F483508
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 852 | 434 | 722 | 314 |
Family's Representative Sequence
| Representative Sequence | 3300032004|Ga0307414_10019331|Ga0307414_100193314 |
| Length | 334 |
| Sequence | MNQSTLLTLPTELSAPGAAPPQWELHQIVDELRAVRERWRDGLASHQECGARQFPSRQHLRELVGALCAALFPMRLGPLDLQQESEDFFVGHTLDTTLTGLHEQVRRELAYQARQHGLPQAVSVEQQALAIVQRFARALPGIRARLDTDVAAAFHGDPAAHSVDEVLLCYPGILAIIHYRLAHALHALGAPLVARIIAEVAHSQTGIDIHPGAVIGASFFIDHGTGVVIGETAIIGERVRIYQAVTLGAKRFPAGADGVLKKGLARHPIVEDDVVIYAGATILGRVTIGQGSVIGGNVWLTRSIAAGSHVTQAHNQQEAAELPPPSHPALTHLP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2501025501 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 2 | 2501025502 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 3 | 2501025504 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 4 | 2508501125 | Burkholderia sp. WSM2232 | Isolate | Nodule |
| 5 | 2510065045 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 6 | 2510065055 | Pseudomonas sp. MOIL14HWK12:I2 | Isolate | Rhizosphere |
| 7 | 2510065058 | Pseudomonas oleovorans MOIL14HWK12 | Isolate | Rhizosphere |
| 8 | 2510917013 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 9 | 2510917014 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 10 | 2510917015 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 11 | 2512047030 | Paraburkholderia tuberum STM678 | Isolate | Nodule |
| 12 | 2513237082 | Paraburkholderia mimosarum STM3621 | Isolate | Nodule |
| 13 | 2513237083 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 14 | 2513237151 | Burkholderia sp. WSM2230 | Isolate | Nodule |
| 15 | 2513237166 | Paraburkholderia azotifigens UYPR1.413 | Isolate | Nodule |
| 16 | 2515154122 | Paraburkholderia atlantica JPY251 | Isolate | Nodule |
| 17 | 2515154123 | Trinickia symbiotica JPY347 | Isolate | Nodule |
| 18 | 2515154189 | Paraburkholderia nodosa DSM 21604 | Isolate | Unclassified |
| 19 | 2519103095 | Burkholderia sp. KJ006 | Isolate | Nodule |
| 20 | 2526164713 | Paraburkholderia phenoliruptrix JPY366 | Isolate | Nodule |
| 21 | 2547132374 | Acidovorax radicis N35 | Isolate | Unclassified |
| 22 | 2551306416 | Herbaspirillum seropedicae Os34 | Isolate | Unclassified |
| 23 | 2562617112 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 24 | 2582581311 | Burkholderia sp. WP42 | Isolate | Rhizosphere |
| 25 | 2599185239 | Burkholderia sp. NFACC38-1 | Isolate | Rhizoplane |
| 26 | 2599185240 | Burkholderia sp. NFPP32 | Isolate | Rhizoplane |
| 27 | 2599185355 | Burkholderia sp. NFACC33-1 | Isolate | Rhizoplane |
| 28 | 2600255067 | Paraburkholderia kururiensis thiooxydans NBRC 107107 | Isolate | Unclassified |
| 29 | 2600255292 | Janthinobacterium lividum NFR18 | Isolate | Rhizoplane |
| 30 | 2643221570 | Acidovorax sp. Root568 | Isolate | Unclassified |
| 31 | 2643221645 | Massilia sp. Root351 | Isolate | Unclassified |
| 32 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 33 | 2675903129 | Burkholderia pyrrocinia NFIX32 | Isolate | Rhizoplane |
| 34 | 2711768613 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 35 | 2718217991 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 36 | 2738541296 | Paraburkholderia sp. GV073 | Isolate | Unclassified |
| 37 | 2738541297 | Duganella sp. GV083 | Isolate | Unclassified |
| 38 | 2738541298 | Paraburkholderia sp. GV068 | Isolate | Unclassified |
| 39 | 2738541306 | Paraburkholderia sp. GV052 | Isolate | Unclassified |
| 40 | 2738541357 | Duganella sp. GV053 | Isolate | Unclassified |
| 41 | 2738543002 | Paraburkholderia sp. GV072 | Isolate | Unclassified |
| 42 | 2738543003 | Duganella sp. GV066 | Isolate | Unclassified |
| 43 | 2738543008 | Paraburkholderia sp. GV060 | Isolate | Unclassified |
| 44 | 2738543026 | Duganella sp. GV089 | Isolate | Unclassified |
| 45 | 2738543029 | Duganella sp. GV039 | Isolate | Unclassified |
| 46 | 2744054900 | Paraburkholderia ginsengiterrae DCY85-1 | Isolate | Unclassified |
| 47 | 2744054901 | Paraburkholderia ginsengiterrae DCY85 | Isolate | Unclassified |
| 48 | 2751185846 | Paraburkholderia ribeironis STM 7296 | Isolate | Unclassified |
| 49 | 2773857672 | Pseudomonas sp. 1766 | Isolate | Unclassified |
| 50 | 2791355137 | Paraburkholderia piptadeniae STM7183 | Isolate | Unclassified |
| 51 | 2808606390 | Burkholderia sp. SJZ115 | Isolate | Rhizosphere |
| 52 | 2808606391 | Burkholderia sp. SJZ091 | Isolate | Rhizosphere |
| 53 | 2808606418 | Herbaspirillum sp. SJZ107 | Isolate | Rhizosphere |
| 54 | 2811994881 | Pseudomonas sp. SLBN-26 | Isolate | Unclassified |
| 55 | 2816332253 | Burkholderia vietnamiensis HI2297 | Isolate | Unclassified |
| 56 | 2816332256 | Burkholderia vietnamiensis MSMB608WGS | Isolate | Unclassified |
| 57 | 2816332286 | Burkholderia vietnamiensis HI2221 | Isolate | Rhizosphere |
| 58 | 2818991449 | Herbaspirillum huttiense 1147 | Isolate | Unclassified |
| 59 | 2818991450 | Burkholderia sp. 604 | Isolate | Unclassified |
| 60 | 2818991452 | Burkholderia cepacia 561 | Isolate | Unclassified |
| 61 | 2821131069 | Duganella sp. 1224 | Isolate | Unclassified |
| 62 | 2842324504 | Paraburkholderia fungorum SEMIA 4007 | Isolate | Nodule |
| 63 | 2842348783 | Paraburkholderia fungorum SEMIA 4013 | Isolate | Nodule |
| 64 | 2842454564 | Paraburkholderia fungorum SEMIA 4056 | Isolate | Nodule |
| 65 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
| 66 | 2856287931 | Paraburkholderia bannensis BE22 | Isolate | Rhizosphere |
| 67 | 2857357740 | Paraburkholderia tropica BE15 | Isolate | Rhizosphere |
| 68 | 2857547612 | Janthinobacterium sp. R-74502 | Isolate | Unclassified |
| 69 | 2857558681 | Duganella sp. R-74565 | Isolate | Unclassified |
| 70 | 2863421361 | Burkholderia cenocepacia CACua-24 | Isolate | Rhizosphere |
| 71 | 2870068957 | Burkholderia sp. JP2-270 | Isolate | Unclassified |
| 72 | 2883087390 | Paraburkholderia guartelaensis CNPSo 3008 | Isolate | Unclassified |
| 73 | 2885080285 | Janthinobacterium sp. AD80 | Isolate | Rhizosphere |
| 74 | 2885270888 | Paraburkholderia sp. UYCPa14C | Isolate | Unclassified |
| 75 | 2900634093 | Paraburkholderia dipogonis ICMP 19430 | Isolate | Unclassified |
| 76 | 2902682994 | Paraburkholderia atlantica CNPSo 3155 | Isolate | Unclassified |
| 77 | 2904424332 | Duganella sp. 1411 | Isolate | Rhizosphere |
| 78 | 2904479285 | Comamonas sediminis 4487 | Isolate | Rhizosphere |
| 79 | 2904483920 | Paraburkholderia caledonica 575 | Isolate | Unclassified |
| 80 | 2904530477 | Herbaspirillum huttiense 611 | Isolate | Unclassified |
| 81 | 2904564687 | Burkholderia sp. 571 | Isolate | Unclassified |
| 82 | 2904571731 | Burkholderia cenocepacia 574 | Isolate | Unclassified |
| 83 | 2904584206 | Herbaspirillum sp. 1050 | Isolate | Unclassified |
| 84 | 2904589729 | Herbaspirillum sp. 1130 | Isolate | Unclassified |
| 85 | 2904601388 | Herbaspirillum sp. 1273 | Isolate | Rhizosphere |
| 86 | 2904615490 | Paraburkholderia franconis CNPSo 3157 | Isolate | Unclassified |
| 87 | 2917832318 | Pseudomonas rhizoryzae RY24 | Isolate | Unclassified |
| 88 | 2919079590 | Herbaspirillum sp. 1173 | Isolate | Unclassified |
| 89 | 2919125081 | Pseudomonas psychrotolerans 1545 | Isolate | Rhizosphere |
| 90 | 2919476304 | Duganella sp. 3397 | Isolate | Unclassified |
| 91 | 2919527303 | Paraburkholderia strydomiana 3827 | Isolate | Unclassified |
| 92 | 2923510766 | Herbaspirillum rubrisubalbicans SLBN-127 | Isolate | Rhizosphere |
| 93 | 2923519811 | Pseudomonas otitidis SLBN-103 | Isolate | Rhizosphere |
| 94 | 2928108538 | Paraburkholderia terricola 1595 | Isolate | Rhizosphere |
| 95 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 96 | 2928130867 | Herbaspirillum seropedicae 1977 | Isolate | Unclassified |
| 97 | 2928135762 | Paraburkholderia terricola 1988 | Isolate | Unclassified |
| 98 | 2928157003 | Burkholderia ambifaria 566 | Isolate | Unclassified |
| 99 | 2928163908 | Burkholderia sp. 567 | Isolate | Unclassified |
| 100 | 2928170801 | Burkholderia sp. 572 | Isolate | Unclassified |
| 101 | 2928503688 | Paraburkholderia terricola 1263 | Isolate | Rhizosphere |
| 102 | 2928536128 | Burkholderia sola 565 | Isolate | Unclassified |
| 103 | 2932410948 | Janthinobacterium lividum 2829 | Isolate | Rhizosphere |
| 104 | 2932416698 | Janthinobacterium lividum 2830 | Isolate | Rhizosphere |
| 105 | 2945934425 | Paraburkholderia graminis W1I13 | Isolate | Rhizosphere |
| 106 | 2952252522 | Salinicola sp. DM10 | Isolate | Unclassified |
| 107 | 2981990288 | Burkholderia sp. PvR073 | Isolate | Rhizosphere |
| 108 | 2984499530 | Pseudomonas sp. SORGH_AS199 | Isolate | Aerial Root |
| 109 | 2984504281 | Pseudomonas psychrotolerans SORGH_AS201 | Isolate | Aerial Root |
| 110 | 2990703756 | Paraburkholderia graminis SLBN-33 | Isolate | Rhizosphere |
| 111 | 3007252601 | Pseudomonas punonensis D1-6 | Isolate | Unclassified |
| 112 | 3007315729 | Pseudomonas argentinensis SA190 | Isolate | Unclassified |
| 113 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 114 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 115 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 116 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 117 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 118 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 119 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 120 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 121 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 122 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 123 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 124 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 125 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 126 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 127 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 128 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 129 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 130 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 131 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 132 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 133 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 134 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 135 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 136 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 137 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 138 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 139 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 140 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 141 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 142 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 143 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 144 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 145 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 146 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 147 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 148 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 149 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 150 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 151 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 152 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 153 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 154 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 155 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 156 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 157 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 158 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 159 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 160 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 161 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 162 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 163 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 164 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 166 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 167 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 168 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 169 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 170 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 171 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 172 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 173 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 174 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 175 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 176 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 177 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 178 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 179 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 180 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 181 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 182 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 183 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 184 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 185 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 186 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 187 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 188 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 189 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 190 | 3300016635 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 | Metagenome | Rhizosphere |
| 191 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 192 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 193 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 194 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 195 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 196 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 197 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 198 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 199 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 200 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 201 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 202 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 203 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 204 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 205 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 206 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 207 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 208 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 209 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 210 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 211 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 212 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 213 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 214 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 215 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 216 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 244 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 246 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 247 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 248 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 249 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 250 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 251 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 252 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 253 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 254 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 255 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 256 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 257 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 258 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 259 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 260 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 261 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 262 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 263 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 