F483492
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 852 | 326 | 1704 | 188 |
Family's Representative Sequence
| Representative Sequence | 3300005467|Ga0070706_100005766|Ga0070706_1000057668 |
| Length | 208 |
| Sequence | MYNTQSLNTQTLCEQEDLMTATDAGTLTGIPGYVAGTWSIDPVHSEVGFAARHMVVAKVRGRFRTFSGQIVTGENPLDSSVTAEIDLSSIDTGNEQRDAHIRSADFFEVETYPTMTYRSTGVRQHRDGYVLDGKLTLKGVTRDVPLTLELNGFGPDPYGGTRAGFTATGEINRRDFGVNFAAVMETGGAVVSDKITIHLEIEAVLQQN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 2 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 3 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 4 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 6 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 7 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 10 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 30 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 32 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 33 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 35 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 36 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 37 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 38 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 39 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 40 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 41 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 42 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 43 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 45 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 49 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 50 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 51 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 52 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 53 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 54 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 55 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 56 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 64 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 78 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 79 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 80 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 81 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 82 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 83 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 84 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 85 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 86 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 87 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 88 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 89 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 90 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 91 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 121 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 123 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 124 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 125 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 126 | 3300030863 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 127 | 3300030880 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 128 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 129 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 130 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 131 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 132 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 133 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 134 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 135 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 136 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 137 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 138 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 139 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 140 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 141 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 142 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 143 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 144 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 145 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 146 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 147 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 148 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 149 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 150 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 151 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 152 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 153 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 154 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 155 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 156 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 157 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 158 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 159 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 160 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 161 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 162 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 163 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 164 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 165 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 166 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 167 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 168 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 169 | 3300036458 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 170 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 171 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 172 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 173 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 174 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 175 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 176 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 177 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 178 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 179 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 180 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 181 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 182 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 183 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 184 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 185 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 186 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 187 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 188 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 189 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 190 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 191 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 192 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 193 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 194 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 195 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 196 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 197 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 198 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 253 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 254 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 255 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 256 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 257 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 258 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 259 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 260 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 261 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 262 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 263 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 264 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 265 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 266 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 267 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 268 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 269 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 270 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 271 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 272 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 273 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 274 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 275 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 276 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 277 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 278 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 279 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 280 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 281 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 282 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 283 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 284 | 3300049538 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 285 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 286 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 287 | 3300049549 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 288 | 3300049550 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 289 | 3300049556 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 290 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 305 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 307 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 308 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 309 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 310 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 311 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 322 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 323 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 324 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 325 | 3300059658 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 326 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.25 |
| Metatranscriptomes | 7.75 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.12 |
| Nodule | 0 |
| Rhizoplane | 3.64 |
| Rhizosphere | 94.95 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.06 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070706_100005766 | 3300005467 | Bacteria | 11763 |
| 2 | JGI25407J50210_10002063 | 3300003373 | Bacteria | 4687 |
| 3 | JGI25407J50210_10006527 | 3300003373 | Bacteria | 2908 |
| 4 | JGI25407J50210_10021539 | 3300003373 | Bacteria | 1676 |
| 5 | Ga0070690_100316732 | 3300005330 | Bacteria | 1123 |
| 6 | Ga0070682_100847713 | 3300005337 | Bacteria | 746 |
| 7 | Ga0068868_100221493 | 3300005338 | Bacteria | 1584 |
| 8 | Ga0070691_10027052 | 3300005341 | Bacteria | 2675 |
| 9 | Ga0070669_100855584 | 3300005353 | Bacteria | 775 |
| 10 | Ga0070688_100197011 | 3300005365 | Bacteria | 1407 |
| 11 | Ga0070709_10000604 | 3300005434 | Bacteria | 20935 |
| 12 | Ga0070709_10004740 | 3300005434 | Bacteria | 7343 |
| 13 | Ga0070709_10012599 | 3300005434 | Bacteria | 4735 |
| 14 | Ga0070709_10091724 | 3300005434 | Bacteria | 2005 |
| 15 | Ga0070709_10307707 | 3300005434 | Bacteria | 1159 |
| 16 | Ga0070714_100001432 | 3300005435 | Bacteria | 17343 |
