ga0436361_0746079_2174_3100 308
636 3300042005 Ga0439448_0001039 Ga0439448_0001039_1020_1964 308
637 3300044656 Ga0466969_0001231 Ga0466969_0001231_3068_4012 308
638 3300044658 Ga0466972_0064390 Ga0466972_0064390_267_1211 308
639 3300044683 Ga0466965_0002305 Ga0466965_0002305_1412_2356 308
640 3300044684 Ga0466966_0002365 Ga0466966_0002365_1880_2824 308
641 3300044684 Ga0466966_0033234 Ga0466966_0033234_2178_3122 308
642 3300044693 Ga0466961_0062638 Ga0466961_0062638_999_1943 308
643 3300044694 Ga0466963_0001623 Ga0466963_0001623_9505_10449 308
644 3300044694 Ga0466963_0005529 Ga0466963_0005529_4174_5118 308
645 3300044719 Ga0466971_0001253 Ga0466971_0001253_468_1412 308
646 3300044765 Ga0466970_0036574 Ga0466970_0036574_730_1674 308
647 3300044842 Ga0466957_0051012 Ga0466957_0051012_909_1853 308
648 3300044842 Ga0466957_0056093 Ga0466957_0056093_421_1365 308
649 3300044842 Ga0466957_0080413 Ga0466957_0080413_861_1790 308
650 3300044901 Ga0466960_0102983 Ga0466960_0102983_379_1338 308
651 3300045049 Ga0466959_0004706 Ga0466959_0004706_7917_8873 308
652 3300045049 Ga0466959_0075518 Ga0466959_0075518_1140_2084 308
653 3300045836 Ga0466958_0040295 Ga0466958_0040295_547_1491 308
654 3300045836 Ga0466958_0047467 Ga0466958_0047467_570_1514 308
655 3300045836 Ga0466958_0075325 Ga0466958_0075325_208_1152 308
656 3300045976 Ga0466967_0218047 Ga0466967_0218047_241_1185 308
657 3300046454 Ga0495592_0007730 Ga0495592_0007730_4194_5120 308
658 3300046454 Ga0495592_0055966 Ga0495592_0055966_615_1541 308
659 3300046454 Ga0495592_0090907 Ga0495592_0090907_1085_2011 308
660 3300046455 Ga0495603_0001565 Ga0495603_0001565_2839_3771 308
661 3300046455 Ga0495603_0002175 Ga0495603_0002175_9583_10509 308
662 3300046457 Ga0495590_0007224 Ga0495590_0007224_2278_3204 308
663 3300046457 Ga0495590_0010145 Ga0495590_0010145_1617_2543 308
664 3300046459 Ga0495629_0008639 Ga0495629_0008639_6137_7063 308
665 3300046459 Ga0495629_0014480 Ga0495629_0014480_4666_5592 308
666 3300046459 Ga0495629_0049934 Ga0495629_0049934_980_1906 308
667 3300046460 Ga0495638_0009449 Ga0495638_0009449_3276_4202 308
668 3300046461 Ga0495641_0026997 Ga0495641_0026997_587_1513 308
669 3300046462 Ga0495651_0004391 Ga0495651_0004391_4213_5286 308
670 3300046462 Ga0495651_0020669 Ga0495651_0020669_2176_3102 308
671 3300046462 Ga0495651_0173334 Ga0495651_0173334_572_1498 308
672 3300046463 Ga0495653_0002197 Ga0495653_0002197_4179_5105 308
673 3300046463 Ga0495653_0014385 Ga0495653_0014385_1440_2366 308
674 3300046463 Ga0495653_0041108 Ga0495653_0041108_1032_2105 308
675 3300046463 Ga0495653_0118495 Ga0495653_0118495_896_1822 308
676 3300046471 Ga0495650_0007850 Ga0495650_0007850_4160_5086 308
677 3300046472 Ga0495580_0000008 Ga0495580_0000008_8495_9421 308
678 3300046472 Ga0495580_0001335 Ga0495580_0001335_14006_14932 308
679 3300046472 Ga0495580_0035670 Ga0495580_0035670_479_1405 308
680 3300046472 Ga0495580_0042778 Ga0495580_0042778_1523_2596 308
681 3300046473 Ga0495582_0000202 Ga0495582_0000202_9308_10234 308
682 3300046473 Ga0495582_0008636 Ga0495582_0008636_2161_3087 308
683 3300046474 Ga0495605_0009179 Ga0495605_0009179_907_1839 308
684 3300046474 Ga0495605_0012959 Ga0495605_0012959_64_990 308