264 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 265 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 266 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 267 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 268 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 269 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 270 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 271 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 272 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 273 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 274 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 275 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 276 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 277 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 278 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 279 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 280 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 281 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 282 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 283 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 284 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 285 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 286 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 287 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 288 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 289 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 290 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 291 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 292 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 293 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 294 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 295 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 296 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 297 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 298 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 299 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 381 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 382 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 383 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 384 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 385 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 386 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 387 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 388 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 389 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 390 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 391 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 392 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 393 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 394 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 395 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 396 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 397 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 398 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 399 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 400 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 401 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 402 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 403 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 404 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 405 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 407 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 408 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 409 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 410 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 411 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 412 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 413 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 414 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 415 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 416 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 417 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 418 | 641736151 | Paraburkholderia graminis C4D1M | Isolate | Rhizoplane |
| 419 | 641736154 | Burkholderia ambifaria IOP40-10 | Isolate | Rhizosphere |
| 420 | 642555112 | Paraburkholderia phymatum STM815 | Isolate | Nodule |
| 421 | 642555113 | Paraburkholderia phytofirmans PsJN | Isolate | Unclassified |
| 422 | 8003955200 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 423 | 8016728285 | Pseudomonas psychrotolerans SORGH_AS 227 | Isolate | Unclassified |
| 424 | 8018845410 | Burkholderia reimsis BE51 | Isolate | Rhizosphere |
| 425 | 8020807995 | Burkholderia sp. B10 | Isolate | Rhizosphere |
| 426 | 8020938398 | Burkholderia sp. BE12 | Isolate | Rhizosphere |
| 427 | 8020945358 | Burkholderia sp. BE17 | Isolate | Rhizosphere |
| 428 | 8020953355 | Burkholderia sp. BE24 | Isolate | Rhizosphere |
| 429 | 8021120328 | Burkholderia sp. LS-044 | Isolate | Rhizosphere |
| 430 | 8039098773 | Burkholderia multivorans MSMB612WGS | Isolate | Unclassified |
| 431 | 8040167225 | Burkholderia vietnamiensis RS1 | Isolate | Unclassified |
| 432 | 8040173305 | Burkholderia vietnamiensis BE10 | Isolate | Rhizosphere |
| 433 | 8055266321 | Paraburkholderia rhynchosiae LMG 27174 | Isolate | Nodule |
| 434 | 8055301274 | Paraburkholderia kirstenboschensis LMG 28727 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 84.27 |
| Metatranscriptomes | 0.47 |
| Isolates | 15.26 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.23 |
| Bulb | 0 |
| Endosphere | 8.33 |
| Nodule | 2.46 |
| Rhizoplane | 6.46 |
| Rhizosphere | 67.84 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 14.67 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10010996 | 3300001979 | Bacteria | 3460 |
| 2 | JGI24739J22299_10001081 | 3300001989 | Bacteria | 10146 |
| 3 | JGI24739J22299_10014841 | 3300001989 | Bacteria | 2833 |
| 4 | JGI24735J21928_10001124 | 3300002067 | Bacteria | 9570 |
| 5 | JGI24735J21928_10001745 | 3300002067 | Bacteria | 7668 |
| 6 | JGI24735J21928_10006683 | 3300002067 | Bacteria | 3785 |
| 7 | JGI24735J21928_10030652 | 3300002067 | Bacteria | 1597 |
| 8 | JGI24738J21930_10001012 | 3300002075 | Bacteria | 8041 |
| 9 | JGI25156J39149_1000135 | 3300002705 | Bacteria | 53930 |
| 10 | JGI25156J39149_1000388 | 3300002705 | Bacteria | 27622 |
| 11 | JGI25156J39149_1000971 | 3300002705 | Bacteria | 13657 |
| 12 | JGI25165J46597_1002248 | 3300003214 | Bacteria | 6694 |
| 13 | JGI25153J46596_10000022 | 3300003215 | Bacteria | 251919 |
| 14 | rootL2_10159651 | 3300003322 | Bacteria | 1547 |
| 15 | Ga0055538_1000002 | 3300003751 | Bacteria | 999437 |
| 16 | Ga0055539_1000002 | 3300003752 | Bacteria | 999437 |
| 17 | Ga0055533_1000004 | 3300003756 | Bacteria | 999437 |
| 18 | Ga0055533_1000094 | 3300003756 | Bacteria | 115741 |
| 19 | Ga0055532_1000003 | 3300003758 | Bacteria | 494004 |
| 20 | Ga0055532_1002121 | 3300003758 | Bacteria | 4496 |
| 21 | Ga0055532_1002497 | 3300003758 | Bacteria | 3767 |
| 22 | Ga0055532_1002749 | 3300003758 | Bacteria | 3426 |
| 23 | Ga0055525_1000002 | 3300003759 | Bacteria | 999437 |
| 24 | Ga0055527_1000006 | 3300003760 | Bacteria | 494004 |
| 25 | Ga0055527_1000567 | 3300003760 | Bacteria | 12206 |
| 26 | Ga0055535_1000003 | 3300003761 | Bacteria | 494004 |
| 27 | Ga0055535_1000523 | 3300003761 | Bacteria | 33415 |
| 28 | Ga0055535_1001427 | 3300003761 | Bacteria | 12206 |
| 29 | Ga0055542_1000007 | 3300003762 | Bacteria | 494004 |
| 30 | Ga0055542_1000541 | 3300003762 | Bacteria | 33561 |
| 31 | Ga0055542_1002728 | 3300003762 | Bacteria | 5386 |
| 32 | Ga0055529_1000003 | 3300003763 | Bacteria | 494004 |
| 33 | Ga0055529_1000521 | 3300003763 | Bacteria | 33561 |
| 34 | Ga0055524_1000003 | 3300003775 | Bacteria | 399748 |
| 35 | Ga0055528_1001920 | 3300003790 | Bacteria | 11801 |
| 36 | Ga0055541_1000002 | 3300003841 | Bacteria | 896405 |
| 37 | Ga0058692_1004101 | 3300003856 | Bacteria | 4374 |
| 38 | Ga0065165_1002241 | 3300005262 | Bacteria | 17172 |
| 39 | Ga0065165_1016609 | 3300005262 | Bacteria | 2748 |
| 40 | Ga0065714_10074278 | 3300005288 | Bacteria | 3059 |
| 41 | Ga0070658_10063001 | 3300005327 | Bacteria | 3022 |
| 42 | Ga0070658_10213133 | 3300005327 | Bacteria | 1632 |
| 43 | Ga0070690_100000275 | 3300005330 | Bacteria | 26334 |
| 44 | Ga0070680_100514102 | 3300005336 | Bacteria | 1025 |
| 45 | Ga0070682_100061331 | 3300005337 | Bacteria | 2380 |
| 46 | Ga0070660_100000159 | 3300005339 | Bacteria | 43943 |
| 47 | Ga0070660_100002227 | 3300005339 | Bacteria | 13358 |
| 48 | Ga0070660_100006481 | 3300005339 | Bacteria | 8116 |
| 49 | Ga0070660_100025183 | 3300005339 | Bacteria | 4421 |
| 50 | Ga0070689_100000376 | 3300005340 | Bacteria | 26278 |
| 51 | Ga0070661_100058214 | 3300005344 | Bacteria | 2832 |
| 52 | Ga0070688_100007098 | 3300005365 | Bacteria | 6029 |
| 53 | Ga0070659_100000223 | 3300005366 | Bacteria | 44089 |
| 54 | Ga0070659_100034980 | 3300005366 | Bacteria | 3910 |
| 55 | Ga0070701_10000088 | 3300005438 | Bacteria | 25619 |
| 56 | Ga0070700_100000542 | 3300005441 | Bacteria | 18937 |
| 57 | Ga0070694_100045181 | 3300005444 | Bacteria | 2951 |
| 58 | Ga0070663_100001049 | 3300005455 | Bacteria | 15125 |
| 59 | Ga0070685_10000777 | 3300005466 | Bacteria | 17368 |
| 60 | Ga0068853_100458756 | 3300005539 | Bacteria | 1199 |
| 61 | Ga0070686_100000294 | 3300005544 | Bacteria | 33575 |
| 62 | Ga0068855_100029854 | 3300005563 | Bacteria | 6520 |
| 63 | Ga0068855_100234974 | 3300005563 | Bacteria | 2050 |
| 64 | Ga0070664_100035576 | 3300005564 | Bacteria | 4181 |
| 65 | Ga0068856_100058492 | 3300005614 | Bacteria | 3807 |
| 66 | Ga0068852_100030497 | 3300005616 | Bacteria | 4440 |
| 67 | Ga0068859_100000481 | 3300005617 | Bacteria | 39283 |
| 68 | Ga0068861_100036148 | 3300005719 | Bacteria | 3664 |
| 69 | Ga0068862_100001216 | 3300005844 | Bacteria | 24301 |
| 70 | Ga0075368_10015920 | 3300006042 | Bacteria | 2794 |
| 71 | Ga0075364_10060848 | 3300006051 | Bacteria | 2476 |
| 72 | Ga0075367_10017516 | 3300006178 | Bacteria | 3933 |
| 73 | Ga0075366_10102184 | 3300006195 | Bacteria | 1721 |
| 74 | Ga0068865_100243119 | 3300006881 | Bacteria | 1417 |
| 75 | Ga0097620_100000481 | 3300006931 | Bacteria | 39283 |
| 76 | Ga0099826_10000002 | 3300006948 | Bacteria | 1125830 |
| 77 | Ga0105251_10001186 | 3300009011 | Bacteria | 22567 |
| 78 | Ga0105244_10001991 | 3300009036 | Bacteria | 15758 |
| 79 | Ga0105244_10021819 | 3300009036 | Bacteria | 3532 |
| 80 | Ga0105240_10003656 | 3300009093 | Bacteria | 23815 |
| 81 | Ga0105240_10088845 | 3300009093 | Bacteria | 3780 |
| 82 | Ga0105240_10103540 | 3300009093 | Bacteria | 3458 |
| 83 | Ga0105240_10191118 | 3300009093 | Bacteria | 2407 |
| 84 | Ga0105240_10239861 | 3300009093 | Bacteria | 2102 |
| 85 | Ga0105247_10062765 | 3300009101 | Bacteria | 2305 |
| 86 | Ga0105243_10050427 | 3300009148 | Bacteria | 3288 |
| 87 | Ga0105241_10029822 | 3300009174 | Bacteria | 4072 |
| 88 | Ga0105242_10005895 | 3300009176 | Bacteria | 9447 |
| 89 | Ga0105242_10096020 | 3300009176 | Bacteria | 2503 |
| 90 | Ga0105248_10057346 | 3300009177 | Bacteria | 4372 |
| 91 | Ga0105248_10279160 | 3300009177 | Bacteria | 1881 |
| 92 | Ga0105237_10013944 | 3300009545 | Bacteria | 8410 |
| 93 | Ga0105237_10193823 | 3300009545 | Bacteria | 2032 |
| 94 | Ga0105238_10030204 | 3300009551 | Bacteria | 5514 |
| 95 | Ga0105238_10033930 | 3300009551 | Bacteria | 5193 |
| 96 | Ga0105238_10218198 | 3300009551 | Bacteria | 1883 |
| 97 | Ga0105239_10005842 | 3300010375 | Bacteria | 14341 |
| 98 | Ga0105239_10021326 | 3300010375 | Bacteria | 7143 |
| 99 | Ga0157371_10341236 | 3300013102 | Bacteria | 1089 |
| 100 | Ga0157370_10000632 | 3300013104 | Bacteria | 43893 |
| 101 | Ga0157370_10000999 | 3300013104 | Bacteria | 35689 |
| 102 | Ga0157369_10001964 | 3300013105 | Bacteria | 24791 |
| 103 | Ga0157369_10004136 | 3300013105 | Bacteria | 17186 |
| 104 | Ga0157369_10013941 | 3300013105 | Bacteria | 9083 |
| 105 | Ga0157369_10103875 | 3300013105 | Bacteria | 3027 |
| 106 | Ga0157369_10255189 | 3300013105 | Bacteria | 1829 |
| 107 | Ga0157369_10356285 | 3300013105 | Bacteria | 1519 |
| 108 | Ga0157369_10365969 | 3300013105 | Bacteria | 1497 |
| 109 | Ga0157374_10000050 | 3300013296 | Bacteria | 132127 |
| 110 | Ga0157378_10104470 | 3300013297 | Bacteria | 2589 |
| 111 | Ga0163162_10024825 | 3300013306 | Bacteria | 5920 |
| 112 | Ga0157372_10000364 | 3300013307 | Bacteria | 50077 |
| 113 | Ga0157380_10021946 | 3300014326 | Bacteria | 4795 |
| 114 | Ga0182008_10000827 | 3300014497 | Bacteria | 21580 |
| 115 | Ga0182008_10043489 | 3300014497 | Bacteria | 2236 |
| 116 | Ga0182008_10070716 | 3300014497 | Bacteria | 1717 |
| 117 | Ga0157376_10011117 | 3300014969 | Bacteria | 6621 |
| 118 | Ga0157376_10070466 | 3300014969 | Bacteria | 2968 |
| 119 | Ga0182006_1000033 | 3300015261 | Bacteria | 238180 |
| 120 | Ga0182006_1000529 | 3300015261 | Bacteria | 28957 |
| 121 | Ga0182006_1019112 | 3300015261 | Bacteria | 2888 |
| 122 | Ga0182007_10000198 | 3300015262 | Bacteria | 40280 |
| 123 | Ga0182007_10000281 | 3300015262 | Bacteria | 33821 |
| 124 | Ga0182007_10026510 | 3300015262 | Bacteria | 2007 |
| 125 | Ga0182005_1000024 | 3300015265 | Bacteria | 238256 |
| 126 | Ga0183361_10002 | 3300016635 | Bacteria | 907642 |
| 127 | Ga0163161_10006140 | 3300017792 | Bacteria | 8321 |
| 128 | Ga0197907_10060606 | 3300020069 | Bacteria | 1616 |
| 129 | Ga0206356_10471300 | 3300020070 | Bacteria | 7064 |
| 130 | Ga0206353_11405814 | 3300020082 | Bacteria | 6718 |
| 131 | Ga0213872_10009130 | 3300021361 | Bacteria | 4765 |
| 132 | Ga0213872_10027618 | 3300021361 | Bacteria | 2604 |
| 133 | Ga0224712_10000024 | 3300022467 | Bacteria | 22697 |
| 134 | Ga0209435_104465 | 3300025206 | Bacteria | 1582 |
| 135 | Ga0209784_100002 | 3300025224 | Bacteria | 1753105 |
| 136 | Ga0209566_100003 | 3300025225 | Bacteria | 1753105 |
| 137 | Ga0209566_100443 | 3300025225 | Bacteria | 30572 |
| 138 | Ga0209674_100004 | 3300025226 | Bacteria | 1753105 |
| 139 | Ga0209674_100025 | 3300025226 | Bacteria | 515942 |
| 140 | Ga0209674_100144 | 3300025226 | Bacteria | 107160 |
| 141 | Ga0209672_100002 | 3300025228 | Bacteria | 1733325 |
| 142 | Ga0209672_100012 | 3300025228 | Bacteria | 795742 |
| 143 | Ga0209672_100063 | 3300025228 | Bacteria | 204903 |
| 144 | Ga0209147_100003 | 3300025229 | Bacteria | 1733325 |
| 145 | Ga0209147_100007 | 3300025229 | Bacteria | 795684 |
| 146 | Ga0209147_100077 | 3300025229 | Bacteria | 205964 |
| 147 | Ga0209147_100119 | 3300025229 | Bacteria | 142860 |
| 148 | Ga0209563_100006 | 3300025230 | Bacteria | 1753105 |
| 149 | Ga0209563_101098 | 3300025230 | Bacteria | 7751 |
| 150 | Ga0207427_100538 | 3300025231 | Bacteria | 19709 |
| 151 | Ga0209258_100005 | 3300025242 | Bacteria | 1087938 |
| 152 | Ga0209258_100014 | 3300025242 | Bacteria | 720132 |
| 153 | Ga0209258_100105 | 3300025242 | Bacteria | 207862 |
| 154 | Ga0209677_100003 | 3300025253 | Bacteria | 1753105 |
| 155 | Ga0209148_1000006 | 3300025254 | Bacteria | 1733325 |
| 156 | Ga0209148_1000107 | 3300025254 | Bacteria | 207862 |
| 157 | Ga0209148_1002224 | 3300025254 | Bacteria | 7101 |
| 158 | Ga0209759_1000008 | 3300025256 | Bacteria | 461395 |
| 159 | Ga0209759_1000014 | 3300025256 | Bacteria | 396291 |
| 160 | Ga0209759_1000094 | 3300025256 | Bacteria | 159426 |
| 161 | Ga0209759_1008521 | 3300025256 | Bacteria | 3185 |
| 162 | Ga0209759_1013849 | 3300025256 | Bacteria | 2163 |
| 163 | Ga0209759_1019850 | 3300025256 | Bacteria | 1580 |
| 164 | Ga0209233_1000018 | 3300025261 | Bacteria | 886857 |
| 165 | Ga0209455_1000003 | 3300025272 | Bacteria | 1471893 |
| 166 | Ga0209455_1000100 | 3300025272 | Bacteria | 207862 |
| 167 | Ga0209455_1000220 | 3300025272 | Bacteria | 79809 |
| 168 | Ga0209455_1001676 | 3300025272 | Bacteria | 9524 |
| 169 | Ga0209673_1000101 | 3300025273 | Bacteria | 190230 |
| 170 | Ga0209564_1003180 | 3300025295 | Bacteria | 11534 |