| 17 | Ga0070714_100010107 | 3300005435 | Bacteria | 7449 |
| 18 | Ga0070714_100048554 | 3300005435 | Bacteria | 3610 |
| 19 | Ga0070714_100058629 | 3300005435 | Bacteria | 3299 |
| 20 | Ga0070714_100075355 | 3300005435 | Bacteria | 2927 |
| 21 | Ga0070714_100087900 | 3300005435 | Bacteria | 2718 |
| 22 | Ga0070714_100089002 | 3300005435 | Bacteria | 2702 |
| 23 | Ga0070714_100090409 | 3300005435 | Bacteria | 2681 |
| 24 | Ga0070714_100094978 | 3300005435 | Bacteria | 2617 |
| 25 | Ga0070714_100140205 | 3300005435 | Bacteria | 2169 |
| 26 | Ga0070714_100446649 | 3300005435 | Bacteria | 1228 |
| 27 | Ga0070714_100579041 | 3300005435 | Bacteria | 1077 |
| 28 | Ga0070714_100583210 | 3300005435 | Bacteria | 1073 |
| 29 | Ga0070714_101121627 | 3300005435 | Bacteria | 767 |
| 30 | Ga0070713_100001304 | 3300005436 | Bacteria | 15955 |
| 31 | Ga0070713_100010956 | 3300005436 | Bacteria | 6575 |
| 32 | Ga0070713_100032833 | 3300005436 | Bacteria | 4151 |
| 33 | Ga0070713_100050629 | 3300005436 | Bacteria | 3432 |
| 34 | Ga0070713_100103271 | 3300005436 | Bacteria | 2473 |
| 35 | Ga0070713_100107186 | 3300005436 | Bacteria | 2430 |
| 36 | Ga0070713_100157734 | 3300005436 | Bacteria | 2024 |
| 37 | Ga0070713_100172590 | 3300005436 | Bacteria | 1938 |
| 38 | Ga0070713_100279352 | 3300005436 | Bacteria | 1531 |
| 39 | Ga0070713_101029183 | 3300005436 | Bacteria | 795 |
| 40 | Ga0070710_10001226 | 3300005437 | Bacteria | 12155 |
| 41 | Ga0070710_10016179 | 3300005437 | Bacteria | 3790 |
| 42 | Ga0070710_10018821 | 3300005437 | Bacteria | 3559 |
| 43 | Ga0070710_10024996 | 3300005437 | Bacteria | 3157 |
| 44 | Ga0070710_10110016 | 3300005437 | Bacteria | 1654 |
| 45 | Ga0070710_10153050 | 3300005437 | Bacteria | 1424 |
| 46 | Ga0070710_10334413 | 3300005437 | Bacteria | 998 |
| 47 | Ga0070711_100001594 | 3300005439 | Bacteria | 12501 |
| 48 | Ga0070711_100025723 | 3300005439 | Bacteria | 3853 |
| 49 | Ga0070711_100058730 | 3300005439 | Bacteria | 2668 |
| 50 | Ga0070711_100125133 | 3300005439 | Bacteria | 1907 |
| 51 | Ga0070711_100131796 | 3300005439 | Bacteria | 1862 |
| 52 | Ga0070711_100185912 | 3300005439 | Bacteria | 1593 |
| 53 | Ga0070711_100232292 | 3300005439 | Bacteria | 1438 |
| 54 | Ga0070711_100267426 | 3300005439 | Bacteria | 1348 |
| 55 | Ga0070705_100124497 | 3300005440 | Bacteria | 1670 |
| 56 | Ga0070705_100233155 | 3300005440 | Bacteria | 1282 |
| 57 | Ga0070694_100551079 | 3300005444 | Bacteria | 923 |
| 58 | Ga0070694_100614970 | 3300005444 | Bacteria | 876 |
| 59 | Ga0070708_100003157 | 3300005445 | Bacteria | 12842 |
| 60 | Ga0070708_100014838 | 3300005445 | Bacteria | 6421 |
| 61 | Ga0070708_100082938 | 3300005445 | Bacteria | 2905 |
| 62 | Ga0070708_100463815 | 3300005445 | Bacteria | 1195 |
| 63 | Ga0070662_100063964 | 3300005457 | Bacteria | 2692 |
| 64 | Ga0070681_11234499 | 3300005458 | Bacteria | 670 |
| 65 | Ga0070706_100004585 | 3300005467 | Bacteria | 13269 |
| 66 | Ga0070706_100005982 | 3300005467 | Bacteria | 11504 |
| 67 | Ga0070706_100020154 | 3300005467 | Bacteria | 6145 |
| 68 | Ga0070706_100038174 | 3300005467 | Bacteria | 4434 |
| 69 | Ga0070706_100038414 | 3300005467 | Bacteria | 4418 |
| 70 | Ga0070706_100040600 | 3300005467 | Bacteria | 4295 |
| 71 | Ga0070706_100074804 | 3300005467 | Bacteria | 3135 |
| 72 | Ga0070706_100098440 | 3300005467 | Bacteria | 2718 |
| 73 | Ga0070706_100119969 | 3300005467 | Bacteria | 2451 |
| 74 | Ga0070706_100172044 | 3300005467 | Bacteria | 2022 |
| 75 | Ga0070706_100307882 | 3300005467 | Bacteria | 1478 |
| 76 | Ga0070707_100003226 | 3300005468 | Bacteria | 15444 |
| 77 | Ga0070707_100010507 | 3300005468 | Bacteria | 8625 |
| 78 | Ga0070707_100024904 | 3300005468 | Bacteria | 5672 |
| 79 | Ga0070707_100026432 | 3300005468 | Bacteria | 5510 |
| 80 | Ga0070707_100039234 | 3300005468 | Bacteria | 4526 |
| 81 | Ga0070707_100077825 | 3300005468 | Bacteria | 3200 |
| 82 | Ga0070707_100085038 | 3300005468 | Bacteria | 3057 |
| 83 | Ga0070707_100102432 | 3300005468 | Bacteria | 2774 |
| 84 | Ga0070707_100112260 | 3300005468 | Bacteria | 2643 |
| 85 | Ga0070707_100343838 | 3300005468 | Bacteria | 1449 |
| 86 | Ga0070707_101126988 | 3300005468 | Bacteria | 750 |
| 87 | Ga0070698_100000028 | 3300005471 | Bacteria | 98040 |
| 88 | Ga0070698_100002154 | 3300005471 | Bacteria | 21853 |
| 89 | Ga0070698_100004320 | 3300005471 | Bacteria | 15623 |
| 90 | Ga0070698_100004476 | 3300005471 | Bacteria | 15361 |
| 91 | Ga0070698_100008436 | 3300005471 | Bacteria | 11137 |
| 92 | Ga0070698_100009159 | 3300005471 | Bacteria | 10626 |
| 93 | Ga0070698_100014786 | 3300005471 | Bacteria | 8249 |
| 94 | Ga0070698_100017593 | 3300005471 | Bacteria | 7533 |
| 95 | Ga0070698_100026422 | 3300005471 | Bacteria | 6043 |
| 96 | Ga0070699_100011832 | 3300005518 | Bacteria | 7530 |
| 97 | Ga0070699_100107379 | 3300005518 | Bacteria | 2449 |
| 98 | Ga0070699_100179726 | 3300005518 | Bacteria | 1877 |
| 99 | Ga0070679_100935873 | 3300005530 | Bacteria | 810 |
| 100 | Ga0070684_100082135 | 3300005535 | Bacteria | 2852 |
| 101 | Ga0070697_100047964 | 3300005536 | Bacteria | 3463 |
| 102 | Ga0070697_100076608 | 3300005536 | Bacteria | 2750 |
| 103 | Ga0070697_100230745 | 3300005536 | Bacteria | 1579 |
| 104 | Ga0070695_100207424 | 3300005545 | Bacteria | 1404 |
| 105 | Ga0070695_100242819 | 3300005545 | Bacteria | 1307 |
| 106 | Ga0070696_100083203 | 3300005546 | Bacteria | 2269 |
| 107 | Ga0070693_100039735 | 3300005547 | Bacteria | 2637 |
| 108 | Ga0070665_100499811 | 3300005548 | Bacteria | 1227 |
| 109 | Ga0070665_100655168 | 3300005548 | Bacteria | 1063 |
| 110 | Ga0068855_100400171 | 3300005563 | Bacteria | 1505 |
| 111 | Ga0070664_100408824 | 3300005564 | Bacteria | 1242 |
| 112 | Ga0068854_100291091 | 3300005578 | Bacteria | 1318 |
| 113 | Ga0068856_100027245 | 3300005614 | Bacteria | 5576 |
| 114 | Ga0068856_100034946 | 3300005614 | Bacteria | 4925 |
| 115 | Ga0068856_100166097 | 3300005614 | Bacteria | 2218 |
| 116 | Ga0068856_100330069 | 3300005614 | Bacteria | 1543 |
| 117 | Ga0068856_100489717 | 3300005614 | Bacteria | 1250 |
| 118 | Ga0070702_100378202 | 3300005615 | Bacteria | 1006 |
| 119 | Ga0068864_100332868 | 3300005618 | Bacteria | 1429 |
| 120 | Ga0068861_100026540 | 3300005719 | Bacteria | 4211 |
| 121 | Ga0068861_100222762 | 3300005719 | Bacteria | 1595 |
| 122 | Ga0068863_100138743 | 3300005841 | Bacteria | 2323 |
| 123 | Ga0068863_100358050 | 3300005841 | Bacteria | 1422 |
| 124 | Ga0068858_100059284 | 3300005842 | Bacteria | 3538 |
| 125 | Ga0068862_101004186 | 3300005844 | Bacteria | 825 |
| 126 | Ga0081455_10000070 | 3300005937 | Bacteria | 110926 |
| 127 | Ga0081455_10013067 | 3300005937 | Bacteria | 8229 |
| 128 | Ga0081538_10003880 | 3300005981 | Bacteria | 13961 |
| 129 | Ga0081538_10006034 | 3300005981 | Bacteria | 10768 |
| 130 | Ga0081538_10007721 | 3300005981 | Bacteria | 9266 |
| 131 | Ga0081538_10011876 | 3300005981 | Bacteria | 7031 |
| 132 | Ga0081538_10012928 | 3300005981 | Bacteria | 6652 |
| 133 | Ga0081538_10016498 | 3300005981 | Bacteria | 5658 |
| 134 | Ga0081538_10048751 | 3300005981 | Bacteria | 2579 |
| 135 | Ga0081538_10049744 | 3300005981 | Bacteria | 2540 |
| 136 | Ga0081538_10098699 | 3300005981 | Bacteria | 1479 |
| 137 | Ga0081540_1000808 | 3300005983 | Bacteria | 28767 |
| 138 | Ga0081540_1064384 | 3300005983 | Bacteria | 1730 |
| 139 | Ga0081539_10001909 | 3300005985 | Bacteria | 32287 |
| 140 | Ga0070717_10000705 | 3300006028 | Bacteria | 21631 |
| 141 | Ga0070717_10008702 | 3300006028 | Bacteria | 7593 |
| 142 | Ga0070717_10012172 | 3300006028 | Bacteria | 6559 |
| 143 | Ga0070717_10028616 | 3300006028 | Bacteria | 4462 |
| 144 | Ga0070717_10034956 | 3300006028 | Bacteria | 4065 |
| 145 | Ga0070717_10037356 | 3300006028 | Bacteria | 3943 |
| 146 | Ga0070717_10066008 | 3300006028 | Bacteria | 3009 |
| 147 | Ga0070717_10103512 | 3300006028 | Bacteria | 2420 |
| 148 | Ga0070717_10122246 | 3300006028 | Bacteria | 2231 |
| 149 | Ga0070717_10156429 | 3300006028 | Bacteria | 1975 |
| 150 | Ga0070717_10191190 | 3300006028 | Unclassified | 1789 |
| 151 | Ga0070717_10253420 | 3300006028 | Bacteria | 1555 |
| 152 | Ga0070717_10280562 | 3300006028 | Bacteria | 1477 |
| 153 | Ga0070717_10566968 | 3300006028 | Bacteria | 1029 |
| 154 | Ga0070717_10863054 | 3300006028 | Bacteria | 824 |
| 155 | Ga0075432_10123509 | 3300006058 | Bacteria | 974 |
| 156 | Ga0070715_10002144 | 3300006163 | Bacteria | 5977 |
| 157 | Ga0070715_10004360 | 3300006163 | Bacteria | 4632 |
| 158 | Ga0070715_10046495 | 3300006163 | Bacteria | 1845 |
| 159 | Ga0070715_10079548 | 3300006163 | Bacteria | 1484 |
| 160 | Ga0070715_10153615 | 3300006163 | Bacteria | 1130 |
| 161 | Ga0070715_10268087 | 3300006163 | Bacteria | 900 |
| 162 | Ga0070716_100000290 | 3300006173 | Bacteria | 20289 |
| 163 | Ga0070716_100000969 | 3300006173 | Bacteria | 12463 |
| 164 | Ga0070716_100004287 | 3300006173 | Bacteria | 6794 |
| 165 | Ga0070716_100037736 | 3300006173 | Bacteria | 2671 |
| 166 | Ga0070716_100063412 | 3300006173 | Bacteria | 2145 |
| 167 | Ga0070712_100003115 | 3300006175 | Bacteria | 10231 |
| 168 | Ga0070712_100003133 | 3300006175 | Bacteria | 10193 |
| 169 | Ga0070712_100315380 | 3300006175 | Bacteria | 1270 |
| 170 | Ga0070712_100345844 | 3300006175 | Bacteria | 1216 |
| 171 | Ga0070712_100392543 | 3300006175 | Bacteria | 1144 |
| 172 | Ga0070712_100628789 | 3300006175 | Bacteria | 911 |
| 173 | Ga0070712_100946264 | 3300006175 | Bacteria | 744 |
| 174 | Ga0075428_100035383 | 3300006844 | Bacteria | 5505 |
| 175 | Ga0075428_100245979 | 3300006844 | Bacteria | 1928 |
| 176 | Ga0075428_100900274 | 3300006844 | Bacteria | 938 |
| 177 | Ga0075428_101332387 | 3300006844 | Bacteria | 754 |
| 178 | Ga0075430_100017260 | 3300006846 | Bacteria | 6148 |
| 179 | Ga0075431_100484235 | 3300006847 | Bacteria | 1230 |
| 180 | Ga0075433_10009794 | 3300006852 | Bacteria | 7678 |
| 181 | Ga0075433_10082152 | 3300006852 | Bacteria | 2841 |
| 182 | Ga0075433_10235954 | 3300006852 | Bacteria | 1624 |
| 183 | Ga0075433_10284919 | 3300006852 | Bacteria | 1463 |
| 184 | Ga0075434_100005930 | 3300006871 | Bacteria | 11184 |
| 185 | Ga0075434_100052605 | 3300006871 | Bacteria | 4046 |
| 186 | Ga0075434_100084213 | 3300006871 | Bacteria | 3178 |
| 187 | Ga0075434_100118566 | 3300006871 | Bacteria | 2660 |
| 188 | Ga0075434_100320497 | 3300006871 | Bacteria | 1570 |
| 189 | Ga0075429_100138410 | 3300006880 | Bacteria | 2131 |
| 190 | Ga0075429_100305323 | 3300006880 | Bacteria | 1393 |
| 191 | Ga0075429_100535307 | 3300006880 | Bacteria | 1027 |
| 192 | Ga0075436_100005367 | 3300006914 | Bacteria | 8824 |
| 193 | Ga0075436_100259946 | 3300006914 | Bacteria | 1238 |
| 194 | Ga0075436_100314370 | 3300006914 | Bacteria | 1124 |
| 195 | Ga0075435_100009622 | 3300007076 | Bacteria | 7016 |
| 196 | Ga0075435_100019512 | 3300007076 | Bacteria | 5181 |
| 197 | Ga0075435_100183728 | 3300007076 | Bacteria | 1768 |
| 198 | Ga0075435_100450679 | 3300007076 | Bacteria | 1109 |
| 199 | Ga0075435_100654929 | 3300007076 | Bacteria | 912 |
| 200 | Ga0111539_10033094 | 3300009094 | Bacteria | 6276 |
| 201 | Ga0111539_10070191 | 3300009094 | Bacteria | 4135 |
| 202 | Ga0111539_10137331 | 3300009094 | Bacteria | 2863 |
| 203 | Ga0111539_10145250 | 3300009094 | Bacteria | 2777 |
| 204 | Ga0105245_10018238 | 3300009098 | Bacteria | 6136 |
| 205 | Ga0105245_10769375 | 3300009098 | Bacteria | 1000 |
| 206 | Ga0105247_10044871 | 3300009101 | Bacteria | 2712 |