685 3300046474 Ga0495605_0092941 Ga0495605_0092941_302_1375 308
686 3300046476 Ga0495662_0006350 Ga0495662_0006350_389_1315 308
687 3300046477 Ga0495664_0000389 Ga0495664_0000389_17321_18247 308
688 3300046477 Ga0495664_0012294 Ga0495664_0012294_2250_3176 308
689 3300046499 Ga0495594_0091877 Ga0495594_0091877_561_1487 308
690 3300046500 Ga0495596_0002063 Ga0495596_0002063_4225_5298 308
691 3300046500 Ga0495596_0008968 Ga0495596_0008968_2239_3165 308
692 3300046500 Ga0495596_0025745 Ga0495596_0025745_80_1006 308
693 3300046506 Ga0495583_0004383 Ga0495583_0004383_6501_7427 308
694 3300046507 Ga0495606_0052857 Ga0495606_0052857_1613_2539 308
695 3300046511 Ga0495608_0007702 Ga0495608_0007702_83_1009 308
696 3300046512 Ga0495610_0009859 Ga0495610_0009859_4760_5686 308
697 3300046513 Ga0495616_0026028 Ga0495616_0026028_1272_2204 308
698 3300046514 Ga0495618_0002329 Ga0495618_0002329_1616_2542 308
699 3300046514 Ga0495618_0011733 Ga0495618_0011733_2320_3393 308
700 3300046515 Ga0495620_0013968 Ga0495620_0013968_1831_2757 308
701 3300046516 Ga0495628_0002415 Ga0495628_0002415_7592_8518 308
702 3300046517 Ga0495630_0001539 Ga0495630_0001539_7876_8802 308
703 3300046517 Ga0495630_0007406 Ga0495630_0007406_3112_4038 308
704 3300046517 Ga0495630_0013682 Ga0495630_0013682_2900_3973 308
705 3300046517 Ga0495630_0052055 Ga0495630_0052055_391_1317 308
706 3300046524 Ga0495648_0019102 Ga0495648_0019102_3123_4049 308
707 3300046524 Ga0495648_0152403 Ga0495648_0152403_132_1064 308
708 3300046526 Ga0495666_0000247 Ga0495666_0000247_3239_4165 308
709 3300046526 Ga0495666_0002749 Ga0495666_0002749_3909_4982 308
710 3300046526 Ga0495666_0042441 Ga0495666_0042441_451_1377 308
711 3300046526 Ga0495666_0076575 Ga0495666_0076575_521_1447 308
712 3300046528 Ga0495642_0004221 Ga0495642_0004221_1857_2783 308
713 3300046528 Ga0495642_0086749 Ga0495642_0086749_69_995 308
714 3300046529 Ga0495652_0025529 Ga0495652_0025529_1153_2079 308
715 3300046529 Ga0495652_0100968 Ga0495652_0100968_41_967 308
716 3300046531 Ga0495665_0005187 Ga0495665_0005187_1559_2485 308
717 3300046531 Ga0495665_0048037 Ga0495665_0048037_1269_2195 308
718 3300046533 Ga0495640_0013871 Ga0495640_0013871_2368_3294 308
719 3300046533 Ga0495640_0016625 Ga0495640_0016625_4538_5464 308
720 3300046533 Ga0495640_0033431 Ga0495640_0033431_1074_2147 308
721 3300046535 Ga0495586_0008140 Ga0495586_0008140_4233_5159 308
722 3300046535 Ga0495586_0150422 Ga0495586_0150422_72_998 308
723 3300046536 Ga0495587_0004211 Ga0495587_0004211_8293_9219 308
724 3300046536 Ga0495587_0022486 Ga0495587_0022486_850_1923 308
725 3300046543 Ga0495645_0000886 Ga0495645_0000886_8693_9619 308
726 3300046543 Ga0495645_0027927 Ga0495645_0027927_1077_2150 308
727 3300046557 Ga0495622_0000140 Ga0495622_0000140_15084_16010 308
728 3300046559 Ga0495667_0264496 Ga0495667_0264496_37_963 308
729 3300046642 Ga0495634_0004526 Ga0495634_0004526_4235_5161 308
730 3300046642 Ga0495634_0022640 Ga0495634_0022640_1289_2215 308
731 3300046663 Ga0495635_0002465 Ga0495635_0002465_3909_4835 308
732 3300046663 Ga0495635_0023014 Ga0495635_0023014_2120_3046 308
733 3300046665 Ga0495661_0003608 Ga0495661_0003608_3238_4164 308
734 3300046665 Ga0495661_0008447 Ga0495661_0008447_1976_3049 308