| 171 | Ga0209758_1000005 | 3300025297 | Bacteria | 1368918 |
| 172 | Ga0209256_1000007 | 3300025299 | Bacteria | 1136599 |
| 173 | Ga0207426_1000180 | 3300025302 | Bacteria | 158321 |
| 174 | Ga0207426_1001127 | 3300025302 | Bacteria | 24293 |
| 175 | Ga0207426_1001753 | 3300025302 | Bacteria | 16453 |
| 176 | Ga0207713_1000590 | 3300025735 | Bacteria | 35946 |
| 177 | Ga0207713_1003582 | 3300025735 | Bacteria | 10487 |
| 178 | Ga0207647_10000145 | 3300025904 | Bacteria | 56900 |
| 179 | Ga0207647_10003580 | 3300025904 | Bacteria | 11644 |
| 180 | Ga0207647_10013282 | 3300025904 | Bacteria | 5716 |
| 181 | Ga0207647_10048340 | 3300025904 | Bacteria | 2642 |
| 182 | Ga0207647_10138665 | 3300025904 | Bacteria | 1426 |
| 183 | Ga0207705_10001623 | 3300025909 | Bacteria | 17837 |
| 184 | Ga0207705_10007441 | 3300025909 | Bacteria | 8052 |
| 185 | Ga0207705_10009968 | 3300025909 | Bacteria | 6919 |
| 186 | Ga0207705_10138342 | 3300025909 | Bacteria | 1817 |
| 187 | Ga0207654_10004588 | 3300025911 | Bacteria | 6977 |
| 188 | Ga0207707_10178503 | 3300025912 | Bacteria | 1854 |
| 189 | Ga0207695_10000368 | 3300025913 | Bacteria | 103176 |
| 190 | Ga0207695_10020889 | 3300025913 | Bacteria | 7482 |
| 191 | Ga0207695_10120922 | 3300025913 | Bacteria | 2586 |
| 192 | Ga0207671_10036256 | 3300025914 | Bacteria | 3657 |
| 193 | Ga0207671_10113107 | 3300025914 | Bacteria | 2067 |
| 194 | Ga0207660_10404331 | 3300025917 | Bacteria | 1100 |
| 195 | Ga0207657_10000442 | 3300025919 | Bacteria | 43937 |
| 196 | Ga0207657_10006101 | 3300025919 | Bacteria | 12528 |
| 197 | Ga0207657_10061594 | 3300025919 | Bacteria | 3216 |
| 198 | Ga0207657_10156726 | 3300025919 | Bacteria | 1852 |
| 199 | Ga0207649_10012810 | 3300025920 | Bacteria | 4666 |
| 200 | Ga0207694_10209671 | 3300025924 | Bacteria | 1587 |
| 201 | Ga0207694_10215677 | 3300025924 | Bacteria | 1564 |
| 202 | Ga0207690_10000037 | 3300025932 | Bacteria | 142658 |
| 203 | Ga0207690_10006058 | 3300025932 | Bacteria | 7163 |
| 204 | Ga0207690_10200759 | 3300025932 | Bacteria | 1514 |
| 205 | Ga0207706_10096897 | 3300025933 | Bacteria | 2594 |
| 206 | Ga0207686_10007886 | 3300025934 | Bacteria | 5739 |
| 207 | Ga0207686_10056102 | 3300025934 | Bacteria | 2475 |
| 208 | Ga0207670_10000079 | 3300025936 | Bacteria | 67061 |
| 209 | Ga0207711_10010149 | 3300025941 | Bacteria | 7820 |
| 210 | Ga0207711_10034469 | 3300025941 | Bacteria | 4287 |
| 211 | Ga0207689_10211609 | 3300025942 | Bacteria | 1602 |
| 212 | Ga0207679_10036895 | 3300025945 | Bacteria | 3470 |
| 213 | Ga0207679_10055898 | 3300025945 | Bacteria | 2912 |
| 214 | Ga0207667_10008527 | 3300025949 | Bacteria | 12169 |
| 215 | Ga0207667_10065063 | 3300025949 | Bacteria | 3804 |
| 216 | Ga0207667_10119869 | 3300025949 | Bacteria | 2711 |
| 217 | Ga0207658_10090765 | 3300025986 | Bacteria | 2369 |
| 218 | Ga0207678_10000317 | 3300026067 | Bacteria | 43506 |
| 219 | Ga0207708_10000652 | 3300026075 | Bacteria | 26611 |
| 220 | Ga0207648_10001111 | 3300026089 | Bacteria | 30179 |
| 221 | Ga0207674_10364764 | 3300026116 | Bacteria | 1396 |
| 222 | Ga0207675_100057508 | 3300026118 | Bacteria | 3629 |
| 223 | Ga0207698_10014639 | 3300026142 | Bacteria | 5222 |
| 224 | Ga0207698_10029747 | 3300026142 | Bacteria | 3916 |
| 225 | Ga0209371_1000080 | 3300027312 | Bacteria | 185771 |
| 226 | Ga0209371_1000781 | 3300027312 | Bacteria | 26294 |
| 227 | Ga0209371_1005060 | 3300027312 | Bacteria | 5415 |
| 228 | Ga0209282_1000001 | 3300027666 | Bacteria | 2450367 |
| 229 | Ga0268265_10001163 | 3300028380 | Bacteria | 23049 |
| 230 | Ga0268265_10009141 | 3300028380 | Bacteria | 6697 |
| 231 | Ga0265318_10000127 | 3300028577 | Bacteria | 70203 |
| 232 | Ga0265318_10000504 | 3300028577 | Bacteria | 28393 |
| 233 | Ga0265338_10000092 | 3300028800 | Bacteria | 168538 |
| 234 | Ga0265338_10000159 | 3300028800 | Bacteria | 123495 |
| 235 | Ga0265338_10037915 | 3300028800 | Bacteria | 4576 |
| 236 | Ga0268256_1000160 | 3300030500 | Bacteria | 86682 |
| 237 | Ga0268256_1000366 | 3300030500 | Bacteria | 42885 |
| 238 | Ga0268256_1006624 | 3300030500 | Bacteria | 4270 |
| 239 | Ga0265330_10000112 | 3300031235 | Bacteria | 66619 |
| 240 | Ga0265332_10001836 | 3300031238 | Bacteria | 11330 |
| 241 | Ga0265328_10000104 | 3300031239 | Bacteria | 41156 |
| 242 | Ga0265328_10006581 | 3300031239 | Bacteria | 4897 |
| 243 | Ga0265320_10000232 | 3300031240 | Bacteria | 45736 |
| 244 | Ga0265320_10000969 | 3300031240 | Bacteria | 21356 |
| 245 | Ga0265325_10004573 | 3300031241 | Bacteria | 8701 |
| 246 | Ga0265325_10005819 | 3300031241 | Bacteria | 7555 |
| 247 | Ga0265325_10069384 | 3300031241 | Bacteria | 1773 |
| 248 | Ga0265329_10001427 | 3300031242 | Bacteria | 11542 |
| 249 | Ga0265329_10012504 | 3300031242 | Bacteria | 3048 |
| 250 | Ga0265340_10006288 | 3300031247 | Bacteria | 6547 |
| 251 | Ga0265339_10003001 | 3300031249 | Bacteria | 11897 |
| 252 | Ga0265331_10000178 | 3300031250 | Bacteria | 77277 |
| 253 | Ga0265331_10000591 | 3300031250 | Bacteria | 32363 |
| 254 | Ga0265331_10004787 | 3300031250 | Bacteria | 8331 |
| 255 | Ga0265327_10000908 | 3300031251 | Bacteria | 43447 |
| 256 | Ga0265327_10013812 | 3300031251 | Bacteria | 5334 |
| 257 | Ga0265316_10000731 | 3300031344 | Bacteria | 36246 |
| 258 | Ga0265316_10001736 | 3300031344 | Bacteria | 23119 |
| 259 | Ga0265316_10008481 | 3300031344 | Bacteria | 9531 |
| 260 | Ga0307513_10260098 | 3300031456 | Bacteria | 1526 |
| 261 | Ga0307408_100064190 | 3300031548 | Bacteria | 2688 |
| 262 | Ga0265313_10000056 | 3300031595 | Bacteria | 109106 |
| 263 | Ga0265313_10000604 | 3300031595 | Bacteria | 37364 |
| 264 | Ga0265314_10005145 | 3300031711 | Bacteria | 11889 |
| 265 | Ga0265342_10000472 | 3300031712 | Bacteria | 43635 |
| 266 | Ga0307405_10079987 | 3300031731 | Bacteria | 2132 |
| 267 | Ga0307413_10178399 | 3300031824 | Bacteria | 1511 |
| 268 | Ga0307410_10089845 | 3300031852 | Bacteria | 2177 |
| 269 | Ga0307412_10000039 | 3300031911 | Bacteria | 182976 |
| 270 | Ga0307412_10046127 | 3300031911 | Bacteria | 2853 |
| 271 | Ga0307416_100088004 | 3300032002 | Bacteria | 2654 |
| 272 | Ga0307414_10019331 | 3300032004 | Bacteria | 4218 |
| 273 | Ga0307411_10008361 | 3300032005 | Bacteria | 5354 |
| 274 | Ga0395899_0000065 | 3300037312 | Bacteria | 205510 |
| 275 | Ga0395899_0110795 | 3300037312 | Bacteria | 1974 |
| 276 | Ga0395900_0000015 | 3300037418 | Bacteria | 384313 |
| 277 | Ga0395900_0014346 | 3300037418 | Bacteria | 8089 |
| 278 | Ga0395900_0029868 | 3300037418 | Bacteria | 5594 |
| 279 | Ga0395900_0036316 | 3300037418 | Bacteria | 5080 |
| 280 | Ga0395900_0068435 | 3300037418 | Bacteria | 3649 |
| 281 | Ga0395900_0133779 | 3300037418 | Bacteria | 2540 |
| 282 | Ga0395898_0000201 | 3300037466 | Bacteria | 153821 |
| 283 | Ga0395898_0003375 | 3300037466 | Bacteria | 17890 |
| 284 | Ga0395898_0027791 | 3300037466 | Bacteria | 5672 |
| 285 | Ga0395898_0049751 | 3300037466 | Bacteria | 4105 |
| 286 | Ga0395898_0108313 | 3300037466 | Bacteria | 2664 |
| 287 | Ga0395905_0000052 | 3300037471 | Bacteria | 215018 |
| 288 | Ga0395905_0008919 | 3300037471 | Bacteria | 9848 |
| 289 | Ga0395905_0014187 | 3300037471 | Bacteria | 7612 |
| 290 | Ga0395905_0016137 | 3300037471 | Bacteria | 7100 |
| 291 | Ga0395905_0019654 | 3300037471 | Bacteria | 6401 |
| 292 | Ga0395905_0119849 | 3300037471 | Bacteria | 2473 |
| 293 | Ga0395901_0000009 | 3300038443 | Bacteria | 479396 |
| 294 | Ga0395901_0000150 | 3300038443 | Bacteria | 90505 |
| 295 | Ga0395901_0000556 | 3300038443 | Bacteria | 43174 |
| 296 | Ga0395901_0000824 | 3300038443 | Bacteria | 34332 |
| 297 | Ga0395901_0144508 | 3300038443 | Bacteria | 2500 |
| 298 | Ga0395901_0144610 | 3300038443 | Bacteria | 2499 |
| 299 | Ga0436365_0357678 | 3300039437 | Bacteria | 4447 |
| 300 | Ga0436361_0061959 | 3300039447 | Bacteria | 13613 |
| 301 | Ga0436361_0580152 | 3300039447 | Bacteria | 3453 |
| 302 | Ga0436361_0678907 | 3300039447 | Bacteria | 2315 |
| 303 | Ga0436361_0746079 | 3300039447 | Bacteria | 4090 |
| 304 | Ga0451853_3073345 | 3300041512 | Bacteria | 1342 |
| 305 | Ga0439448_0001039 | 3300042005 | Bacteria | 6942 |
| 306 | Ga0439448_0002423 | 3300042005 | Bacteria | 5069 |
| 307 | Ga0439450_017898 | 3300042008 | Bacteria | 1483 |
| 308 | Ga0450906_006299 | 3300042145 | Bacteria | 2402 |
| 309 | Ga0439458_0003074 | 3300042157 | Bacteria | 3977 |
| 310 | Ga0450918_001218 | 3300042531 | Bacteria | 5231 |
| 311 | Ga0466969_0001231 | 3300044656 | Bacteria | 13843 |
| 312 | Ga0466969_0060021 | 3300044656 | Bacteria | 1849 |
| 313 | Ga0466972_0064390 | 3300044658 | Bacteria | 1755 |
| 314 | Ga0466965_0002305 | 3300044683 | Bacteria | 8054 |
| 315 | Ga0466965_0006181 | 3300044683 | Bacteria | 5418 |
| 316 | Ga0466965_0068246 | 3300044683 | Bacteria | 1785 |
| 317 | Ga0466965_0134116 | 3300044683 | Bacteria | 1285 |
| 318 | Ga0466966_0002365 | 3300044684 | Bacteria | 12323 |
| 319 | Ga0466966_0033234 | 3300044684 | Bacteria | 3340 |
| 320 | Ga0466961_0000238 | 3300044693 | Bacteria | 37000 |
| 321 | Ga0466961_0039421 | 3300044693 | Bacteria | 3028 |
| 322 | Ga0466961_0041622 | 3300044693 | Bacteria | 2945 |
| 323 | Ga0466961_0062638 | 3300044693 | Bacteria | 2363 |
| 324 | Ga0466963_0001623 | 3300044694 | Bacteria | 12238 |
| 325 | Ga0466963_0005529 | 3300044694 | Bacteria | 7397 |
| 326 | Ga0466963_0070685 | 3300044694 | Bacteria | 2348 |
| 327 | Ga0466964_0099185 | 3300044706 | Bacteria | 1281 |
| 328 | Ga0466971_0001253 | 3300044719 | Bacteria | 10578 |
| 329 | Ga0466971_0003561 | 3300044719 | Bacteria | 6656 |
| 330 | Ga0466968_0000357 | 3300044735 | Bacteria | 14800 |
| 331 | Ga0466970_0029996 | 3300044765 | Bacteria | 2867 |
| 332 | Ga0466970_0036574 | 3300044765 | Bacteria | 2601 |
| 333 | Ga0466957_0000032 | 3300044842 | Bacteria | 51211 |
| 334 | Ga0466957_0020077 | 3300044842 | Bacteria | 3933 |
| 335 | Ga0466957_0041778 | 3300044842 | Bacteria | 2773 |
| 336 | Ga0466957_0051012 | 3300044842 | Bacteria | 2518 |
| 337 | Ga0466957_0056093 | 3300044842 | Bacteria | 2408 |
| 338 | Ga0466957_0080413 | 3300044842 | Bacteria | 2029 |
| 339 | Ga0466960_0102983 | 3300044901 | Bacteria | 1473 |
| 340 | Ga0466959_0004706 | 3300045049 | Bacteria | 9190 |
| 341 | Ga0466959_0075518 | 3300045049 | Bacteria | 2434 |
| 342 | Ga0466958_0009905 | 3300045836 | Bacteria | 5322 |
| 343 | Ga0466958_0040295 | 3300045836 | Bacteria | 2807 |
| 344 | Ga0466958_0047467 | 3300045836 | Bacteria | 2592 |
| 345 | Ga0466958_0047862 | 3300045836 | Bacteria | 2582 |
| 346 | Ga0466958_0075325 | 3300045836 | Bacteria | 2070 |
| 347 | Ga0466967_0042855 | 3300045976 | Bacteria | 3914 |
| 348 | Ga0466967_0177408 | 3300045976 | Bacteria | 2007 |
| 349 | Ga0466967_0218047 | 3300045976 | Bacteria | 1812 |
| 350 | Ga0495592_0007730 | 3300046454 | Bacteria | 8052 |
| 351 | Ga0495592_0055966 | 3300046454 | Bacteria | 2916 |
| 352 | Ga0495592_0090329 | 3300046454 | Bacteria | 2198 |
| 353 | Ga0495592_0090907 | 3300046454 | Bacteria | 2189 |
| 354 | Ga0495603_0001030 | 3300046455 | Bacteria | 16099 |
| 355 | Ga0495603_0001565 | 3300046455 | Bacteria | 13380 |
| 356 | Ga0495603_0002175 | 3300046455 | Bacteria | 11534 |
| 357 | Ga0495603_0004485 | 3300046455 | Bacteria | 8331 |
| 358 | Ga0495590_0006595 | 3300046457 | Bacteria | 4523 |
| 359 | Ga0495590_0007224 | 3300046457 | Bacteria | 4293 |
| 360 | Ga0495590_0010145 | 3300046457 | Bacteria | 3552 |
| 361 | Ga0495591_015253 | 3300046458 | Bacteria | 2723 |
| 362 | Ga0495629_0000045 | 3300046459 | Bacteria | 110283 |
| 363 | Ga0495629_0000088 | 3300046459 | Bacteria | 80848 |
| 364 | Ga0495629_0000704 | 3300046459 | Bacteria | 27097 |
| 365 | Ga0495629_0008639 | 3300046459 | Bacteria | 7502 |
| 366 | Ga0495629_0014480 | 3300046459 | Bacteria | 5674 |
| 367 | Ga0495629_0035997 | 3300046459 | Bacteria | 3497 |
| 368 | Ga0495629_0049934 | 3300046459 | Bacteria | 2931 |
| 369 | Ga0495629_0073392 | 3300046459 | Bacteria | 2389 |
| 370 | Ga0495638_0009449 | 3300046460 | Bacteria | 6843 |
| 371 | Ga0495641_0026997 | 3300046461 | Bacteria | 2796 |
| 372 | Ga0495651_0004391 | 3300046462 | Bacteria | 10795 |
| 373 | Ga0495651_0020669 | 3300046462 | Bacteria | 5111 |
| 374 | Ga0495651_0083711 | 3300046462 | Bacteria | 2405 |
| 375 | Ga0495651_0173334 | 3300046462 | Bacteria | 1534 |
| 376 | Ga0495653_0001472 | 3300046463 | Bacteria | 18364 |
| 377 | Ga0495653_0002197 | 3300046463 | Bacteria | 15431 |
| 378 | Ga0495653_0014385 | 3300046463 | Bacteria | 6457 |
| 379 | Ga0495653_0016500 | 3300046463 | Bacteria | 6010 |
| 380 | Ga0495653_0041108 | 3300046463 | Bacteria | 3610 |
| 381 | Ga0495653_0118495 | 3300046463 | Bacteria | 1890 |
| 382 | Ga0495650_0000549 | 3300046471 | Bacteria | 53534 |
| 383 | Ga0495650_0001527 | 3300046471 | Bacteria | 21978 |
| 384 | Ga0495650_0003550 | 3300046471 | Bacteria | 11291 |
| 385 | Ga0495650_0007850 | 3300046471 | Bacteria | 6339 |
| 386 | Ga0495650_0015568 | 3300046471 | Bacteria | 3894 |
| 387 | Ga0495580_0000008 | 3300046472 | Bacteria | 102421 |
| 388 | Ga0495580_0001335 | 3300046472 | Bacteria | 21761 |
| 389 | Ga0495580_0010284 | 3300046472 | Bacteria | 7297 |
| 390 | Ga0495580_0017278 | 3300046472 | Bacteria | 5399 |
| 391 | Ga0495580_0035670 | 3300046472 | Bacteria | 3575 |
| 392 | Ga0495580_0042778 | 3300046472 | Bacteria | 3225 |
| 393 | Ga0495582_0000202 | 3300046473 | Bacteria | 33047 |
| 394 | Ga0495582_0008636 | 3300046473 | Bacteria | 5618 |
| 395 | Ga0495582_0012847 | 3300046473 | Bacteria | 4613 |
| 396 | Ga0495582_0020021 | 3300046473 | Bacteria | 3659 |
| 397 | Ga0495605_0009179 | 3300046474 | Bacteria | 5561 |
| 398 | Ga0495605_0012770 | 3300046474 | Bacteria | 4650 |
| 399 | Ga0495605_0012959 | 3300046474 | Bacteria | 4610 |
| 400 | Ga0495605_0092941 | 3300046474 | Bacteria | 1396 |
| 401 | Ga0495639_0039876 | 3300046475 | Bacteria | 2112 |
| 402 | Ga0495662_0006350 | 3300046476 | Bacteria | 5908 |
| 403 | Ga0495662_0022356 | 3300046476 | Bacteria | 3054 |
| 404 | Ga0495662_0065863 | 3300046476 | Bacteria | 1751 |
| 405 | Ga0495664_0000389 | 3300046477 | Bacteria | 21485 |
| 406 | Ga0495664_0012294 | 3300046477 | Bacteria | 4847 |
| 407 | Ga0495664_0112956 | 3300046477 | Bacteria | 1640 |
| 408 | Ga0495664_0163531 | 3300046477 | Bacteria | 1350 |
| 409 | Ga0495584_0006971 | 3300046491 | Bacteria | 5903 |
| 410 | Ga0495584_0019480 | 3300046491 | Bacteria | 3446 |
| 411 | Ga0495585_0061255 | 3300046492 | Bacteria | 2069 |
| 412 | Ga0495585_0105755 | 3300046492 | Bacteria | 1501 |
| 413 | Ga0495594_0009835 | 3300046499 | Bacteria | 4954 |
| 414 | Ga0495594_0091877 | 3300046499 | Bacteria | 1701 |
| 415 | Ga0495596_0002063 | 3300046500 | Bacteria | 11033 |
| 416 | Ga0495596_0006629 | 3300046500 | Bacteria | 5307 |
| 417 | Ga0495596_0008968 | 3300046500 | Bacteria | 4419 |
| 418 | Ga0495596_0025745 | 3300046500 | Bacteria | 2376 |
| 419 | Ga0495583_0004383 | 3300046506 | Bacteria | 10142 |
| 420 | Ga0495606_0011856 | 3300046507 | Bacteria | 7055 |
| 421 | Ga0495606_0011920 | 3300046507 | Bacteria | 7031 |
| 422 | Ga0495606_0052857 | 3300046507 | Bacteria | 2639 |
| 423 | Ga0495608_0007702 | 3300046511 | Bacteria | 7588 |
| 424 | Ga0495610_0009859 | 3300046512 | Bacteria | 5982 |
| 425 | Ga0495616_0026028 | 3300046513 | Bacteria | 3118 |
| 426 | Ga0495616_0045571 | 3300046513 | Bacteria | 2218 |
| 427 | Ga0495618_0002329 | 3300046514 | Bacteria | 12275 |
| 428 | Ga0495618_0011733 | 3300046514 | Bacteria | 5319 |
| 429 | Ga0495620_0013968 | 3300046515 | Bacteria | 4095 |
| 430 | Ga0495628_0002415 | 3300046516 | Bacteria | 16855 |
| 431 | Ga0495628_0021289 | 3300046516 | Bacteria | 5337 |
| 432 | Ga0495628_0032206 | 3300046516 | Bacteria | 4233 |
| 433 | Ga0495628_0109822 | 3300046516 | Bacteria | 2122 |
| 434 | Ga0495628_0128017 | 3300046516 | Bacteria | 1944 |
| 435 | Ga0495630_0001539 | 3300046517 | Bacteria | 16004 |
| 436 | Ga0495630_0007406 | 3300046517 | Bacteria | 7843 |
| 437 | Ga0495630_0013682 | 3300046517 | Bacteria | 5899 |
| 438 | Ga0495630_0052055 | 3300046517 | Bacteria | 3065 |