| 207 | Ga0105247_10117174 | 3300009101 | Bacteria | 1721 |
| 208 | Ga0114129_10001806 | 3300009147 | Bacteria | 29163 |
| 209 | Ga0114129_10083953 | 3300009147 | Bacteria | 4422 |
| 210 | Ga0114129_10686301 | 3300009147 | Bacteria | 1318 |
| 211 | Ga0114129_10824811 | 3300009147 | Bacteria | 1181 |
| 212 | Ga0114129_11106077 | 3300009147 | Bacteria | 992 |
| 213 | Ga0105241_10132241 | 3300009174 | Bacteria | 2022 |
| 214 | Ga0105248_10035656 | 3300009177 | Bacteria | 5565 |
| 215 | Ga0105249_10031124 | 3300009553 | Bacteria | 4823 |
| 216 | Ga0099796_10049711 | 3300010159 | Bacteria | 1451 |
| 217 | Ga0105239_10406683 | 3300010375 | Bacteria | 1541 |
| 218 | Ga0105239_10438556 | 3300010375 | Bacteria | 1481 |
| 219 | Ga0105239_10579072 | 3300010375 | Bacteria | 1279 |
| 220 | Ga0105239_11032448 | 3300010375 | Bacteria | 946 |
| 221 | Ga0105246_10245292 | 3300011119 | Bacteria | 1418 |
| 222 | Ga0157370_10066648 | 3300013104 | Bacteria | 3404 |
| 223 | Ga0157369_10079993 | 3300013105 | Bacteria | 3500 |
| 224 | Ga0157369_11105518 | 3300013105 | Bacteria | 810 |
| 225 | Ga0157374_10093628 | 3300013296 | Bacteria | 2869 |
| 226 | Ga0157378_10165730 | 3300013297 | Bacteria | 2070 |
| 227 | Ga0163162_10115326 | 3300013306 | Bacteria | 2786 |
| 228 | Ga0163162_10242440 | 3300013306 | Bacteria | 1934 |
| 229 | Ga0157372_10127391 | 3300013307 | Bacteria | 2927 |
| 230 | Ga0157372_10279830 | 3300013307 | Bacteria | 1940 |
| 231 | Ga0157372_10596515 | 3300013307 | Bacteria | 1287 |
| 232 | Ga0157375_10022078 | 3300013308 | Bacteria | 5853 |
| 233 | Ga0163163_10017671 | 3300014325 | Bacteria | 6658 |
| 234 | Ga0157379_10004985 | 3300014968 | Bacteria | 11394 |
| 235 | Ga0157376_10242068 | 3300014969 | Bacteria | 1681 |
| 236 | Ga0163161_10078643 | 3300017792 | Bacteria | 2424 |
| 237 | Ga0163161_10543693 | 3300017792 | Bacteria | 951 |
| 238 | Ga0197907_10530067 | 3300020069 | Bacteria | 1236 |
| 239 | Ga0197907_11059048 | 3300020069 | Bacteria | 727 |
| 240 | Ga0197907_11238878 | 3300020069 | Bacteria | 1845 |
| 241 | Ga0206356_11227511 | 3300020070 | Bacteria | 1225 |
| 242 | Ga0206349_1388505 | 3300020075 | Bacteria | 661 |
| 243 | Ga0206349_1541577 | 3300020075 | Bacteria | 638 |
| 244 | Ga0206349_1884858 | 3300020075 | Bacteria | 1245 |
| 245 | Ga0206355_1035705 | 3300020076 | Bacteria | 1170 |
| 246 | Ga0206355_1091329 | 3300020076 | Bacteria | 1368 |
| 247 | Ga0206355_1699087 | 3300020076 | Bacteria | 2138 |
| 248 | Ga0206351_10721053 | 3300020077 | Bacteria | 1249 |
| 249 | Ga0206350_10217589 | 3300020080 | Bacteria | 616 |
| 250 | Ga0206350_10340345 | 3300020080 | Bacteria | 1247 |
| 251 | Ga0206354_11655940 | 3300020081 | Bacteria | 663 |
| 252 | Ga0154015_1356672 | 3300020610 | Bacteria | 1064 |
| 253 | Ga0213873_10000154 | 3300021358 | Bacteria | 13161 |
| 254 | Ga0213876_10264912 | 3300021384 | Bacteria | 913 |
| 255 | Ga0213875_10000453 | 3300021388 | Bacteria | 35468 |
| 256 | Ga0213875_10027769 | 3300021388 | Bacteria | 2693 |
| 257 | Ga0213875_10357734 | 3300021388 | Bacteria | 694 |
| 258 | Ga0224712_10008546 | 3300022467 | Bacteria | 3041 |
| 259 | Ga0224712_10052531 | 3300022467 | Bacteria | 1592 |
| 260 | Ga0224712_10430300 | 3300022467 | Bacteria | 632 |
| 261 | Ga0224712_10481637 | 3300022467 | Bacteria | 598 |
| 262 | Ga0224572_1002018 | 3300024225 | Bacteria | 3184 |
| 263 | Ga0228598_1035959 | 3300024227 | Bacteria | 976 |
| 264 | Ga0207692_10000993 | 3300025898 | Bacteria | 10358 |
| 265 | Ga0207692_10002662 | 3300025898 | Bacteria | 6874 |
| 266 | Ga0207692_10002729 | 3300025898 | Bacteria | 6814 |
| 267 | Ga0207692_10006476 | 3300025898 | Bacteria | 4748 |
| 268 | Ga0207692_10019350 | 3300025898 | Bacteria | 3075 |
| 269 | Ga0207692_10130803 | 3300025898 | Bacteria | 1417 |
| 270 | Ga0207692_10148538 | 3300025898 | Bacteria | 1340 |
| 271 | Ga0207692_10260727 | 3300025898 | Bacteria | 1042 |
| 272 | Ga0207710_10298197 | 3300025900 | Bacteria | 814 |
| 273 | Ga0207647_10227282 | 3300025904 | Bacteria | 1074 |
| 274 | Ga0207685_10000642 | 3300025905 | Bacteria | 6175 |
| 275 | Ga0207685_10002737 | 3300025905 | Bacteria | 4114 |
| 276 | Ga0207685_10220832 | 3300025905 | Bacteria | 901 |
| 277 | Ga0207699_10000384 | 3300025906 | Bacteria | 23251 |
| 278 | Ga0207699_10001474 | 3300025906 | Bacteria | 11170 |
| 279 | Ga0207699_10008057 | 3300025906 | Bacteria | 5179 |
| 280 | Ga0207699_10009676 | 3300025906 | Bacteria | 4810 |
| 281 | Ga0207699_10010456 | 3300025906 | Bacteria | 4658 |
| 282 | Ga0207699_10204548 | 3300025906 | Bacteria | 1340 |
| 283 | Ga0207699_10351431 | 3300025906 | Bacteria | 1041 |
| 284 | Ga0207684_10000506 | 3300025910 | Bacteria | 48735 |
| 285 | Ga0207684_10001501 | 3300025910 | Bacteria | 24994 |
| 286 | Ga0207684_10002941 | 3300025910 | Bacteria | 16864 |
| 287 | Ga0207684_10005160 | 3300025910 | Bacteria | 12158 |
| 288 | Ga0207684_10019358 | 3300025910 | Bacteria | 5825 |
| 289 | Ga0207684_10028810 | 3300025910 | Bacteria | 4730 |
| 290 | Ga0207684_10072054 | 3300025910 | Bacteria | 2935 |
| 291 | Ga0207684_10080815 | 3300025910 | Bacteria | 2766 |
| 292 | Ga0207684_10095844 | 3300025910 | Bacteria | 2532 |
| 293 | Ga0207684_10155534 | 3300025910 | Bacteria | 1968 |
| 294 | Ga0207684_10187739 | 3300025910 | Bacteria | 1782 |
| 295 | Ga0207654_10447061 | 3300025911 | Bacteria | 906 |
| 296 | Ga0207671_10823399 | 3300025914 | Bacteria | 736 |
| 297 | Ga0207693_10007215 | 3300025915 | Bacteria | 9148 |
| 298 | Ga0207693_10051475 | 3300025915 | Bacteria | 3231 |
| 299 | Ga0207693_10674910 | 3300025915 | Bacteria | 802 |
| 300 | Ga0207663_10004564 | 3300025916 | Bacteria | 6904 |
| 301 | Ga0207663_10006491 | 3300025916 | Bacteria | 5989 |
| 302 | Ga0207663_10006959 | 3300025916 | Bacteria | 5830 |
| 303 | Ga0207663_10040878 | 3300025916 | Bacteria | 2822 |
| 304 | Ga0207663_10092353 | 3300025916 | Bacteria | 2012 |
| 305 | Ga0207663_10097314 | 3300025916 | Bacteria | 1968 |
| 306 | Ga0207663_10120270 | 3300025916 | Bacteria | 1797 |
| 307 | Ga0207663_10270588 | 3300025916 | Bacteria | 1258 |
| 308 | Ga0207663_10593040 | 3300025916 | Bacteria | 870 |
| 309 | Ga0207660_10475672 | 3300025917 | Bacteria | 1012 |
| 310 | Ga0207646_10000253 | 3300025922 | Bacteria | 72559 |
| 311 | Ga0207646_10001795 | 3300025922 | Bacteria | 25949 |
| 312 | Ga0207646_10004352 | 3300025922 | Bacteria | 15432 |
| 313 | Ga0207646_10017683 | 3300025922 | Bacteria | 6663 |
| 314 | Ga0207646_10022370 | 3300025922 | Bacteria | 5826 |
| 315 | Ga0207646_10049506 | 3300025922 | Bacteria | 3763 |
| 316 | Ga0207646_10074220 | 3300025922 | Bacteria | 3038 |
| 317 | Ga0207646_10083370 | 3300025922 | Bacteria | 2860 |
| 318 | Ga0207646_10262233 | 3300025922 | Bacteria | 1561 |
| 319 | Ga0207646_10288204 | 3300025922 | Bacteria | 1484 |
| 320 | Ga0207646_10317556 | 3300025922 | Bacteria | 1408 |
| 321 | Ga0207646_10913133 | 3300025922 | Bacteria | 779 |
| 322 | Ga0207681_10877021 | 3300025923 | Bacteria | 751 |
| 323 | Ga0207687_10135705 | 3300025927 | Bacteria | 1861 |
| 324 | Ga0207687_10324470 | 3300025927 | Bacteria | 1247 |
| 325 | Ga0207700_10001332 | 3300025928 | Bacteria | 14001 |
| 326 | Ga0207700_10002045 | 3300025928 | Bacteria | 11544 |
| 327 | Ga0207700_10004412 | 3300025928 | Bacteria | 8293 |
| 328 | Ga0207700_10029337 | 3300025928 | Bacteria | 3880 |
| 329 | Ga0207700_10053007 | 3300025928 | Bacteria | 3036 |
| 330 | Ga0207700_10096325 | 3300025928 | Bacteria | 2349 |
| 331 | Ga0207700_10153461 | 3300025928 | Bacteria | 1905 |
| 332 | Ga0207700_10259945 | 3300025928 | Bacteria | 1486 |
| 333 | Ga0207700_10365592 | 3300025928 | Bacteria | 1259 |
| 334 | Ga0207700_10623969 | 3300025928 | Bacteria | 960 |
| 335 | Ga0207700_10972665 | 3300025928 | Bacteria | 760 |
| 336 | Ga0207664_10005699 | 3300025929 | Bacteria | 8511 |
| 337 | Ga0207664_10006841 | 3300025929 | Bacteria | 7880 |
| 338 | Ga0207664_10007708 | 3300025929 | Bacteria | 7471 |
| 339 | Ga0207664_10013730 | 3300025929 | Bacteria | 5825 |
| 340 | Ga0207664_10031224 | 3300025929 | Bacteria | 4074 |
| 341 | Ga0207664_10053645 | 3300025929 | Bacteria | 3192 |
| 342 | Ga0207664_10072926 | 3300025929 | Bacteria | 2769 |
| 343 | Ga0207664_10122632 | 3300025929 | Bacteria | 2177 |
| 344 | Ga0207664_10148272 | 3300025929 | Bacteria | 1991 |
| 345 | Ga0207664_10335038 | 3300025929 | Bacteria | 1337 |
| 346 | Ga0207664_10342324 | 3300025929 | Bacteria | 1322 |
| 347 | Ga0207664_10365387 | 3300025929 | Bacteria | 1279 |
| 348 | Ga0207664_10510476 | 3300025929 | Bacteria | 1077 |
| 349 | Ga0207664_10611267 | 3300025929 | Bacteria | 979 |
| 350 | Ga0207664_10797630 | 3300025929 | Bacteria | 849 |
| 351 | Ga0207706_10061434 | 3300025933 | Bacteria | 3309 |
| 352 | Ga0207665_10000804 | 3300025939 | Bacteria | 21249 |
| 353 | Ga0207665_10001312 | 3300025939 | Bacteria | 16758 |
| 354 | Ga0207665_10002268 | 3300025939 | Bacteria | 12977 |
| 355 | Ga0207665_10007286 | 3300025939 | Bacteria | 7318 |
| 356 | Ga0207665_10039793 | 3300025939 | Bacteria | 3135 |
| 357 | Ga0207711_10035694 | 3300025941 | Bacteria | 4216 |
| 358 | Ga0207667_10377033 | 3300025949 | Bacteria | 1445 |
| 359 | Ga0207712_10550168 | 3300025961 | Bacteria | 993 |
| 360 | Ga0207712_10678507 | 3300025961 | Bacteria | 898 |
| 361 | Ga0207640_10240854 | 3300025981 | Bacteria | 1398 |
| 362 | Ga0207677_10163514 | 3300026023 | Bacteria | 1732 |
| 363 | Ga0207677_11242593 | 3300026023 | Bacteria | 683 |
| 364 | Ga0207703_10041980 | 3300026035 | Bacteria | 3667 |
| 365 | Ga0207708_10000044 | 3300026075 | Bacteria | 120765 |
| 366 | Ga0207702_10018736 | 3300026078 | Bacteria | 5726 |
| 367 | Ga0207702_10063093 | 3300026078 | Bacteria | 3168 |
| 368 | Ga0207702_10357770 | 3300026078 | Bacteria | 1398 |
| 369 | Ga0207702_10888556 | 3300026078 | Bacteria | 883 |
| 370 | Ga0207641_10060746 | 3300026088 | Bacteria | 3222 |
| 371 | Ga0207641_10149440 | 3300026088 | Bacteria | 2115 |
| 372 | Ga0207674_10112578 | 3300026116 | Bacteria | 2695 |
| 373 | Ga0207675_100097618 | 3300026118 | Bacteria | 2767 |
| 374 | Ga0207428_10029562 | 3300027907 | Bacteria | 4540 |
| 375 | Ga0268266_10159038 | 3300028379 | Bacteria | 2043 |
| 376 | Ga0265336_10002104 | 3300028666 | Bacteria | 8454 |
| 377 | Ga0265336_10023213 | 3300028666 | Bacteria | 1970 |
| 378 | Ga0265338_10000966 | 3300028800 | Bacteria | 48429 |
| 379 | Ga0265338_10002944 | 3300028800 | Bacteria | 24701 |
| 380 | Ga0265338_10102989 | 3300028800 | Bacteria | 2320 |
| 381 | Ga0265338_10128139 | 3300028800 | Bacteria | 2010 |
| 382 | Ga0316178_1001611 | 3300030735 | Bacteria | 735 |
| 383 | Ga0265762_1029750 | 3300030760 | Bacteria | 1034 |
| 384 | Ga0265766_1013204 | 3300030863 | Bacteria | 618 |
| 385 | Ga0265776_106205 | 3300030880 | Bacteria | 642 |
| 386 | Ga0265760_10027645 | 3300031090 | Bacteria | 1663 |
| 387 | Ga0265760_10141670 | 3300031090 | Bacteria | 783 |
| 388 | Ga0265325_10055484 | 3300031241 | Bacteria | 2025 |
| 389 | Ga0265340_10014578 | 3300031247 | Bacteria | 4101 |
| 390 | Ga0265339_10074003 | 3300031249 | Bacteria | 1811 |
| 391 | Ga0265316_10128468 | 3300031344 | Bacteria | 1910 |
| 392 | Ga0265313_10130904 | 3300031595 | Bacteria | 1087 |
| 393 | Ga0307410_10175339 | 3300031852 | Bacteria | 1619 |
| 394 | Ga0307410_10196992 | 3300031852 | Bacteria | 1536 |
| 395 | Ga0307406_10752973 | 3300031901 | Bacteria | 818 |
| 396 | Ga0307407_10098643 | 3300031903 | Bacteria | 1808 |
| 397 | Ga0307407_10187309 | 3300031903 | Bacteria | 1376 |