735 3300046665 Ga0495661_0050512 Ga0495661_0050512_480_1406 308
736 3300046674 Ga0495588_0020489 Ga0495588_0020489_1473_2399 308
737 3300046675 Ga0495657_0084847 Ga0495657_0084847_100_1026 308
738 3300046678 Ga0495599_0026652 Ga0495599_0026652_1340_2413 308
739 3300046679 Ga0495623_0006073 Ga0495623_0006073_2613_3686 308
740 3300046679 Ga0495623_0019998 Ga0495623_0019998_832_1758 308
741 3300046680 Ga0495646_0003240 Ga0495646_0003240_6068_6994 308
742 3300046680 Ga0495646_0015998 Ga0495646_0015998_2207_3133 308
743 3300046680 Ga0495646_0016650 Ga0495646_0016650_2090_3163 308
744 3300046689 Ga0495613_0007006 Ga0495613_0007006_4233_5159 308
745 3300046689 Ga0495613_0052317 Ga0495613_0052317_849_1922 308
746 3300046690 Ga0495624_0000346 Ga0495624_0000346_12749_13675 308
747 3300046690 Ga0495624_0043231 Ga0495624_0043231_1524_2597 308
748 3300046690 Ga0495624_0044109 Ga0495624_0044109_707_1633 308
749 3300046692 Ga0495671_0013009 Ga0495671_0013009_2235_3161 308
750 3300046692 Ga0495671_0014195 Ga0495671_0014195_3271_4218 308
751 3300046694 Ga0495649_0015713 Ga0495649_0015713_1311_2243 308
752 3300046694 Ga0495649_0027574 Ga0495649_0027574_1699_2625 308
753 3300046794 Ga0495589_0008041 Ga0495589_0008041_1657_2583 308
754 3300046794 Ga0495589_0083086 Ga0495589_0083086_437_1363 308
755 3300046794 Ga0495589_0127314 Ga0495589_0127314_132_1058 308
756 3300046809 Ga0495600_0007206 Ga0495600_0007206_2649_3575 308
757 3300047315 Ga0495581_0000497 Ga0495581_0000497_301_1227 308
758 3300047315 Ga0495581_0013341 Ga0495581_0013341_1467_2393 308
759 3300047315 Ga0495581_0041636 Ga0495581_0041636_1526_2599 308
760 3300047317 Ga0495604_0002218 Ga0495604_0002218_5260_6186 308
761 3300047317 Ga0495604_0010126 Ga0495604_0010126_4150_5076 308
762 3300047317 Ga0495604_0017290 Ga0495604_0017290_3051_3977 308
763 3300047317 Ga0495604_0049126 Ga0495604_0049126_1727_2653 308
764 3300047317 Ga0495604_0158176 Ga0495604_0158176_429_1355 308
765 3300047319 Ga0495674_0015099 Ga0495674_0015099_3717_4643 308
766 3300047319 Ga0495674_0045197 Ga0495674_0045197_1032_2105 308
767 3300047319 Ga0495674_0102222 Ga0495674_0102222_697_1623 308
768 3300047320 Ga0495672_0028953 Ga0495672_0028953_352_1284 308
769 3300047320 Ga0495672_0057945 Ga0495672_0057945_147_1073 308
770 3300047321 Ga0495676_0003897 Ga0495676_0003897_8354_9280 308
771 3300047321 Ga0495676_0028906 Ga0495676_0028906_416_1342 308
772 3300047321 Ga0495676_0080548 Ga0495676_0080548_325_1251 308
773 3300047321 Ga0495676_0124642 Ga0495676_0124642_697_1623 308
774 3300047322 Ga0495680_0003540 Ga0495680_0003540_10278_11204 308
775 3300047322 Ga0495680_0015815 Ga0495680_0015815_4391_5464 308
776 3300047323 Ga0495683_0005695 Ga0495683_0005695_1657_2730 308
777 3300047323 Ga0495683_0006341 Ga0495683_0006341_3267_4193 308
778 3300047323 Ga0495683_0026301 Ga0495683_0026301_506_1432 308
779 3300047443 Ga0495687_000029 Ga0495687_000029_240404_241396 308
780 3300047443 Ga0495687_008012 Ga0495687_008012_2247_3173 308
781 3300047443 Ga0495687_033147 Ga0495687_033147_1155_2081 308
782 3300047443 Ga0495687_041609 Ga0495687_041609_192_1124 308
783 3300047444 Ga0495675_0001013 Ga0495675_0001013_11834_12907 308
784 3300047444 Ga0495675_0004530 Ga0495675_0004530_4011_4937 308