| 439 | Ga0495631_0039899 | 3300046518 | Bacteria | 2080 |
| 440 | Ga0495644_0010933 | 3300046523 | Bacteria | 3497 |
| 441 | Ga0495648_0019102 | 3300046524 | Bacteria | 4832 |
| 442 | Ga0495648_0152403 | 3300046524 | Bacteria | 1204 |
| 443 | Ga0495666_0000247 | 3300046526 | Bacteria | 23327 |
| 444 | Ga0495666_0002749 | 3300046526 | Bacteria | 8790 |
| 445 | Ga0495666_0042441 | 3300046526 | Bacteria | 2199 |
| 446 | Ga0495666_0076575 | 3300046526 | Bacteria | 1586 |
| 447 | Ga0495642_0004221 | 3300046528 | Bacteria | 5596 |
| 448 | Ga0495642_0007985 | 3300046528 | Bacteria | 4050 |
| 449 | Ga0495642_0013271 | 3300046528 | Bacteria | 3184 |
| 450 | Ga0495642_0072561 | 3300046528 | Bacteria | 1441 |
| 451 | Ga0495642_0086749 | 3300046528 | Bacteria | 1322 |
| 452 | Ga0495652_0025529 | 3300046529 | Bacteria | 5225 |
| 453 | Ga0495652_0027681 | 3300046529 | Bacteria | 4993 |
| 454 | Ga0495652_0100968 | 3300046529 | Bacteria | 2339 |
| 455 | Ga0495654_0008980 | 3300046530 | Bacteria | 5488 |
| 456 | Ga0495654_0022582 | 3300046530 | Bacteria | 3265 |
| 457 | Ga0495665_0000978 | 3300046531 | Bacteria | 15148 |
| 458 | Ga0495665_0005187 | 3300046531 | Bacteria | 7023 |
| 459 | Ga0495665_0048037 | 3300046531 | Bacteria | 2263 |
| 460 | Ga0495640_0013871 | 3300046533 | Bacteria | 6118 |
| 461 | Ga0495640_0016625 | 3300046533 | Bacteria | 5501 |
| 462 | Ga0495640_0033431 | 3300046533 | Bacteria | 3652 |
| 463 | Ga0495586_0008140 | 3300046535 | Bacteria | 5587 |
| 464 | Ga0495586_0150422 | 3300046535 | Bacteria | 1309 |
| 465 | Ga0495587_0004211 | 3300046536 | Bacteria | 9519 |
| 466 | Ga0495587_0022486 | 3300046536 | Bacteria | 3882 |
| 467 | Ga0495609_0014989 | 3300046538 | Bacteria | 3634 |
| 468 | Ga0495597_0008640 | 3300046542 | Bacteria | 5094 |
| 469 | Ga0495597_0019255 | 3300046542 | Bacteria | 3196 |
| 470 | Ga0495597_0023728 | 3300046542 | Bacteria | 2836 |
| 471 | Ga0495645_0000728 | 3300046543 | Bacteria | 22551 |
| 472 | Ga0495645_0000886 | 3300046543 | Bacteria | 20409 |
| 473 | Ga0495645_0002412 | 3300046543 | Bacteria | 12683 |
| 474 | Ga0495645_0027927 | 3300046543 | Bacteria | 4099 |
| 475 | Ga0495645_0047783 | 3300046543 | Bacteria | 3117 |
| 476 | Ga0495622_0000140 | 3300046557 | Bacteria | 62347 |
| 477 | Ga0495622_0072620 | 3300046557 | Bacteria | 1588 |
| 478 | Ga0495633_0000353 | 3300046558 | Bacteria | 50204 |
| 479 | Ga0495667_0264496 | 3300046559 | Bacteria | 1093 |
| 480 | Ga0495668_0167612 | 3300046616 | Bacteria | 1203 |
| 481 | Ga0495634_0004526 | 3300046642 | Bacteria | 10891 |
| 482 | Ga0495634_0022640 | 3300046642 | Bacteria | 4426 |
| 483 | Ga0495625_0035464 | 3300046660 | Bacteria | 3677 |
| 484 | Ga0495635_0002465 | 3300046663 | Bacteria | 12635 |
| 485 | Ga0495635_0023014 | 3300046663 | Bacteria | 4343 |
| 486 | Ga0495635_0164820 | 3300046663 | Bacteria | 1508 |
| 487 | Ga0495661_0003608 | 3300046665 | Bacteria | 11396 |
| 488 | Ga0495661_0008447 | 3300046665 | Bacteria | 7122 |
| 489 | Ga0495661_0046385 | 3300046665 | Bacteria | 2653 |
| 490 | Ga0495661_0050512 | 3300046665 | Bacteria | 2517 |
| 491 | Ga0495588_0020489 | 3300046674 | Bacteria | 3251 |
| 492 | Ga0495588_0106198 | 3300046674 | Bacteria | 1478 |
| 493 | Ga0495657_0084847 | 3300046675 | Bacteria | 2042 |
| 494 | Ga0495599_0026652 | 3300046678 | Bacteria | 3623 |
| 495 | Ga0495599_0036027 | 3300046678 | Bacteria | 3106 |
| 496 | Ga0495623_0004544 | 3300046679 | Bacteria | 9111 |
| 497 | Ga0495623_0006073 | 3300046679 | Bacteria | 7851 |
| 498 | Ga0495623_0019998 | 3300046679 | Bacteria | 4328 |
| 499 | Ga0495646_0003240 | 3300046680 | Bacteria | 10117 |
| 500 | Ga0495646_0006087 | 3300046680 | Bacteria | 7651 |
| 501 | Ga0495646_0015998 | 3300046680 | Bacteria | 4761 |
| 502 | Ga0495646_0016386 | 3300046680 | Bacteria | 4702 |
| 503 | Ga0495646_0016650 | 3300046680 | Bacteria | 4668 |
| 504 | Ga0495669_0000228 | 3300046684 | Bacteria | 33234 |
| 505 | Ga0495669_0013602 | 3300046684 | Bacteria | 3471 |
| 506 | Ga0495669_0044426 | 3300046684 | Bacteria | 1979 |
| 507 | Ga0495613_0007006 | 3300046689 | Bacteria | 8396 |
| 508 | Ga0495613_0052317 | 3300046689 | Bacteria | 3008 |
| 509 | Ga0495624_0000346 | 3300046690 | Bacteria | 36774 |
| 510 | Ga0495624_0002771 | 3300046690 | Bacteria | 13171 |
| 511 | Ga0495624_0010869 | 3300046690 | Bacteria | 6274 |
| 512 | Ga0495624_0043231 | 3300046690 | Bacteria | 2874 |
| 513 | Ga0495624_0044109 | 3300046690 | Bacteria | 2843 |
| 514 | Ga0495670_0050516 | 3300046691 | Bacteria | 2082 |
| 515 | Ga0495671_0013009 | 3300046692 | Bacteria | 4525 |
| 516 | Ga0495671_0014195 | 3300046692 | Bacteria | 4293 |
| 517 | Ga0495671_0060469 | 3300046692 | Bacteria | 1870 |
| 518 | Ga0495649_0006454 | 3300046694 | Bacteria | 7303 |
| 519 | Ga0495649_0015713 | 3300046694 | Bacteria | 4304 |
| 520 | Ga0495649_0016992 | 3300046694 | Bacteria | 4117 |
| 521 | Ga0495649_0017374 | 3300046694 | Bacteria | 4059 |
| 522 | Ga0495649_0021983 | 3300046694 | Bacteria | 3572 |
| 523 | Ga0495649_0027574 | 3300046694 | Bacteria | 3150 |
| 524 | Ga0495649_0111342 | 3300046694 | Bacteria | 1452 |
| 525 | Ga0495649_0127063 | 3300046694 | Bacteria | 1346 |
| 526 | Ga0495589_0008041 | 3300046794 | Bacteria | 5516 |
| 527 | Ga0495589_0011191 | 3300046794 | Bacteria | 4656 |
| 528 | Ga0495589_0011609 | 3300046794 | Bacteria | 4573 |
| 529 | Ga0495589_0042293 | 3300046794 | Bacteria | 2271 |
| 530 | Ga0495589_0083086 | 3300046794 | Bacteria | 1557 |
| 531 | Ga0495589_0127314 | 3300046794 | Bacteria | 1224 |
| 532 | Ga0495600_0007206 | 3300046809 | Bacteria | 6789 |
| 533 | Ga0495581_0000497 | 3300047315 | Bacteria | 20079 |
| 534 | Ga0495581_0003779 | 3300047315 | Bacteria | 8709 |
| 535 | Ga0495581_0005780 | 3300047315 | Bacteria | 7171 |
| 536 | Ga0495581_0013341 | 3300047315 | Bacteria | 4764 |
| 537 | Ga0495581_0041335 | 3300047315 | Bacteria | 2668 |
| 538 | Ga0495581_0041636 | 3300047315 | Bacteria | 2659 |
| 539 | Ga0495604_0002218 | 3300047317 | Bacteria | 15548 |
| 540 | Ga0495604_0002466 | 3300047317 | Bacteria | 14788 |
| 541 | Ga0495604_0010126 | 3300047317 | Bacteria | 7468 |
| 542 | Ga0495604_0017290 | 3300047317 | Bacteria | 5771 |
| 543 | Ga0495604_0049126 | 3300047317 | Bacteria | 3279 |
| 544 | Ga0495604_0158176 | 3300047317 | Bacteria | 1603 |
| 545 | Ga0495674_0003027 | 3300047319 | Bacteria | 16366 |
| 546 | Ga0495674_0015099 | 3300047319 | Bacteria | 7225 |
| 547 | Ga0495674_0032791 | 3300047319 | Bacteria | 4707 |
| 548 | Ga0495674_0045197 | 3300047319 | Bacteria | 3910 |
| 549 | Ga0495674_0102222 | 3300047319 | Bacteria | 2437 |
| 550 | Ga0495674_0118513 | 3300047319 | Bacteria | 2238 |
| 551 | Ga0495672_0022883 | 3300047320 | Bacteria | 4054 |
| 552 | Ga0495672_0028495 | 3300047320 | Bacteria | 3532 |
| 553 | Ga0495672_0028953 | 3300047320 | Bacteria | 3495 |
| 554 | Ga0495672_0057945 | 3300047320 | Bacteria | 2247 |
| 555 | Ga0495672_0083369 | 3300047320 | Bacteria | 1776 |
| 556 | Ga0495676_0000180 | 3300047321 | Bacteria | 49779 |
| 557 | Ga0495676_0003897 | 3300047321 | Bacteria | 13565 |
| 558 | Ga0495676_0028906 | 3300047321 | Bacteria | 4727 |
| 559 | Ga0495676_0080548 | 3300047321 | Bacteria | 2472 |
| 560 | Ga0495676_0124642 | 3300047321 | Bacteria | 1868 |
| 561 | Ga0495680_0003480 | 3300047322 | Bacteria | 15478 |
| 562 | Ga0495680_0003540 | 3300047322 | Bacteria | 15308 |
| 563 | Ga0495680_0015815 | 3300047322 | Bacteria | 6495 |
| 564 | Ga0495683_0004510 | 3300047323 | Bacteria | 7889 |
| 565 | Ga0495683_0005695 | 3300047323 | Bacteria | 6882 |
| 566 | Ga0495683_0006341 | 3300047323 | Bacteria | 6465 |
| 567 | Ga0495683_0010772 | 3300047323 | Bacteria | 4822 |
| 568 | Ga0495683_0026301 | 3300047323 | Bacteria | 2978 |
| 569 | Ga0495683_0036522 | 3300047323 | Bacteria | 2493 |
| 570 | Ga0495683_0115056 | 3300047323 | Bacteria | 1281 |
| 571 | Ga0495687_000029 | 3300047443 | Bacteria | 293244 |
| 572 | Ga0495687_000069 | 3300047443 | Bacteria | 159852 |
| 573 | Ga0495687_008012 | 3300047443 | Bacteria | 6115 |
| 574 | Ga0495687_033147 | 3300047443 | Bacteria | 2347 |
| 575 | Ga0495687_041609 | 3300047443 | Bacteria | 2014 |
| 576 | Ga0495687_054910 | 3300047443 | Bacteria | 1668 |
| 577 | Ga0495675_0001013 | 3300047444 | Bacteria | 17088 |
| 578 | Ga0495675_0004530 | 3300047444 | Bacteria | 8426 |
| 579 | Ga0495675_0005353 | 3300047444 | Bacteria | 7821 |
| 580 | Ga0495675_0007707 | 3300047444 | Bacteria | 6639 |
| 581 | Ga0495675_0048610 | 3300047444 | Bacteria | 2698 |
| 582 | Ga0495679_000117 | 3300047446 | Bacteria | 69653 |
| 583 | Ga0495679_001343 | 3300047446 | Bacteria | 14201 |
| 584 | Ga0495679_004804 | 3300047446 | Bacteria | 6114 |
| 585 | Ga0495673_0006174 | 3300047469 | Bacteria | 7096 |
| 586 | Ga0495673_0013634 | 3300047469 | Bacteria | 4258 |
| 587 | Ga0495673_0015893 | 3300047469 | Bacteria | 3863 |
| 588 | Ga0495681_0034390 | 3300047470 | Bacteria | 2526 |
| 589 | Ga0495681_0042134 | 3300047470 | Bacteria | 2212 |
| 590 | Ga0495686_0000143 | 3300047472 | Bacteria | 143037 |
| 591 | Ga0495686_0056666 | 3300047472 | Bacteria | 2448 |
| 592 | Ga0495686_0214417 | 3300047472 | Bacteria | 1098 |
| 593 | Ga0495593_0001204 | 3300047673 | Bacteria | 15122 |
| 594 | Ga0495593_0002984 | 3300047673 | Bacteria | 10188 |
| 595 | Ga0495593_0003439 | 3300047673 | Bacteria | 9479 |
| 596 | Ga0495593_0005141 | 3300047673 | Bacteria | 7735 |
| 597 | Ga0495593_0033182 | 3300047673 | Bacteria | 2812 |
| 598 | Ga0495602_0000199 | 3300048088 | Bacteria | 55862 |
| 599 | Ga0495602_0002585 | 3300048088 | Bacteria | 18476 |
| 600 | Ga0495602_0006600 | 3300048088 | Bacteria | 12159 |
| 601 | Ga0495602_0022235 | 3300048088 | Bacteria | 6213 |
| 602 | Ga0495602_0062536 | 3300048088 | Bacteria | 3229 |
| 603 | Ga0495602_0076516 | 3300048088 | Bacteria | 2835 |
| 604 | Ga0495602_0190589 | 3300048088 | Bacteria | 1572 |
| 605 | Ga0495614_0002425 | 3300048089 | Bacteria | 8282 |
| 606 | Ga0495614_0003403 | 3300048089 | Bacteria | 7116 |
| 607 | Ga0495614_0006988 | 3300048089 | Bacteria | 5040 |
| 608 | Ga0495614_0010970 | 3300048089 | Bacteria | 3986 |
| 609 | Ga0495614_0015459 | 3300048089 | Bacteria | 3327 |
| 610 | Ga0495626_0015983 | 3300048091 | Bacteria | 3826 |
| 611 | Ga0495626_0018709 | 3300048091 | Bacteria | 3471 |
| 612 | Ga0495626_0024851 | 3300048091 | Bacteria | 2933 |
| 613 | Ga0496100_0003210 | 3300048903 | Bacteria | 8486 |
| 614 | Ga0496100_0006374 | 3300048903 | Bacteria | 6430 |
| 615 | Ga0496100_0034221 | 3300048903 | Bacteria | 3186 |
| 616 | Ga0496101_0002176 | 3300048904 | Bacteria | 11960 |
| 617 | Ga0496101_0002632 | 3300048904 | Bacteria | 11027 |
| 618 | Ga0496101_0006655 | 3300048904 | Bacteria | 7453 |
| 619 | Ga0496101_0031118 | 3300048904 | Bacteria | 3749 |
| 620 | Ga0496101_0424503 | 3300048904 | Bacteria | 1048 |
| 621 | Ga0496102_0000955 | 3300048905 | Bacteria | 27231 |
| 622 | Ga0496102_0015162 | 3300048905 | Bacteria | 6708 |
| 623 | Ga0496102_0022810 | 3300048905 | Bacteria | 5550 |
| 624 | Ga0496102_0045231 | 3300048905 | Bacteria | 3996 |
| 625 | Ga0496102_0115125 | 3300048905 | Bacteria | 2509 |
| 626 | Ga0496102_0149240 | 3300048905 | Bacteria | 2196 |
| 627 | Ga0496103_0000338 | 3300048906 | Bacteria | 42786 |
| 628 | Ga0496103_0004052 | 3300048906 | Bacteria | 8906 |
| 629 | Ga0496103_0006828 | 3300048906 | Bacteria | 6812 |
| 630 | Ga0496103_0013968 | 3300048906 | Bacteria | 4766 |
| 631 | Ga0496104_0095561 | 3300048907 | Bacteria | 2843 |
| 632 | Ga0496105_0024010 | 3300048908 | Bacteria | 4952 |
| 633 | Ga0496105_0024408 | 3300048908 | Bacteria | 4911 |
| 634 | Ga0496105_0026268 | 3300048908 | Bacteria | 4748 |
| 635 | Ga0496105_0049948 | 3300048908 | Bacteria | 3455 |
| 636 | Ga0496105_0072622 | 3300048908 | Bacteria | 2843 |
| 637 | Ga0496106_0000001 | 3300048909 | Bacteria | 497458 |
| 638 | Ga0496106_0001944 | 3300048909 | Bacteria | 15500 |
| 639 | Ga0496106_0309513 | 3300048909 | Bacteria | 1267 |
| 640 | Ga0496107_0002965 | 3300048910 | Bacteria | 11239 |
| 641 | Ga0496107_0063063 | 3300048910 | Bacteria | 2685 |
| 642 | Ga0496107_0218764 | 3300048910 | Bacteria | 1417 |
| 643 | Ga0496109_0052376 | 3300048912 | Bacteria | 3720 |
| 644 | Ga0496109_0577087 | 3300048912 | Bacteria | 1060 |
| 645 | Ga0496110_0117344 | 3300048913 | Bacteria | 2396 |
| 646 | Ga0496110_0166694 | 3300048913 | Bacteria | 1998 |
| 647 | Ga0496110_0187716 | 3300048913 | Bacteria | 1877 |
| 648 | Ga0496110_0209218 | 3300048913 | Bacteria | 1773 |
| 649 | Ga0496110_0315172 | 3300048913 | Bacteria | 1424 |
| 650 | Ga0496111_0011970 | 3300048914 | Bacteria | 5863 |
| 651 | Ga0496111_0051941 | 3300048914 | Bacteria | 2960 |
| 652 | Ga0496112_0039003 | 3300048915 | Bacteria | 4640 |
| 653 | Ga0496113_0109919 | 3300048916 | Bacteria | 2144 |
| 654 | Ga0496114_0005431 | 3300048917 | Bacteria | 9972 |
| 655 | Ga0496114_0079787 | 3300048917 | Bacteria | 2763 |
| 656 | Ga0496114_0242643 | 3300048917 | Bacteria | 1585 |
| 657 | Ga0496114_0366820 | 3300048917 | Bacteria | 1274 |
| 658 | Ga0496114_0542224 | 3300048917 | Bacteria | 1028 |
| 659 | Ga0496115_0037391 | 3300048918 | Bacteria | 3847 |
| 660 | Ga0496115_0180048 | 3300048918 | Bacteria | 1748 |
| 661 | Ga0496115_0193580 | 3300048918 | Bacteria | 1680 |
| 662 | Ga0496116_0002490 | 3300048919 | Bacteria | 19299 |
| 663 | Ga0496116_0023479 | 3300048919 | Bacteria | 4591 |
| 664 | Ga0496116_0064789 | 3300048919 | Bacteria | 2347 |
| 665 | Ga0496117_0000005 | 3300048920 | Bacteria | 777468 |
| 666 | Ga0496117_0002765 | 3300048920 | Bacteria | 21479 |
| 667 | Ga0496117_0003919 | 3300048920 | Bacteria | 16853 |
| 668 | Ga0496117_0007290 | 3300048920 | Bacteria | 10863 |
| 669 | Ga0496117_0017379 | 3300048920 | Bacteria | 6006 |
| 670 | Ga0496117_0025441 | 3300048920 | Bacteria | 4654 |
| 671 | Ga0496117_0027959 | 3300048920 | Bacteria | 4375 |
| 672 | Ga0496118_0000031 | 3300048921 | Bacteria | 339329 |
| 673 | Ga0496118_0000215 | 3300048921 | Bacteria | 100753 |
| 674 | Ga0496118_0001206 | 3300048921 | Bacteria | 39812 |
| 675 | Ga0496118_0003051 | 3300048921 | Bacteria | 21551 |
| 676 | Ga0496118_0006556 | 3300048921 | Bacteria | 12726 |
| 677 | Ga0496118_0015186 | 3300048921 | Bacteria | 7150 |
| 678 | Ga0496118_0035740 | 3300048921 | Bacteria | 4028 |
| 679 | Ga0496118_0096852 | 3300048921 | Bacteria | 2009 |
| 680 | Ga0496118_0100916 | 3300048921 | Bacteria | 1950 |
| 681 | Ga0496119_0033957 | 3300048922 | Bacteria | 3370 |
| 682 | Ga0496121_0001279 | 3300048924 | Bacteria | 43329 |
| 683 | Ga0496121_0002026 | 3300048924 | Bacteria | 32144 |
| 684 | Ga0496121_0004114 | 3300048924 | Bacteria | 19942 |
| 685 | Ga0496121_0008458 | 3300048924 | Bacteria | 12085 |
| 686 | Ga0496121_0009536 | 3300048924 | Bacteria | 11121 |
| 687 | Ga0496121_0010944 | 3300048924 | Bacteria | 10133 |
| 688 | Ga0496121_0014329 | 3300048924 | Bacteria | 8425 |
| 689 | Ga0496121_0015334 | 3300048924 | Bacteria | 8040 |
| 690 | Ga0496122_0001300 | 3300048925 | Bacteria | 41219 |
| 691 | Ga0496122_0012369 | 3300048925 | Bacteria | 8512 |
| 692 | Ga0496122_0030969 | 3300048925 | Bacteria | 4466 |
| 693 | Ga0496122_0052429 | 3300048925 | Bacteria | 3088 |
| 694 | Ga0496123_0003538 | 3300048926 | Bacteria | 17374 |
| 695 | Ga0496123_0020942 | 3300048926 | Bacteria | 5097 |
| 696 | Ga0496123_0057080 | 3300048926 | Bacteria | 2545 |
| 697 | Ga0496124_0029873 | 3300048927 | Bacteria | 4848 |
| 698 | Ga0496124_0043284 | 3300048927 | Bacteria | 3871 |
| 699 | Ga0496124_0124513 | 3300048927 | Bacteria | 2055 |
| 700 | Ga0496124_0146946 | 3300048927 | Bacteria | 1854 |
| 701 | Ga0496124_0177307 | 3300048927 | Bacteria | 1644 |
| 702 | Ga0496125_0006279 | 3300048928 | Bacteria | 12915 |
| 703 | Ga0496126_0000032 | 3300048929 | Bacteria | 372456 |
| 704 | Ga0496126_0002361 | 3300048929 | Bacteria | 25765 |
| 705 | Ga0496126_0002530 | 3300048929 | Bacteria | 24476 |
| 706 | Ga0496126_0021102 | 3300048929 | Bacteria | 6369 |
| 707 | Ga0496126_0231437 | 3300048929 | Bacteria | 1548 |
| 708 | Ga0495682_0008882 | 3300049460 | Bacteria | 3944 |
| 709 | Ga0501031_0069401 | 3300049568 | Bacteria | 2295 |