| 398 | Ga0307407_10733809 | 3300031903 | Bacteria | 747 |
| 399 | Ga0307409_100052676 | 3300031995 | Bacteria | 3122 |
| 400 | Ga0307409_100116986 | 3300031995 | Bacteria | 2248 |
| 401 | Ga0307409_100257557 | 3300031995 | Bacteria | 1599 |
| 402 | Ga0307409_100380934 | 3300031995 | Bacteria | 1341 |
| 403 | Ga0307416_100060630 | 3300032002 | Bacteria | 3082 |
| 404 | Ga0307416_100161748 | 3300032002 | Bacteria | 2070 |
| 405 | Ga0307416_100709173 | 3300032002 | Bacteria | 1096 |
| 406 | Ga0307414_10504542 | 3300032004 | Bacteria | 1071 |
| 407 | Ga0307415_100005975 | 3300032126 | Bacteria | 6521 |
| 408 | Ga0307415_100025403 | 3300032126 | Bacteria | 3716 |
| 409 | Ga0307415_100047887 | 3300032126 | Bacteria | 2880 |
| 410 | Ga0307415_100054722 | 3300032126 | Bacteria | 2726 |
| 411 | Ga0307415_100981856 | 3300032126 | Bacteria | 784 |
| 412 | Ga0307510_10521745 | 3300033180 | Bacteria | 632 |
| 413 | Ga0373948_0010140 | 3300034817 | Bacteria | 1639 |
| 414 | Ga0373950_0004752 | 3300034818 | Bacteria | 2000 |
| 415 | Ga0373959_0041849 | 3300034820 | Bacteria | 964 |
| 416 | Ga0373934_0007401 | 3300035086 | Bacteria | 4076 |
| 417 | Ga0373934_0011720 | 3300035086 | Bacteria | 3301 |
| 418 | Ga0373949_0034634 | 3300035090 | Bacteria | 1218 |
| 419 | Ga0373951_0032926 | 3300035091 | Bacteria | 1227 |
| 420 | Ga0373952_0020300 | 3300035092 | Bacteria | 1391 |
| 421 | Ga0373923_0019707 | 3300035111 | Bacteria | 2614 |
| 422 | Ga0373923_0024852 | 3300035111 | Bacteria | 2368 |
| 423 | Ga0373923_0030953 | 3300035111 | Bacteria | 2154 |
| 424 | Ga0373923_0035542 | 3300035111 | Bacteria | 2029 |
| 425 | Ga0373936_0000776 | 3300035113 | Bacteria | 11259 |
| 426 | Ga0373936_0225728 | 3300035113 | Bacteria | 832 |
| 427 | Ga0373941_0155676 | 3300035115 | Bacteria | 841 |
| 428 | Ga0373945_0193107 | 3300035116 | Bacteria | 842 |
| 429 | Ga0373953_0000633 | 3300035117 | Bacteria | 9756 |
| 430 | Ga0373953_0004067 | 3300035117 | Bacteria | 4624 |
| 431 | Ga0373953_0005368 | 3300035117 | Bacteria | 4153 |
| 432 | Ga0373954_0001328 | 3300035118 | Bacteria | 9987 |
| 433 | Ga0373954_0015306 | 3300035118 | Bacteria | 3428 |
| 434 | Ga0373956_0002275 | 3300035119 | Bacteria | 7907 |
| 435 | Ga0373956_0017570 | 3300035119 | Bacteria | 3017 |
| 436 | Ga0373956_0068803 | 3300035119 | Bacteria | 1613 |
| 437 | Ga0373957_0000105 | 3300035120 | Bacteria | 20463 |
| 438 | Ga0373957_0005099 | 3300035120 | Bacteria | 4052 |
| 439 | Ga0373957_0018046 | 3300035120 | Bacteria | 2465 |
| 440 | Ga0373957_0020283 | 3300035120 | Bacteria | 2347 |
| 441 | Ga0373943_0194963 | 3300035170 | Bacteria | 1119 |
| 442 | Ga0373943_0203535 | 3300035170 | Bacteria | 1096 |
| 443 | Ga0373943_0320160 | 3300035170 | Bacteria | 884 |
| 444 | Ga0373946_0060758 | 3300035171 | Bacteria | 1607 |
| 445 | Ga0373946_0197428 | 3300035171 | Bacteria | 962 |
| 446 | Ga0373946_0385789 | 3300035171 | Bacteria | 705 |
| 447 | Ga0373955_0000005 | 3300035172 | Bacteria | 108267 |
| 448 | Ga0373955_0068163 | 3300035172 | Bacteria | 1982 |
| 449 | Ga0373942_0008585 | 3300035207 | Bacteria | 2384 |
| 450 | Ga0373961_0075606 | 3300035241 | Bacteria | 1050 |
| 451 | Ga0373924_0001034 | 3300035410 | Bacteria | 8851 |
| 452 | Ga0373924_0012430 | 3300035410 | Bacteria | 3180 |
| 453 | Ga0373924_0078247 | 3300035410 | Bacteria | 1403 |
| 454 | Ga0373931_0013251 | 3300035691 | Bacteria | 4012 |
| 455 | Ga0373931_0062277 | 3300035691 | Bacteria | 2014 |
| 456 | Ga0373935_0004473 | 3300035692 | Bacteria | 8209 |
| 457 | Ga0373935_0040866 | 3300035692 | Bacteria | 2912 |
| 458 | Ga0373935_0133635 | 3300035692 | Bacteria | 1669 |
| 459 | Ga0373935_0214113 | 3300035692 | Bacteria | 1336 |
| 460 | Ga0373935_0344443 | 3300035692 | Bacteria | 1061 |
| 461 | Ga0373935_0670830 | 3300035692 | Bacteria | 761 |
| 462 | Ga0373927_0168576 | 3300035695 | Bacteria | 1435 |
| 463 | Ga0373933_0000043 | 3300035724 | Bacteria | 78147 |
| 464 | Ga0373933_0004400 | 3300035724 | Bacteria | 7734 |
| 465 | Ga0373933_0005196 | 3300035724 | Bacteria | 7102 |
| 466 | Ga0373933_0009228 | 3300035724 | Bacteria | 5387 |
| 467 | Ga0373947_0155585 | 3300035725 | Bacteria | 1475 |
| 468 | Ga0373947_0257092 | 3300035725 | Bacteria | 1156 |
| 469 | Ga0373937_0000951 | 3300036401 | Bacteria | 24624 |
| 470 | Ga0373937_0091646 | 3300036401 | Bacteria | 2816 |
| 471 | Ga0373937_0137630 | 3300036401 | Bacteria | 2283 |
| 472 | Ga0373937_0226876 | 3300036401 | Bacteria | 1758 |
| 473 | Ga0373937_0365079 | 3300036401 | Bacteria | 1368 |
| 474 | Ga0373937_0434962 | 3300036401 | Bacteria | 1245 |
| 475 | Ga0310112_037093 | 3300036458 | Bacteria | 664 |
| 476 | Ga0373925_0055868 | 3300037068 | Bacteria | 2956 |
| 477 | Ga0373925_0068229 | 3300037068 | Bacteria | 2684 |
| 478 | Ga0373925_0097522 | 3300037068 | Bacteria | 2254 |
| 479 | Ga0373925_0119170 | 3300037068 | Bacteria | 2047 |
| 480 | Ga0373925_0168813 | 3300037068 | Bacteria | 1726 |
| 481 | Ga0373925_0502410 | 3300037068 | Bacteria | 995 |
| 482 | Ga0395899_0291984 | 3300037312 | Bacteria | 1106 |
| 483 | Ga0395900_0015425 | 3300037418 | Bacteria | 7789 |
| 484 | Ga0395900_0328819 | 3300037418 | Bacteria | 1507 |
| 485 | Ga0395898_0018695 | 3300037466 | Bacteria | 7065 |
| 486 | Ga0395898_0681283 | 3300037466 | Bacteria | 970 |
| 487 | Ga0395898_0836442 | 3300037466 | Bacteria | 860 |
| 488 | Ga0395905_0117655 | 3300037471 | Bacteria | 2497 |
| 489 | Ga0436364_0431777 | 3300037853 | Bacteria | 22382 |
| 490 | Ga0436364_1160943 | 3300037853 | Unclassified | 1077 |
| 491 | Ga0436364_1206720 | 3300037853 | Bacteria | 3323 |
| 492 | Ga0395901_0003924 | 3300038443 | Bacteria | 14959 |
| 493 | Ga0395901_0081417 | 3300038443 | Bacteria | 3382 |
| 494 | Ga0395901_0419170 | 3300038443 | Unclassified | 1373 |
| 495 | Ga0436365_0529014 | 3300039437 | Bacteria | 5151 |
| 496 | Ga0436363_0731983 | 3300039450 | Unclassified | 1039 |
| 497 | Ga0436362_1289131 | 3300039453 | Bacteria | 14337 |
| 498 | Ga0439448_0086729 | 3300042005 | Bacteria | 1055 |
| 499 | Ga0439450_026072 | 3300042008 | Bacteria | 1286 |
| 500 | Ga0439451_054867 | 3300042009 | Bacteria | 798 |
| 501 | Ga0439454_024067 | 3300042011 | Bacteria | 918 |
| 502 | Ga0439455_0129471 | 3300042012 | Bacteria | 711 |
| 503 | Ga0439456_073553 | 3300042013 | Bacteria | 759 |
| 504 | Ga0439463_077625 | 3300042016 | Bacteria | 853 |
| 505 | Ga0439460_0082928 | 3300042461 | Bacteria | 1008 |
| 506 | Ga0439440_0008607 | 3300042993 | Bacteria | 2099 |
| 507 | Ga0466969_0034109 | 3300044656 | Bacteria | 2579 |
| 508 | Ga0466969_0124266 | 3300044656 | Bacteria | 1199 |
| 509 | Ga0466972_0003105 | 3300044658 | Bacteria | 8240 |
| 510 | Ga0466966_0158205 | 3300044684 | Bacteria | 1380 |
| 511 | Ga0466966_0172832 | 3300044684 | Bacteria | 1312 |
| 512 | Ga0466961_0065229 | 3300044693 | Bacteria | 2314 |
| 513 | Ga0466961_0107908 | 3300044693 | Bacteria | 1752 |
| 514 | Ga0466963_0139989 | 3300044694 | Bacteria | 1676 |
| 515 | Ga0466963_0282319 | 3300044694 | Bacteria | 1167 |
| 516 | Ga0466971_0082601 | 3300044719 | Bacteria | 1466 |
| 517 | Ga0466971_0088643 | 3300044719 | Bacteria | 1415 |
| 518 | Ga0466970_0025651 | 3300044765 | Bacteria | 3087 |
| 519 | Ga0466970_0084836 | 3300044765 | Bacteria | 1715 |
| 520 | Ga0466957_0200621 | 3300044842 | Bacteria | 1310 |
| 521 | Ga0466958_0008482 | 3300045836 | Bacteria | 5705 |
| 522 | Ga0495592_0000092 | 3300046454 | Bacteria | 79147 |
| 523 | Ga0495592_0022414 | 3300046454 | Bacteria | 4805 |
| 524 | Ga0495592_0071795 | 3300046454 | Bacteria | 2519 |
| 525 | Ga0495592_0076386 | 3300046454 | Bacteria | 2430 |
| 526 | Ga0495592_0106217 | 3300046454 | Bacteria | 1993 |
| 527 | Ga0495603_0118767 | 3300046455 | Bacteria | 1541 |
| 528 | Ga0495629_0003314 | 3300046459 | Bacteria | 12168 |
| 529 | Ga0495629_0003661 | 3300046459 | Bacteria | 11620 |
| 530 | Ga0495629_0025285 | 3300046459 | Bacteria | 4222 |
| 531 | Ga0495629_0576292 | 3300046459 | Bacteria | 754 |
| 532 | Ga0495641_0008076 | 3300046461 | Bacteria | 6470 |
| 533 | Ga0495641_0014110 | 3300046461 | Bacteria | 4340 |
| 534 | Ga0495651_0000066 | 3300046462 | Bacteria | 77538 |
| 535 | Ga0495651_0006931 | 3300046462 | Bacteria | 8663 |
| 536 | Ga0495651_0011774 | 3300046462 | Bacteria | 6722 |
| 537 | Ga0495651_0033166 | 3300046462 | Bacteria | 4027 |
| 538 | Ga0495651_0086916 | 3300046462 | Bacteria | 2351 |
| 539 | Ga0495653_0004729 | 3300046463 | Bacteria | 11024 |
| 540 | Ga0495653_0018365 | 3300046463 | Bacteria | 5680 |
| 541 | Ga0495653_0033826 | 3300046463 | Bacteria | 4047 |
| 542 | Ga0495653_0035799 | 3300046463 | Bacteria | 3915 |
| 543 | Ga0495653_0044544 | 3300046463 | Bacteria | 3443 |
| 544 | Ga0495653_0306726 | 3300046463 | Bacteria | 1033 |
| 545 | Ga0495580_0039310 | 3300046472 | Bacteria | 3384 |
| 546 | Ga0495580_0567492 | 3300046472 | Bacteria | 752 |
| 547 | Ga0495582_0004853 | 3300046473 | Bacteria | 7543 |
| 548 | Ga0495582_0017308 | 3300046473 | Bacteria | 3944 |
| 549 | Ga0495582_0034908 | 3300046473 | Bacteria | 2764 |
| 550 | Ga0495605_0292211 | 3300046474 | Bacteria | 691 |
| 551 | Ga0495639_0182393 | 3300046475 | Bacteria | 1022 |
| 552 | Ga0495662_0014032 | 3300046476 | Bacteria | 3900 |
| 553 | Ga0495662_0136704 | 3300046476 | Bacteria | 1205 |
| 554 | Ga0495664_0018432 | 3300046477 | Bacteria | 3999 |
| 555 | Ga0495664_0030915 | 3300046477 | Bacteria | 3137 |
| 556 | Ga0495664_0074201 | 3300046477 | Bacteria | 2035 |
| 557 | Ga0495608_0000070 | 3300046511 | Bacteria | 77533 |
| 558 | Ga0495608_0022587 | 3300046511 | Bacteria | 4314 |
| 559 | Ga0495608_0024087 | 3300046511 | Bacteria | 4165 |
| 560 | Ga0495608_0041140 | 3300046511 | Bacteria | 3094 |
| 561 | Ga0495608_0055683 | 3300046511 | Bacteria | 2613 |
| 562 | Ga0495618_0065186 | 3300046514 | Bacteria | 2315 |
| 563 | Ga0495618_0077752 | 3300046514 | Bacteria | 2114 |
| 564 | Ga0495618_0081384 | 3300046514 | Bacteria | 2067 |
| 565 | Ga0495628_0000829 | 3300046516 | Bacteria | 28672 |
| 566 | Ga0495628_0026167 | 3300046516 | Bacteria | 4762 |
| 567 | Ga0495628_0037057 | 3300046516 | Bacteria | 3910 |
| 568 | Ga0495628_0081973 | 3300046516 | Bacteria | 2505 |
| 569 | Ga0495628_0094225 | 3300046516 | Bacteria | 2315 |
| 570 | Ga0495628_0129988 | 3300046516 | Bacteria | 1927 |
| 571 | Ga0495628_0363557 | 3300046516 | Bacteria | 1062 |
| 572 | Ga0495628_0582697 | 3300046516 | Bacteria | 800 |
| 573 | Ga0495630_0211054 | 3300046517 | Bacteria | 1482 |
| 574 | Ga0495630_0243288 | 3300046517 | Bacteria | 1374 |
| 575 | Ga0495630_0812347 | 3300046517 | Bacteria | 714 |
| 576 | Ga0495630_0853510 | 3300046517 | Bacteria | 694 |
| 577 | Ga0495666_0199154 | 3300046526 | Bacteria | 921 |
| 578 | Ga0495642_0221014 | 3300046528 | Bacteria | 827 |
| 579 | Ga0495652_0000232 | 3300046529 | Bacteria | 65303 |
| 580 | Ga0495652_0006959 | 3300046529 | Bacteria | 10460 |
| 581 | Ga0495652_0010261 | 3300046529 | Bacteria | 8491 |
| 582 | Ga0495652_0045104 | 3300046529 | Bacteria | 3793 |
| 583 | Ga0495652_0120137 | 3300046529 | Bacteria | 2097 |
| 584 | Ga0495652_0149636 | 3300046529 | Bacteria | 1825 |
| 585 | Ga0495652_0205291 | 3300046529 | Bacteria | 1492 |
| 586 | Ga0495652_0263285 | 3300046529 | Bacteria | 1271 |
| 587 | Ga0495665_0004219 | 3300046531 | Bacteria | 7760 |
| 588 | Ga0495640_0018902 | 3300046533 | Bacteria | 5097 |
| 589 | Ga0495640_0031768 | 3300046533 | Bacteria | 3767 |
| 590 | Ga0495640_0041803 | 3300046533 | Bacteria | 3201 |
| 591 | Ga0495640_0045456 | 3300046533 | Bacteria | 3046 |
| 592 | Ga0495640_0283935 | 3300046533 | Bacteria | 1030 |