785 3300047444 Ga0495675_0005353 Ga0495675_0005353_1637_2563 308
786 3300047444 Ga0495675_0007707 Ga0495675_0007707_5340_6266 308
787 3300047446 Ga0495679_000117 Ga0495679_000117_52019_52945 308
788 3300047446 Ga0495679_001343 Ga0495679_001343_4194_5267 308
789 3300047446 Ga0495679_004804 Ga0495679_004804_3123_4049 308
790 3300047469 Ga0495673_0006174 Ga0495673_0006174_1680_2753 308
791 3300047469 Ga0495673_0013634 Ga0495673_0013634_930_1862 308
792 3300047469 Ga0495673_0015893 Ga0495673_0015893_1359_2285 308
793 3300047470 Ga0495681_0034390 Ga0495681_0034390_425_1351 308
794 3300047472 Ga0495686_0056666 Ga0495686_0056666_712_1650 308
795 3300047673 Ga0495593_0003439 Ga0495593_0003439_2899_3972 308
796 3300047673 Ga0495593_0005141 Ga0495593_0005141_4569_5495 308
797 3300047673 Ga0495593_0033182 Ga0495593_0033182_801_1727 308
798 3300048088 Ga0495602_0002585 Ga0495602_0002585_10001_10927 308
799 3300048088 Ga0495602_0006600 Ga0495602_0006600_4078_5004 308
800 3300048088 Ga0495602_0022235 Ga0495602_0022235_4109_5182 308
801 3300048088 Ga0495602_0062536 Ga0495602_0062536_1705_2631 308
802 3300048088 Ga0495602_0190589 Ga0495602_0190589_198_1124 308
803 3300048089 Ga0495614_0002425 Ga0495614_0002425_4233_5159 308
804 3300048089 Ga0495614_0003403 Ga0495614_0003403_1976_3049 308
805 3300048089 Ga0495614_0010970 Ga0495614_0010970_2103_3029 308
806 3300048091 Ga0495626_0015983 Ga0495626_0015983_2022_2948 308
807 3300048091 Ga0495626_0024851 Ga0495626_0024851_790_1716 308
808 3300048903 Ga0496100_0034221 Ga0496100_0034221_2114_3046 308
809 3300048904 Ga0496101_0002632 Ga0496101_0002632_261_1193 308
810 3300048904 Ga0496101_0424503 Ga0496101_0424503_64_1017 308
811 3300048905 Ga0496102_0000955 Ga0496102_0000955_24180_25112 308
812 3300048905 Ga0496102_0149240 Ga0496102_0149240_194_1168 308
813 3300048906 Ga0496103_0000338 Ga0496103_0000338_39347_40279 308
814 3300048906 Ga0496103_0013968 Ga0496103_0013968_1532_2485 308
815 3300048908 Ga0496105_0026268 Ga0496105_0026268_653_1585 308
816 3300048908 Ga0496105_0049948 Ga0496105_0049948_2285_3217 308
817 3300048909 Ga0496106_0000001 Ga0496106_0000001_60437_61543 308
818 3300048913 Ga0496110_0187716 Ga0496110_0187716_905_1837 308
819 3300048913 Ga0496110_0209218 Ga0496110_0209218_662_1630 308
820 3300048915 Ga0496112_0039003 Ga0496112_0039003_2513_3445 308
821 3300048917 Ga0496114_0366820 Ga0496114_0366820_87_1055 308
822 3300048919 Ga0496116_0023479 Ga0496116_0023479_1744_2676 308
823 3300048920 Ga0496117_0002765 Ga0496117_0002765_3522_4454 308
824 3300048920 Ga0496117_0003919 Ga0496117_0003919_4416_5369 308
825 3300048920 Ga0496117_0007290 Ga0496117_0007290_7765_8733 308
826 3300048920 Ga0496117_0017379 Ga0496117_0017379_4555_5481 308
827 3300048921 Ga0496118_0000215 Ga0496118_0000215_95465_96418 308
828 3300048921 Ga0496118_0001206 Ga0496118_0001206_11994_12962 308
829 3300048921 Ga0496118_0006556 Ga0496118_0006556_2120_3052 308
830 3300048921 Ga0496118_0015186 Ga0496118_0015186_3084_4010 308
831 3300048921 Ga0496118_0035740 Ga0496118_0035740_2141_3079 308
832 3300048921 Ga0496118_0096852 Ga0496118_0096852_167_1093 308
833 3300048921 Ga0496118_0100916 Ga0496118_0100916_302_1228 308
834 3300048922 Ga0496119_0033957 Ga0496119_0033957_2392_3324 308
835 3300048924 Ga0496121_0001279 Ga0496121_0001279_3481_4407 308
836 3300048924 Ga0496121_0002026 Ga0496121_0002026_261_1193 308
837 3300048924 Ga0496121_0004114 Ga0496121_0004114_11850_12956 308
838 3300048924 Ga0496121_0015334 Ga0496121_0015334_261_1193 308
839 3300048925 Ga0496122_0052429 Ga0496122_0052429_541_1473 308
840 3300048926 Ga0496123_0057080 Ga0496123_0057080_322_1254 308
841 3300048927 Ga0496124_0177307 Ga0496124_0177307_376_1317 308
842 3300048929 Ga0496126_0000032 Ga0496126_0000032_132608_133576 308
843 3300048929 Ga0496126_0002361 Ga0496126_0002361_14048_14974 308
844 3300048929 Ga0496126_0002530 Ga0496126_0002530_16485_17411 308
845 3300048929 Ga0496126_0021102 Ga0496126_0021102_2214_3152 308
846 3300049460 Ga0495682_0008882 Ga0495682_0008882_1860_2786 308
847 3300061719 Ga0466962_0001441 Ga0466962_0001441_677_1621 308
848 3300061719 Ga0466962_0042067 Ga0466962_0042067_421_1365 308
849 iso_pu_bacteria 2510065045 2510248660 308
850 iso_pu_bacteria 2718217991 2719642914 308
851 iso_pu_bacteria 2808606390 2809003651 308
852 iso_pu_bacteria 2808606391 2809010928 308

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00132

Hexapep

Bacterial transferase hexapeptide (six repeats)

267

302

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3f1x-assembly1.cif.gz_A three dimensional structure of the serine acetyltransferase from bacteroides vulgatus, northeast structural genomics consortium target bvr62. 0.9303 11 294
6lcn-assembly1.cif.gz_B crystal structure of serine acetyltransferase from planctomyces limnophilus at 2.15a 0.9254 11 293
6lcn-assembly1.cif.gz_F crystal structure of serine acetyltransferase from planctomyces limnophilus at 2.15a 0.9236 11 293
6lcn-assembly1.cif.gz_E crystal structure of serine acetyltransferase from planctomyces limnophilus at 2.15a 0.9228 11 293
6lcn-assembly1.cif.gz_A crystal structure of serine acetyltransferase from planctomyces limnophilus at 2.15a 0.9092 11 293
ID Description Score Start End Superfamily
3f1xA02 Mainly Beta;3 Solenoid;UDP N-Acetylglucosamine Acyltransferase; domain 1;Hexapeptide repeat proteins 0.9935 190 294 2.160.10.10
3gvdA02 Mainly Beta;3 Solenoid;UDP N-Acetylglucosamine Acyltransferase; domain 1;Hexapeptide repeat proteins 0.9594 190 287 2.160.10.10
3f1xA01 Mainly Alpha;Orthogonal Bundle;serine acetyltransferase, domain 1;serine acetyltransferase, domain 1 0.9586 37 189 1.10.3130.10
af_K7MGT5_229_334_2.160.10.10 Mainly Beta;3 Solenoid;UDP N-Acetylglucosamine Acyltransferase; domain 1;Hexapeptide repeat proteins 0.9439 227 291 2.160.10.10
4n6bB02 Mainly Beta;3 Solenoid;UDP N-Acetylglucosamine Acyltransferase; domain 1;Hexapeptide repeat proteins 0.9437 190 291 2.160.10.10
ID Description Score Start End GO Terms
AF-A0A6I1WC39-F1-model_v4 deleted 0.999 201 289
AF-A0A829E9B8-F1-model_v4 deleted 0.9938 211 294
AF-A0A3A1WWC4-F1-model_v4 Serine acetyltransferase 0.9894 153 290 GO:0005737
GO:0006535
GO:0009001
AF-K1UKK0-F1-model_v4 Serine O-acetyltransferase 0.9892 120 251 GO:0009001
AF-A0A2S3V241-F1-model_v4 serine O-acetyltransferase (EC 2.3.1.30) 0.9886 126 291 GO:0005737
GO:0006535
GO:0009001

Feature Viewer

pLDDT pTM Quality
90.21 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map