| 710 | Ga0501032_0012186 | 3300049569 | Bacteria | 6156 |
| 711 | Ga0501039_0155001 | 3300049575 | Bacteria | 1799 |
| 712 | Ga0501041_0010572 | 3300049577 | Bacteria | 5442 |
| 713 | Ga0501266_000285 | 3300049763 | Bacteria | 6659 |
| 714 | nmdc:mga00v17_5260_c1 | 3300050491 | Bacteria | 2503 |
| 715 | nmdc:mga06z11_3711_c1 | 3300050494 | Bacteria | 5932 |
| 716 | Ga0500651_0014592 | 3300053093 | Bacteria | 4809 |
| 717 | Ga0500641_0021153 | 3300053096 | Bacteria | 2475 |
| 718 | Ga0500556_0058478 | 3300053104 | Bacteria | 1414 |
| 719 | Ga0500609_001160 | 3300053731 | Bacteria | 3920 |
| 720 | Ga0466962_0001441 | 3300061719 | Bacteria | 11091 |
| 721 | Ga0466962_0003879 | 3300061719 | Bacteria | 7145 |
| 722 | Ga0466962_0042067 | 3300061719 | Bacteria | 2186 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009036 | Ga0105244_10001991 | Ga0105244_1000199114 | 274 |
| 2 | 3300048927 | Ga0496124_0146946 | Ga0496124_0146946_673_1650 | 274 |
| 3 | 3300046507 | Ga0495606_0011920 | Ga0495606_0011920_2552_3511 | 286 |
| 4 | 3300046459 | Ga0495629_0073392 | Ga0495629_0073392_1113_2048 | 287 |
| 5 | 3300046473 | Ga0495582_0012847 | Ga0495582_0012847_1255_2190 | 287 |
| 6 | 3300046491 | Ga0495584_0006971 | Ga0495584_0006971_3012_3944 | 287 |
| 7 | 3300046492 | Ga0495585_0061255 | Ga0495585_0061255_763_1698 | 287 |
| 8 | 3300046499 | Ga0495594_0009835 | Ga0495594_0009835_593_1528 | 287 |
| 9 | 3300046500 | Ga0495596_0006629 | Ga0495596_0006629_1859_2791 | 287 |
| 10 | 3300046513 | Ga0495616_0045571 | Ga0495616_0045571_298_1233 | 287 |
| 11 | 3300046518 | Ga0495631_0039899 | Ga0495631_0039899_227_1162 | 287 |
| 12 | 3300046523 | Ga0495644_0010933 | Ga0495644_0010933_1014_1949 | 287 |
| 13 | 3300046660 | Ga0495625_0035464 | Ga0495625_0035464_1221_2156 | 287 |
| 14 | 3300046665 | Ga0495661_0046385 | Ga0495661_0046385_478_1413 | 287 |
| 15 | 3300046684 | Ga0495669_0000228 | Ga0495669_0000228_24572_25504 | 287 |
| 16 | 3300046691 | Ga0495670_0050516 | Ga0495670_0050516_35_970 | 287 |
| 17 | 3300046694 | Ga0495649_0016992 | Ga0495649_0016992_1418_2353 | 287 |
| 18 | 3300047315 | Ga0495581_0003779 | Ga0495581_0003779_4467_5402 | 287 |
| 19 | 3300047320 | Ga0495672_0022883 | Ga0495672_0022883_1627_2562 | 287 |
| 20 | 3300047323 | Ga0495683_0036522 | Ga0495683_0036522_400_1335 | 287 |
| 21 | 3300048089 | Ga0495614_0006988 | Ga0495614_0006988_2999_3934 | 287 |
| 22 | 3300048091 | Ga0495626_0018709 | Ga0495626_0018709_2519_3451 | 287 |
| 23 | 3300003322 | rootL2_10159651 | rootL2_101596512 | 289 |
| 24 | 3300028800 | Ga0265338_10000092 | Ga0265338_100000929 | 289 |
| 25 | 3300046557 | Ga0495622_0072620 | Ga0495622_0072620_454_1386 | 289 |
| 26 | 3300047321 | Ga0495676_0000180 | Ga0495676_0000180_23417_24349 | 289 |
| 27 | 3300049763 | Ga0501266_000285 | Ga0501266_000285_490_1422 | 289 |
| 28 | iso_pu_bacteria | 2857357740 | 2857357936 | 289 |
| 29 | 3300025919 | Ga0207657_10156726 | Ga0207657_101567263 | 290 |
| 30 | 3300025932 | Ga0207690_10200759 | Ga0207690_102007592 | 290 |
| 31 | 3300026116 | Ga0207674_10364764 | Ga0207674_103647642 | 290 |
| 32 | 3300031251 | Ga0265327_10000908 | Ga0265327_1000090816 | 290 |
| 33 | 3300042008 | Ga0439450_017898 | Ga0439450_017898_518_1444 | 290 |
| 34 | 3300042157 | Ga0439458_0003074 | Ga0439458_0003074_1412_2335 | 290 |
| 35 | 3300003775 | Ga0055524_1000003 | Ga0055524_1000003152 | 291 |
| 36 | 3300005262 | Ga0065165_1016609 | Ga0065165_10166092 | 291 |
| 37 | 3300006948 | Ga0099826_10000002 | Ga0099826_10000002599 | 291 |
| 38 | 3300025299 | Ga0209256_1000007 | Ga0209256_1000007212 | 291 |
| 39 | 3300027666 | Ga0209282_1000001 | Ga0209282_1000001554 | 291 |
| 40 | 3300046542 | Ga0495597_0019255 | Ga0495597_0019255_300_1397 | 291 |
| 41 | 3300046616 | Ga0495668_0167612 | Ga0495668_0167612_235_1179 | 291 |
| 42 | 3300047443 | Ga0495687_054910 | Ga0495687_054910_41_1138 | 291 |
| 43 | iso_pu_bacteria | 2952252522 | 2952253515 | 291 |
| 44 | 3300037471 | Ga0395905_0008919 | Ga0395905_0008919_259_1203 | 292 |
| 45 | 3300044683 | Ga0466965_0068246 | Ga0466965_0068246_180_1118 | 292 |
| 46 | 3300048913 | Ga0496110_0315172 | Ga0496110_0315172_113_1042 | 292 |
| 47 | 3300048917 | Ga0496114_0242643 | Ga0496114_0242643_539_1468 | 292 |
| 48 | 3300046474 | Ga0495605_0012770 | Ga0495605_0012770_1054_1995 | 293 |
| 49 | 3300046491 | Ga0495584_0019480 | Ga0495584_0019480_1923_2864 | 293 |
| 50 | 3300046528 | Ga0495642_0007985 | Ga0495642_0007985_579_1520 | 293 |
| 51 | 3300046530 | Ga0495654_0022582 | Ga0495654_0022582_1405_2346 | 293 |
| 52 | 3300046538 | Ga0495609_0014989 | Ga0495609_0014989_166_1107 | 293 |
| 53 | 3300046542 | Ga0495597_0023728 | Ga0495597_0023728_407_1348 | 293 |
| 54 | 3300047320 | Ga0495672_0028495 | Ga0495672_0028495_1563_2504 | 293 |
| 55 | iso_pu_bacteria | 2808606418 | 2809144003 | 293 |
| 56 | 3300003215 | JGI25153J46596_10000022 | JGI25153J46596_1000002289 | 294 |
| 57 | 3300005844 | Ga0068862_100001216 | Ga0068862_10000121612 | 294 |
| 58 | 3300009176 | Ga0105242_10096020 | Ga0105242_100960203 | 294 |
| 59 | 3300025297 | Ga0209758_1000005 | Ga0209758_1000005473 | 294 |
| 60 | 3300025934 | Ga0207686_10056102 | Ga0207686_100561023 | 294 |
| 61 | 3300028380 | Ga0268265_10001163 | Ga0268265_1000116315 | 294 |
| 62 | 3300048927 | Ga0496124_0124513 | Ga0496124_0124513_52_975 | 294 |
| 63 | 3300053731 | Ga0500609_001160 | Ga0500609_001160_547_1467 | 294 |
| 64 | iso_pu_bacteria | 2547132374 | 2548500584 | 294 |
| 65 | iso_pu_bacteria | 2551306416 | 2553003466 | 294 |
| 66 | iso_pu_bacteria | 2643221570 | 2643864416 | 294 |
| 67 | iso_pu_bacteria | 2643221717 | 2644646868 | 294 |
| 68 | iso_pu_bacteria | 2811994881 | 2812367490 | 294 |
| 69 | iso_pu_bacteria | 2818991449 | 2819614423 | 294 |
| 70 | iso_pu_bacteria | 2904530477 | 2904534047 | 294 |
| 71 | iso_pu_bacteria | 2904584206 | 2904589112 | 294 |
| 72 | iso_pu_bacteria | 2904589729 | 2904590406 | 294 |
| 73 | iso_pu_bacteria | 2904601388 | 2904603725 | 294 |
| 74 | iso_pu_bacteria | 2919079590 | 2919080269 | 294 |
| 75 | iso_pu_bacteria | 2923510766 | 2923511587 | 294 |
| 76 | iso_pu_bacteria | 2923519811 | 2923521539 | 294 |
| 77 | iso_pu_bacteria | 2928115317 | 2928119915 | 294 |
| 78 | iso_pu_bacteria | 2928130867 | 2928131518 | 294 |
| 79 | iso_pu_bacteria | 2510065055 | 2510291445 | 295 |
| 80 | iso_pu_bacteria | 2510065058 | 2510310518 | 295 |
| 81 | iso_pu_bacteria | 2773857672 | 2774131035 | 295 |
| 82 | iso_pu_bacteria | 2917832318 | 2917835644 | 295 |
| 83 | iso_pu_bacteria | 2919125081 | 2919129866 | 295 |
| 84 | iso_pu_bacteria | 2984499530 | 2984502196 | 295 |
| 85 | iso_pu_bacteria | 2984504281 | 2984509154 | 295 |
| 86 | iso_pu_bacteria | 3007252601 | 3007256655 | 295 |
| 87 | iso_pu_bacteria | 3007315729 | 3007319104 | 295 |
| 88 | iso_pu_bacteria | 8016728285 | 8016728521 | 295 |
| 89 | 3300005288 | Ga0065714_10074278 | Ga0065714_100742783 | 296 |
| 90 | 3300006195 | Ga0075366_10102184 | Ga0075366_101021843 | 296 |
| 91 | 3300014497 | Ga0182008_10000827 | Ga0182008_1000082722 | 296 |
| 92 | 3300015261 | Ga0182006_1000033 | Ga0182006_1000033116 | 296 |
| 93 | 3300015262 | Ga0182007_10000281 | Ga0182007_1000028121 | 296 |
| 94 | 3300015265 | Ga0182005_1000024 | Ga0182005_1000024107 | 296 |
| 95 | 3300031548 | Ga0307408_100064190 | Ga0307408_1000641902 | 296 |
| 96 | 3300031731 | Ga0307405_10079987 | Ga0307405_100799871 | 296 |
| 97 | 3300031824 | Ga0307413_10178399 | Ga0307413_101783991 | 296 |
| 98 | 3300031852 | Ga0307410_10089845 | Ga0307410_100898452 | 296 |
| 99 | 3300031911 | Ga0307412_10046127 | Ga0307412_100461272 | 296 |
| 100 | 3300032002 | Ga0307416_100088004 | Ga0307416_1000880041 | 296 |
| 101 | 3300032005 | Ga0307411_10008361 | Ga0307411_100083613 | 296 |
| 102 | 3300039447 | Ga0436361_0580152 | Ga0436361_0580152_1610_2530 | 296 |
| 103 | 3300042145 | Ga0450906_006299 | Ga0450906_006299_618_1532 | 296 |
| 104 | 3300042531 | Ga0450918_001218 | Ga0450918_001218_3542_4456 | 296 |
| 105 | 3300048914 | Ga0496111_0051941 | Ga0496111_0051941_165_1151 | 296 |
| 106 | 3300048920 | Ga0496117_0000005 | Ga0496117_0000005_643448_644434 | 296 |
| 107 | 3300048921 | Ga0496118_0000031 | Ga0496118_0000031_133035_134021 | 296 |
| 108 | 3300048924 | Ga0496121_0009536 | Ga0496121_0009536_9007_9993 | 296 |
| 109 | 3300048925 | Ga0496122_0001300 | Ga0496122_0001300_13504_14490 | 296 |
| 110 | 3300048926 | Ga0496123_0003538 | Ga0496123_0003538_1996_2982 | 296 |
| 111 | 3300048927 | Ga0496124_0043284 | Ga0496124_0043284_2487_3473 | 296 |
| 112 | iso_pu_bacteria | 2738541297 | 2738829961 | 296 |
| 113 | iso_pu_bacteria | 2738541357 | 2739153757 | 296 |
| 114 | iso_pu_bacteria | 2738543003 | 2739195677 | 296 |
| 115 | iso_pu_bacteria | 2738543026 | 2739322153 | 296 |
| 116 | iso_pu_bacteria | 2738543029 | 2739340394 | 296 |
| 117 | iso_pu_bacteria | 2821131069 | 2821131904 | 296 |
| 118 | iso_pu_bacteria | 2842711865 | 2842715608 | 296 |
| 119 | iso_pu_bacteria | 2857558681 | 2857561749 | 296 |
| 120 | iso_pu_bacteria | 2904424332 | 2904425648 | 296 |
| 121 | iso_pu_bacteria | 2919476304 | 2919478212 | 296 |
| 122 | 3300005539 | Ga0068853_100458756 | Ga0068853_1004587561 | 297 |
| 123 | 3300046694 | Ga0495649_0111342 | Ga0495649_0111342_366_1316 | 297 |
| 124 | 3300053093 | Ga0500651_0014592 | Ga0500651_0014592_3349_4299 | 297 |
| 125 | 3300053096 | Ga0500641_0021153 | Ga0500641_0021153_480_1451 | 297 |
| 126 | 3300053104 | Ga0500556_0058478 | Ga0500556_0058478_138_1088 | 297 |
| 127 | iso_pu_bacteria | 2643221645 | 2644251547 | 297 |
| 128 | 3300003751 | Ga0055538_1000002 | Ga0055538_1000002219 | 298 |
| 129 | 3300003752 | Ga0055539_1000002 | Ga0055539_1000002219 | 298 |
| 130 | 3300003756 | Ga0055533_1000004 | Ga0055533_1000004219 | 298 |
| 131 | 3300003759 | Ga0055525_1000002 | Ga0055525_1000002219 | 298 |
| 132 | 3300003841 | Ga0055541_1000002 | Ga0055541_1000002623 | 298 |
| 133 | 3300005339 | Ga0070660_100006481 | Ga0070660_1000064815 | 298 |
| 134 | 3300005564 | Ga0070664_100035576 | Ga0070664_1000355765 | 298 |
| 135 | 3300009148 | Ga0105243_10050427 | Ga0105243_100504274 | 298 |
| 136 | 3300009174 | Ga0105241_10029822 | Ga0105241_100298223 | 298 |
| 137 | 3300009176 | Ga0105242_10005895 | Ga0105242_1000589511 | 298 |
| 138 | 3300009545 | Ga0105237_10193823 | Ga0105237_101938233 | 298 |
| 139 | 3300013102 | Ga0157371_10341236 | Ga0157371_103412362 | 298 |
| 140 | 3300015261 | Ga0182006_1000529 | Ga0182006_100052924 | 298 |
| 141 | 3300015261 | Ga0182006_1019112 | Ga0182006_10191122 | 298 |
| 142 | 3300021361 | Ga0213872_10009130 | Ga0213872_100091303 | 298 |
| 143 | 3300025224 | Ga0209784_100002 | Ga0209784_100002452 | 298 |
| 144 | 3300025225 | Ga0209566_100003 | Ga0209566_100003452 | 298 |
| 145 | 3300025226 | Ga0209674_100004 | Ga0209674_100004452 | 298 |
| 146 | 3300025230 | Ga0209563_100006 | Ga0209563_100006452 | 298 |
| 147 | 3300025253 | Ga0209677_100003 | Ga0209677_100003452 | 298 |
| 148 | 3300025909 | Ga0207705_10007441 | Ga0207705_100074417 | 298 |
| 149 | 3300025911 | Ga0207654_10004588 | Ga0207654_100045886 | 298 |
| 150 | 3300025919 | Ga0207657_10061594 | Ga0207657_100615943 | 298 |
| 151 | 3300025920 | Ga0207649_10012810 | Ga0207649_100128103 | 298 |
| 152 | 3300025933 | Ga0207706_10096897 | Ga0207706_100968971 | 298 |
| 153 | 3300025934 | Ga0207686_10007886 | Ga0207686_100078864 | 298 |
| 154 | 3300025942 | Ga0207689_10211609 | Ga0207689_102116092 | 298 |
| 155 | 3300025945 | Ga0207679_10036895 | Ga0207679_100368953 | 298 |
| 156 | 3300025949 | Ga0207667_10065063 | Ga0207667_100650633 | 298 |
| 157 | 3300026142 | Ga0207698_10014639 | Ga0207698_100146395 | 298 |
| 158 | 3300027312 | Ga0209371_1000781 | Ga0209371_100078112 | 298 |
| 159 | 3300028380 | Ga0268265_10009141 | Ga0268265_100091414 | 298 |
| 160 | 3300030500 | Ga0268256_1000366 | Ga0268256_100036627 | 298 |
| 161 | 3300031250 | Ga0265331_10000178 | Ga0265331_1000017833 | 298 |
| 162 | 3300037418 | Ga0395900_0029868 | Ga0395900_0029868_3791_4717 | 298 |
| 163 | 3300037418 | Ga0395900_0133779 | Ga0395900_0133779_130_1053 | 298 |
| 164 | 3300037466 | Ga0395898_0027791 | Ga0395898_0027791_977_1903 | 298 |
| 165 | 3300037466 | Ga0395898_0108313 | Ga0395898_0108313_736_1659 | 298 |
| 166 | 3300037471 | Ga0395905_0014187 | Ga0395905_0014187_3791_4717 | 298 |
| 167 | 3300037471 | Ga0395905_0016137 | Ga0395905_0016137_965_1900 | 298 |
| 168 | 3300038443 | Ga0395901_0000824 | Ga0395901_0000824_19596_20522 | 298 |
| 169 | 3300039447 | Ga0436361_0061959 | Ga0436361_0061959_6651_7577 | 298 |
| 170 | 3300041512 | Ga0451853_3073345 | Ga0451853_3073345_180_1136 | 298 |
| 171 | 3300042005 | Ga0439448_0002423 | Ga0439448_0002423_563_1489 | 298 |
| 172 | 3300044656 | Ga0466969_0060021 | Ga0466969_0060021_413_1339 | 298 |
| 173 | 3300044683 | Ga0466965_0134116 | Ga0466965_0134116_97_1023 | 298 |
| 174 | 3300044693 | Ga0466961_0039421 | Ga0466961_0039421_1170_2096 | 298 |
| 175 | 3300044694 | Ga0466963_0070685 | Ga0466963_0070685_348_1274 | 298 |
| 176 | 3300044706 | Ga0466964_0099185 | Ga0466964_0099185_168_1091 | 298 |
| 177 | 3300044735 | Ga0466968_0000357 | Ga0466968_0000357_4369_5295 | 298 |
| 178 | 3300044842 | Ga0466957_0000032 | Ga0466957_0000032_38939_39865 | 298 |
| 179 | 3300044842 | Ga0466957_0020077 | Ga0466957_0020077_2148_3074 | 298 |
| 180 | 3300045836 | Ga0466958_0047862 | Ga0466958_0047862_1343_2266 | 298 |
| 181 | 3300045976 | Ga0466967_0042855 | Ga0466967_0042855_438_1364 | 298 |
| 182 | 3300045976 | Ga0466967_0177408 | Ga0466967_0177408_272_1198 | 298 |
| 183 | 3300046455 | Ga0495603_0004485 | Ga0495603_0004485_6499_7443 | 298 |
| 184 | 3300046459 | Ga0495629_0000088 | Ga0495629_0000088_34685_35629 | 298 |
| 185 | 3300046471 | Ga0495650_0001527 | Ga0495650_0001527_19937_20881 | 298 |
| 186 | 3300046473 | Ga0495582_0020021 | Ga0495582_0020021_795_1739 | 298 |
| 187 | 3300046476 | Ga0495662_0065863 | Ga0495662_0065863_75_1019 | 298 |
| 188 | 3300046492 | Ga0495585_0105755 | Ga0495585_0105755_76_1020 | 298 |
| 189 | 3300046528 | Ga0495642_0013271 | Ga0495642_0013271_837_1781 | 298 |
| 190 | 3300046530 | Ga0495654_0008980 | Ga0495654_0008980_3735_4679 | 298 |
| 191 | 3300046543 | Ga0495645_0047783 | Ga0495645_0047783_868_1812 | 298 |
| 192 | 3300046684 | Ga0495669_0044426 | Ga0495669_0044426_237_1181 | 298 |
| 193 | 3300046692 | Ga0495671_0060469 | Ga0495671_0060469_679_1623 | 298 |
| 194 | 3300046694 | Ga0495649_0017374 | Ga0495649_0017374_1536_2480 | 298 |
| 195 | 3300046694 | Ga0495649_0127063 | Ga0495649_0127063_178_1122 | 298 |
| 196 | 3300046794 | Ga0495589_0011609 | Ga0495589_0011609_1437_2381 | 298 |
| 197 | 3300047315 | Ga0495581_0041335 | Ga0495581_0041335_730_1674 | 298 |
| 198 | 3300047443 | Ga0495687_000069 | Ga0495687_000069_128081_129025 | 298 |
| 199 | 3300047444 | Ga0495675_0048610 | Ga0495675_0048610_721_1665 | 298 |
| 200 | 3300047470 | Ga0495681_0042134 | Ga0495681_0042134_546_1490 | 298 |
| 201 | 3300048904 | Ga0496101_0006655 | Ga0496101_0006655_5153_6097 | 298 |
| 202 | 3300048908 | Ga0496105_0024010 | Ga0496105_0024010_3792_4715 | 298 |
| 203 | 3300048909 | Ga0496106_0309513 | Ga0496106_0309513_149_1093 | 298 |
| 204 | 3300048913 | Ga0496110_0166694 | Ga0496110_0166694_227_1171 | 298 |
| 205 | 3300048917 | Ga0496114_0079787 | Ga0496114_0079787_694_1638 | 298 |
| 206 | 3300048917 | Ga0496114_0542224 | Ga0496114_0542224_11_934 | 298 |
| 207 | 3300006051 | Ga0075364_10060848 | Ga0075364_100608484 | 299 |
| 208 | 3300021361 | Ga0213872_10027618 | Ga0213872_100276184 | 299 |
| 209 | 3300050491 | nmdc:mga00v17_5260_c1 | nmdc:mga00v17_5260_c1_1442_2353 | 299 |
| 210 | iso_pu_bacteria | 2599185239 | 2599740352 | 299 |
| 211 | iso_pu_bacteria | 2599185240 | 2599748988 | 299 |
| 212 | iso_pu_bacteria | 2599185355 | 2600211065 | 299 |
| 213 | iso_pu_bacteria | 2675903129 | 2676747194 | 299 |
| 214 | iso_pu_bacteria | 2818991452 | 2819635378 | 299 |
| 215 | iso_pu_bacteria | 2863421361 | 2863425192 | 299 |
| 216 | iso_pu_bacteria | 2870068957 | 2870074141 | 299 |
| 217 | iso_pu_bacteria | 2904564687 | 2904571596 | 299 |