| 593 | Ga0495640_0463342 | 3300046533 | Bacteria | 773 |
| 594 | Ga0495586_0014146 | 3300046535 | Bacteria | 4239 |
| 595 | Ga0495587_0000077 | 3300046536 | Bacteria | 77532 |
| 596 | Ga0495587_0002793 | 3300046536 | Bacteria | 11666 |
| 597 | Ga0495587_0006338 | 3300046536 | Bacteria | 7714 |
| 598 | Ga0495587_0021693 | 3300046536 | Bacteria | 3962 |
| 599 | Ga0495587_0029964 | 3300046536 | Bacteria | 3301 |
| 600 | Ga0495587_0520807 | 3300046536 | Bacteria | 657 |
| 601 | Ga0495609_0127833 | 3300046538 | Bacteria | 1090 |
| 602 | Ga0495609_0164241 | 3300046538 | Bacteria | 940 |
| 603 | Ga0495645_0020924 | 3300046543 | Bacteria | 4727 |
| 604 | Ga0495645_0039049 | 3300046543 | Bacteria | 3462 |
| 605 | Ga0495645_0113708 | 3300046543 | Bacteria | 1913 |
| 606 | Ga0495645_0160121 | 3300046543 | Bacteria | 1557 |
| 607 | Ga0495633_0158987 | 3300046558 | Bacteria | 1043 |
| 608 | Ga0495667_0000071 | 3300046559 | Bacteria | 77538 |
| 609 | Ga0495667_0003348 | 3300046559 | Bacteria | 10735 |
| 610 | Ga0495667_0051639 | 3300046559 | Bacteria | 2711 |
| 611 | Ga0495667_0054331 | 3300046559 | Bacteria | 2635 |
| 612 | Ga0495667_0089470 | 3300046559 | Bacteria | 1995 |
| 613 | Ga0495667_0268831 | 3300046559 | Bacteria | 1083 |
| 614 | Ga0495656_0139854 | 3300046615 | Bacteria | 1160 |
| 615 | Ga0495656_0152025 | 3300046615 | Bacteria | 1119 |
| 616 | Ga0495634_0007920 | 3300046642 | Bacteria | 7925 |
| 617 | Ga0495634_0033601 | 3300046642 | Bacteria | 3524 |
| 618 | Ga0495634_0086203 | 3300046642 | Bacteria | 2045 |
| 619 | Ga0495634_0113068 | 3300046642 | Bacteria | 1744 |
| 620 | Ga0495634_0147014 | 3300046642 | Bacteria | 1493 |
| 621 | Ga0495634_0332239 | 3300046642 | Bacteria | 913 |
| 622 | Ga0495611_0274192 | 3300046648 | Bacteria | 780 |
| 623 | Ga0495635_0003963 | 3300046663 | Bacteria | 10301 |
| 624 | Ga0495635_0026444 | 3300046663 | Bacteria | 4037 |
| 625 | Ga0495635_0073633 | 3300046663 | Unclassified | 2340 |
| 626 | Ga0495635_0094017 | 3300046663 | Bacteria | 2049 |
| 627 | Ga0495659_0187535 | 3300046664 | Bacteria | 844 |
| 628 | Ga0495661_0267740 | 3300046665 | Bacteria | 866 |
| 629 | Ga0495657_0000095 | 3300046675 | Bacteria | 77538 |
| 630 | Ga0495657_0016622 | 3300046675 | Bacteria | 5358 |
| 631 | Ga0495657_0017707 | 3300046675 | Bacteria | 5168 |
| 632 | Ga0495657_0022581 | 3300046675 | Bacteria | 4504 |
| 633 | Ga0495657_0056956 | 3300046675 | Bacteria | 2600 |
| 634 | Ga0495599_0000331 | 3300046678 | Bacteria | 28205 |
| 635 | Ga0495599_0009664 | 3300046678 | Bacteria | 5904 |
| 636 | Ga0495599_0012091 | 3300046678 | Bacteria | 5312 |
| 637 | Ga0495599_0026910 | 3300046678 | Bacteria | 3605 |
| 638 | Ga0495599_0041226 | 3300046678 | Bacteria | 2899 |
| 639 | Ga0495599_0042920 | 3300046678 | Bacteria | 2838 |
| 640 | Ga0495599_0125263 | 3300046678 | Bacteria | 1597 |
| 641 | Ga0495599_0578608 | 3300046678 | Bacteria | 655 |
| 642 | Ga0495623_0001233 | 3300046679 | Bacteria | 17374 |
| 643 | Ga0495623_0013202 | 3300046679 | Bacteria | 5355 |
| 644 | Ga0495623_0039712 | 3300046679 | Bacteria | 3006 |
| 645 | Ga0495623_0093951 | 3300046679 | Bacteria | 1835 |
| 646 | Ga0495623_0181474 | 3300046679 | Bacteria | 1222 |
| 647 | Ga0495646_0002846 | 3300046680 | Bacteria | 10709 |
| 648 | Ga0495646_0010735 | 3300046680 | Bacteria | 5820 |
| 649 | Ga0495646_0023620 | 3300046680 | Bacteria | 3870 |
| 650 | Ga0495646_0163773 | 3300046680 | Bacteria | 1229 |
| 651 | Ga0495646_0232027 | 3300046680 | Bacteria | 994 |
| 652 | Ga0495658_0023824 | 3300046683 | Bacteria | 3253 |
| 653 | Ga0495613_0027049 | 3300046689 | Bacteria | 4269 |
| 654 | Ga0495613_0087106 | 3300046689 | Bacteria | 2264 |
| 655 | Ga0495613_0087757 | 3300046689 | Bacteria | 2254 |
| 656 | Ga0495613_0089302 | 3300046689 | Bacteria | 2232 |
| 657 | Ga0495613_0500070 | 3300046689 | Unclassified | 819 |
| 658 | Ga0495624_0008506 | 3300046690 | Bacteria | 7149 |
| 659 | Ga0495624_0014188 | 3300046690 | Bacteria | 5415 |
| 660 | Ga0495624_0062979 | 3300046690 | Bacteria | 2319 |
| 661 | Ga0495624_0287875 | 3300046690 | Bacteria | 992 |
| 662 | Ga0495624_0550035 | 3300046690 | Bacteria | 689 |
| 663 | Ga0495600_0001235 | 3300046809 | Bacteria | 14020 |
| 664 | Ga0495600_0005735 | 3300046809 | Bacteria | 7502 |
| 665 | Ga0495600_0010034 | 3300046809 | Bacteria | 5870 |
| 666 | Ga0495600_0012615 | 3300046809 | Bacteria | 5290 |
| 667 | Ga0495600_0045663 | 3300046809 | Bacteria | 2859 |
| 668 | Ga0495600_0072349 | 3300046809 | Bacteria | 2252 |
| 669 | Ga0495581_0003544 | 3300047315 | Bacteria | 8960 |
| 670 | Ga0495581_0039124 | 3300047315 | Bacteria | 2745 |
| 671 | Ga0495604_0000087 | 3300047317 | Bacteria | 79147 |
| 672 | Ga0495604_0012709 | 3300047317 | Bacteria | 6699 |
| 673 | Ga0495604_0014967 | 3300047317 | Bacteria | 6187 |
| 674 | Ga0495604_0021296 | 3300047317 | Bacteria | 5176 |
| 675 | Ga0495604_0198054 | 3300047317 | Bacteria | 1395 |
| 676 | Ga0495636_0067411 | 3300047318 | Bacteria | 1523 |
| 677 | Ga0495674_0006513 | 3300047319 | Bacteria | 11206 |
| 678 | Ga0495674_0043705 | 3300047319 | Bacteria | 3987 |
| 679 | Ga0495674_0051395 | 3300047319 | Bacteria | 3634 |
| 680 | Ga0495674_0071507 | 3300047319 | Bacteria | 2994 |
| 681 | Ga0495674_0107595 | 3300047319 | Bacteria | 2366 |
| 682 | Ga0495674_0114419 | 3300047319 | Bacteria | 2284 |
| 683 | Ga0495674_0220078 | 3300047319 | Bacteria | 1569 |
| 684 | Ga0495674_0423188 | 3300047319 | Bacteria | 1073 |
| 685 | Ga0495676_0029423 | 3300047321 | Bacteria | 4677 |
| 686 | Ga0495676_0098396 | 3300047321 | Bacteria | 2170 |
| 687 | Ga0495680_0000225 | 3300047322 | Bacteria | 61654 |
| 688 | Ga0495680_0001403 | 3300047322 | Bacteria | 25974 |
| 689 | Ga0495680_0002555 | 3300047322 | Bacteria | 18576 |
| 690 | Ga0495680_0029233 | 3300047322 | Bacteria | 4513 |
| 691 | Ga0495680_0052003 | 3300047322 | Bacteria | 3195 |
| 692 | Ga0495680_0144636 | 3300047322 | Bacteria | 1737 |
| 693 | Ga0495683_0325825 | 3300047323 | Bacteria | 654 |
| 694 | Ga0495675_0000651 | 3300047444 | Bacteria | 22014 |
| 695 | Ga0495675_0009443 | 3300047444 | Bacteria | 6069 |
| 696 | Ga0495675_0020165 | 3300047444 | Bacteria | 4237 |
| 697 | Ga0495675_0050700 | 3300047444 | Bacteria | 2638 |
| 698 | Ga0495675_0063331 | 3300047444 | Bacteria | 2340 |
| 699 | Ga0495675_0366797 | 3300047444 | Bacteria | 844 |
| 700 | Ga0495684_0025680 | 3300047471 | Bacteria | 4526 |
| 701 | Ga0495684_0038444 | 3300047471 | Bacteria | 3669 |
| 702 | Ga0495684_0042288 | 3300047471 | Bacteria | 3490 |
| 703 | Ga0495593_0002417 | 3300047673 | Bacteria | 11229 |
| 704 | Ga0495593_0012570 | 3300047673 | Bacteria | 4835 |
| 705 | Ga0495602_0000419 | 3300048088 | Bacteria | 39857 |
| 706 | Ga0495602_0010581 | 3300048088 | Bacteria | 9568 |
| 707 | Ga0495602_0021863 | 3300048088 | Bacteria | 6279 |
| 708 | Ga0495602_0114740 | 3300048088 | Bacteria | 2180 |
| 709 | Ga0495602_0331026 | 3300048088 | Bacteria | 1105 |
| 710 | Ga0495602_0453934 | 3300048088 | Unclassified | 904 |
| 711 | Ga0495614_0051169 | 3300048089 | Bacteria | 1770 |
| 712 | Ga0495615_0168422 | 3300048090 | Bacteria | 662 |
| 713 | Ga0496100_0021800 | 3300048903 | Bacteria | 3865 |
| 714 | Ga0496101_0044335 | 3300048904 | Bacteria | 3182 |
| 715 | Ga0496101_0465383 | 3300048904 | Bacteria | 998 |
| 716 | Ga0496101_0992869 | 3300048904 | Bacteria | 660 |
| 717 | Ga0496102_0060132 | 3300048905 | Bacteria | 3476 |
| 718 | Ga0496102_0071570 | 3300048905 | Bacteria | 3184 |
| 719 | Ga0496104_0001701 | 3300048907 | Bacteria | 19000 |
| 720 | Ga0496104_0056756 | 3300048907 | Bacteria | 3704 |
| 721 | Ga0496104_0151268 | 3300048907 | Bacteria | 2228 |
| 722 | Ga0496104_0955147 | 3300048907 | Bacteria | 761 |
| 723 | Ga0496105_0007991 | 3300048908 | Bacteria | 8223 |
| 724 | Ga0496105_0019792 | 3300048908 | Bacteria | 5431 |
| 725 | Ga0496105_0119401 | 3300048908 | Bacteria | 2174 |
| 726 | Ga0496106_0121329 | 3300048909 | Bacteria | 2043 |
| 727 | Ga0496107_0269354 | 3300048910 | Bacteria | 1268 |
| 728 | Ga0496108_0042939 | 3300048911 | Bacteria | 3775 |
| 729 | Ga0496109_0035309 | 3300048912 | Bacteria | 4509 |
| 730 | Ga0496110_0029218 | 3300048913 | Bacteria | 4742 |
| 731 | Ga0496110_0032544 | 3300048913 | Bacteria | 4504 |
| 732 | Ga0496110_0675081 | 3300048913 | Bacteria | 934 |
| 733 | Ga0496111_0008909 | 3300048914 | Bacteria | 6672 |
| 734 | Ga0496112_0020605 | 3300048915 | Bacteria | 6252 |
| 735 | Ga0496112_0622532 | 3300048915 | Bacteria | 1010 |
| 736 | Ga0496113_0052089 | 3300048916 | Bacteria | 3056 |
| 737 | Ga0496113_0113770 | 3300048916 | Bacteria | 2109 |
| 738 | Ga0496114_0068638 | 3300048917 | Bacteria | 2976 |
| 739 | Ga0496114_0720912 | 3300048917 | Bacteria | 873 |
| 740 | Ga0496115_0049228 | 3300048918 | Bacteria | 3372 |
| 741 | Ga0496115_0244844 | 3300048918 | Bacteria | 1477 |
| 742 | Ga0496115_0498392 | 3300048918 | Bacteria | 979 |
| 743 | Ga0496115_0536108 | 3300048918 | Bacteria | 937 |
| 744 | Ga0501306_043706 | 3300049127 | Bacteria | 701 |
| 745 | Ga0501308_008285 | 3300049128 | Bacteria | 1109 |
| 746 | Ga0501309_035398 | 3300049129 | Bacteria | 749 |
| 747 | Ga0501309_052412 | 3300049129 | Bacteria | 643 |
| 748 | Ga0501310_026825 | 3300049130 | Bacteria | 748 |
| 749 | Ga0501310_045833 | 3300049130 | Bacteria | 621 |
| 750 | Ga0501305_028057 | 3300049161 | Bacteria | 865 |
| 751 | Ga0501305_036193 | 3300049161 | Bacteria | 788 |
| 752 | Ga0501307_014933 | 3300049162 | Bacteria | 954 |
| 753 | Ga0501311_019721 | 3300049527 | Bacteria | 906 |
| 754 | Ga0501312_023399 | 3300049528 | Bacteria | 931 |
| 755 | Ga0501312_028579 | 3300049528 | Bacteria | 865 |
| 756 | Ga0501313_002921 | 3300049529 | Bacteria | 1656 |
| 757 | Ga0501313_037658 | 3300049529 | Bacteria | 643 |
| 758 | Ga0501314_001546 | 3300049530 | Bacteria | 1678 |
| 759 | Ga0501315_011596 | 3300049531 | Bacteria | 1079 |
| 760 | Ga0501315_023584 | 3300049531 | Bacteria | 846 |
| 761 | Ga0501316_018174 | 3300049532 | Bacteria | 868 |
| 762 | Ga0501317_022346 | 3300049533 | Bacteria | 866 |
| 763 | Ga0501317_023869 | 3300049533 | Bacteria | 847 |
| 764 | Ga0501317_059148 | 3300049533 | Bacteria | 625 |
| 765 | Ga0501318_008088 | 3300049534 | Bacteria | 1116 |
| 766 | Ga0501318_049957 | 3300049534 | Bacteria | 619 |
| 767 | Ga0501319_007541 | 3300049535 | Bacteria | 825 |
| 768 | Ga0501320_017798 | 3300049536 | Bacteria | 797 |
| 769 | Ga0501320_024867 | 3300049536 | Bacteria | 715 |
| 770 | Ga0501321_017056 | 3300049537 | Bacteria | 870 |
| 771 | Ga0501321_025544 | 3300049537 | Bacteria | 762 |
| 772 | Ga0501321_046818 | 3300049537 | Bacteria | 623 |
| 773 | Ga0501322_005641 | 3300049538 | Bacteria | 871 |
| 774 | Ga0501323_035436 | 3300049539 | Bacteria | 715 |
| 775 | Ga0501324_011064 | 3300049540 | Bacteria | 830 |
| 776 | Ga0501333_006357 | 3300049549 | Bacteria | 784 |
| 777 | Ga0501334_05564 | 3300049550 | Bacteria | 833 |
| 778 | Ga0501340_015684 | 3300049556 | Bacteria | 600 |
| 779 | Ga0501031_0020283 | 3300049568 | Bacteria | 4334 |
| 780 | Ga0501033_0266306 | 3300049570 | Bacteria | 1212 |
| 781 | Ga0501037_0380735 | 3300049573 | Unclassified | 970 |
| 782 | Ga0501038_0117739 | 3300049574 | Bacteria | 2194 |
| 783 | Ga0501040_0063342 | 3300049576 | Bacteria | 2544 |
| 784 | Ga0501041_0184200 | 3300049577 | Bacteria | 1307 |
| 785 | Ga0501042_0003453 | 3300049578 | Bacteria | 9924 |
| 786 | Ga0501043_0223678 | 3300049579 | Bacteria | 1455 |
| 787 | Ga0501047_0313907 | 3300049581 | Bacteria | 1408 |
| 788 | Ga0501068_0271784 | 3300049584 | Bacteria | 1082 |
| 789 | Ga0501074_0004369 | 3300049590 | Bacteria | 10097 |
| 790 | Ga0501075_0164802 | 3300049591 | Bacteria | 1691 |
| 791 | Ga0501076_0010607 | 3300049592 | Bacteria | 6842 |
| 792 | Ga0501077_0318514 | 3300049593 | Unclassified | 991 |
| 793 | Ga0501081_0334129 | 3300049743 | Bacteria | 1115 |
| 794 | Ga0501045_0004719 | 3300049824 | Bacteria | 9405 |
| 795 | nmdc:mga0k408_301664_c1 | 3300050493 | Bacteria | 956 |
| 796 | nmdc:mga05p37_160474_c1 | 3300050507 | Bacteria | 2746 |
| 797 | nmdc:mga05p37_324766_c1 | 3300050507 | Bacteria | 1820 |
| 798 | nmdc:mga05p37_32652_c1 | 3300050507 | Bacteria | 6368 |
| 799 | nmdc:mga05p37_3884_c1 | 3300050507 | Bacteria | 11612 |
| 800 | nmdc:mga05p37_410916_c1 | 3300050507 | Bacteria | 1578 |
| 801 | nmdc:mga05p37_732682_c1 | 3300050507 | Bacteria | 1093 |
| 802 | nmdc:mga09592_131261_c1 | 3300050508 | Bacteria | 2155 |
| 803 | nmdc:mga0qj67_394148_c1 | 3300050509 | Bacteria | 1118 |
| 804 | nmdc:mga0qj67_42241_c1 | 3300050509 | Bacteria | 3589 |
| 805 | nmdc:mga0qj67_443165_c1 | 3300050509 | Bacteria | 1046 |
| 806 | nmdc:mga06r32_200650_c1 | 3300050510 | Bacteria | 1983 |
| 807 | nmdc:mga08y16_226876_c1 | 3300050511 | Bacteria | 1933 |
| 808 | nmdc:mga08y16_279650_c1 | 3300050511 | Bacteria | 1722 |
| 809 | nmdc:mga08y16_453912_c1 | 3300050511 | Bacteria | 1307 |
| 810 | nmdc:mga08y16_757348_c1 | 3300050511 | Bacteria | 967 |
| 811 | nmdc:mga0n895_23187_c1 | 3300050512 | Bacteria | 5830 |
| 812 | nmdc:mga0n895_233827_c1 | 3300050512 | Bacteria | 1865 |
| 813 | nmdc:mga0n895_255100_c1 | 3300050512 | Bacteria | 1780 |
| 814 | nmdc:mga0n895_49031_c1 | 3300050512 | Bacteria | 4136 |
| 815 | nmdc:mga0n895_691939_c1 | 3300050512 | Bacteria | 1016 |
| 816 | nmdc:mga0n895_97557_c1 | 3300050512 | Bacteria | 2945 |
| 817 | nmdc:mga0rr50_163953_c1 | 3300050513 | Bacteria | 1806 |
| 818 | nmdc:mga0rr50_225145_c1 | 3300050513 | Bacteria | 1550 |
| 819 | nmdc:mga0rr50_227075_c1 | 3300050513 | Bacteria | 1544 |
| 820 | nmdc:mga0rr50_61698_c1 | 3300050513 | Bacteria | 2825 |
| 821 | nmdc:mga0rr50_816596_c1 | 3300050513 | Bacteria | 795 |
| 822 | nmdc:mga08x19_21343_c1 | 3300050514 | Bacteria | 3997 |
| 823 | nmdc:mga08x19_7627_c1 | 3300050514 | Bacteria | 6428 |
| 824 | nmdc:mga0a205_11019_c1 | 3300050515 | Bacteria | 8323 |
| 825 | nmdc:mga0a205_131902_c1 | 3300050515 | Bacteria | 2399 |
| 826 | nmdc:mga0a205_73625_c1 | 3300050515 | Bacteria | 3300 |
| 827 | nmdc:mga0a205_84835_c1 | 3300050515 | Bacteria | 3060 |
| 828 | nmdc:mga0a205_9253_c1 | 3300050515 | Bacteria | 8997 |
| 829 | Ga0495601_0034346 | 3300053077 | Bacteria | 3163 |
| 830 | Ga0495601_0054957 | 3300053077 | Bacteria | 2520 |
| 831 | Ga0495601_0640352 | 3300053077 | Bacteria | 680 |
| 832 | Ga0495612_0013749 | 3300053078 | Bacteria | 3260 |
| 833 | Ga0495612_0043775 | 3300053078 | Bacteria | 1830 |
| 834 | Ga0495612_0067760 | 3300053078 | Bacteria | 1485 |
| 835 | Ga0495612_0114973 | 3300053078 | Bacteria | 1154 |
| 836 | Ga0495612_0119716 | 3300053078 | Bacteria | 1132 |
| 837 | Ga0495595_0001939 | 3300053084 | Bacteria | 8030 |
| 838 | Ga0495595_0003589 | 3300053084 | Bacteria | 6163 |
| 839 | Ga0495595_0020021 | 3300053084 | Bacteria | 2908 |
| 840 | Ga0495595_0081902 | 3300053084 | Bacteria | 1538 |
| 841 | Ga0495619_0016795 | 3300053085 | Bacteria | 4634 |
| 842 | Ga0495619_0023324 | 3300053085 | Bacteria | 3966 |
| 843 | Ga0495619_0047912 | 3300053085 | Bacteria | 2815 |
| 844 | Ga0495619_0109009 | 3300053085 | Bacteria | 1890 |
| 845 | Ga0501084_0046559 | 3300054114 | Bacteria | 3633 |
| 846 | Ga0587101_038886 | 3300059623 | Bacteria | 776 |
| 847 | Ga0587128_041480 | 3300059630 | Bacteria | 807 |
| 848 | Ga0587079_087169 | 3300059647 | Bacteria | 724 |
| 849 | Ga0587114_051953 | 3300059655 | Bacteria | 697 |
| 850 | Ga0587119_010549 | 3300059658 | Bacteria | 1049 |
| 851 | Ga0587119_042639 | 3300059658 | Bacteria | 656 |
| 852 | Ga0466962_0025481 | 3300061719 | Bacteria | 2839 |
| 853 | Ga0070706_100005766 | |||
| 854 | JGI25407J50210_10002063 | |||
| 855 | JGI25407J50210_10006527 | |||
| 856 | JGI25407J50210_10021539 | |||
| 857 | Ga0070690_100316732 | |||
| 858 | Ga0070682_100847713 | |||
| 859 | Ga0068868_100221493 | |||
| 860 | Ga0070691_10027052 | |||
| 861 | Ga0070669_100855584 | |||
| 862 | Ga0070688_100197011 | |||
| 863 | Ga0070709_10000604 | |||
| 864 | Ga0070709_10004740 | |||
| 865 | Ga0070709_10012599 | |||
| 866 | Ga0070709_10091724 | |||
| 867 | Ga0070709_10307707 | |||
| 868 | Ga0070714_100001432 | |||
| 869 | Ga0070714_100010107 | |||
| 870 | Ga0070714_100048554 | |||
| 871 | Ga0070714_100058629 | |||
| 872 | Ga0070714_100075355 | |||
| 873 | Ga0070714_100087900 | |||
| 874 | Ga0070714_100089002 | |||
| 875 | Ga0070714_100090409 | |||
| 876 | Ga0070714_100094978 | |||
| 877 | Ga0070714_100140205 | |||
| 878 | Ga0070714_100446649 | |||
| 879 | Ga0070714_100579041 | |||
| 880 | Ga0070714_100583210 | |||
| 881 | Ga0070714_101121627 | |||
| 882 | Ga0070713_100001304 | |||
| 883 | Ga0070713_100010956 | |||
| 884 | Ga0070713_100032833 | |||
| 885 | Ga0070713_100050629 | |||
| 886 | Ga0070713_100103271 | |||
| 887 | Ga0070713_100107186 | |||
| 888 | Ga0070713_100157734 | |||
| 889 | Ga0070713_100172590 | |||
| 890 | Ga0070713_100279352 | |||
| 891 | Ga0070713_101029183 | |||
| 892 | Ga0070710_10001226 | |||
| 893 | Ga0070710_10016179 | |||
| 894 | Ga0070710_10018821 | |||
| 895 | Ga0070710_10024996 | |||
| 896 | Ga0070710_10110016 | |||
| 897 | Ga0070710_10153050 | |||
| 898 | Ga0070710_10334413 | |||
| 899 | Ga0070711_100001594 | |||
| 900 | Ga0070711_100025723 | |||
| 901 | Ga0070711_100058730 | |||
| 902 | Ga0070711_100125133 | |||
| 903 | Ga0070711_100131796 | |||
| 904 | Ga0070711_100185912 | |||
| 905 | Ga0070711_100232292 | |||
| 906 | Ga0070711_100267426 | |||
| 907 | Ga0070705_100124497 | |||
| 908 | Ga0070705_100233155 | |||
| 909 | Ga0070694_100551079 | |||
| 910 | Ga0070694_100614970 | |||
| 911 | Ga0070708_100003157 | |||
| 912 | Ga0070708_100014838 | |||
| 913 | Ga0070708_100082938 | |||
| 914 | Ga0070708_100463815 | |||
| 915 | Ga0070662_100063964 | |||
| 916 | Ga0070681_11234499 | |||
| 917 | Ga0070706_100004585 | |||
| 918 | Ga0070706_100005982 | |||
| 919 | Ga0070706_100020154 | |||
| 920 | Ga0070706_100038174 | |||
| 921 | Ga0070706_100038414 | |||
| 922 | Ga0070706_100040600 | |||
| 923 | Ga0070706_100074804 | |||
| 924 | Ga0070706_100098440 | |||
| 925 | Ga0070706_100119969 | |||
| 926 | Ga0070706_100172044 | |||
| 927 | Ga0070706_100307882 | |||
| 928 | Ga0070707_100003226 | |||
| 929 | Ga0070707_100010507 | |||
| 930 | Ga0070707_100024904 | |||
| 931 | Ga0070707_100026432 | |||
| 932 | Ga0070707_100039234 | |||
| 933 | Ga0070707_100077825 | |||
| 934 | Ga0070707_100085038 | |||
| 935 | Ga0070707_100102432 | |||
| 936 | Ga0070707_100112260 | |||
| 937 | Ga0070707_100343838 | |||
| 938 | Ga0070707_101126988 | |||
| 939 | Ga0070698_100000028 | |||
| 940 | Ga0070698_100002154 | |||
| 941 | Ga0070698_100004320 | |||
| 942 | Ga0070698_100004476 | |||
| 943 | Ga0070698_100008436 | |||
| 944 | Ga0070698_100009159 | |||
| 945 | Ga0070698_100014786 | |||
| 946 | Ga0070698_100017593 | |||
| 947 | Ga0070698_100026422 | |||
| 948 | Ga0070699_100011832 | |||
| 949 | Ga0070699_100107379 | |||
| 950 | Ga0070699_100179726 | |||
| 951 | Ga0070679_100935873 | |||
| 952 | Ga0070684_100082135 | |||
| 953 | Ga0070697_100047964 | |||
| 954 | Ga0070697_100076608 | |||
| 955 | Ga0070697_100230745 | |||
| 956 | Ga0070695_100207424 | |||
| 957 | Ga0070695_100242819 | |||
| 958 | Ga0070696_100083203 | |||
| 959 | Ga0070693_100039735 | |||
| 960 | Ga0070665_100499811 | |||
| 961 | Ga0070665_100655168 | |||
| 962 | Ga0068855_100400171 | |||
| 963 | Ga0070664_100408824 | |||
| 964 | Ga0068854_100291091 | |||
| 965 | Ga0068856_100027245 | |||
| 966 | Ga0068856_100034946 | |||
| 967 | Ga0068856_100166097 | |||
| 968 | Ga0068856_100330069 | |||
| 969 | Ga0068856_100489717 | |||
| 970 | Ga0070702_100378202 | |||
| 971 | Ga0068864_100332868 | |||
| 972 | Ga0068861_100026540 | |||
| 973 | Ga0068861_100222762 | |||
| 974 | Ga0068863_100138743 | |||
| 975 | Ga0068863_100358050 | |||
| 976 | Ga0068858_100059284 | |||
| 977 | Ga0068862_101004186 | |||
| 978 | Ga0081455_10000070 | |||
| 979 | Ga0081455_10013067 | |||
| 980 | Ga0081538_10003880 | |||
| 981 | Ga0081538_10006034 | |||
| 982 | Ga0081538_10007721 | |||
| 983 | Ga0081538_10011876 | |||
| 984 | Ga0081538_10012928 | |||
| 985 | Ga0081538_10016498 | |||
| 986 | Ga0081538_10048751 | |||
| 987 | Ga0081538_10049744 | |||
| 988 | Ga0081538_10098699 | |||
| 989 | Ga0081540_1000808 | |||
| 990 | Ga0081540_1064384 | |||
| 991 | Ga0081539_10001909 | |||
| 992 | Ga0070717_10000705 | |||
| 993 | Ga0070717_10008702 | |||
| 994 | Ga0070717_10012172 | |||
| 995 | Ga0070717_10028616 | |||
| 996 | Ga0070717_10034956 | |||
| 997 | Ga0070717_10037356 | |||
| 998 | Ga0070717_10066008 | |||
| 999 | Ga0070717_10103512 | |||
| 1000 | Ga0070717_10122246 | |||
| 1001 | Ga0070717_10156429 | |||
| 1002 | Ga0070717_10191190 | |||
| 1003 | Ga0070717_10253420 | |||
| 1004 | Ga0070717_10280562 | |||
| 1005 | Ga0070717_10566968 | |||
| 1006 | Ga0070717_10863054 | |||
| 1007 | Ga0075432_10123509 | |||
| 1008 | Ga0070715_10002144 | |||
| 1009 | Ga0070715_10004360 | |||
| 1010 | Ga0070715_10046495 | |||
| 1011 | Ga0070715_10079548 | |||
| 1012 | Ga0070715_10153615 | |||
| 1013 | Ga0070715_10268087 | |||
| 1014 | Ga0070716_100000290 | |||
| 1015 | Ga0070716_100000969 | |||
| 1016 | Ga0070716_100004287 | |||
| 1017 | Ga0070716_100037736 | |||
| 1018 | Ga0070716_100063412 | |||
| 1019 | Ga0070712_100003115 | |||
| 1020 | Ga0070712_100003133 | |||
| 1021 | Ga0070712_100315380 | |||
| 1022 | Ga0070712_100345844 | |||
| 1023 | Ga0070712_100392543 | |||
| 1024 | Ga0070712_100628789 | |||
| 1025 | Ga0070712_100946264 | |||
| 1026 | Ga0075428_100035383 | |||
| 1027 | Ga0075428_100245979 | |||
| 1028 | Ga0075428_100900274 | |||
| 1029 | Ga0075428_101332387 | |||
| 1030 | Ga0075430_100017260 | |||
| 1031 | Ga0075431_100484235 | |||
| 1032 | Ga0075433_10009794 | |||
| 1033 | Ga0075433_10082152 | |||
| 1034 | Ga0075433_10235954 | |||
| 1035 | Ga0075433_10284919 | |||
| 1036 | Ga0075434_100005930 | |||
| 1037 | Ga0075434_100052605 | |||
| 1038 | Ga0075434_100084213 | |||
| 1039 | Ga0075434_100118566 | |||
| 1040 | Ga0075434_100320497 | |||
| 1041 | Ga0075429_100138410 | |||
| 1042 | Ga0075429_100305323 | |||
| 1043 | Ga0075429_100535307 | |||
| 1044 | Ga0075436_100005367 | |||
| 1045 | Ga0075436_100259946 | |||
| 1046 | Ga0075436_100314370 | |||
| 1047 | Ga0075435_100009622 | |||
| 1048 | Ga0075435_100019512 | |||
| 1049 | Ga0075435_100183728 | |||
| 1050 | Ga0075435_100450679 | |||
| 1051 | Ga0075435_100654929 | |||
| 1052 | Ga0111539_10033094 | |||
| 1053 | Ga0111539_10070191 | |||
| 1054 | Ga0111539_10137331 | |||
| 1055 | Ga0111539_10145250 | |||
| 1056 | Ga0105245_10018238 | |||
| 1057 | Ga0105245_10769375 | |||
| 1058 | Ga0105247_10044871 | |||
| 1059 | Ga0105247_10117174 | |||
| 1060 | Ga0114129_10001806 | |||
| 1061 | Ga0114129_10083953 | |||
| 1062 | Ga0114129_10686301 | |||
| 1063 | Ga0114129_10824811 | |||
| 1064 | Ga0114129_11106077 | |||
| 1065 | Ga0105241_10132241 | |||
| 1066 | Ga0105248_10035656 | |||
| 1067 | Ga0105249_10031124 | |||
| 1068 | Ga0099796_10049711 | |||
| 1069 | Ga0105239_10406683 | |||
| 1070 | Ga0105239_10438556 | |||
| 1071 | Ga0105239_10579072 | |||
| 1072 | Ga0105239_11032448 | |||
| 1073 | Ga0105246_10245292 | |||
| 1074 | Ga0157370_10066648 | |||
| 1075 | Ga0157369_10079993 | |||
| 1076 | Ga0157369_11105518 | |||
| 1077 | Ga0157374_10093628 | |||
| 1078 | Ga0157378_10165730 | |||
| 1079 | Ga0163162_10115326 | |||
| 1080 | Ga0163162_10242440 | |||
| 1081 | Ga0157372_10127391 | |||
| 1082 | Ga0157372_10279830 | |||
| 1083 | Ga0157372_10596515 | |||
| 1084 | Ga0157375_10022078 | |||
| 1085 | Ga0163163_10017671 | |||
| 1086 | Ga0157379_10004985 | |||
| 1087 | Ga0157376_10242068 | |||
| 1088 | Ga0163161_10078643 | |||
| 1089 | Ga0163161_10543693 | |||
| 1090 | Ga0197907_10530067 | |||
| 1091 | Ga0197907_11059048 | |||
| 1092 | Ga0197907_11238878 | |||
| 1093 | Ga0206356_11227511 | |||
| 1094 | Ga0206349_1388505 | |||
| 1095 | Ga0206349_1541577 | |||
| 1096 | Ga0206349_1884858 | |||
| 1097 | Ga0206355_1035705 | |||
| 1098 | Ga0206355_1091329 | |||
| 1099 | Ga0206355_1699087 | |||
| 1100 | Ga0206351_10721053 | |||
| 1101 | Ga0206350_10217589 | |||
| 1102 | Ga0206350_10340345 | |||
| 1103 | Ga0206354_11655940 | |||
| 1104 | Ga0154015_1356672 | |||
| 1105 | Ga0213873_10000154 | |||
| 1106 | Ga0213876_10264912 | |||
| 1107 | Ga0213875_10000453 | |||
| 1108 | Ga0213875_10027769 | |||
| 1109 | Ga0213875_10357734 | |||
| 1110 | Ga0224712_10008546 | |||
| 1111 | Ga0224712_10052531 | |||
| 1112 | Ga0224712_10430300 | |||
| 1113 | Ga0224712_10481637 | |||
| 1114 | Ga0224572_1002018 | |||
| 1115 | Ga0228598_1035959 | |||
| 1116 | Ga0207692_10000993 | |||
| 1117 | Ga0207692_10002662 | |||
| 1118 | Ga0207692_10002729 | |||
| 1119 | Ga0207692_10006476 | |||
| 1120 | Ga0207692_10019350 | |||
| 1121 | Ga0207692_10130803 | |||
| 1122 | Ga0207692_10148538 | |||
| 1123 | Ga0207692_10260727 | |||
| 1124 | Ga0207710_10298197 | |||
| 1125 | Ga0207647_10227282 | |||
| 1126 | Ga0207685_10000642 | |||
| 1127 | Ga0207685_10002737 | |||
| 1128 | Ga0207685_10220832 | |||
| 1129 | Ga0207699_10000384 | |||
| 1130 | Ga0207699_10001474 | |||
| 1131 | Ga0207699_10008057 | |||
| 1132 | Ga0207699_10009676 | |||
| 1133 | Ga0207699_10010456 | |||
| 1134 | Ga0207699_10204548 | |||
| 1135 | Ga0207699_10351431 | |||
| 1136 | Ga0207684_10000506 | |||
| 1137 | Ga0207684_10001501 | |||
| 1138 | Ga0207684_10002941 | |||
| 1139 | Ga0207684_10005160 | |||
| 1140 | Ga0207684_10019358 | |||
| 1141 | Ga0207684_10028810 | |||
| 1142 | Ga0207684_10072054 | |||
| 1143 | Ga0207684_10080815 | |||
| 1144 | Ga0207684_10095844 | |||
| 1145 | Ga0207684_10155534 | |||
| 1146 | Ga0207684_10187739 | |||
| 1147 | Ga0207654_10447061 | |||
| 1148 | Ga0207671_10823399 | |||
| 1149 | Ga0207693_10007215 | |||
| 1150 | Ga0207693_10051475 | |||
| 1151 | Ga0207693_10674910 | |||
| 1152 | Ga0207663_10004564 | |||
| 1153 | Ga0207663_10006491 | |||
| 1154 | Ga0207663_10006959 | |||
| 1155 | Ga0207663_10040878 | |||
| 1156 | Ga0207663_10092353 | |||
| 1157 | Ga0207663_10097314 | |||
| 1158 | Ga0207663_10120270 | |||
| 1159 | Ga0207663_10270588 | |||
| 1160 | Ga0207663_10593040 | |||
| 1161 | Ga0207660_10475672 | |||
| 1162 | Ga0207646_10000253 | |||
| 1163 | Ga0207646_10001795 | |||
| 1164 | Ga0207646_10004352 | |||
| 1165 | Ga0207646_10017683 | |||
| 1166 | Ga0207646_10022370 | |||
| 1167 | Ga0207646_10049506 | |||
| 1168 | Ga0207646_10074220 | |||
| 1169 | Ga0207646_10083370 | |||
| 1170 | Ga0207646_10262233 | |||
| 1171 | Ga0207646_10288204 | |||
| 1172 | Ga0207646_10317556 | |||
| 1173 | Ga0207646_10913133 | |||
| 1174 | Ga0207681_10877021 | |||
| 1175 | Ga0207687_10135705 | |||
| 1176 | Ga0207687_10324470 | |||
| 1177 | Ga0207700_10001332 | |||
| 1178 | Ga0207700_10002045 | |||
| 1179 | Ga0207700_10004412 | |||
| 1180 | Ga0207700_10029337 | |||
| 1181 | Ga0207700_10053007 | |||
| 1182 | Ga0207700_10096325 | |||
| 1183 | Ga0207700_10153461 | |||
| 1184 | Ga0207700_10259945 | |||
| 1185 | Ga0207700_10365592 | |||
| 1186 | Ga0207700_10623969 | |||
| 1187 | Ga0207700_10972665 | |||
| 1188 | Ga0207664_10005699 | |||
| 1189 | Ga0207664_10006841 | |||
| 1190 | Ga0207664_10007708 | |||
| 1191 | Ga0207664_10013730 | |||
| 1192 | Ga0207664_10031224 | |||
| 1193 | Ga0207664_10053645 | |||
| 1194 | Ga0207664_10072926 | |||
| 1195 | Ga0207664_10122632 | |||
| 1196 | Ga0207664_10148272 | |||
| 1197 | Ga0207664_10335038 | |||
| 1198 | Ga0207664_10342324 | |||
| 1199 | Ga0207664_10365387 | |||
| 1200 | Ga0207664_10510476 | |||
| 1201 | Ga0207664_10611267 | |||
| 1202 | Ga0207664_10797630 | |||
| 1203 | Ga0207706_10061434 | |||
| 1204 | Ga0207665_10000804 | |||
| 1205 | Ga0207665_10001312 | |||
| 1206 | Ga0207665_10002268 | |||
| 1207 | Ga0207665_10007286 | |||
| 1208 | Ga0207665_10039793 | |||
| 1209 | Ga0207711_10035694 | |||
| 1210 | Ga0207667_10377033 | |||
| 1211 | Ga0207712_10550168 | |||
| 1212 | Ga0207712_10678507 | |||
| 1213 | Ga0207640_10240854 | |||
| 1214 | Ga0207677_10163514 | |||
| 1215 | Ga0207677_11242593 | |||
| 1216 | Ga0207703_10041980 | |||
| 1217 | Ga0207708_10000044 | |||
| 1218 | Ga0207702_10018736 | |||
| 1219 | Ga0207702_10063093 | |||
| 1220 | Ga0207702_10357770 | |||
| 1221 | Ga0207702_10888556 | |||
| 1222 | Ga0207641_10060746 | |||
| 1223 | Ga0207641_10149440 | |||
| 1224 | Ga0207674_10112578 | |||
| 1225 | Ga0207675_100097618 | |||
| 1226 | Ga0207428_10029562 | |||
| 1227 | Ga0268266_10159038 | |||
| 1228 | Ga0265336_10002104 | |||
| 1229 | Ga0265336_10023213 | |||
| 1230 | Ga0265338_10000966 | |||
| 1231 | Ga0265338_10002944 | |||
| 1232 | Ga0265338_10102989 | |||
| 1233 | Ga0265338_10128139 | |||
| 1234 | Ga0316178_1001611 | |||
| 1235 | Ga0265762_1029750 | |||
| 1236 | Ga0265766_1013204 | |||
| 1237 | Ga0265776_106205 | |||
| 1238 | Ga0265760_10027645 | |||
| 1239 | Ga0265760_10141670 | |||
| 1240 | Ga0265325_10055484 | |||
| 1241 | Ga0265340_10014578 | |||
| 1242 | Ga0265339_10074003 | |||
| 1243 | Ga0265316_10128468 | |||
| 1244 | Ga0265313_10130904 | |||
| 1245 | Ga0307410_10175339 | |||
| 1246 | Ga0307410_10196992 | |||
| 1247 | Ga0307406_10752973 | |||
| 1248 | Ga0307407_10098643 | |||
| 1249 | Ga0307407_10187309 | |||
| 1250 | Ga0307407_10733809 | |||
| 1251 | Ga0307409_100052676 | |||
| 1252 | Ga0307409_100116986 | |||
| 1253 | Ga0307409_100257557 | |||
| 1254 | Ga0307409_100380934 | |||
| 1255 | Ga0307416_100060630 | |||
| 1256 | Ga0307416_100161748 | |||
| 1257 | Ga0307416_100709173 | |||
| 1258 | Ga0307414_10504542 | |||
| 1259 | Ga0307415_100005975 | |||
| 1260 | Ga0307415_100025403 | |||
| 1261 | Ga0307415_100047887 | |||
| 1262 | Ga0307415_100054722 | |||
| 1263 | Ga0307415_100981856 | |||
| 1264 | Ga0307510_10521745 | |||
| 1265 | Ga0373948_0010140 | |||
| 1266 | Ga0373950_0004752 | |||
| 1267 | Ga0373959_0041849 | |||
| 1268 | Ga0373934_0007401 | |||
| 1269 | Ga0373934_0011720 | |||
| 1270 | Ga0373949_0034634 | |||
| 1271 | Ga0373951_0032926 | |||
| 1272 | Ga0373952_0020300 | |||
| 1273 | Ga0373923_0019707 | |||
| 1274 | Ga0373923_0024852 | |||
| 1275 | Ga0373923_0030953 | |||
| 1276 | Ga0373923_0035542 | |||
| 1277 | Ga0373936_0000776 | |||
| 1278 | Ga0373936_0225728 | |||
| 1279 | Ga0373941_0155676 | |||
| 1280 | Ga0373945_0193107 | |||
| 1281 | Ga0373953_0000633 | |||
| 1282 | Ga0373953_0004067 | |||
| 1283 | Ga0373953_0005368 | |||
| 1284 | Ga0373954_0001328 | |||
| 1285 | Ga0373954_0015306 | |||
| 1286 | Ga0373956_0002275 | |||
| 1287 | Ga0373956_0017570 | |||
| 1288 | Ga0373956_0068803 | |||
| 1289 | Ga0373957_0000105 | |||
| 1290 | Ga0373957_0005099 | |||
| 1291 | Ga0373957_0018046 | |||
| 1292 | Ga0373957_0020283 | |||
| 1293 | Ga0373943_0194963 | |||
| 1294 | Ga0373943_0203535 | |||
| 1295 | Ga0373943_0320160 | |||
| 1296 | Ga0373946_0060758 | |||
| 1297 | Ga0373946_0197428 | |||
| 1298 | Ga0373946_0385789 | |||
| 1299 | Ga0373955_0000005 | |||
| 1300 | Ga0373955_0068163 | |||
| 1301 | Ga0373942_0008585 | |||
| 1302 | Ga0373961_0075606 | |||
| 1303 | Ga0373924_0001034 | |||
| 1304 | Ga0373924_0012430 | |||
| 1305 | Ga0373924_0078247 | |||
| 1306 | Ga0373931_0013251 | |||
| 1307 | Ga0373931_0062277 | |||
| 1308 | Ga0373935_0004473 | |||
| 1309 | Ga0373935_0040866 | |||
| 1310 | Ga0373935_0133635 | |||
| 1311 | Ga0373935_0214113 | |||
| 1312 | Ga0373935_0344443 | |||
| 1313 | Ga0373935_0670830 | |||
| 1314 | Ga0373927_0168576 | |||
| 1315 | Ga0373933_0000043 | |||
| 1316 | Ga0373933_0004400 | |||
| 1317 | Ga0373933_0005196 | |||
| 1318 | Ga0373933_0009228 | |||
| 1319 | Ga0373947_0155585 | |||
| 1320 | Ga0373947_0257092 | |||
| 1321 | Ga0373937_0000951 | |||
| 1322 | Ga0373937_0091646 | |||
| 1323 | Ga0373937_0137630 | |||
| 1324 | Ga0373937_0226876 | |||
| 1325 | Ga0373937_0365079 | |||
| 1326 | Ga0373937_0434962 | |||
| 1327 | Ga0310112_037093 | |||
| 1328 | Ga0373925_0055868 | |||
| 1329 | Ga0373925_0068229 | |||
| 1330 | Ga0373925_0097522 | |||
| 1331 | Ga0373925_0119170 | |||
| 1332 | Ga0373925_0168813 | |||
| 1333 | Ga0373925_0502410 | |||
| 1334 | Ga0395899_0291984 | |||
| 1335 | Ga0395900_0015425 | |||
| 1336 | Ga0395900_0328819 | |||
| 1337 | Ga0395898_0018695 | |||
| 1338 | Ga0395898_0681283 | |||
| 1339 | Ga0395898_0836442 | |||
| 1340 | Ga0395905_0117655 | |||
| 1341 | Ga0436364_0431777 | |||
| 1342 | Ga0436364_1160943 | |||
| 1343 | Ga0436364_1206720 | |||
| 1344 | Ga0395901_0003924 | |||
| 1345 | Ga0395901_0081417 | |||
| 1346 | Ga0395901_0419170 | |||
| 1347 | Ga0436365_0529014 | |||
| 1348 | Ga0436363_0731983 | |||
| 1349 | Ga0436362_1289131 | |||
| 1350 | Ga0439448_0086729 | |||
| 1351 | Ga0439450_026072 | |||
| 1352 | Ga0439451_054867 | |||
| 1353 | Ga0439454_024067 | |||
| 1354 | Ga0439455_0129471 | |||
| 1355 | Ga0439456_073553 | |||
| 1356 | Ga0439463_077625 | |||
| 1357 | Ga0439460_0082928 | |||
| 1358 | Ga0439440_0008607 | |||
| 1359 | Ga0466969_0034109 | |||
| 1360 | Ga0466969_0124266 | |||
| 1361 | Ga0466972_0003105 | |||
| 1362 | Ga0466966_0158205 | |||
| 1363 | Ga0466966_0172832 | |||
| 1364 | Ga0466961_0065229 | |||
| 1365 | Ga0466961_0107908 | |||
| 1366 | Ga0466963_0139989 | |||
| 1367 | Ga0466963_0282319 | |||
| 1368 | Ga0466971_0082601 | |||
| 1369 | Ga0466971_0088643 | |||
| 1370 | Ga0466970_0025651 | |||
| 1371 | Ga0466970_0084836 | |||
| 1372 | Ga0466957_0200621 | |||
| 1373 | Ga0466958_0008482 | |||
| 1374 | Ga0495592_0000092 | |||
| 1375 | Ga0495592_0022414 | |||
| 1376 | Ga0495592_0071795 | |||
| 1377 | Ga0495592_0076386 | |||
| 1378 | Ga0495592_0106217 | |||
| 1379 | Ga0495603_0118767 | |||
| 1380 | Ga0495629_0003314 | |||
| 1381 | Ga0495629_0003661 | |||
| 1382 | Ga0495629_0025285 | |||
| 1383 | Ga0495629_0576292 | |||
| 1384 | Ga0495641_0008076 | |||
| 1385 | Ga0495641_0014110 | |||
| 1386 | Ga0495651_0000066 | |||
| 1387 | Ga0495651_0006931 | |||
| 1388 | Ga0495651_0011774 | |||
| 1389 | Ga0495651_0033166 | |||
| 1390 | Ga0495651_0086916 | |||
| 1391 | Ga0495653_0004729 | |||
| 1392 | Ga0495653_0018365 | |||
| 1393 | Ga0495653_0033826 | |||
| 1394 | Ga0495653_0035799 | |||
| 1395 | Ga0495653_0044544 | |||
| 1396 | Ga0495653_0306726 | |||
| 1397 | Ga0495580_0039310 | |||
| 1398 | Ga0495580_0567492 | |||
| 1399 | Ga0495582_0004853 | |||
| 1400 | Ga0495582_0017308 | |||
| 1401 | Ga0495582_0034908 | |||
| 1402 | Ga0495605_0292211 | |||
| 1403 | Ga0495639_0182393 | |||
| 1404 | Ga0495662_0014032 | |||
| 1405 | Ga0495662_0136704 | |||
| 1406 | Ga0495664_0018432 | |||
| 1407 | Ga0495664_0030915 | |||
| 1408 | Ga0495664_0074201 | |||
| 1409 | Ga0495608_0000070 | |||
| 1410 | Ga0495608_0022587 | |||
| 1411 | Ga0495608_0024087 | |||
| 1412 | Ga0495608_0041140 | |||
| 1413 | Ga0495608_0055683 | |||
| 1414 | Ga0495618_0065186 | |||
| 1415 | Ga0495618_0077752 | |||
| 1416 | Ga0495618_0081384 | |||
| 1417 | Ga0495628_0000829 | |||
| 1418 | Ga0495628_0026167 | |||
| 1419 | Ga0495628_0037057 | |||
| 1420 | Ga0495628_0081973 | |||
| 1421 | Ga0495628_0094225 | |||
| 1422 | Ga0495628_0129988 | |||
| 1423 | Ga0495628_0363557 | |||
| 1424 | Ga0495628_0582697 | |||
| 1425 | Ga0495630_0211054 | |||
| 1426 | Ga0495630_0243288 | |||
| 1427 | Ga0495630_0812347 | |||
| 1428 | Ga0495630_0853510 | |||
| 1429 | Ga0495666_0199154 | |||
| 1430 | Ga0495642_0221014 | |||
| 1431 | Ga0495652_0000232 | |||
| 1432 | Ga0495652_0006959 | |||
| 1433 | Ga0495652_0010261 | |||
| 1434 | Ga0495652_0045104 | |||
| 1435 | Ga0495652_0120137 | |||
| 1436 | Ga0495652_0149636 | |||
| 1437 | Ga0495652_0205291 | |||
| 1438 | Ga0495652_0263285 | |||
| 1439 | Ga0495665_0004219 | |||
| 1440 | Ga0495640_0018902 | |||
| 1441 | Ga0495640_0031768 | |||
| 1442 | Ga0495640_0041803 | |||
| 1443 | Ga0495640_0045456 | |||
| 1444 | Ga0495640_0283935 | |||
| 1445 | Ga0495640_0463342 | |||
| 1446 | Ga0495586_0014146 | |||
| 1447 | Ga0495587_0000077 | |||
| 1448 | Ga0495587_0002793 | |||
| 1449 | Ga0495587_0006338 | |||
| 1450 | Ga0495587_0021693 | |||
| 1451 | Ga0495587_0029964 | |||
| 1452 | Ga0495587_0520807 | |||
| 1453 | Ga0495609_0127833 | |||
| 1454 | Ga0495609_0164241 | |||
| 1455 | Ga0495645_0020924 | |||
| 1456 | Ga0495645_0039049 | |||
| 1457 | Ga0495645_0113708 | |||
| 1458 | Ga0495645_0160121 | |||
| 1459 | Ga0495633_0158987 | |||
| 1460 | Ga0495667_0000071 | |||
| 1461 | Ga0495667_0003348 | |||
| 1462 | Ga0495667_0051639 | |||
| 1463 | Ga0495667_0054331 | |||
| 1464 | Ga0495667_0089470 | |||
| 1465 | Ga0495667_0268831 | |||
| 1466 | Ga0495656_0139854 | |||
| 1467 | Ga0495656_0152025 | |||
| 1468 | Ga0495634_0007920 | |||
| 1469 | Ga0495634_0033601 | |||
| 1470 | Ga0495634_0086203 | |||
| 1471 | Ga0495634_0113068 | |||
| 1472 | Ga0495634_0147014 | |||
| 1473 | Ga0495634_0332239 | |||
| 1474 | Ga0495611_0274192 | |||
| 1475 | Ga0495635_0003963 | |||
| 1476 | Ga0495635_0026444 | |||
| 1477 | Ga0495635_0073633 | |||
| 1478 | Ga0495635_0094017 | |||
| 1479 | Ga0495659_0187535 | |||
| 1480 | Ga0495661_0267740 | |||
| 1481 | Ga0495657_0000095 | |||
| 1482 | Ga0495657_0016622 | |||
| 1483 | Ga0495657_0017707 | |||
| 1484 | Ga0495657_0022581 | |||
| 1485 | Ga0495657_0056956 | |||
| 1486 | Ga0495599_0000331 | |||
| 1487 | Ga0495599_0009664 | |||
| 1488 | Ga0495599_0012091 | |||
| 1489 | Ga0495599_0026910 | |||
| 1490 | Ga0495599_0041226 | |||
| 1491 | Ga0495599_0042920 | |||
| 1492 | Ga0495599_0125263 | |||
| 1493 | Ga0495599_0578608 | |||
| 1494 | Ga0495623_0001233 | |||
| 1495 | Ga0495623_0013202 | |||
| 1496 | Ga0495623_0039712 | |||
| 1497 | Ga0495623_0093951 | |||
| 1498 | Ga0495623_0181474 | |||
| 1499 | Ga0495646_0002846 | |||
| 1500 | Ga0495646_0010735 | |||
| 1501 | Ga0495646_0023620 | |||
| 1502 | Ga0495646_0163773 | |||
| 1503 | Ga0495646_0232027 | |||
| 1504 | Ga0495658_0023824 | |||
| 1505 | Ga0495613_0027049 | |||
| 1506 | Ga0495613_0087106 | |||
| 1507 | Ga0495613_0087757 | |||
| 1508 | Ga0495613_0089302 | |||
| 1509 | Ga0495613_0500070 | |||
| 1510 | Ga0495624_0008506 | |||
| 1511 | Ga0495624_0014188 | |||
| 1512 | Ga0495624_0062979 | |||
| 1513 | Ga0495624_0287875 | |||
| 1514 | Ga0495624_0550035 | |||
| 1515 | Ga0495600_0001235 | |||
| 1516 | Ga0495600_0005735 | |||
| 1517 | Ga0495600_0010034 | |||
| 1518 | Ga0495600_0012615 | |||
| 1519 | Ga0495600_0045663 | |||
| 1520 | Ga0495600_0072349 | |||
| 1521 | Ga0495581_0003544 | |||
| 1522 | Ga0495581_0039124 | |||
| 1523 | Ga0495604_0000087 | |||
| 1524 | Ga0495604_0012709 | |||
| 1525 | Ga0495604_0014967 | |||
| 1526 | Ga0495604_0021296 | |||
| 1527 | Ga0495604_0198054 | |||
| 1528 | Ga0495636_0067411 | |||
| 1529 | Ga0495674_0006513 | |||
| 1530 | Ga0495674_0043705 | |||
| 1531 | Ga0495674_0051395 | |||
| 1532 | Ga0495674_0071507 | |||
| 1533 | Ga0495674_0107595 | |||
| 1534 | Ga0495674_0114419 | |||
| 1535 | Ga0495674_0220078 | |||
| 1536 | Ga0495674_0423188 | |||
| 1537 | Ga0495676_0029423 | |||
| 1538 | Ga0495676_0098396 | |||
| 1539 | Ga0495680_0000225 | |||
| 1540 | Ga0495680_0001403 | |||
| 1541 | Ga0495680_0002555 | |||
| 1542 | Ga0495680_0029233 | |||
| 1543 | Ga0495680_0052003 | |||
| 1544 | Ga0495680_0144636 | |||
| 1545 | Ga0495683_0325825 | |||
| 1546 | Ga0495675_0000651 | |||
| 1547 | Ga0495675_0009443 | |||
| 1548 | Ga0495675_0020165 | |||
| 1549 | Ga0495675_0050700 | |||
| 1550 | Ga0495675_0063331 | |||
| 1551 | Ga0495675_0366797 | |||
| 1552 | Ga0495684_0025680 | |||
| 1553 | Ga0495684_0038444 | |||
| 1554 | Ga0495684_0042288 | |||
| 1555 | Ga0495593_0002417 | |||
| 1556 | Ga0495593_0012570 | |||
| 1557 | Ga0495602_0000419 | |||
| 1558 | Ga0495602_0010581 | |||
| 1559 | Ga0495602_0021863 | |||
| 1560 | Ga0495602_0114740 | |||
| 1561 | Ga0495602_0331026 | |||
| 1562 | Ga0495602_0453934 | |||
| 1563 | Ga0495614_0051169 | |||
| 1564 | Ga0495615_0168422 | |||
| 1565 | Ga0496100_0021800 | |||
| 1566 | Ga0496101_0044335 | |||
| 1567 | Ga0496101_0465383 | |||
| 1568 | Ga0496101_0992869 | |||
| 1569 | Ga0496102_0060132 | |||
| 1570 | Ga0496102_0071570 | |||
| 1571 | Ga0496104_0001701 | |||
| 1572 | Ga0496104_0056756 | |||
| 1573 | Ga0496104_0151268 | |||
| 1574 | Ga0496104_0955147 | |||
| 1575 | Ga0496105_0007991 | |||
| 1576 | Ga0496105_0019792 | |||
| 1577 | Ga0496105_0119401 | |||
| 1578 | Ga0496106_0121329 | |||
| 1579 | Ga0496107_0269354 | |||
| 1580 | Ga0496108_0042939 | |||
| 1581 | Ga0496109_0035309 | |||
| 1582 | Ga0496110_0029218 | |||
| 1583 | Ga0496110_0032544 | |||
| 1584 | Ga0496110_0675081 | |||
| 1585 | Ga0496111_0008909 | |||
| 1586 | Ga0496112_0020605 | |||
| 1587 | Ga0496112_0622532 | |||
| 1588 | Ga0496113_0052089 | |||
| 1589 | Ga0496113_0113770 | |||
| 1590 | Ga0496114_0068638 | |||
| 1591 | Ga0496114_0720912 | |||
| 1592 | Ga0496115_0049228 | |||
| 1593 | Ga0496115_0244844 | |||
| 1594 | Ga0496115_0498392 | |||
| 1595 | Ga0496115_0536108 | |||
| 1596 | Ga0501306_043706 | |||
| 1597 | Ga0501308_008285 | |||
| 1598 | Ga0501309_035398 | |||
| 1599 | Ga0501309_052412 | |||
| 1600 | Ga0501310_026825 | |||
| 1601 | Ga0501310_045833 | |||
| 1602 | Ga0501305_028057 | |||
| 1603 | Ga0501305_036193 | |||
| 1604 | Ga0501307_014933 | |||
| 1605 | Ga0501311_019721 | |||
| 1606 | Ga0501312_023399 | |||
| 1607 | Ga0501312_028579 | |||
| 1608 | Ga0501313_002921 | |||
| 1609 | Ga0501313_037658 | |||
| 1610 | Ga0501314_001546 | |||
| 1611 | Ga0501315_011596 | |||
| 1612 | Ga0501315_023584 | |||
| 1613 | Ga0501316_018174 | |||
| 1614 | Ga0501317_022346 | |||
| 1615 | Ga0501317_023869 | |||
| 1616 | Ga0501317_059148 | |||
| 1617 | Ga0501318_008088 | |||
| 1618 | Ga0501318_049957 | |||
| 1619 | Ga0501319_007541 | |||
| 1620 | Ga0501320_017798 | |||
| 1621 | Ga0501320_024867 | |||
| 1622 | Ga0501321_017056 | |||
| 1623 | Ga0501321_025544 | |||
| 1624 | Ga0501321_046818 | |||
| 1625 | Ga0501322_005641 | |||
| 1626 | Ga0501323_035436 | |||
| 1627 | Ga0501324_011064 | |||
| 1628 | Ga0501333_006357 | |||
| 1629 | Ga0501334_05564 | |||
| 1630 | Ga0501340_015684 | |||
| 1631 | Ga0501031_0020283 | |||
| 1632 | Ga0501033_0266306 | |||
| 1633 | Ga0501037_0380735 | |||
| 1634 | Ga0501038_0117739 | |||
| 1635 | Ga0501040_0063342 | |||
| 1636 | Ga0501041_0184200 | |||
| 1637 | Ga0501042_0003453 | |||
| 1638 | Ga0501043_0223678 | |||
| 1639 | Ga0501047_0313907 | |||
| 1640 | Ga0501068_0271784 | |||
| 1641 | Ga0501074_0004369 | |||
| 1642 | Ga0501075_0164802 | |||
| 1643 | Ga0501076_0010607 | |||
| 1644 | Ga0501077_0318514 | |||
| 1645 | Ga0501081_0334129 | |||
| 1646 | Ga0501045_0004719 | |||
| 1647 | nmdc:mga0k408_301664_c1 | |||
| 1648 | nmdc:mga05p37_160474_c1 | |||
| 1649 | nmdc:mga05p37_324766_c1 | |||
| 1650 | nmdc:mga05p37_32652_c1 | |||
| 1651 | nmdc:mga05p37_3884_c1 | |||
| 1652 | nmdc:mga05p37_410916_c1 | |||
| 1653 | nmdc:mga05p37_732682_c1 | |||
| 1654 | nmdc:mga09592_131261_c1 | |||
| 1655 | nmdc:mga0qj67_394148_c1 | |||
| 1656 | nmdc:mga0qj67_42241_c1 | |||
| 1657 | nmdc:mga0qj67_443165_c1 | |||
| 1658 | nmdc:mga06r32_200650_c1 | |||
| 1659 | nmdc:mga08y16_226876_c1 | |||
| 1660 | nmdc:mga08y16_279650_c1 | |||
| 1661 | nmdc:mga08y16_453912_c1 | |||
| 1662 | nmdc:mga08y16_757348_c1 | |||
| 1663 | nmdc:mga0n895_23187_c1 | |||
| 1664 | nmdc:mga0n895_233827_c1 | |||
| 1665 | nmdc:mga0n895_255100_c1 | |||
| 1666 | nmdc:mga0n895_49031_c1 | |||
| 1667 | nmdc:mga0n895_691939_c1 | |||
| 1668 | nmdc:mga0n895_97557_c1 | |||
| 1669 | nmdc:mga0rr50_163953_c1 | |||
| 1670 | nmdc:mga0rr50_225145_c1 | |||
| 1671 | nmdc:mga0rr50_227075_c1 | |||
| 1672 | nmdc:mga0rr50_61698_c1 | |||
| 1673 | nmdc:mga0rr50_816596_c1 | |||
| 1674 | nmdc:mga08x19_21343_c1 | |||
| 1675 | nmdc:mga08x19_7627_c1 | |||
| 1676 | nmdc:mga0a205_11019_c1 | |||
| 1677 | nmdc:mga0a205_131902_c1 | |||
| 1678 | nmdc:mga0a205_73625_c1 | |||
| 1679 | nmdc:mga0a205_84835_c1 | |||
| 1680 | nmdc:mga0a205_9253_c1 | |||
| 1681 | Ga0495601_0034346 | |||
| 1682 | Ga0495601_0054957 | |||
| 1683 | Ga0495601_0640352 | |||
| 1684 | Ga0495612_0013749 | |||
| 1685 | Ga0495612_0043775 | |||
| 1686 | Ga0495612_0067760 | |||
| 1687 | Ga0495612_0114973 | |||
| 1688 | Ga0495612_0119716 | |||
| 1689 | Ga0495595_0001939 | |||
| 1690 | Ga0495595_0003589 | |||
| 1691 | Ga0495595_0020021 | |||
| 1692 | Ga0495595_0081902 | |||
| 1693 | Ga0495619_0016795 | |||
| 1694 | Ga0495619_0023324 | |||
| 1695 | Ga0495619_0047912 | |||
| 1696 | Ga0495619_0109009 | |||
| 1697 | Ga0501084_0046559 | |||
| 1698 | Ga0587101_038886 | |||
| 1699 | Ga0587128_041480 | |||
| 1700 | Ga0587079_087169 | |||
| 1701 | Ga0587114_051953 | |||
| 1702 | Ga0587119_010549 | |||
| 1703 | Ga0587119_042639 | |||
| 1704 | Ga0466962_0025481 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7bwl-assembly1.cif.gz_A | structure of antibiotic sequester from pseudomonas aerurinosa | 0.9289 | 15 | 184 |
| 1y0g-assembly2.cif.gz_D | crystal structure of the escherichia coli ycei protein, structural genomics | 0.9274 | 15 | 185 |
| 1wub-assembly1.cif.gz_A | crystal structure of the polyisoprenoid-binding protein, tt1927b, from thermus thermophilus hb8 | 0.9197 | 15 | 187 |
| 7bwl-assembly1.cif.gz_A | structure of antibiotic sequester from pseudomonas aerurinosa | 0.9181 | 15 | 184 |
| 1y0g-assembly2.cif.gz_D | crystal structure of the escherichia coli ycei protein, structural genomics | 0.9168 | 15 | 185 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FUS9_3_167_2.40.128.110 | Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like | 0.9436 | 18 | 180 | 2.40.128.110 |
| af_P0A8X2_23_191_2.40.128.110 | Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like | 0.934 | 15 | 185 | 2.40.128.110 |
| af_P0A8X2_23_191_2.40.128.110 | Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like | 0.9233 | 15 | 185 | 2.40.128.110 |
| 1wubA00 | Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like | 0.9197 | 15 | 187 | 2.40.128.110 |
| af_Q2FUS9_3_167_2.40.128.110 | Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like | 0.916 | 18 | 180 | 2.40.128.110 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7X0D6X4-F1-model_v4 | Polyisoprenoid-binding protein YceI | 0.9888 | 32 | 186 |
|
| AF-A0A172X1R7-F1-model_v4 | deleted | 0.9883 | 5 | 186 |
|
| AF-A0A7W1GQG4-F1-model_v4 | YceI family protein | 0.9867 | 19 | 185 |
|
| AF-A0A1R4G6Y4-F1-model_v4 | Protein yceI | 0.9863 | 6 | 184 |
|
| AF-A0A3N5FBD3-F1-model_v4 | Polyisoprenoid-binding protein | 0.9854 | 15 | 184 |
|