| 218 | iso_pu_bacteria | 2904571731 | 2904578652 | 299 |
| 219 | iso_pu_bacteria | 2928157003 | 2928161024 | 299 |
| 220 | iso_pu_bacteria | 2928163908 | 2928166040 | 299 |
| 221 | iso_pu_bacteria | 2928170801 | 2928171051 | 299 |
| 222 | iso_pu_bacteria | 2928536128 | 2928536515 | 299 |
| 223 | iso_pu_bacteria | 2981990288 | 2981991303 | 299 |
| 224 | iso_pu_bacteria | 641736154 | 642413931 | 299 |
| 225 | iso_pu_bacteria | 8018845410 | 8018849176 | 299 |
| 226 | iso_pu_bacteria | 8020938398 | 8020942050 | 299 |
| 227 | iso_pu_bacteria | 8020945358 | 8020950047 | 299 |
| 228 | iso_pu_bacteria | 8020953355 | 8020957272 | 299 |
| 229 | iso_pu_bacteria | 8021120328 | 8021123223 | 299 |
| 230 | iso_pu_bacteria | 8039098773 | 8039103012 | 299 |
| 231 | 3300031239 | Ga0265328_10000104 | Ga0265328_1000010423 | 300 |
| 232 | 3300031240 | Ga0265320_10000232 | Ga0265320_1000023241 | 300 |
| 233 | 3300031241 | Ga0265325_10005819 | Ga0265325_100058195 | 300 |
| 234 | 3300031242 | Ga0265329_10012504 | Ga0265329_100125043 | 300 |
| 235 | 3300031250 | Ga0265331_10004787 | Ga0265331_100047876 | 300 |
| 236 | 3300031251 | Ga0265327_10013812 | Ga0265327_100138121 | 300 |
| 237 | 3300031344 | Ga0265316_10008481 | Ga0265316_100084813 | 300 |
| 238 | 3300046674 | Ga0495588_0106198 | Ga0495588_0106198_94_1023 | 300 |
| 239 | 3300048905 | Ga0496102_0022810 | Ga0496102_0022810_751_1680 | 300 |
| 240 | 3300048910 | Ga0496107_0218764 | Ga0496107_0218764_435_1364 | 300 |
| 241 | 3300028577 | Ga0265318_10000504 | Ga0265318_1000050411 | 301 |
| 242 | 3300028800 | Ga0265338_10037915 | Ga0265338_100379152 | 301 |
| 243 | 3300031241 | Ga0265325_10004573 | Ga0265325_100045733 | 301 |
| 244 | 3300031247 | Ga0265340_10006288 | Ga0265340_100062883 | 301 |
| 245 | 3300031344 | Ga0265316_10001736 | Ga0265316_100017364 | 301 |
| 246 | 3300031595 | Ga0265313_10000604 | Ga0265313_100006046 | 301 |
| 247 | 3300044683 | Ga0466965_0006181 | Ga0466965_0006181_3231_4175 | 301 |
| 248 | 3300044693 | Ga0466961_0000238 | Ga0466961_0000238_22988_23998 | 301 |
| 249 | 3300044719 | Ga0466971_0003561 | Ga0466971_0003561_3346_4356 | 301 |
| 250 | 3300044842 | Ga0466957_0041778 | Ga0466957_0041778_91_1101 | 301 |
| 251 | 3300045836 | Ga0466958_0009905 | Ga0466958_0009905_4303_5247 | 301 |
| 252 | 3300061719 | Ga0466962_0003879 | Ga0466962_0003879_5087_6097 | 301 |
| 253 | 3300001989 | JGI24739J22299_10014841 | JGI24739J22299_100148414 | 302 |
| 254 | 3300003758 | Ga0055532_1002121 | Ga0055532_10021212 | 302 |
| 255 | 3300003758 | Ga0055532_1002497 | Ga0055532_10024974 | 302 |
| 256 | 3300003758 | Ga0055532_1002749 | Ga0055532_10027494 | 302 |
| 257 | 3300003760 | Ga0055527_1000567 | Ga0055527_100056713 | 302 |
| 258 | 3300003761 | Ga0055535_1000523 | Ga0055535_100052330 | 302 |
| 259 | 3300003761 | Ga0055535_1001427 | Ga0055535_100142713 | 302 |
| 260 | 3300003762 | Ga0055542_1000541 | Ga0055542_10005413 | 302 |
| 261 | 3300003762 | Ga0055542_1002728 | Ga0055542_10027283 | 302 |
| 262 | 3300003763 | Ga0055529_1000521 | Ga0055529_10005213 | 302 |
| 263 | 3300003790 | Ga0055528_1001920 | Ga0055528_10019209 | 302 |
| 264 | 3300003856 | Ga0058692_1004101 | Ga0058692_10041014 | 302 |
| 265 | 3300005327 | Ga0070658_10063001 | Ga0070658_100630013 | 302 |
| 266 | 3300005339 | Ga0070660_100000159 | Ga0070660_10000015930 | 302 |
| 267 | 3300005344 | Ga0070661_100058214 | Ga0070661_1000582141 | 302 |
| 268 | 3300005366 | Ga0070659_100000223 | Ga0070659_10000022316 | 302 |
| 269 | 3300005455 | Ga0070663_100001049 | Ga0070663_10000104915 | 302 |
| 270 | 3300005614 | Ga0068856_100058492 | Ga0068856_1000584923 | 302 |
| 271 | 3300005616 | Ga0068852_100030497 | Ga0068852_1000304974 | 302 |
| 272 | 3300005617 | Ga0068859_100000481 | Ga0068859_10000048135 | 302 |
| 273 | 3300005719 | Ga0068861_100036148 | Ga0068861_1000361482 | 302 |
| 274 | 3300006881 | Ga0068865_100243119 | Ga0068865_1002431191 | 302 |
| 275 | 3300006931 | Ga0097620_100000481 | Ga0097620_10000048126 | 302 |
| 276 | 3300009093 | Ga0105240_10003656 | Ga0105240_1000365622 | 302 |
| 277 | 3300009093 | Ga0105240_10191118 | Ga0105240_101911182 | 302 |
| 278 | 3300010375 | Ga0105239_10021326 | Ga0105239_100213267 | 302 |
| 279 | 3300013105 | Ga0157369_10356285 | Ga0157369_103562852 | 302 |
| 280 | 3300015262 | Ga0182007_10026510 | Ga0182007_100265102 | 302 |
| 281 | 3300025225 | Ga0209566_100443 | Ga0209566_1004439 | 302 |
| 282 | 3300025228 | Ga0209672_100012 | Ga0209672_100012444 | 302 |
| 283 | 3300025228 | Ga0209672_100063 | Ga0209672_100063186 | 302 |
| 284 | 3300025229 | Ga0209147_100007 | Ga0209147_100007327 | 302 |
| 285 | 3300025229 | Ga0209147_100077 | Ga0209147_100077186 | 302 |
| 286 | 3300025229 | Ga0209147_100119 | Ga0209147_10011995 | 302 |
| 287 | 3300025242 | Ga0209258_100014 | Ga0209258_100014375 | 302 |
| 288 | 3300025242 | Ga0209258_100105 | Ga0209258_100105186 | 302 |
| 289 | 3300025254 | Ga0209148_1000107 | Ga0209148_1000107186 | 302 |
| 290 | 3300025254 | Ga0209148_1002224 | Ga0209148_10022248 | 302 |
| 291 | 3300025256 | Ga0209759_1019850 | Ga0209759_10198502 | 302 |
| 292 | 3300025272 | Ga0209455_1000100 | Ga0209455_1000100186 | 302 |
| 293 | 3300025272 | Ga0209455_1000220 | Ga0209455_10002203 | 302 |
| 294 | 3300025272 | Ga0209455_1001676 | Ga0209455_100167610 | 302 |
| 295 | 3300025273 | Ga0209673_1000101 | Ga0209673_1000101154 | 302 |
| 296 | 3300025295 | Ga0209564_1003180 | Ga0209564_10031806 | 302 |
| 297 | 3300025904 | Ga0207647_10003580 | Ga0207647_1000358012 | 302 |
| 298 | 3300025909 | Ga0207705_10009968 | Ga0207705_100099687 | 302 |
| 299 | 3300025913 | Ga0207695_10000368 | Ga0207695_1000036821 | 302 |
| 300 | 3300025919 | Ga0207657_10000442 | Ga0207657_1000044231 | 302 |
| 301 | 3300025924 | Ga0207694_10215677 | Ga0207694_102156772 | 302 |
| 302 | 3300025932 | Ga0207690_10000037 | Ga0207690_10000037119 | 302 |
| 303 | 3300025936 | Ga0207670_10000079 | Ga0207670_1000007966 | 302 |
| 304 | 3300025941 | Ga0207711_10010149 | Ga0207711_100101492 | 302 |
| 305 | 3300025945 | Ga0207679_10055898 | Ga0207679_100558983 | 302 |
| 306 | 3300025949 | Ga0207667_10119869 | Ga0207667_101198692 | 302 |
| 307 | 3300026067 | Ga0207678_10000317 | Ga0207678_1000031715 | 302 |
| 308 | 3300026075 | Ga0207708_10000652 | Ga0207708_1000065220 | 302 |
| 309 | 3300026089 | Ga0207648_10001111 | Ga0207648_1000111125 | 302 |
| 310 | 3300026118 | Ga0207675_100057508 | Ga0207675_1000575082 | 302 |
| 311 | 3300026142 | Ga0207698_10029747 | Ga0207698_100297473 | 302 |
| 312 | 3300027312 | Ga0209371_1000080 | Ga0209371_100008079 | 302 |
| 313 | 3300028577 | Ga0265318_10000127 | Ga0265318_1000012743 | 302 |
| 314 | 3300030500 | Ga0268256_1000160 | Ga0268256_100016055 | 302 |
| 315 | 3300031235 | Ga0265330_10000112 | Ga0265330_1000011251 | 302 |
| 316 | 3300031238 | Ga0265332_10001836 | Ga0265332_100018363 | 302 |
| 317 | 3300031239 | Ga0265328_10006581 | Ga0265328_100065811 | 302 |
| 318 | 3300031240 | Ga0265320_10000969 | Ga0265320_1000096917 | 302 |
| 319 | 3300031241 | Ga0265325_10069384 | Ga0265325_100693842 | 302 |
| 320 | 3300031242 | Ga0265329_10001427 | Ga0265329_100014275 | 302 |
| 321 | 3300031249 | Ga0265339_10003001 | Ga0265339_100030015 | 302 |
| 322 | 3300031250 | Ga0265331_10000591 | Ga0265331_1000059121 | 302 |
| 323 | 3300031344 | Ga0265316_10000731 | Ga0265316_100007318 | 302 |
| 324 | 3300031595 | Ga0265313_10000056 | Ga0265313_1000005629 | 302 |
| 325 | 3300031711 | Ga0265314_10005145 | Ga0265314_100051453 | 302 |
| 326 | 3300031712 | Ga0265342_10000472 | Ga0265342_100004728 | 302 |
| 327 | 3300037312 | Ga0395899_0000065 | Ga0395899_0000065_84622_85566 | 302 |
| 328 | 3300037418 | Ga0395900_0014346 | Ga0395900_0014346_2724_3668 | 302 |
| 329 | 3300037466 | Ga0395898_0003375 | Ga0395898_0003375_12525_13469 | 302 |
| 330 | 3300039437 | Ga0436365_0357678 | Ga0436365_0357678_544_1464 | 302 |
| 331 | iso_pu_bacteria | 2519103095 | 2519460695 | 302 |
| 332 | iso_pu_bacteria | 2582581311 | 2585293149 | 302 |
| 333 | iso_pu_bacteria | 2600255292 | 2601672177 | 302 |
| 334 | iso_pu_bacteria | 2816332253 | 2817257551 | 302 |
| 335 | iso_pu_bacteria | 2816332256 | 2817282045 | 302 |
| 336 | iso_pu_bacteria | 2816332286 | 2817451494 | 302 |
| 337 | iso_pu_bacteria | 2857547612 | 2857549209 | 302 |
| 338 | iso_pu_bacteria | 2885080285 | 2885082322 | 302 |
| 339 | iso_pu_bacteria | 2932410948 | 2932416253 | 302 |
| 340 | iso_pu_bacteria | 2932416698 | 2932422353 | 302 |
| 341 | iso_pu_bacteria | 8020807995 | 8020811160 | 302 |
| 342 | iso_pu_bacteria | 8040167225 | 8040168267 | 302 |
| 343 | iso_pu_bacteria | 8040173305 | 8040175947 | 302 |
| 344 | 3300009551 | Ga0105238_10033930 | Ga0105238_100339303 | 303 |
| 345 | 3300025302 | Ga0207426_1001127 | Ga0207426_10011272 | 303 |
| 346 | 3300046477 | Ga0495664_0163531 | Ga0495664_0163531_154_1095 | 303 |
| 347 | 3300047319 | Ga0495674_0003027 | Ga0495674_0003027_5657_6598 | 303 |
| 348 | 3300048903 | Ga0496100_0003210 | Ga0496100_0003210_2984_3988 | 303 |
| 349 | 3300048904 | Ga0496101_0002176 | Ga0496101_0002176_5178_6182 | 303 |
| 350 | 3300048905 | Ga0496102_0015162 | Ga0496102_0015162_3306_4310 | 303 |
| 351 | 3300048906 | Ga0496103_0006828 | Ga0496103_0006828_2068_3072 | 303 |
| 352 | 3300048909 | Ga0496106_0001944 | Ga0496106_0001944_7407_8411 | 303 |
| 353 | 3300048910 | Ga0496107_0063063 | Ga0496107_0063063_811_1815 | 303 |
| 354 | 3300048912 | Ga0496109_0577087 | Ga0496109_0577087_28_1032 | 303 |
| 355 | 3300048918 | Ga0496115_0180048 | Ga0496115_0180048_115_1119 | 303 |
| 356 | 3300048919 | Ga0496116_0002490 | Ga0496116_0002490_4423_5427 | 303 |
| 357 | 3300048920 | Ga0496117_0027959 | Ga0496117_0027959_2050_3054 | 303 |
| 358 | 3300048921 | Ga0496118_0003051 | Ga0496118_0003051_10109_11113 | 303 |
| 359 | 3300048924 | Ga0496121_0008458 | Ga0496121_0008458_10663_11667 | 303 |
| 360 | 3300048924 | Ga0496121_0014329 | Ga0496121_0014329_815_1810 | 303 |
| 361 | 3300048925 | Ga0496122_0030969 | Ga0496122_0030969_1239_2243 | 303 |
| 362 | 3300048926 | Ga0496123_0020942 | Ga0496123_0020942_3196_4200 | 303 |
| 363 | iso_pu_bacteria | 2501025502 | 2501085868 | 303 |
| 364 | iso_pu_bacteria | 2508501125 | 2509126504 | 303 |
| 365 | iso_pu_bacteria | 2510917013 | 2511088400 | 303 |
| 366 | iso_pu_bacteria | 2513237151 | 2513958267 | 303 |
| 367 | iso_pu_bacteria | 2856287931 | 2856289049 | 303 |
| 368 | iso_pu_bacteria | 2857357740 | 2857358597 | 303 |
| 369 | iso_pu_bacteria | 2904479285 | 2904482057 | 303 |
| 370 | 3300031456 | Ga0307513_10260098 | Ga0307513_102600982 | 304 |
| 371 | iso_pu_bacteria | 2501025501 | 2501076142 | 304 |
| 372 | iso_pu_bacteria | 2501025504 | 2501411995 | 304 |
| 373 | iso_pu_bacteria | 2510917014 | 2511100989 | 304 |
| 374 | iso_pu_bacteria | 2510917015 | 2511107265 | 304 |
| 375 | iso_pu_bacteria | 2512047030 | 2512349231 | 304 |
| 376 | iso_pu_bacteria | 2513237082 | 2513557296 | 304 |
| 377 | iso_pu_bacteria | 2513237083 | 2513564933 | 304 |
| 378 | iso_pu_bacteria | 2513237166 | 2514053692 | 304 |
| 379 | iso_pu_bacteria | 2515154122 | 2515680085 | 304 |
| 380 | iso_pu_bacteria | 2515154123 | 2515690157 | 304 |
| 381 | iso_pu_bacteria | 2515154189 | 2516022042 | 304 |
| 382 | iso_pu_bacteria | 2526164713 | 2527077234 | 304 |
| 383 | iso_pu_bacteria | 2562617112 | 2563060591 | 304 |
| 384 | iso_pu_bacteria | 2600255067 | 2600811195 | 304 |
| 385 | iso_pu_bacteria | 2711768613 | 2713475768 | 304 |
| 386 | iso_pu_bacteria | 2738541296 | 2738819359 | 304 |
| 387 | iso_pu_bacteria | 2738541298 | 2738831838 | 304 |
| 388 | iso_pu_bacteria | 2738541306 | 2738873366 | 304 |
| 389 | iso_pu_bacteria | 2738543002 | 2739184996 | 304 |
| 390 | iso_pu_bacteria | 2738543008 | 2739219965 | 304 |
| 391 | iso_pu_bacteria | 2744054900 | 2746087172 | 304 |
| 392 | iso_pu_bacteria | 2744054901 | 2746096625 | 304 |
| 393 | iso_pu_bacteria | 2751185846 | 2753571584 | 304 |
| 394 | iso_pu_bacteria | 2791355137 | 2792838806 | 304 |
| 395 | iso_pu_bacteria | 2818991450 | 2819619392 | 304 |
| 396 | iso_pu_bacteria | 2842324504 | 2842326650 | 304 |
| 397 | iso_pu_bacteria | 2842348783 | 2842350254 | 304 |
| 398 | iso_pu_bacteria | 2842454564 | 2842456974 | 304 |
| 399 | iso_pu_bacteria | 2883087390 | 2883089449 | 304 |
| 400 | iso_pu_bacteria | 2885270888 | 2885278192 | 304 |
| 401 | iso_pu_bacteria | 2900634093 | 2900638648 | 304 |
| 402 | iso_pu_bacteria | 2902682994 | 2902688070 | 304 |
| 403 | iso_pu_bacteria | 2904483920 | 2904486860 | 304 |
| 404 | iso_pu_bacteria | 2904615490 | 2904625185 | 304 |
| 405 | iso_pu_bacteria | 2919527303 | 2919528192 | 304 |
| 406 | iso_pu_bacteria | 2928108538 | 2928111585 | 304 |
| 407 | iso_pu_bacteria | 2928135762 | 2928138387 | 304 |
| 408 | iso_pu_bacteria | 2928503688 | 2928504804 | 304 |
| 409 | iso_pu_bacteria | 2945934425 | 2945940373 | 304 |
| 410 | iso_pu_bacteria | 2990703756 | 2990707501 | 304 |
| 411 | iso_pu_bacteria | 641736151 | 642423942 | 304 |
| 412 | iso_pu_bacteria | 642555112 | 642596204 | 304 |
| 413 | iso_pu_bacteria | 642555113 | 642615381 | 304 |
| 414 | iso_pu_bacteria | 8003955200 | 8003960423 | 304 |
| 415 | iso_pu_bacteria | 8055266321 | 8055272095 | 304 |
| 416 | iso_pu_bacteria | 8055301274 | 8055304879 | 304 |
| 417 | 3300005330 | Ga0070690_100000275 | Ga0070690_10000027533 | 305 |
| 418 | 3300005336 | Ga0070680_100514102 | Ga0070680_1005141021 | 305 |
| 419 | 3300005337 | Ga0070682_100061331 | Ga0070682_1000613311 | 305 |
| 420 | 3300005340 | Ga0070689_100000376 | Ga0070689_1000003765 | 305 |
| 421 | 3300005365 | Ga0070688_100007098 | Ga0070688_1000070986 | 305 |
| 422 | 3300005438 | Ga0070701_10000088 | Ga0070701_1000008810 | 305 |
| 423 | 3300005441 | Ga0070700_100000542 | Ga0070700_10000054220 | 305 |
| 424 | 3300005444 | Ga0070694_100045181 | Ga0070694_1000451812 | 305 |
| 425 | 3300005466 | Ga0070685_10000777 | Ga0070685_1000077717 | 305 |
| 426 | 3300005544 | Ga0070686_100000294 | Ga0070686_10000029431 | 305 |
| 427 | 3300009177 | Ga0105248_10057346 | Ga0105248_100573465 | 305 |
| 428 | 3300013297 | Ga0157378_10104470 | Ga0157378_101044702 | 305 |
| 429 | 3300013306 | Ga0163162_10024825 | Ga0163162_100248258 | 305 |
| 430 | 3300014326 | Ga0157380_10021946 | Ga0157380_100219465 | 305 |
| 431 | 3300014969 | Ga0157376_10011117 | Ga0157376_100111174 | 305 |
| 432 | 3300017792 | Ga0163161_10006140 | Ga0163161_100061409 | 305 |
| 433 | 3300025912 | Ga0207707_10178503 | Ga0207707_101785033 | 305 |
| 434 | 3300025917 | Ga0207660_10404331 | Ga0207660_104043311 | 305 |
| 435 | 3300032004 | Ga0307414_10019331 | Ga0307414_100193314 | 305 |
| 436 | 3300046516 | Ga0495628_0128017 | Ga0495628_0128017_606_1559 | 305 |
| 437 | 3300046558 | Ga0495633_0000353 | Ga0495633_0000353_8231_9217 | 305 |
| 438 | 3300046694 | Ga0495649_0021983 | Ga0495649_0021983_360_1277 | 305 |
| 439 | 3300047323 | Ga0495683_0004510 | Ga0495683_0004510_5450_6367 | 305 |
| 440 | 3300047472 | Ga0495686_0000143 | Ga0495686_0000143_3492_4445 | 305 |
| 441 | 3300049568 | Ga0501031_0069401 | Ga0501031_0069401_1249_2259 | 305 |
| 442 | 3300049569 | Ga0501032_0012186 | Ga0501032_0012186_377_1387 | 305 |
| 443 | 3300049575 | Ga0501039_0155001 | Ga0501039_0155001_37_1047 | 305 |
| 444 | 3300049577 | Ga0501041_0010572 | Ga0501041_0010572_4084_5073 | 305 |
| 445 | 3300006042 | Ga0075368_10015920 | Ga0075368_100159205 | 306 |
| 446 | 3300006178 | Ga0075367_10017516 | Ga0075367_100175163 | 306 |
| 447 | 3300050494 | nmdc:mga06z11_3711_c1 | nmdc:mga06z11_3711_c1_1560_2576 | 306 |
| 448 | 3300002067 | JGI24735J21928_10001124 | JGI24735J21928_100011244 | 307 |
| 449 | 3300009036 | Ga0105244_10021819 | Ga0105244_100218196 | 307 |
| 450 | 3300009093 | Ga0105240_10088845 | Ga0105240_100888456 | 307 |
| 451 | 3300009101 | Ga0105247_10062765 | Ga0105247_100627654 | 307 |
| 452 | 3300013105 | Ga0157369_10103875 | Ga0157369_101038754 | 307 |
| 453 | 3300013105 | Ga0157369_10365969 | Ga0157369_103659692 | 307 |
| 454 | 3300025206 | Ga0209435_104465 | Ga0209435_1044652 | 307 |
| 455 | 3300025302 | Ga0207426_1001753 | Ga0207426_100175313 | 307 |
| 456 | 3300025735 | Ga0207713_1003582 | Ga0207713_10035827 | 307 |
| 457 | 3300025904 | Ga0207647_10048340 | Ga0207647_100483403 | 307 |
| 458 | 3300025909 | Ga0207705_10138342 | Ga0207705_101383422 | 307 |
| 459 | 3300027312 | Ga0209371_1005060 | Ga0209371_10050603 | 307 |
| 460 | 3300030500 | Ga0268256_1006624 | Ga0268256_10066244 | 307 |
| 461 | 3300037471 | Ga0395905_0019654 | Ga0395905_0019654_162_1154 | 307 |
| 462 | 3300044693 | Ga0466961_0041622 | Ga0466961_0041622_659_1774 | 307 |
| 463 | 3300044765 | Ga0466970_0029996 | Ga0466970_0029996_51_1112 | 307 |
| 464 | 3300046454 | Ga0495592_0090329 | Ga0495592_0090329_796_1785 | 307 |
| 465 | 3300046455 | Ga0495603_0001030 | Ga0495603_0001030_10149_11138 | 307 |
| 466 | 3300046457 | Ga0495590_0006595 | Ga0495590_0006595_1993_2994 | 307 |
| 467 | 3300046458 | Ga0495591_015253 | Ga0495591_015253_530_1519 | 307 |
| 468 | 3300046459 | Ga0495629_0000045 | Ga0495629_0000045_72469_73458 | 307 |
| 469 | 3300046459 | Ga0495629_0000704 | Ga0495629_0000704_17420_18343 | 307 |
| 470 | 3300046459 | Ga0495629_0035997 | Ga0495629_0035997_2112_3113 | 307 |
| 471 | 3300046462 | Ga0495651_0083711 | Ga0495651_0083711_1045_2034 | 307 |
| 472 | 3300046463 | Ga0495653_0001472 | Ga0495653_0001472_15593_16516 | 307 |
| 473 | 3300046463 | Ga0495653_0016500 | Ga0495653_0016500_4900_5901 | 307 |
| 474 | 3300046471 | Ga0495650_0000549 | Ga0495650_0000549_3095_4084 | 307 |
| 475 | 3300046471 | Ga0495650_0003550 | Ga0495650_0003550_9074_10003 | 307 |
| 476 | 3300046471 | Ga0495650_0015568 | Ga0495650_0015568_2623_3546 | 307 |
| 477 | 3300046472 | Ga0495580_0010284 | Ga0495580_0010284_5145_6080 | 307 |
| 478 | 3300046472 | Ga0495580_0017278 | Ga0495580_0017278_1245_2168 | 307 |
| 479 | 3300046475 | Ga0495639_0039876 | Ga0495639_0039876_426_1415 | 307 |
| 480 | 3300046476 | Ga0495662_0022356 | Ga0495662_0022356_623_1612 | 307 |
| 481 | 3300046477 | Ga0495664_0112956 | Ga0495664_0112956_398_1363 | 307 |
| 482 | 3300046507 | Ga0495606_0011856 | Ga0495606_0011856_4519_5484 | 307 |
| 483 | 3300046516 | Ga0495628_0021289 | Ga0495628_0021289_366_1289 | 307 |
| 484 | 3300046516 | Ga0495628_0032206 | Ga0495628_0032206_2538_3539 | 307 |
| 485 | 3300046516 | Ga0495628_0109822 | Ga0495628_0109822_88_1053 | 307 |
| 486 | 3300046528 | Ga0495642_0072561 | Ga0495642_0072561_357_1358 | 307 |
| 487 | 3300046529 | Ga0495652_0027681 | Ga0495652_0027681_3957_4958 | 307 |
| 488 | 3300046531 | Ga0495665_0000978 | Ga0495665_0000978_9847_10848 | 307 |
| 489 | 3300046542 | Ga0495597_0008640 | Ga0495597_0008640_1371_2372 | 307 |
| 490 | 3300046543 | Ga0495645_0000728 | Ga0495645_0000728_17172_18161 | 307 |
| 491 | 3300046543 | Ga0495645_0002412 | Ga0495645_0002412_1554_2519 | 307 |
| 492 | 3300046663 | Ga0495635_0164820 | Ga0495635_0164820_455_1444 | 307 |
| 493 | 3300046678 | Ga0495599_0036027 | Ga0495599_0036027_1918_2883 | 307 |
| 494 | 3300046679 | Ga0495623_0004544 | Ga0495623_0004544_3328_4329 | 307 |
| 495 | 3300046680 | Ga0495646_0006087 | Ga0495646_0006087_3794_4795 | 307 |
| 496 | 3300046680 | Ga0495646_0016386 | Ga0495646_0016386_3627_4550 | 307 |
| 497 | 3300046684 | Ga0495669_0013602 | Ga0495669_0013602_1094_2059 | 307 |
| 498 | 3300046690 | Ga0495624_0002771 | Ga0495624_0002771_3494_4417 | 307 |
| 499 | 3300046690 | Ga0495624_0010869 | Ga0495624_0010869_3931_4932 | 307 |
| 500 | 3300046694 | Ga0495649_0006454 | Ga0495649_0006454_2501_3466 | 307 |
| 501 | 3300046794 | Ga0495589_0011191 | Ga0495589_0011191_687_1676 | 307 |
| 502 | 3300046794 | Ga0495589_0042293 | Ga0495589_0042293_48_1013 | 307 |
| 503 | 3300047315 | Ga0495581_0005780 | Ga0495581_0005780_5283_6272 | 307 |
| 504 | 3300047317 | Ga0495604_0002466 | Ga0495604_0002466_12624_13625 | 307 |
| 505 | 3300047319 | Ga0495674_0032791 | Ga0495674_0032791_3654_4655 | 307 |
| 506 | 3300047319 | Ga0495674_0118513 | Ga0495674_0118513_1062_2027 | 307 |
| 507 | 3300047320 | Ga0495672_0083369 | Ga0495672_0083369_349_1350 | 307 |
| 508 | 3300047322 | Ga0495680_0003480 | Ga0495680_0003480_10805_11806 | 307 |
| 509 | 3300047323 | Ga0495683_0010772 | Ga0495683_0010772_1055_2056 | 307 |
| 510 | 3300047323 | Ga0495683_0115056 | Ga0495683_0115056_250_1215 | 307 |
| 511 | 3300047472 | Ga0495686_0214417 | Ga0495686_0214417_77_1000 | 307 |
| 512 | 3300047673 | Ga0495593_0001204 | Ga0495593_0001204_9085_10086 | 307 |
| 513 | 3300047673 | Ga0495593_0002984 | Ga0495593_0002984_7433_8356 | 307 |
| 514 | 3300048088 | Ga0495602_0000199 | Ga0495602_0000199_26428_27429 | 307 |
| 515 | 3300048088 | Ga0495602_0076516 | Ga0495602_0076516_1807_2808 | 307 |
| 516 | 3300048089 | Ga0495614_0015459 | Ga0495614_0015459_1809_2798 | 307 |
| 517 | 3300048903 | Ga0496100_0006374 | Ga0496100_0006374_2952_3953 | 307 |
| 518 | 3300048904 | Ga0496101_0031118 | Ga0496101_0031118_1934_2923 | 307 |
| 519 | 3300048905 | Ga0496102_0045231 | Ga0496102_0045231_1948_2949 | 307 |
| 520 | 3300048905 | Ga0496102_0115125 | Ga0496102_0115125_953_1954 | 307 |
| 521 | 3300048906 | Ga0496103_0004052 | Ga0496103_0004052_5958_6959 | 307 |
| 522 | 3300048907 | Ga0496104_0095561 | Ga0496104_0095561_942_1943 | 307 |
| 523 | 3300048908 | Ga0496105_0024408 | Ga0496105_0024408_3092_4093 | 307 |
| 524 | 3300048908 | Ga0496105_0072622 | Ga0496105_0072622_496_1497 | 307 |
| 525 | 3300048910 | Ga0496107_0002965 | Ga0496107_0002965_6740_7741 | 307 |
| 526 | 3300048912 | Ga0496109_0052376 | Ga0496109_0052376_1379_2380 | 307 |
| 527 | 3300048913 | Ga0496110_0117344 | Ga0496110_0117344_704_1705 | 307 |
| 528 | 3300048914 | Ga0496111_0011970 | Ga0496111_0011970_1714_2715 | 307 |
| 529 | 3300048916 | Ga0496113_0109919 | Ga0496113_0109919_62_1063 | 307 |
| 530 | 3300048917 | Ga0496114_0005431 | Ga0496114_0005431_6449_7438 | 307 |
| 531 | 3300048918 | Ga0496115_0037391 | Ga0496115_0037391_205_1206 | 307 |
| 532 | 3300048918 | Ga0496115_0193580 | Ga0496115_0193580_674_1663 | 307 |
| 533 | 3300048919 | Ga0496116_0064789 | Ga0496116_0064789_642_1643 | 307 |
| 534 | 3300048920 | Ga0496117_0025441 | Ga0496117_0025441_3557_4558 | 307 |
| 535 | 3300048924 | Ga0496121_0010944 | Ga0496121_0010944_2706_3707 | 307 |
| 536 | 3300048925 | Ga0496122_0012369 | Ga0496122_0012369_2504_3505 | 307 |
| 537 | 3300048927 | Ga0496124_0029873 | Ga0496124_0029873_2147_3148 | 307 |
| 538 | 3300048928 | Ga0496125_0006279 | Ga0496125_0006279_10993_11994 | 307 |
| 539 | 3300048929 | Ga0496126_0231437 | Ga0496126_0231437_52_1053 | 307 |
| 540 | 3300001979 | JGI24740J21852_10010996 | JGI24740J21852_100109964 | 308 |
| 541 | 3300001989 | JGI24739J22299_10001081 | JGI24739J22299_100010814 | 308 |
| 542 | 3300002067 | JGI24735J21928_10001745 | JGI24735J21928_100017455 | 308 |
| 543 | 3300002067 | JGI24735J21928_10006683 | JGI24735J21928_100066835 | 308 |
| 544 | 3300002067 | JGI24735J21928_10030652 | JGI24735J21928_100306521 | 308 |
| 545 | 3300002075 | JGI24738J21930_10001012 | JGI24738J21930_100010125 | 308 |
| 546 | 3300002705 | JGI25156J39149_1000135 | JGI25156J39149_10001352 | 308 |
| 547 | 3300002705 | JGI25156J39149_1000388 | JGI25156J39149_100038813 | 308 |
| 548 | 3300002705 | JGI25156J39149_1000971 | JGI25156J39149_10009719 | 308 |
| 549 | 3300003214 | JGI25165J46597_1002248 | JGI25165J46597_10022487 | 308 |
| 550 | 3300003756 | Ga0055533_1000094 | Ga0055533_100009435 | 308 |
| 551 | 3300003758 | Ga0055532_1000003 | Ga0055532_1000003205 | 308 |
| 552 | 3300003760 | Ga0055527_1000006 | Ga0055527_1000006250 | 308 |
| 553 | 3300003761 | Ga0055535_1000003 | Ga0055535_1000003205 | 308 |
| 554 | 3300003762 | Ga0055542_1000007 | Ga0055542_1000007205 | 308 |
| 555 | 3300003763 | Ga0055529_1000003 | Ga0055529_1000003250 | 308 |
| 556 | 3300005262 | Ga0065165_1002241 | Ga0065165_100224115 | 308 |
| 557 | 3300005327 | Ga0070658_10213133 | Ga0070658_102131332 | 308 |
| 558 | 3300005339 | Ga0070660_100002227 | Ga0070660_10000222710 | 308 |
| 559 | 3300005339 | Ga0070660_100025183 | Ga0070660_1000251832 | 308 |
| 560 | 3300005366 | Ga0070659_100034980 | Ga0070659_1000349804 | 308 |
| 561 | 3300005563 | Ga0068855_100029854 | Ga0068855_1000298542 | 308 |
| 562 | 3300005563 | Ga0068855_100234974 | Ga0068855_1002349742 | 308 |
| 563 | 3300009011 | Ga0105251_10001186 | Ga0105251_1000118618 | 308 |
| 564 | 3300009093 | Ga0105240_10103540 | Ga0105240_101035403 | 308 |
| 565 | 3300009093 | Ga0105240_10239861 | Ga0105240_102398613 | 308 |
| 566 | 3300009177 | Ga0105248_10279160 | Ga0105248_102791602 | 308 |
| 567 | 3300009545 | Ga0105237_10013944 | Ga0105237_100139448 | 308 |
| 568 | 3300009551 | Ga0105238_10030204 | Ga0105238_100302042 | 308 |
| 569 | 3300009551 | Ga0105238_10218198 | Ga0105238_102181982 | 308 |
| 570 | 3300010375 | Ga0105239_10005842 | Ga0105239_100058426 | 308 |
| 571 | 3300013104 | Ga0157370_10000632 | Ga0157370_1000063225 | 308 |
| 572 | 3300013104 | Ga0157370_10000999 | Ga0157370_1000099923 | 308 |
| 573 | 3300013105 | Ga0157369_10001964 | Ga0157369_1000196411 | 308 |
| 574 | 3300013105 | Ga0157369_10004136 | Ga0157369_1000413613 | 308 |
| 575 | 3300013105 | Ga0157369_10013941 | Ga0157369_100139416 | 308 |
| 576 | 3300013105 | Ga0157369_10255189 | Ga0157369_102551892 | 308 |
| 577 | 3300013296 | Ga0157374_10000050 | Ga0157374_1000005080 | 308 |
| 578 | 3300013307 | Ga0157372_10000364 | Ga0157372_1000036442 | 308 |
| 579 | 3300014497 | Ga0182008_10043489 | Ga0182008_100434892 | 308 |
| 580 | 3300014497 | Ga0182008_10070716 | Ga0182008_100707162 | 308 |
| 581 | 3300014969 | Ga0157376_10070466 | Ga0157376_100704663 | 308 |
| 582 | 3300015262 | Ga0182007_10000198 | Ga0182007_1000019826 | 308 |
| 583 | 3300016635 | Ga0183361_10002 | Ga0183361_10002482 | 308 |
| 584 | 3300020069 | Ga0197907_10060606 | Ga0197907_100606062 | 308 |
| 585 | 3300020070 | Ga0206356_10471300 | Ga0206356_104713002 | 308 |
| 586 | 3300020082 | Ga0206353_11405814 | Ga0206353_114058143 | 308 |
| 587 | 3300022467 | Ga0224712_10000024 | Ga0224712_100000242 | 308 |
| 588 | 3300025226 | Ga0209674_100025 | Ga0209674_100025199 | 308 |
| 589 | 3300025226 | Ga0209674_100144 | Ga0209674_10014480 | 308 |
| 590 | 3300025228 | Ga0209672_100002 | Ga0209672_1000021102 | 308 |
| 591 | 3300025229 | Ga0209147_100003 | Ga0209147_1000031102 | 308 |
| 592 | 3300025230 | Ga0209563_101098 | Ga0209563_1010984 | 308 |
| 593 | 3300025231 | Ga0207427_100538 | Ga0207427_1005383 | 308 |
| 594 | 3300025242 | Ga0209258_100005 | Ga0209258_100005744 | 308 |
| 595 | 3300025254 | Ga0209148_1000006 | Ga0209148_10000061102 | 308 |
| 596 | 3300025256 | Ga0209759_1000008 | Ga0209759_100000827 | 308 |
| 597 | 3300025256 | Ga0209759_1000014 | Ga0209759_1000014253 | 308 |
| 598 | 3300025256 | Ga0209759_1000094 | Ga0209759_100009417 | 308 |
| 599 | 3300025256 | Ga0209759_1008521 | Ga0209759_10085214 | 308 |
| 600 | 3300025256 | Ga0209759_1013849 | Ga0209759_10138492 | 308 |
| 601 | 3300025261 | Ga0209233_1000018 | Ga0209233_1000018251 | 308 |
| 602 | 3300025272 | Ga0209455_1000003 | Ga0209455_10000031102 | 308 |
| 603 | 3300025302 | Ga0207426_1000180 | Ga0207426_10001805 | 308 |
| 604 | 3300025735 | Ga0207713_1000590 | Ga0207713_100059028 | 308 |
| 605 | 3300025904 | Ga0207647_10000145 | Ga0207647_1000014519 | 308 |
| 606 | 3300025904 | Ga0207647_10013282 | Ga0207647_100132822 | 308 |
| 607 | 3300025904 | Ga0207647_10138665 | Ga0207647_101386652 | 308 |
| 608 | 3300025909 | Ga0207705_10001623 | Ga0207705_1000162310 | 308 |
| 609 | 3300025913 | Ga0207695_10020889 | Ga0207695_100208896 | 308 |
| 610 | 3300025913 | Ga0207695_10120922 | Ga0207695_101209223 | 308 |
| 611 | 3300025914 | Ga0207671_10036256 | Ga0207671_100362563 | 308 |
| 612 | 3300025914 | Ga0207671_10113107 | Ga0207671_101131072 | 308 |
| 613 | 3300025919 | Ga0207657_10006101 | Ga0207657_100061018 | 308 |
| 614 | 3300025924 | Ga0207694_10209671 | Ga0207694_102096712 | 308 |
| 615 | 3300025932 | Ga0207690_10006058 | Ga0207690_100060588 | 308 |
| 616 | 3300025941 | Ga0207711_10034469 | Ga0207711_100344692 | 308 |
| 617 | 3300025949 | Ga0207667_10008527 | Ga0207667_1000852711 | 308 |
| 618 | 3300025986 | Ga0207658_10090765 | Ga0207658_100907652 | 308 |
| 619 | 3300028800 | Ga0265338_10000159 | Ga0265338_1000015953 | 308 |
| 620 | 3300031911 | Ga0307412_10000039 | Ga0307412_1000003918 | 308 |
| 621 | 3300037312 | Ga0395899_0110795 | Ga0395899_0110795_993_1937 | 308 |
| 622 | 3300037418 | Ga0395900_0000015 | Ga0395900_0000015_118588_119532 | 308 |
| 623 | 3300037418 | Ga0395900_0036316 | Ga0395900_0036316_1820_2764 | 308 |
| 624 | 3300037418 | Ga0395900_0068435 | Ga0395900_0068435_2154_3098 | 308 |
| 625 | 3300037466 | Ga0395898_0000201 | Ga0395898_0000201_5663_6607 | 308 |
| 626 | 3300037466 | Ga0395898_0049751 | Ga0395898_0049751_60_1004 | 308 |
| 627 | 3300037471 | Ga0395905_0000052 | Ga0395905_0000052_107511_108443 | 308 |
| 628 | 3300037471 | Ga0395905_0119849 | Ga0395905_0119849_1397_2329 | 308 |
| 629 | 3300038443 | Ga0395901_0000009 | Ga0395901_0000009_25107_26054 | 308 |
| 630 | 3300038443 | Ga0395901_0000150 | Ga0395901_0000150_41808_42752 | 308 |
| 631 | 3300038443 | Ga0395901_0000556 | Ga0395901_0000556_33160_34104 | 308 |
| 632 | 3300038443 | Ga0395901_0144508 | Ga0395901_0144508_98_1042 | 308 |
| 633 | 3300038443 | Ga0395901_0144610 | Ga0395901_0144610_1458_2402 | 308 |
| 634 | 3300039447 | Ga0436361_0678907 | Ga0436361_0678907_100_1050 | 308 |
| 635 | 3300039447 | Ga0436361_0746079 | Ga0436361_0746079_2174_3100 | 308 |
| 636 | 3300042005 | Ga0439448_0001039 | Ga0439448_0001039_1020_1964 | 308 |
| 637 | 3300044656 | Ga0466969_0001231 | Ga0466969_0001231_3068_4012 | 308 |
| 638 | 3300044658 | Ga0466972_0064390 | Ga0466972_0064390_267_1211 | 308 |
| 639 | 3300044683 | Ga0466965_0002305 | Ga0466965_0002305_1412_2356 | 308 |
| 640 | 3300044684 | Ga0466966_0002365 | Ga0466966_0002365_1880_2824 | 308 |
| 641 | 3300044684 | Ga0466966_0033234 | Ga0466966_0033234_2178_3122 | 308 |
| 642 | 3300044693 | Ga0466961_0062638 | Ga0466961_0062638_999_1943 | 308 |
| 643 | 3300044694 | Ga0466963_0001623 | Ga0466963_0001623_9505_10449 | 308 |
| 644 | 3300044694 | Ga0466963_0005529 | Ga0466963_0005529_4174_5118 | 308 |
| 645 | 3300044719 | Ga0466971_0001253 | Ga0466971_0001253_468_1412 | 308 |
| 646 | 3300044765 | Ga0466970_0036574 | Ga0466970_0036574_730_1674 | 308 |
| 647 | 3300044842 | Ga0466957_0051012 | Ga0466957_0051012_909_1853 | 308 |
| 648 | 3300044842 | Ga0466957_0056093 | Ga0466957_0056093_421_1365 | 308 |
| 649 | 3300044842 | Ga0466957_0080413 | Ga0466957_0080413_861_1790 | 308 |
| 650 | 3300044901 | Ga0466960_0102983 | Ga0466960_0102983_379_1338 | 308 |
| 651 | 3300045049 | Ga0466959_0004706 | Ga0466959_0004706_7917_8873 | 308 |
| 652 | 3300045049 | Ga0466959_0075518 | Ga0466959_0075518_1140_2084 | 308 |
| 653 | 3300045836 | Ga0466958_0040295 | Ga0466958_0040295_547_1491 | 308 |
| 654 | 3300045836 | Ga0466958_0047467 | Ga0466958_0047467_570_1514 | 308 |
| 655 | 3300045836 | Ga0466958_0075325 | Ga0466958_0075325_208_1152 | 308 |
| 656 | 3300045976 | Ga0466967_0218047 | Ga0466967_0218047_241_1185 | 308 |
| 657 | 3300046454 | Ga0495592_0007730 | Ga0495592_0007730_4194_5120 | 308 |
| 658 | 3300046454 | Ga0495592_0055966 | Ga0495592_0055966_615_1541 | 308 |
| 659 | 3300046454 | Ga0495592_0090907 | Ga0495592_0090907_1085_2011 | 308 |
| 660 | 3300046455 | Ga0495603_0001565 | Ga0495603_0001565_2839_3771 | 308 |
| 661 | 3300046455 | Ga0495603_0002175 | Ga0495603_0002175_9583_10509 | 308 |
| 662 | 3300046457 | Ga0495590_0007224 | Ga0495590_0007224_2278_3204 | 308 |
| 663 | 3300046457 | Ga0495590_0010145 | Ga0495590_0010145_1617_2543 | 308 |
| 664 | 3300046459 | Ga0495629_0008639 | Ga0495629_0008639_6137_7063 | 308 |
| 665 | 3300046459 | Ga0495629_0014480 | Ga0495629_0014480_4666_5592 | 308 |
| 666 | 3300046459 | Ga0495629_0049934 | Ga0495629_0049934_980_1906 | 308 |
| 667 | 3300046460 | Ga0495638_0009449 | Ga0495638_0009449_3276_4202 | 308 |
| 668 | 3300046461 | Ga0495641_0026997 | Ga0495641_0026997_587_1513 | 308 |
| 669 | 3300046462 | Ga0495651_0004391 | Ga0495651_0004391_4213_5286 | 308 |
| 670 | 3300046462 | Ga0495651_0020669 | Ga0495651_0020669_2176_3102 | 308 |
| 671 | 3300046462 | Ga0495651_0173334 | Ga0495651_0173334_572_1498 | 308 |
| 672 | 3300046463 | Ga0495653_0002197 | Ga0495653_0002197_4179_5105 | 308 |
| 673 | 3300046463 | Ga0495653_0014385 | Ga0495653_0014385_1440_2366 | 308 |
| 674 | 3300046463 | Ga0495653_0041108 | Ga0495653_0041108_1032_2105 | 308 |
| 675 | 3300046463 | Ga0495653_0118495 | Ga0495653_0118495_896_1822 | 308 |
| 676 | 3300046471 | Ga0495650_0007850 | Ga0495650_0007850_4160_5086 | 308 |
| 677 | 3300046472 | Ga0495580_0000008 | Ga0495580_0000008_8495_9421 | 308 |
| 678 | 3300046472 | Ga0495580_0001335 | Ga0495580_0001335_14006_14932 | 308 |
| 679 | 3300046472 | Ga0495580_0035670 | Ga0495580_0035670_479_1405 | 308 |
| 680 | 3300046472 | Ga0495580_0042778 | Ga0495580_0042778_1523_2596 | 308 |
| 681 | 3300046473 | Ga0495582_0000202 | Ga0495582_0000202_9308_10234 | 308 |
| 682 | 3300046473 | Ga0495582_0008636 | Ga0495582_0008636_2161_3087 | 308 |
| 683 | 3300046474 | Ga0495605_0009179 | Ga0495605_0009179_907_1839 | 308 |
| 684 | 3300046474 | Ga0495605_0012959 | Ga0495605_0012959_64_990 | 308 |
| 685 | 3300046474 | Ga0495605_0092941 | Ga0495605_0092941_302_1375 | 308 |
| 686 | 3300046476 | Ga0495662_0006350 | Ga0495662_0006350_389_1315 | 308 |
| 687 | 3300046477 | Ga0495664_0000389 | Ga0495664_0000389_17321_18247 | 308 |
| 688 | 3300046477 | Ga0495664_0012294 | Ga0495664_0012294_2250_3176 | 308 |
| 689 | 3300046499 | Ga0495594_0091877 | Ga0495594_0091877_561_1487 | 308 |
| 690 | 3300046500 | Ga0495596_0002063 | Ga0495596_0002063_4225_5298 | 308 |
| 691 | 3300046500 | Ga0495596_0008968 | Ga0495596_0008968_2239_3165 | 308 |
| 692 | 3300046500 | Ga0495596_0025745 | Ga0495596_0025745_80_1006 | 308 |
| 693 | 3300046506 | Ga0495583_0004383 | Ga0495583_0004383_6501_7427 | 308 |
| 694 | 3300046507 | Ga0495606_0052857 | Ga0495606_0052857_1613_2539 | 308 |
| 695 | 3300046511 | Ga0495608_0007702 | Ga0495608_0007702_83_1009 | 308 |
| 696 | 3300046512 | Ga0495610_0009859 | Ga0495610_0009859_4760_5686 | 308 |
| 697 | 3300046513 | Ga0495616_0026028 | Ga0495616_0026028_1272_2204 | 308 |
| 698 | 3300046514 | Ga0495618_0002329 | Ga0495618_0002329_1616_2542 | 308 |
| 699 | 3300046514 | Ga0495618_0011733 | Ga0495618_0011733_2320_3393 | 308 |
| 700 | 3300046515 | Ga0495620_0013968 | Ga0495620_0013968_1831_2757 | 308 |
| 701 | 3300046516 | Ga0495628_0002415 | Ga0495628_0002415_7592_8518 | 308 |
| 702 | 3300046517 | Ga0495630_0001539 | Ga0495630_0001539_7876_8802 | 308 |
| 703 | 3300046517 | Ga0495630_0007406 | Ga0495630_0007406_3112_4038 | 308 |
| 704 | 3300046517 | Ga0495630_0013682 | Ga0495630_0013682_2900_3973 | 308 |
| 705 | 3300046517 | Ga0495630_0052055 | Ga0495630_0052055_391_1317 | 308 |
| 706 | 3300046524 | Ga0495648_0019102 | Ga0495648_0019102_3123_4049 | 308 |
| 707 | 3300046524 | Ga0495648_0152403 | Ga0495648_0152403_132_1064 | 308 |
| 708 | 3300046526 | Ga0495666_0000247 | Ga0495666_0000247_3239_4165 | 308 |
| 709 | 3300046526 | Ga0495666_0002749 | Ga0495666_0002749_3909_4982 | 308 |
| 710 | 3300046526 | Ga0495666_0042441 | Ga0495666_0042441_451_1377 | 308 |
| 711 | 3300046526 | Ga0495666_0076575 | Ga0495666_0076575_521_1447 | 308 |
| 712 | 3300046528 | Ga0495642_0004221 | Ga0495642_0004221_1857_2783 | 308 |
| 713 | 3300046528 | Ga0495642_0086749 | Ga0495642_0086749_69_995 | 308 |
| 714 | 3300046529 | Ga0495652_0025529 | Ga0495652_0025529_1153_2079 | 308 |
| 715 | 3300046529 | Ga0495652_0100968 | Ga0495652_0100968_41_967 | 308 |
| 716 | 3300046531 | Ga0495665_0005187 | Ga0495665_0005187_1559_2485 | 308 |
| 717 | 3300046531 | Ga0495665_0048037 | Ga0495665_0048037_1269_2195 | 308 |
| 718 | 3300046533 | Ga0495640_0013871 | Ga0495640_0013871_2368_3294 | 308 |
| 719 | 3300046533 | Ga0495640_0016625 | Ga0495640_0016625_4538_5464 | 308 |
| 720 | 3300046533 | Ga0495640_0033431 | Ga0495640_0033431_1074_2147 | 308 |
| 721 | 3300046535 | Ga0495586_0008140 | Ga0495586_0008140_4233_5159 | 308 |
| 722 | 3300046535 | Ga0495586_0150422 | Ga0495586_0150422_72_998 | 308 |
| 723 | 3300046536 | Ga0495587_0004211 | Ga0495587_0004211_8293_9219 | 308 |
| 724 | 3300046536 | Ga0495587_0022486 | Ga0495587_0022486_850_1923 | 308 |
| 725 | 3300046543 | Ga0495645_0000886 | Ga0495645_0000886_8693_9619 | 308 |
| 726 | 3300046543 | Ga0495645_0027927 | Ga0495645_0027927_1077_2150 | 308 |
| 727 | 3300046557 | Ga0495622_0000140 | Ga0495622_0000140_15084_16010 | 308 |
| 728 | 3300046559 | Ga0495667_0264496 | Ga0495667_0264496_37_963 | 308 |
| 729 | 3300046642 | Ga0495634_0004526 | Ga0495634_0004526_4235_5161 | 308 |
| 730 | 3300046642 | Ga0495634_0022640 | Ga0495634_0022640_1289_2215 | 308 |
| 731 | 3300046663 | Ga0495635_0002465 | Ga0495635_0002465_3909_4835 | 308 |
| 732 | 3300046663 | Ga0495635_0023014 | Ga0495635_0023014_2120_3046 | 308 |
| 733 | 3300046665 | Ga0495661_0003608 | Ga0495661_0003608_3238_4164 | 308 |
| 734 | 3300046665 | Ga0495661_0008447 | Ga0495661_0008447_1976_3049 | 308 |
| 735 | 3300046665 | Ga0495661_0050512 | Ga0495661_0050512_480_1406 | 308 |
| 736 | 3300046674 | Ga0495588_0020489 | Ga0495588_0020489_1473_2399 | 308 |
| 737 | 3300046675 | Ga0495657_0084847 | Ga0495657_0084847_100_1026 | 308 |
| 738 | 3300046678 | Ga0495599_0026652 | Ga0495599_0026652_1340_2413 | 308 |
| 739 | 3300046679 | Ga0495623_0006073 | Ga0495623_0006073_2613_3686 | 308 |
| 740 | 3300046679 | Ga0495623_0019998 | Ga0495623_0019998_832_1758 | 308 |
| 741 | 3300046680 | Ga0495646_0003240 | Ga0495646_0003240_6068_6994 | 308 |
| 742 | 3300046680 | Ga0495646_0015998 | Ga0495646_0015998_2207_3133 | 308 |
| 743 | 3300046680 | Ga0495646_0016650 | Ga0495646_0016650_2090_3163 | 308 |
| 744 | 3300046689 | Ga0495613_0007006 | Ga0495613_0007006_4233_5159 | 308 |
| 745 | 3300046689 | Ga0495613_0052317 | Ga0495613_0052317_849_1922 | 308 |
| 746 | 3300046690 | Ga0495624_0000346 | Ga0495624_0000346_12749_13675 | 308 |
| 747 | 3300046690 | Ga0495624_0043231 | Ga0495624_0043231_1524_2597 | 308 |
| 748 | 3300046690 | Ga0495624_0044109 | Ga0495624_0044109_707_1633 | 308 |
| 749 | 3300046692 | Ga0495671_0013009 | Ga0495671_0013009_2235_3161 | 308 |
| 750 | 3300046692 | Ga0495671_0014195 | Ga0495671_0014195_3271_4218 | 308 |
| 751 | 3300046694 | Ga0495649_0015713 | Ga0495649_0015713_1311_2243 | 308 |
| 752 | 3300046694 | Ga0495649_0027574 | Ga0495649_0027574_1699_2625 | 308 |
| 753 | 3300046794 | Ga0495589_0008041 | Ga0495589_0008041_1657_2583 | 308 |
| 754 | 3300046794 | Ga0495589_0083086 | Ga0495589_0083086_437_1363 | 308 |
| 755 | 3300046794 | Ga0495589_0127314 | Ga0495589_0127314_132_1058 | 308 |
| 756 | 3300046809 | Ga0495600_0007206 | Ga0495600_0007206_2649_3575 | 308 |
| 757 | 3300047315 | Ga0495581_0000497 | Ga0495581_0000497_301_1227 | 308 |
| 758 | 3300047315 | Ga0495581_0013341 | Ga0495581_0013341_1467_2393 | 308 |
| 759 | 3300047315 | Ga0495581_0041636 | Ga0495581_0041636_1526_2599 | 308 |
| 760 | 3300047317 | Ga0495604_0002218 | Ga0495604_0002218_5260_6186 | 308 |
| 761 | 3300047317 | Ga0495604_0010126 | Ga0495604_0010126_4150_5076 | 308 |
| 762 | 3300047317 | Ga0495604_0017290 | Ga0495604_0017290_3051_3977 | 308 |
| 763 | 3300047317 | Ga0495604_0049126 | Ga0495604_0049126_1727_2653 | 308 |
| 764 | 3300047317 | Ga0495604_0158176 | Ga0495604_0158176_429_1355 | 308 |
| 765 | 3300047319 | Ga0495674_0015099 | Ga0495674_0015099_3717_4643 | 308 |
| 766 | 3300047319 | Ga0495674_0045197 | Ga0495674_0045197_1032_2105 | 308 |
| 767 | 3300047319 | Ga0495674_0102222 | Ga0495674_0102222_697_1623 | 308 |
| 768 | 3300047320 | Ga0495672_0028953 | Ga0495672_0028953_352_1284 | 308 |
| 769 | 3300047320 | Ga0495672_0057945 | Ga0495672_0057945_147_1073 | 308 |
| 770 | 3300047321 | Ga0495676_0003897 | Ga0495676_0003897_8354_9280 | 308 |
| 771 | 3300047321 | Ga0495676_0028906 | Ga0495676_0028906_416_1342 | 308 |
| 772 | 3300047321 | Ga0495676_0080548 | Ga0495676_0080548_325_1251 | 308 |
| 773 | 3300047321 | Ga0495676_0124642 | Ga0495676_0124642_697_1623 | 308 |
| 774 | 3300047322 | Ga0495680_0003540 | Ga0495680_0003540_10278_11204 | 308 |
| 775 | 3300047322 | Ga0495680_0015815 | Ga0495680_0015815_4391_5464 | 308 |
| 776 | 3300047323 | Ga0495683_0005695 | Ga0495683_0005695_1657_2730 | 308 |
| 777 | 3300047323 | Ga0495683_0006341 | Ga0495683_0006341_3267_4193 | 308 |
| 778 | 3300047323 | Ga0495683_0026301 | Ga0495683_0026301_506_1432 | 308 |
| 779 | 3300047443 | Ga0495687_000029 | Ga0495687_000029_240404_241396 | 308 |
| 780 | 3300047443 | Ga0495687_008012 | Ga0495687_008012_2247_3173 | 308 |
| 781 | 3300047443 | Ga0495687_033147 | Ga0495687_033147_1155_2081 | 308 |
| 782 | 3300047443 | Ga0495687_041609 | Ga0495687_041609_192_1124 | 308 |
| 783 | 3300047444 | Ga0495675_0001013 | Ga0495675_0001013_11834_12907 | 308 |
| 784 | 3300047444 | Ga0495675_0004530 | Ga0495675_0004530_4011_4937 | 308 |
| 785 | 3300047444 | Ga0495675_0005353 | Ga0495675_0005353_1637_2563 | 308 |
| 786 | 3300047444 | Ga0495675_0007707 | Ga0495675_0007707_5340_6266 | 308 |
| 787 | 3300047446 | Ga0495679_000117 | Ga0495679_000117_52019_52945 | 308 |
| 788 | 3300047446 | Ga0495679_001343 | Ga0495679_001343_4194_5267 | 308 |
| 789 | 3300047446 | Ga0495679_004804 | Ga0495679_004804_3123_4049 | 308 |
| 790 | 3300047469 | Ga0495673_0006174 | Ga0495673_0006174_1680_2753 | 308 |
| 791 | 3300047469 | Ga0495673_0013634 | Ga0495673_0013634_930_1862 | 308 |
| 792 | 3300047469 | Ga0495673_0015893 | Ga0495673_0015893_1359_2285 | 308 |
| 793 | 3300047470 | Ga0495681_0034390 | Ga0495681_0034390_425_1351 | 308 |
| 794 | 3300047472 | Ga0495686_0056666 | Ga0495686_0056666_712_1650 | 308 |
| 795 | 3300047673 | Ga0495593_0003439 | Ga0495593_0003439_2899_3972 | 308 |
| 796 | 3300047673 | Ga0495593_0005141 | Ga0495593_0005141_4569_5495 | 308 |
| 797 | 3300047673 | Ga0495593_0033182 | Ga0495593_0033182_801_1727 | 308 |
| 798 | 3300048088 | Ga0495602_0002585 | Ga0495602_0002585_10001_10927 | 308 |
| 799 | 3300048088 | Ga0495602_0006600 | Ga0495602_0006600_4078_5004 | 308 |
| 800 | 3300048088 | Ga0495602_0022235 | Ga0495602_0022235_4109_5182 | 308 |
| 801 | 3300048088 | Ga0495602_0062536 | Ga0495602_0062536_1705_2631 | 308 |
| 802 | 3300048088 | Ga0495602_0190589 | Ga0495602_0190589_198_1124 | 308 |
| 803 | 3300048089 | Ga0495614_0002425 | Ga0495614_0002425_4233_5159 | 308 |
| 804 | 3300048089 | Ga0495614_0003403 | Ga0495614_0003403_1976_3049 | 308 |
| 805 | 3300048089 | Ga0495614_0010970 | Ga0495614_0010970_2103_3029 | 308 |
| 806 | 3300048091 | Ga0495626_0015983 | Ga0495626_0015983_2022_2948 | 308 |
| 807 | 3300048091 | Ga0495626_0024851 | Ga0495626_0024851_790_1716 | 308 |
| 808 | 3300048903 | Ga0496100_0034221 | Ga0496100_0034221_2114_3046 | 308 |
| 809 | 3300048904 | Ga0496101_0002632 | Ga0496101_0002632_261_1193 | 308 |
| 810 | 3300048904 | Ga0496101_0424503 | Ga0496101_0424503_64_1017 | 308 |
| 811 | 3300048905 | Ga0496102_0000955 | Ga0496102_0000955_24180_25112 | 308 |
| 812 | 3300048905 | Ga0496102_0149240 | Ga0496102_0149240_194_1168 | 308 |
| 813 | 3300048906 | Ga0496103_0000338 | Ga0496103_0000338_39347_40279 | 308 |
| 814 | 3300048906 | Ga0496103_0013968 | Ga0496103_0013968_1532_2485 | 308 |
| 815 | 3300048908 | Ga0496105_0026268 | Ga0496105_0026268_653_1585 | 308 |
| 816 | 3300048908 | Ga0496105_0049948 | Ga0496105_0049948_2285_3217 | 308 |
| 817 | 3300048909 | Ga0496106_0000001 | Ga0496106_0000001_60437_61543 | 308 |
| 818 | 3300048913 | Ga0496110_0187716 | Ga0496110_0187716_905_1837 | 308 |
| 819 | 3300048913 | Ga0496110_0209218 | Ga0496110_0209218_662_1630 | 308 |
| 820 | 3300048915 | Ga0496112_0039003 | Ga0496112_0039003_2513_3445 | 308 |
| 821 | 3300048917 | Ga0496114_0366820 | Ga0496114_0366820_87_1055 | 308 |
| 822 | 3300048919 | Ga0496116_0023479 | Ga0496116_0023479_1744_2676 | 308 |
| 823 | 3300048920 | Ga0496117_0002765 | Ga0496117_0002765_3522_4454 | 308 |
| 824 | 3300048920 | Ga0496117_0003919 | Ga0496117_0003919_4416_5369 | 308 |
| 825 | 3300048920 | Ga0496117_0007290 | Ga0496117_0007290_7765_8733 | 308 |
| 826 | 3300048920 | Ga0496117_0017379 | Ga0496117_0017379_4555_5481 | 308 |
| 827 | 3300048921 | Ga0496118_0000215 | Ga0496118_0000215_95465_96418 | 308 |
| 828 | 3300048921 | Ga0496118_0001206 | Ga0496118_0001206_11994_12962 | 308 |
| 829 | 3300048921 | Ga0496118_0006556 | Ga0496118_0006556_2120_3052 | 308 |
| 830 | 3300048921 | Ga0496118_0015186 | Ga0496118_0015186_3084_4010 | 308 |
| 831 | 3300048921 | Ga0496118_0035740 | Ga0496118_0035740_2141_3079 | 308 |
| 832 | 3300048921 | Ga0496118_0096852 | Ga0496118_0096852_167_1093 | 308 |
| 833 | 3300048921 | Ga0496118_0100916 | Ga0496118_0100916_302_1228 | 308 |
| 834 | 3300048922 | Ga0496119_0033957 | Ga0496119_0033957_2392_3324 | 308 |
| 835 | 3300048924 | Ga0496121_0001279 | Ga0496121_0001279_3481_4407 | 308 |
| 836 | 3300048924 | Ga0496121_0002026 | Ga0496121_0002026_261_1193 | 308 |
| 837 | 3300048924 | Ga0496121_0004114 | Ga0496121_0004114_11850_12956 | 308 |
| 838 | 3300048924 | Ga0496121_0015334 | Ga0496121_0015334_261_1193 | 308 |
| 839 | 3300048925 | Ga0496122_0052429 | Ga0496122_0052429_541_1473 | 308 |
| 840 | 3300048926 | Ga0496123_0057080 | Ga0496123_0057080_322_1254 | 308 |
| 841 | 3300048927 | Ga0496124_0177307 | Ga0496124_0177307_376_1317 | 308 |
| 842 | 3300048929 | Ga0496126_0000032 | Ga0496126_0000032_132608_133576 | 308 |
| 843 | 3300048929 | Ga0496126_0002361 | Ga0496126_0002361_14048_14974 | 308 |
| 844 | 3300048929 | Ga0496126_0002530 | Ga0496126_0002530_16485_17411 | 308 |
| 845 | 3300048929 | Ga0496126_0021102 | Ga0496126_0021102_2214_3152 | 308 |
| 846 | 3300049460 | Ga0495682_0008882 | Ga0495682_0008882_1860_2786 | 308 |
| 847 | 3300061719 | Ga0466962_0001441 | Ga0466962_0001441_677_1621 | 308 |
| 848 | 3300061719 | Ga0466962_0042067 | Ga0466962_0042067_421_1365 | 308 |
| 849 | iso_pu_bacteria | 2510065045 | 2510248660 | 308 |
| 850 | iso_pu_bacteria | 2718217991 | 2719642914 | 308 |
| 851 | iso_pu_bacteria | 2808606390 | 2809003651 | 308 |
| 852 | iso_pu_bacteria | 2808606391 | 2809010928 | 308 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3f1x-assembly1.cif.gz_A | three dimensional structure of the serine acetyltransferase from bacteroides vulgatus, northeast structural genomics consortium target bvr62. | 0.9303 | 11 | 294 |
| 6lcn-assembly1.cif.gz_B | crystal structure of serine acetyltransferase from planctomyces limnophilus at 2.15a | 0.9254 | 11 | 293 |
| 6lcn-assembly1.cif.gz_F | crystal structure of serine acetyltransferase from planctomyces limnophilus at 2.15a | 0.9236 | 11 | 293 |
| 6lcn-assembly1.cif.gz_E | crystal structure of serine acetyltransferase from planctomyces limnophilus at 2.15a | 0.9228 | 11 | 293 |
| 6lcn-assembly1.cif.gz_A | crystal structure of serine acetyltransferase from planctomyces limnophilus at 2.15a | 0.9092 | 11 | 293 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3f1xA02 | Mainly Beta;3 Solenoid;UDP N-Acetylglucosamine Acyltransferase; domain 1;Hexapeptide repeat proteins | 0.9935 | 190 | 294 | 2.160.10.10 |
| 3gvdA02 | Mainly Beta;3 Solenoid;UDP N-Acetylglucosamine Acyltransferase; domain 1;Hexapeptide repeat proteins | 0.9594 | 190 | 287 | 2.160.10.10 |
| 3f1xA01 | Mainly Alpha;Orthogonal Bundle;serine acetyltransferase, domain 1;serine acetyltransferase, domain 1 | 0.9586 | 37 | 189 | 1.10.3130.10 |
| af_K7MGT5_229_334_2.160.10.10 | Mainly Beta;3 Solenoid;UDP N-Acetylglucosamine Acyltransferase; domain 1;Hexapeptide repeat proteins | 0.9439 | 227 | 291 | 2.160.10.10 |
| 4n6bB02 | Mainly Beta;3 Solenoid;UDP N-Acetylglucosamine Acyltransferase; domain 1;Hexapeptide repeat proteins | 0.9437 | 190 | 291 | 2.160.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6I1WC39-F1-model_v4 | deleted | 0.999 | 201 | 289 |
|
| AF-A0A829E9B8-F1-model_v4 | deleted | 0.9938 | 211 | 294 |
|
| AF-A0A3A1WWC4-F1-model_v4 | Serine acetyltransferase | 0.9894 | 153 | 290 |
GO:0005737
GO:0006535 GO:0009001 |
| AF-K1UKK0-F1-model_v4 | Serine O-acetyltransferase | 0.9892 | 120 | 251 |
GO:0009001
|
| AF-A0A2S3V241-F1-model_v4 | serine O-acetyltransferase (EC 2.3.1.30) | 0.9886 | 126 | 291 |
GO:0005737
GO:0006535 GO:0009001 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar