F483492

General Info

Members Datasets Scaffolds Average Seq Length
852 326 1704 188

Family's Representative Sequence

Representative Sequence 3300005467|Ga0070706_100005766|Ga0070706_1000057668
Length 208
Sequence MYNTQSLNTQTLCEQEDLMTATDAGTLTGIPGYVAGTWSIDPVHSEVGFAARHMVVAKVRGRFRTFSGQIVTGENPLDSSVTAEIDLSSIDTGNEQRDAHIRSADFFEVETYPTMTYRSTGVRQHRDGYVLDGKLTLKGVTRDVPLTLELNGFGPDPYGGTRAGFTATGEINRRDFGVNFAAVMETGGAVVSDKITIHLEIEAVLQQN

Samples

Sample ID Description Type Environment
1 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
40 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
41 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
42 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
45 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
46 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
81 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
85 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
86 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
87 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
88 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
90 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
91 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
121 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
123 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
124 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
125 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
126 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
127 3300030880 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
128 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
129 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
130 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
131 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
132 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
133 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
134 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
135 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
136 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
137 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
138 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
139 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
140 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
141 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
142 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
143 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
144 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
145 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
146 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
147 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
148 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
149 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
150 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
151 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
152 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
153 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
154 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
155 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
156 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
157 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
158 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
159 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
160 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
161 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
162 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
163 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
164 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
165 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
166 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
167 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
168 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
169 3300036458 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
170 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
172 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
173 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
174 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
175 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
176 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
177 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
178 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
179 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
180 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
181 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
182 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
183 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
184 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
185 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
186 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
187 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
188 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
189 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
190 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
191 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
192 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
193 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
194 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
195 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
196 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
197 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
198 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
199 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
200 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
201 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
202 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
203 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
204 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
205 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
206 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
207 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
208 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
209 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
210 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
211 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
212 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
213 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
214 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
215 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
216 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
217 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
218 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
219 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
220 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
221 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
222 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
223 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
224 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
225 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
226 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
227 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
228 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
229 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
230 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
231 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
232 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
233 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
234 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
235 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
236 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
237 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
238 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
239 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
240 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
241 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
242 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
243 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
244 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
245 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
246 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
247 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
248 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
249 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
250 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
251 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
252 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
253 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
254 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
255 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
256 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
257 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
258 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
259 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
260 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
261 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
262 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
263 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
264 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
265 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
266 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
267 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
268 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
269 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
270 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
271 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
272 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
273 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
274 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
275 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
276 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
277 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
278 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
279 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
280 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
281 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
282 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
283 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
284 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
285 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
286 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
287 3300049549 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
288 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
289 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
290 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
291 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
292 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
293 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
294 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
297 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
298 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
299 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
300 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
301 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
302 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
303 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
304 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
305 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
306 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
307 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
308 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
309 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
310 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
311 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
312 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
313 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
314 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
315 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
316 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
317 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
318 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
319 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
320 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
321 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
322 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
323 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
324 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
325 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
326 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.25
Metatranscriptomes 7.75
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.12
Nodule 0
Rhizoplane 3.64
Rhizosphere 94.95
Stem 0
Stem Tuber 0
Unclassified 1.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070706_100005766 3300005467 Bacteria 11763
2 JGI25407J50210_10002063 3300003373 Bacteria 4687
3 JGI25407J50210_10006527 3300003373 Bacteria 2908
4 JGI25407J50210_10021539 3300003373 Bacteria 1676
5 Ga0070690_100316732 3300005330 Bacteria 1123
6 Ga0070682_100847713 3300005337 Bacteria 746
7 Ga0068868_100221493 3300005338 Bacteria 1584
8 Ga0070691_10027052 3300005341 Bacteria 2675
9 Ga0070669_100855584 3300005353 Bacteria 775
10 Ga0070688_100197011 3300005365 Bacteria 1407
11 Ga0070709_10000604 3300005434 Bacteria 20935
12 Ga0070709_10004740 3300005434 Bacteria 7343
13 Ga0070709_10012599 3300005434 Bacteria 4735
14 Ga0070709_10091724 3300005434 Bacteria 2005
15 Ga0070709_10307707 3300005434 Bacteria 1159
16 Ga0070714_100001432 3300005435 Bacteria 17343
17 Ga0070714_100010107 3300005435 Bacteria 7449
18 Ga0070714_100048554 3300005435 Bacteria 3610
19 Ga0070714_100058629 3300005435 Bacteria 3299
20 Ga0070714_100075355 3300005435 Bacteria 2927
21 Ga0070714_100087900 3300005435 Bacteria 2718
22 Ga0070714_100089002 3300005435 Bacteria 2702
23 Ga0070714_100090409 3300005435 Bacteria 2681
24 Ga0070714_100094978 3300005435 Bacteria 2617
25 Ga0070714_100140205 3300005435 Bacteria 2169
26 Ga0070714_100446649 3300005435 Bacteria 1228
27 Ga0070714_100579041 3300005435 Bacteria 1077
28 Ga0070714_100583210 3300005435 Bacteria 1073
29 Ga0070714_101121627 3300005435 Bacteria 767
30 Ga0070713_100001304 3300005436 Bacteria 15955
31 Ga0070713_100010956 3300005436 Bacteria 6575
32 Ga0070713_100032833 3300005436 Bacteria 4151
33 Ga0070713_100050629 3300005436 Bacteria 3432
34 Ga0070713_100103271 3300005436 Bacteria 2473
35 Ga0070713_100107186 3300005436 Bacteria 2430
36 Ga0070713_100157734 3300005436 Bacteria 2024
37 Ga0070713_100172590 3300005436 Bacteria 1938
38 Ga0070713_100279352 3300005436 Bacteria 1531
39 Ga0070713_101029183 3300005436 Bacteria 795
40 Ga0070710_10001226 3300005437 Bacteria 12155
41 Ga0070710_10016179 3300005437 Bacteria 3790
42 Ga0070710_10018821 3300005437 Bacteria 3559
43 Ga0070710_10024996 3300005437 Bacteria 3157
44 Ga0070710_10110016 3300005437 Bacteria 1654
45 Ga0070710_10153050 3300005437 Bacteria 1424
46 Ga0070710_10334413 3300005437 Bacteria 998
47 Ga0070711_100001594 3300005439 Bacteria 12501
48 Ga0070711_100025723 3300005439 Bacteria 3853
49 Ga0070711_100058730 3300005439 Bacteria 2668
50 Ga0070711_100125133 3300005439 Bacteria 1907
51 Ga0070711_100131796 3300005439 Bacteria 1862
52 Ga0070711_100185912 3300005439 Bacteria 1593
53 Ga0070711_100232292 3300005439 Bacteria 1438
54 Ga0070711_100267426 3300005439 Bacteria 1348
55 Ga0070705_100124497 3300005440 Bacteria 1670
56 Ga0070705_100233155 3300005440 Bacteria 1282
57 Ga0070694_100551079 3300005444 Bacteria 923
58 Ga0070694_100614970 3300005444 Bacteria 876
59 Ga0070708_100003157 3300005445 Bacteria 12842
60 Ga0070708_100014838 3300005445 Bacteria 6421
61 Ga0070708_100082938 3300005445 Bacteria 2905
62 Ga0070708_100463815 3300005445 Bacteria 1195
63 Ga0070662_100063964 3300005457 Bacteria 2692
64 Ga0070681_11234499 3300005458 Bacteria 670
65 Ga0070706_100004585 3300005467 Bacteria 13269
66 Ga0070706_100005982 3300005467 Bacteria 11504
67 Ga0070706_100020154 3300005467 Bacteria 6145
68 Ga0070706_100038174 3300005467 Bacteria 4434
69 Ga0070706_100038414 3300005467 Bacteria 4418
70 Ga0070706_100040600 3300005467 Bacteria 4295
71 Ga0070706_100074804 3300005467 Bacteria 3135
72 Ga0070706_100098440 3300005467 Bacteria 2718
73 Ga0070706_100119969 3300005467 Bacteria 2451
74 Ga0070706_100172044 3300005467 Bacteria 2022
75 Ga0070706_100307882 3300005467 Bacteria 1478
76 Ga0070707_100003226 3300005468 Bacteria 15444
77 Ga0070707_100010507 3300005468 Bacteria 8625
78 Ga0070707_100024904 3300005468 Bacteria 5672
79 Ga0070707_100026432 3300005468 Bacteria 5510
80 Ga0070707_100039234 3300005468 Bacteria 4526
81 Ga0070707_100077825 3300005468 Bacteria 3200
82 Ga0070707_100085038 3300005468 Bacteria 3057
83 Ga0070707_100102432 3300005468 Bacteria 2774
84 Ga0070707_100112260 3300005468 Bacteria 2643
85 Ga0070707_100343838 3300005468 Bacteria 1449
86 Ga0070707_101126988 3300005468 Bacteria 750
87 Ga0070698_100000028 3300005471 Bacteria 98040
88 Ga0070698_100002154 3300005471 Bacteria 21853
89 Ga0070698_100004320 3300005471 Bacteria 15623
90 Ga0070698_100004476 3300005471 Bacteria 15361
91 Ga0070698_100008436 3300005471 Bacteria 11137
92 Ga0070698_100009159 3300005471 Bacteria 10626
93 Ga0070698_100014786 3300005471 Bacteria 8249
94 Ga0070698_100017593 3300005471 Bacteria 7533
95 Ga0070698_100026422 3300005471 Bacteria 6043
96 Ga0070699_100011832 3300005518 Bacteria 7530
97 Ga0070699_100107379 3300005518 Bacteria 2449
98 Ga0070699_100179726 3300005518 Bacteria 1877
99 Ga0070679_100935873 3300005530 Bacteria 810
100 Ga0070684_100082135 3300005535 Bacteria 2852
101 Ga0070697_100047964 3300005536 Bacteria 3463
102 Ga0070697_100076608 3300005536 Bacteria 2750
103 Ga0070697_100230745 3300005536 Bacteria 1579
104 Ga0070695_100207424 3300005545 Bacteria 1404
105 Ga0070695_100242819 3300005545 Bacteria 1307
106 Ga0070696_100083203 3300005546 Bacteria 2269
107 Ga0070693_100039735 3300005547 Bacteria 2637
108 Ga0070665_100499811 3300005548 Bacteria 1227
109 Ga0070665_100655168 3300005548 Bacteria 1063
110 Ga0068855_100400171 3300005563 Bacteria 1505
111 Ga0070664_100408824 3300005564 Bacteria 1242
112 Ga0068854_100291091 3300005578 Bacteria 1318
113 Ga0068856_100027245 3300005614 Bacteria 5576
114 Ga0068856_100034946 3300005614 Bacteria 4925
115 Ga0068856_100166097 3300005614 Bacteria 2218
116 Ga0068856_100330069 3300005614 Bacteria 1543
117 Ga0068856_100489717 3300005614 Bacteria 1250
118 Ga0070702_100378202 3300005615 Bacteria 1006
119 Ga0068864_100332868 3300005618 Bacteria 1429
120 Ga0068861_100026540 3300005719 Bacteria 4211
121 Ga0068861_100222762 3300005719 Bacteria 1595
122 Ga0068863_100138743 3300005841 Bacteria 2323
123 Ga0068863_100358050 3300005841 Bacteria 1422
124 Ga0068858_100059284 3300005842 Bacteria 3538
125 Ga0068862_101004186 3300005844 Bacteria 825
126 Ga0081455_10000070 3300005937 Bacteria 110926
127 Ga0081455_10013067 3300005937 Bacteria 8229
128 Ga0081538_10003880 3300005981 Bacteria 13961
129 Ga0081538_10006034 3300005981 Bacteria 10768
130 Ga0081538_10007721 3300005981 Bacteria 9266
131 Ga0081538_10011876 3300005981 Bacteria 7031
132 Ga0081538_10012928 3300005981 Bacteria 6652
133 Ga0081538_10016498 3300005981 Bacteria 5658
134 Ga0081538_10048751 3300005981 Bacteria 2579
135 Ga0081538_10049744 3300005981 Bacteria 2540
136 Ga0081538_10098699 3300005981 Bacteria 1479
137 Ga0081540_1000808 3300005983 Bacteria 28767
138 Ga0081540_1064384 3300005983 Bacteria 1730
139 Ga0081539_10001909 3300005985 Bacteria 32287
140 Ga0070717_10000705 3300006028 Bacteria 21631
141 Ga0070717_10008702 3300006028 Bacteria 7593
142 Ga0070717_10012172 3300006028 Bacteria 6559
143 Ga0070717_10028616 3300006028 Bacteria 4462
144 Ga0070717_10034956 3300006028 Bacteria 4065
145 Ga0070717_10037356 3300006028 Bacteria 3943
146 Ga0070717_10066008 3300006028 Bacteria 3009
147 Ga0070717_10103512 3300006028 Bacteria 2420
148 Ga0070717_10122246 3300006028 Bacteria 2231
149 Ga0070717_10156429 3300006028 Bacteria 1975
150 Ga0070717_10191190 3300006028 Unclassified 1789
151 Ga0070717_10253420 3300006028 Bacteria 1555
152 Ga0070717_10280562 3300006028 Bacteria 1477
153 Ga0070717_10566968 3300006028 Bacteria 1029
154 Ga0070717_10863054 3300006028 Bacteria 824
155 Ga0075432_10123509 3300006058 Bacteria 974
156 Ga0070715_10002144 3300006163 Bacteria 5977
157 Ga0070715_10004360 3300006163 Bacteria 4632
158 Ga0070715_10046495 3300006163 Bacteria 1845
159 Ga0070715_10079548 3300006163 Bacteria 1484
160 Ga0070715_10153615 3300006163 Bacteria 1130
161 Ga0070715_10268087 3300006163 Bacteria 900
162 Ga0070716_100000290 3300006173 Bacteria 20289
163 Ga0070716_100000969 3300006173 Bacteria 12463
164 Ga0070716_100004287 3300006173 Bacteria 6794
165 Ga0070716_100037736 3300006173 Bacteria 2671
166 Ga0070716_100063412 3300006173 Bacteria 2145
167 Ga0070712_100003115 3300006175 Bacteria 10231
168 Ga0070712_100003133 3300006175 Bacteria 10193
169 Ga0070712_100315380 3300006175 Bacteria 1270
170 Ga0070712_100345844 3300006175 Bacteria 1216
171 Ga0070712_100392543 3300006175 Bacteria 1144
172 Ga0070712_100628789 3300006175 Bacteria 911
173 Ga0070712_100946264 3300006175 Bacteria 744
174 Ga0075428_100035383 3300006844 Bacteria 5505
175 Ga0075428_100245979 3300006844 Bacteria 1928
176 Ga0075428_100900274 3300006844 Bacteria 938
177 Ga0075428_101332387 3300006844 Bacteria 754
178 Ga0075430_100017260 3300006846 Bacteria 6148
179 Ga0075431_100484235 3300006847 Bacteria 1230
180 Ga0075433_10009794 3300006852 Bacteria 7678
181 Ga0075433_10082152 3300006852 Bacteria 2841
182 Ga0075433_10235954 3300006852 Bacteria 1624
183 Ga0075433_10284919 3300006852 Bacteria 1463
184 Ga0075434_100005930 3300006871 Bacteria 11184
185 Ga0075434_100052605 3300006871 Bacteria 4046
186 Ga0075434_100084213 3300006871 Bacteria 3178
187 Ga0075434_100118566 3300006871 Bacteria 2660
188 Ga0075434_100320497 3300006871 Bacteria 1570
189 Ga0075429_100138410 3300006880 Bacteria 2131
190 Ga0075429_100305323 3300006880 Bacteria 1393
191 Ga0075429_100535307 3300006880 Bacteria 1027
192 Ga0075436_100005367 3300006914 Bacteria 8824
193 Ga0075436_100259946 3300006914 Bacteria 1238
194 Ga0075436_100314370 3300006914 Bacteria 1124
195 Ga0075435_100009622 3300007076 Bacteria 7016
196 Ga0075435_100019512 3300007076 Bacteria 5181
197 Ga0075435_100183728 3300007076 Bacteria 1768
198 Ga0075435_100450679 3300007076 Bacteria 1109
199 Ga0075435_100654929 3300007076 Bacteria 912
200 Ga0111539_10033094 3300009094 Bacteria 6276
201 Ga0111539_10070191 3300009094 Bacteria 4135
202 Ga0111539_10137331 3300009094 Bacteria 2863
203 Ga0111539_10145250 3300009094 Bacteria 2777
204 Ga0105245_10018238 3300009098 Bacteria 6136
205 Ga0105245_10769375 3300009098 Bacteria 1000
206 Ga0105247_10044871 3300009101 Bacteria 2712
207 Ga0105247_10117174 3300009101 Bacteria 1721
208 Ga0114129_10001806 3300009147 Bacteria 29163
209 Ga0114129_10083953 3300009147 Bacteria 4422
210 Ga0114129_10686301 3300009147 Bacteria 1318
211 Ga0114129_10824811 3300009147 Bacteria 1181
212 Ga0114129_11106077 3300009147 Bacteria 992
213 Ga0105241_10132241 3300009174 Bacteria 2022
214 Ga0105248_10035656 3300009177 Bacteria 5565
215 Ga0105249_10031124 3300009553 Bacteria 4823
216 Ga0099796_10049711 3300010159 Bacteria 1451
217 Ga0105239_10406683 3300010375 Bacteria 1541
218 Ga0105239_10438556 3300010375 Bacteria 1481
219 Ga0105239_10579072 3300010375 Bacteria 1279
220 Ga0105239_11032448 3300010375 Bacteria 946
221 Ga0105246_10245292 3300011119 Bacteria 1418
222 Ga0157370_10066648 3300013104 Bacteria 3404
223 Ga0157369_10079993 3300013105 Bacteria 3500
224 Ga0157369_11105518 3300013105 Bacteria 810
225 Ga0157374_10093628 3300013296 Bacteria 2869
226 Ga0157378_10165730 3300013297 Bacteria 2070
227 Ga0163162_10115326 3300013306 Bacteria 2786
228 Ga0163162_10242440 3300013306 Bacteria 1934
229 Ga0157372_10127391 3300013307 Bacteria 2927
230 Ga0157372_10279830 3300013307 Bacteria 1940
231 Ga0157372_10596515 3300013307 Bacteria 1287
232 Ga0157375_10022078 3300013308 Bacteria 5853
233 Ga0163163_10017671 3300014325 Bacteria 6658
234 Ga0157379_10004985 3300014968 Bacteria 11394
235 Ga0157376_10242068 3300014969 Bacteria 1681
236 Ga0163161_10078643 3300017792 Bacteria 2424
237 Ga0163161_10543693 3300017792 Bacteria 951
238 Ga0197907_10530067 3300020069 Bacteria 1236
239 Ga0197907_11059048 3300020069 Bacteria 727
240 Ga0197907_11238878 3300020069 Bacteria 1845
241 Ga0206356_11227511 3300020070 Bacteria 1225
242 Ga0206349_1388505 3300020075 Bacteria 661
243 Ga0206349_1541577 3300020075 Bacteria 638
244 Ga0206349_1884858 3300020075 Bacteria 1245
245 Ga0206355_1035705 3300020076 Bacteria 1170
246 Ga0206355_1091329 3300020076 Bacteria 1368
247 Ga0206355_1699087 3300020076 Bacteria 2138
248 Ga0206351_10721053 3300020077 Bacteria 1249
249 Ga0206350_10217589 3300020080 Bacteria 616
250 Ga0206350_10340345 3300020080 Bacteria 1247
251 Ga0206354_11655940 3300020081 Bacteria 663
252 Ga0154015_1356672 3300020610 Bacteria 1064
253 Ga0213873_10000154 3300021358 Bacteria 13161
254 Ga0213876_10264912 3300021384 Bacteria 913
255 Ga0213875_10000453 3300021388 Bacteria 35468
256 Ga0213875_10027769 3300021388 Bacteria 2693
257 Ga0213875_10357734 3300021388 Bacteria 694
258 Ga0224712_10008546 3300022467 Bacteria 3041
259 Ga0224712_10052531 3300022467 Bacteria 1592
260 Ga0224712_10430300 3300022467 Bacteria 632
261 Ga0224712_10481637 3300022467 Bacteria 598
262 Ga0224572_1002018 3300024225 Bacteria 3184
263 Ga0228598_1035959 3300024227 Bacteria 976
264 Ga0207692_10000993 3300025898 Bacteria 10358
265 Ga0207692_10002662 3300025898 Bacteria 6874
266 Ga0207692_10002729 3300025898 Bacteria 6814
267 Ga0207692_10006476 3300025898 Bacteria 4748
268 Ga0207692_10019350 3300025898 Bacteria 3075
269 Ga0207692_10130803 3300025898 Bacteria 1417
270 Ga0207692_10148538 3300025898 Bacteria 1340
271 Ga0207692_10260727 3300025898 Bacteria 1042
272 Ga0207710_10298197 3300025900 Bacteria 814
273 Ga0207647_10227282 3300025904 Bacteria 1074
274 Ga0207685_10000642 3300025905 Bacteria 6175
275 Ga0207685_10002737 3300025905 Bacteria 4114
276 Ga0207685_10220832 3300025905 Bacteria 901
277 Ga0207699_10000384 3300025906 Bacteria 23251
278 Ga0207699_10001474 3300025906 Bacteria 11170
279 Ga0207699_10008057 3300025906 Bacteria 5179
280 Ga0207699_10009676 3300025906 Bacteria 4810
281 Ga0207699_10010456 3300025906 Bacteria 4658
282 Ga0207699_10204548 3300025906 Bacteria 1340
283 Ga0207699_10351431 3300025906 Bacteria 1041
284 Ga0207684_10000506 3300025910 Bacteria 48735
285 Ga0207684_10001501 3300025910 Bacteria 24994
286 Ga0207684_10002941 3300025910 Bacteria 16864
287 Ga0207684_10005160 3300025910 Bacteria 12158
288 Ga0207684_10019358 3300025910 Bacteria 5825
289 Ga0207684_10028810 3300025910 Bacteria 4730
290 Ga0207684_10072054 3300025910 Bacteria 2935
291 Ga0207684_10080815 3300025910 Bacteria 2766
292 Ga0207684_10095844 3300025910 Bacteria 2532
293 Ga0207684_10155534 3300025910 Bacteria 1968
294 Ga0207684_10187739 3300025910 Bacteria 1782
295 Ga0207654_10447061 3300025911 Bacteria 906
296 Ga0207671_10823399 3300025914 Bacteria 736
297 Ga0207693_10007215 3300025915 Bacteria 9148
298 Ga0207693_10051475 3300025915 Bacteria 3231
299 Ga0207693_10674910 3300025915 Bacteria 802
300 Ga0207663_10004564 3300025916 Bacteria 6904
301 Ga0207663_10006491 3300025916 Bacteria 5989
302 Ga0207663_10006959 3300025916 Bacteria 5830
303 Ga0207663_10040878 3300025916 Bacteria 2822
304 Ga0207663_10092353 3300025916 Bacteria 2012
305 Ga0207663_10097314 3300025916 Bacteria 1968
306 Ga0207663_10120270 3300025916 Bacteria 1797
307 Ga0207663_10270588 3300025916 Bacteria 1258
308 Ga0207663_10593040 3300025916 Bacteria 870
309 Ga0207660_10475672 3300025917 Bacteria 1012
310 Ga0207646_10000253 3300025922 Bacteria 72559
311 Ga0207646_10001795 3300025922 Bacteria 25949
312 Ga0207646_10004352 3300025922 Bacteria 15432
313 Ga0207646_10017683 3300025922 Bacteria 6663
314 Ga0207646_10022370 3300025922 Bacteria 5826
315 Ga0207646_10049506 3300025922 Bacteria 3763
316 Ga0207646_10074220 3300025922 Bacteria 3038
317 Ga0207646_10083370 3300025922 Bacteria 2860
318 Ga0207646_10262233 3300025922 Bacteria 1561
319 Ga0207646_10288204 3300025922 Bacteria 1484
320 Ga0207646_10317556 3300025922 Bacteria 1408
321 Ga0207646_10913133 3300025922 Bacteria 779
322 Ga0207681_10877021 3300025923 Bacteria 751
323 Ga0207687_10135705 3300025927 Bacteria 1861
324 Ga0207687_10324470 3300025927 Bacteria 1247
325 Ga0207700_10001332 3300025928 Bacteria 14001
326 Ga0207700_10002045 3300025928 Bacteria 11544
327 Ga0207700_10004412 3300025928 Bacteria 8293
328 Ga0207700_10029337 3300025928 Bacteria 3880
329 Ga0207700_10053007 3300025928 Bacteria 3036
330 Ga0207700_10096325 3300025928 Bacteria 2349
331 Ga0207700_10153461 3300025928 Bacteria 1905
332 Ga0207700_10259945 3300025928 Bacteria 1486
333 Ga0207700_10365592 3300025928 Bacteria 1259
334 Ga0207700_10623969 3300025928 Bacteria 960
335 Ga0207700_10972665 3300025928 Bacteria 760
336 Ga0207664_10005699 3300025929 Bacteria 8511
337 Ga0207664_10006841 3300025929 Bacteria 7880
338 Ga0207664_10007708 3300025929 Bacteria 7471
339 Ga0207664_10013730 3300025929 Bacteria 5825
340 Ga0207664_10031224 3300025929 Bacteria 4074
341 Ga0207664_10053645 3300025929 Bacteria 3192
342 Ga0207664_10072926 3300025929 Bacteria 2769
343 Ga0207664_10122632 3300025929 Bacteria 2177
344 Ga0207664_10148272 3300025929 Bacteria 1991
345 Ga0207664_10335038 3300025929 Bacteria 1337
346 Ga0207664_10342324 3300025929 Bacteria 1322
347 Ga0207664_10365387 3300025929 Bacteria 1279
348 Ga0207664_10510476 3300025929 Bacteria 1077
349 Ga0207664_10611267 3300025929 Bacteria 979
350 Ga0207664_10797630 3300025929 Bacteria 849
351 Ga0207706_10061434 3300025933 Bacteria 3309
352 Ga0207665_10000804 3300025939 Bacteria 21249
353 Ga0207665_10001312 3300025939 Bacteria 16758
354 Ga0207665_10002268 3300025939 Bacteria 12977
355 Ga0207665_10007286 3300025939 Bacteria 7318
356 Ga0207665_10039793 3300025939 Bacteria 3135
357 Ga0207711_10035694 3300025941 Bacteria 4216
358 Ga0207667_10377033 3300025949 Bacteria 1445
359 Ga0207712_10550168 3300025961 Bacteria 993
360 Ga0207712_10678507 3300025961 Bacteria 898
361 Ga0207640_10240854 3300025981 Bacteria 1398
362 Ga0207677_10163514 3300026023 Bacteria 1732
363 Ga0207677_11242593 3300026023 Bacteria 683
364 Ga0207703_10041980 3300026035 Bacteria 3667
365 Ga0207708_10000044 3300026075 Bacteria 120765
366 Ga0207702_10018736 3300026078 Bacteria 5726
367 Ga0207702_10063093 3300026078 Bacteria 3168
368 Ga0207702_10357770 3300026078 Bacteria 1398
369 Ga0207702_10888556 3300026078 Bacteria 883
370 Ga0207641_10060746 3300026088 Bacteria 3222
371 Ga0207641_10149440 3300026088 Bacteria 2115
372 Ga0207674_10112578 3300026116 Bacteria 2695
373 Ga0207675_100097618 3300026118 Bacteria 2767
374 Ga0207428_10029562 3300027907 Bacteria 4540
375 Ga0268266_10159038 3300028379 Bacteria 2043
376 Ga0265336_10002104 3300028666 Bacteria 8454
377 Ga0265336_10023213 3300028666 Bacteria 1970
378 Ga0265338_10000966 3300028800 Bacteria 48429
379 Ga0265338_10002944 3300028800 Bacteria 24701
380 Ga0265338_10102989 3300028800 Bacteria 2320
381 Ga0265338_10128139 3300028800 Bacteria 2010
382 Ga0316178_1001611 3300030735 Bacteria 735
383 Ga0265762_1029750 3300030760 Bacteria 1034
384 Ga0265766_1013204 3300030863 Bacteria 618
385 Ga0265776_106205 3300030880 Bacteria 642
386 Ga0265760_10027645 3300031090 Bacteria 1663
387 Ga0265760_10141670 3300031090 Bacteria 783
388 Ga0265325_10055484 3300031241 Bacteria 2025
389 Ga0265340_10014578 3300031247 Bacteria 4101
390 Ga0265339_10074003 3300031249 Bacteria 1811
391 Ga0265316_10128468 3300031344 Bacteria 1910
392 Ga0265313_10130904 3300031595 Bacteria 1087
393 Ga0307410_10175339 3300031852 Bacteria 1619
394 Ga0307410_10196992 3300031852 Bacteria 1536
395 Ga0307406_10752973 3300031901 Bacteria 818
396 Ga0307407_10098643 3300031903 Bacteria 1808
397 Ga0307407_10187309 3300031903 Bacteria 1376
398 Ga0307407_10733809 3300031903 Bacteria 747
399 Ga0307409_100052676 3300031995 Bacteria 3122
400 Ga0307409_100116986 3300031995 Bacteria 2248
401 Ga0307409_100257557 3300031995 Bacteria 1599
402 Ga0307409_100380934 3300031995 Bacteria 1341
403 Ga0307416_100060630 3300032002 Bacteria 3082
404 Ga0307416_100161748 3300032002 Bacteria 2070
405 Ga0307416_100709173 3300032002 Bacteria 1096
406 Ga0307414_10504542 3300032004 Bacteria 1071
407 Ga0307415_100005975 3300032126 Bacteria 6521
408 Ga0307415_100025403 3300032126 Bacteria 3716
409 Ga0307415_100047887 3300032126 Bacteria 2880
410 Ga0307415_100054722 3300032126 Bacteria 2726
411 Ga0307415_100981856 3300032126 Bacteria 784
412 Ga0307510_10521745 3300033180 Bacteria 632
413 Ga0373948_0010140 3300034817 Bacteria 1639
414 Ga0373950_0004752 3300034818 Bacteria 2000
415 Ga0373959_0041849 3300034820 Bacteria 964
416 Ga0373934_0007401 3300035086 Bacteria 4076
417 Ga0373934_0011720 3300035086 Bacteria 3301
418 Ga0373949_0034634 3300035090 Bacteria 1218
419 Ga0373951_0032926 3300035091 Bacteria 1227
420 Ga0373952_0020300 3300035092 Bacteria 1391
421 Ga0373923_0019707 3300035111 Bacteria 2614
422 Ga0373923_0024852 3300035111 Bacteria 2368
423 Ga0373923_0030953 3300035111 Bacteria 2154
424 Ga0373923_0035542 3300035111 Bacteria 2029
425 Ga0373936_0000776 3300035113 Bacteria 11259
426 Ga0373936_0225728 3300035113 Bacteria 832
427 Ga0373941_0155676 3300035115 Bacteria 841
428 Ga0373945_0193107 3300035116 Bacteria 842
429 Ga0373953_0000633 3300035117 Bacteria 9756
430 Ga0373953_0004067 3300035117 Bacteria 4624
431 Ga0373953_0005368 3300035117 Bacteria 4153
432 Ga0373954_0001328 3300035118 Bacteria 9987
433 Ga0373954_0015306 3300035118 Bacteria 3428
434 Ga0373956_0002275 3300035119 Bacteria 7907
435 Ga0373956_0017570 3300035119 Bacteria 3017
436 Ga0373956_0068803 3300035119 Bacteria 1613
437 Ga0373957_0000105 3300035120 Bacteria 20463
438 Ga0373957_0005099 3300035120 Bacteria 4052
439 Ga0373957_0018046 3300035120 Bacteria 2465
440 Ga0373957_0020283 3300035120 Bacteria 2347
441 Ga0373943_0194963 3300035170 Bacteria 1119
442 Ga0373943_0203535 3300035170 Bacteria 1096
443 Ga0373943_0320160 3300035170 Bacteria 884
444 Ga0373946_0060758 3300035171 Bacteria 1607
445 Ga0373946_0197428 3300035171 Bacteria 962
446 Ga0373946_0385789 3300035171 Bacteria 705
447 Ga0373955_0000005 3300035172 Bacteria 108267
448 Ga0373955_0068163 3300035172 Bacteria 1982
449 Ga0373942_0008585 3300035207 Bacteria 2384
450 Ga0373961_0075606 3300035241 Bacteria 1050
451 Ga0373924_0001034 3300035410 Bacteria 8851
452 Ga0373924_0012430 3300035410 Bacteria 3180
453 Ga0373924_0078247 3300035410 Bacteria 1403
454 Ga0373931_0013251 3300035691 Bacteria 4012
455 Ga0373931_0062277 3300035691 Bacteria 2014
456 Ga0373935_0004473 3300035692 Bacteria 8209
457 Ga0373935_0040866 3300035692 Bacteria 2912
458 Ga0373935_0133635 3300035692 Bacteria 1669
459 Ga0373935_0214113 3300035692 Bacteria 1336
460 Ga0373935_0344443 3300035692 Bacteria 1061
461 Ga0373935_0670830 3300035692 Bacteria 761
462 Ga0373927_0168576 3300035695 Bacteria 1435
463 Ga0373933_0000043 3300035724 Bacteria 78147
464 Ga0373933_0004400 3300035724 Bacteria 7734
465 Ga0373933_0005196 3300035724 Bacteria 7102
466 Ga0373933_0009228 3300035724 Bacteria 5387
467 Ga0373947_0155585 3300035725 Bacteria 1475
468 Ga0373947_0257092 3300035725 Bacteria 1156
469 Ga0373937_0000951 3300036401 Bacteria 24624
470 Ga0373937_0091646 3300036401 Bacteria 2816
471 Ga0373937_0137630 3300036401 Bacteria 2283
472 Ga0373937_0226876 3300036401 Bacteria 1758
473 Ga0373937_0365079 3300036401 Bacteria 1368
474 Ga0373937_0434962 3300036401 Bacteria 1245
475 Ga0310112_037093 3300036458 Bacteria 664
476 Ga0373925_0055868 3300037068 Bacteria 2956
477 Ga0373925_0068229 3300037068 Bacteria 2684
478 Ga0373925_0097522 3300037068 Bacteria 2254
479 Ga0373925_0119170 3300037068 Bacteria 2047
480 Ga0373925_0168813 3300037068 Bacteria 1726
481 Ga0373925_0502410 3300037068 Bacteria 995
482 Ga0395899_0291984 3300037312 Bacteria 1106
483 Ga0395900_0015425 3300037418 Bacteria 7789
484 Ga0395900_0328819 3300037418 Bacteria 1507
485 Ga0395898_0018695 3300037466 Bacteria 7065
486 Ga0395898_0681283 3300037466 Bacteria 970
487 Ga0395898_0836442 3300037466 Bacteria 860
488 Ga0395905_0117655 3300037471 Bacteria 2497
489 Ga0436364_0431777 3300037853 Bacteria 22382
490 Ga0436364_1160943 3300037853 Unclassified 1077
491 Ga0436364_1206720 3300037853 Bacteria 3323
492 Ga0395901_0003924 3300038443 Bacteria 14959
493 Ga0395901_0081417 3300038443 Bacteria 3382
494 Ga0395901_0419170 3300038443 Unclassified 1373
495 Ga0436365_0529014 3300039437 Bacteria 5151
496 Ga0436363_0731983 3300039450 Unclassified 1039
497 Ga0436362_1289131 3300039453 Bacteria 14337
498 Ga0439448_0086729 3300042005 Bacteria 1055
499 Ga0439450_026072 3300042008 Bacteria 1286
500 Ga0439451_054867 3300042009 Bacteria 798
501 Ga0439454_024067 3300042011 Bacteria 918
502 Ga0439455_0129471 3300042012 Bacteria 711
503 Ga0439456_073553 3300042013 Bacteria 759
504 Ga0439463_077625 3300042016 Bacteria 853
505 Ga0439460_0082928 3300042461 Bacteria 1008
506 Ga0439440_0008607 3300042993 Bacteria 2099
507 Ga0466969_0034109 3300044656 Bacteria 2579
508 Ga0466969_0124266 3300044656 Bacteria 1199
509 Ga0466972_0003105 3300044658 Bacteria 8240
510 Ga0466966_0158205 3300044684 Bacteria 1380
511 Ga0466966_0172832 3300044684 Bacteria 1312
512 Ga0466961_0065229 3300044693 Bacteria 2314
513 Ga0466961_0107908 3300044693 Bacteria 1752
514 Ga0466963_0139989 3300044694 Bacteria 1676
515 Ga0466963_0282319 3300044694 Bacteria 1167
516 Ga0466971_0082601 3300044719 Bacteria 1466
517 Ga0466971_0088643 3300044719 Bacteria 1415
518 Ga0466970_0025651 3300044765 Bacteria 3087
519 Ga0466970_0084836 3300044765 Bacteria 1715
520 Ga0466957_0200621 3300044842 Bacteria 1310
521 Ga0466958_0008482 3300045836 Bacteria 5705
522 Ga0495592_0000092 3300046454 Bacteria 79147
523 Ga0495592_0022414 3300046454 Bacteria 4805
524 Ga0495592_0071795 3300046454 Bacteria 2519
525 Ga0495592_0076386 3300046454 Bacteria 2430
526 Ga0495592_0106217 3300046454 Bacteria 1993
527 Ga0495603_0118767 3300046455 Bacteria 1541
528 Ga0495629_0003314 3300046459 Bacteria 12168
529 Ga0495629_0003661 3300046459 Bacteria 11620
530 Ga0495629_0025285 3300046459 Bacteria 4222
531 Ga0495629_0576292 3300046459 Bacteria 754
532 Ga0495641_0008076 3300046461 Bacteria 6470
533 Ga0495641_0014110 3300046461 Bacteria 4340
534 Ga0495651_0000066 3300046462 Bacteria 77538
535 Ga0495651_0006931 3300046462 Bacteria 8663
536 Ga0495651_0011774 3300046462 Bacteria 6722
537 Ga0495651_0033166 3300046462 Bacteria 4027
538 Ga0495651_0086916 3300046462 Bacteria 2351
539 Ga0495653_0004729 3300046463 Bacteria 11024
540 Ga0495653_0018365 3300046463 Bacteria 5680
541 Ga0495653_0033826 3300046463 Bacteria 4047
542 Ga0495653_0035799 3300046463 Bacteria 3915
543 Ga0495653_0044544 3300046463 Bacteria 3443
544 Ga0495653_0306726 3300046463 Bacteria 1033
545 Ga0495580_0039310 3300046472 Bacteria 3384
546 Ga0495580_0567492 3300046472 Bacteria 752
547 Ga0495582_0004853 3300046473 Bacteria 7543
548 Ga0495582_0017308 3300046473 Bacteria 3944
549 Ga0495582_0034908 3300046473 Bacteria 2764
550 Ga0495605_0292211 3300046474 Bacteria 691
551 Ga0495639_0182393 3300046475 Bacteria 1022
552 Ga0495662_0014032 3300046476 Bacteria 3900
553 Ga0495662_0136704 3300046476 Bacteria 1205
554 Ga0495664_0018432 3300046477 Bacteria 3999
555 Ga0495664_0030915 3300046477 Bacteria 3137
556 Ga0495664_0074201 3300046477 Bacteria 2035
557 Ga0495608_0000070 3300046511 Bacteria 77533
558 Ga0495608_0022587 3300046511 Bacteria 4314
559 Ga0495608_0024087 3300046511 Bacteria 4165
560 Ga0495608_0041140 3300046511 Bacteria 3094
561 Ga0495608_0055683 3300046511 Bacteria 2613
562 Ga0495618_0065186 3300046514 Bacteria 2315
563 Ga0495618_0077752 3300046514 Bacteria 2114
564 Ga0495618_0081384 3300046514 Bacteria 2067
565 Ga0495628_0000829 3300046516 Bacteria 28672
566 Ga0495628_0026167 3300046516 Bacteria 4762
567 Ga0495628_0037057 3300046516 Bacteria 3910
568 Ga0495628_0081973 3300046516 Bacteria 2505
569 Ga0495628_0094225 3300046516 Bacteria 2315
570 Ga0495628_0129988 3300046516 Bacteria 1927
571 Ga0495628_0363557 3300046516 Bacteria 1062
572 Ga0495628_0582697 3300046516 Bacteria 800
573 Ga0495630_0211054 3300046517 Bacteria 1482
574 Ga0495630_0243288 3300046517 Bacteria 1374
575 Ga0495630_0812347 3300046517 Bacteria 714
576 Ga0495630_0853510 3300046517 Bacteria 694
577 Ga0495666_0199154 3300046526 Bacteria 921
578 Ga0495642_0221014 3300046528 Bacteria 827
579 Ga0495652_0000232 3300046529 Bacteria 65303
580 Ga0495652_0006959 3300046529 Bacteria 10460
581 Ga0495652_0010261 3300046529 Bacteria 8491
582 Ga0495652_0045104 3300046529 Bacteria 3793
583 Ga0495652_0120137 3300046529 Bacteria 2097
584 Ga0495652_0149636 3300046529 Bacteria 1825
585 Ga0495652_0205291 3300046529 Bacteria 1492
586 Ga0495652_0263285 3300046529 Bacteria 1271
587 Ga0495665_0004219 3300046531 Bacteria 7760
588 Ga0495640_0018902 3300046533 Bacteria 5097
589 Ga0495640_0031768 3300046533 Bacteria 3767
590 Ga0495640_0041803 3300046533 Bacteria 3201
591 Ga0495640_0045456 3300046533 Bacteria 3046
592 Ga0495640_0283935 3300046533 Bacteria 1030
593 Ga0495640_0463342 3300046533 Bacteria 773
594 Ga0495586_0014146 3300046535 Bacteria 4239
595 Ga0495587_0000077 3300046536 Bacteria 77532
596 Ga0495587_0002793 3300046536 Bacteria 11666
597 Ga0495587_0006338 3300046536 Bacteria 7714
598 Ga0495587_0021693 3300046536 Bacteria 3962
599 Ga0495587_0029964 3300046536 Bacteria 3301
600 Ga0495587_0520807 3300046536 Bacteria 657
601 Ga0495609_0127833 3300046538 Bacteria 1090
602 Ga0495609_0164241 3300046538 Bacteria 940
603 Ga0495645_0020924 3300046543 Bacteria 4727
604 Ga0495645_0039049 3300046543 Bacteria 3462
605 Ga0495645_0113708 3300046543 Bacteria 1913
606 Ga0495645_0160121 3300046543 Bacteria 1557
607 Ga0495633_0158987 3300046558 Bacteria 1043
608 Ga0495667_0000071 3300046559 Bacteria 77538
609 Ga0495667_0003348 3300046559 Bacteria 10735
610 Ga0495667_0051639 3300046559 Bacteria 2711
611 Ga0495667_0054331 3300046559 Bacteria 2635
612 Ga0495667_0089470 3300046559 Bacteria 1995
613 Ga0495667_0268831 3300046559 Bacteria 1083
614 Ga0495656_0139854 3300046615 Bacteria 1160
615 Ga0495656_0152025 3300046615 Bacteria 1119
616 Ga0495634_0007920 3300046642 Bacteria 7925
617 Ga0495634_0033601 3300046642 Bacteria 3524
618 Ga0495634_0086203 3300046642 Bacteria 2045
619 Ga0495634_0113068 3300046642 Bacteria 1744
620 Ga0495634_0147014 3300046642 Bacteria 1493
621 Ga0495634_0332239 3300046642 Bacteria 913
622 Ga0495611_0274192 3300046648 Bacteria 780
623 Ga0495635_0003963 3300046663 Bacteria 10301
624 Ga0495635_0026444 3300046663 Bacteria 4037
625 Ga0495635_0073633 3300046663 Unclassified 2340
626 Ga0495635_0094017 3300046663 Bacteria 2049
627 Ga0495659_0187535 3300046664 Bacteria 844
628 Ga0495661_0267740 3300046665 Bacteria 866
629 Ga0495657_0000095 3300046675 Bacteria 77538
630 Ga0495657_0016622 3300046675 Bacteria 5358
631 Ga0495657_0017707 3300046675 Bacteria 5168
632 Ga0495657_0022581 3300046675 Bacteria 4504
633 Ga0495657_0056956 3300046675 Bacteria 2600
634 Ga0495599_0000331 3300046678 Bacteria 28205
635 Ga0495599_0009664 3300046678 Bacteria 5904
636 Ga0495599_0012091 3300046678 Bacteria 5312
637 Ga0495599_0026910 3300046678 Bacteria 3605
638 Ga0495599_0041226 3300046678 Bacteria 2899
639 Ga0495599_0042920 3300046678 Bacteria 2838
640 Ga0495599_0125263 3300046678 Bacteria 1597
641 Ga0495599_0578608 3300046678 Bacteria 655
642 Ga0495623_0001233 3300046679 Bacteria 17374
643 Ga0495623_0013202 3300046679 Bacteria 5355
644 Ga0495623_0039712 3300046679 Bacteria 3006
645 Ga0495623_0093951 3300046679 Bacteria 1835
646 Ga0495623_0181474 3300046679 Bacteria 1222
647 Ga0495646_0002846 3300046680 Bacteria 10709
648 Ga0495646_0010735 3300046680 Bacteria 5820
649 Ga0495646_0023620 3300046680 Bacteria 3870
650 Ga0495646_0163773 3300046680 Bacteria 1229
651 Ga0495646_0232027 3300046680 Bacteria 994
652 Ga0495658_0023824 3300046683 Bacteria 3253
653 Ga0495613_0027049 3300046689 Bacteria 4269
654 Ga0495613_0087106 3300046689 Bacteria 2264
655 Ga0495613_0087757 3300046689 Bacteria 2254
656 Ga0495613_0089302 3300046689 Bacteria 2232
657 Ga0495613_0500070 3300046689 Unclassified 819
658 Ga0495624_0008506 3300046690 Bacteria 7149
659 Ga0495624_0014188 3300046690 Bacteria 5415
660 Ga0495624_0062979 3300046690 Bacteria 2319
661 Ga0495624_0287875 3300046690 Bacteria 992
662 Ga0495624_0550035 3300046690 Bacteria 689
663 Ga0495600_0001235 3300046809 Bacteria 14020
664 Ga0495600_0005735 3300046809 Bacteria 7502
665 Ga0495600_0010034 3300046809 Bacteria 5870
666 Ga0495600_0012615 3300046809 Bacteria 5290
667 Ga0495600_0045663 3300046809 Bacteria 2859
668 Ga0495600_0072349 3300046809 Bacteria 2252
669 Ga0495581_0003544 3300047315 Bacteria 8960
670 Ga0495581_0039124 3300047315 Bacteria 2745
671 Ga0495604_0000087 3300047317 Bacteria 79147
672 Ga0495604_0012709 3300047317 Bacteria 6699
673 Ga0495604_0014967 3300047317 Bacteria 6187
674 Ga0495604_0021296 3300047317 Bacteria 5176
675 Ga0495604_0198054 3300047317 Bacteria 1395
676 Ga0495636_0067411 3300047318 Bacteria 1523
677 Ga0495674_0006513 3300047319 Bacteria 11206
678 Ga0495674_0043705 3300047319 Bacteria 3987
679 Ga0495674_0051395 3300047319 Bacteria 3634
680 Ga0495674_0071507 3300047319 Bacteria 2994
681 Ga0495674_0107595 3300047319 Bacteria 2366
682 Ga0495674_0114419 3300047319 Bacteria 2284
683 Ga0495674_0220078 3300047319 Bacteria 1569
684 Ga0495674_0423188 3300047319 Bacteria 1073
685 Ga0495676_0029423 3300047321 Bacteria 4677
686 Ga0495676_0098396 3300047321 Bacteria 2170
687 Ga0495680_0000225 3300047322 Bacteria 61654
688 Ga0495680_0001403 3300047322 Bacteria 25974
689 Ga0495680_0002555 3300047322 Bacteria 18576
690 Ga0495680_0029233 3300047322 Bacteria 4513
691 Ga0495680_0052003 3300047322 Bacteria 3195
692 Ga0495680_0144636 3300047322 Bacteria 1737
693 Ga0495683_0325825 3300047323 Bacteria 654
694 Ga0495675_0000651 3300047444 Bacteria 22014
695 Ga0495675_0009443 3300047444 Bacteria 6069
696 Ga0495675_0020165 3300047444 Bacteria 4237
697 Ga0495675_0050700 3300047444 Bacteria 2638
698 Ga0495675_0063331 3300047444 Bacteria 2340
699 Ga0495675_0366797 3300047444 Bacteria 844
700 Ga0495684_0025680 3300047471 Bacteria 4526
701 Ga0495684_0038444 3300047471 Bacteria 3669
702 Ga0495684_0042288 3300047471 Bacteria 3490
703 Ga0495593_0002417 3300047673 Bacteria 11229
704 Ga0495593_0012570 3300047673 Bacteria 4835
705 Ga0495602_0000419 3300048088 Bacteria 39857
706 Ga0495602_0010581 3300048088 Bacteria 9568
707 Ga0495602_0021863 3300048088 Bacteria 6279
708 Ga0495602_0114740 3300048088 Bacteria 2180
709 Ga0495602_0331026 3300048088 Bacteria 1105
710 Ga0495602_0453934 3300048088 Unclassified 904
711 Ga0495614_0051169 3300048089 Bacteria 1770
712 Ga0495615_0168422 3300048090 Bacteria 662
713 Ga0496100_0021800 3300048903 Bacteria 3865
714 Ga0496101_0044335 3300048904 Bacteria 3182
715 Ga0496101_0465383 3300048904 Bacteria 998
716 Ga0496101_0992869 3300048904 Bacteria 660
717 Ga0496102_0060132 3300048905 Bacteria 3476
718 Ga0496102_0071570 3300048905 Bacteria 3184
719 Ga0496104_0001701 3300048907 Bacteria 19000
720 Ga0496104_0056756 3300048907 Bacteria 3704
721 Ga0496104_0151268 3300048907 Bacteria 2228
722 Ga0496104_0955147 3300048907 Bacteria 761
723 Ga0496105_0007991 3300048908 Bacteria 8223
724 Ga0496105_0019792 3300048908 Bacteria 5431
725 Ga0496105_0119401 3300048908 Bacteria 2174
726 Ga0496106_0121329 3300048909 Bacteria 2043
727 Ga0496107_0269354 3300048910 Bacteria 1268
728 Ga0496108_0042939 3300048911 Bacteria 3775
729 Ga0496109_0035309 3300048912 Bacteria 4509
730 Ga0496110_0029218 3300048913 Bacteria 4742
731 Ga0496110_0032544 3300048913 Bacteria 4504
732 Ga0496110_0675081 3300048913 Bacteria 934
733 Ga0496111_0008909 3300048914 Bacteria 6672
734 Ga0496112_0020605 3300048915 Bacteria 6252
735 Ga0496112_0622532 3300048915 Bacteria 1010
736 Ga0496113_0052089 3300048916 Bacteria 3056
737 Ga0496113_0113770 3300048916 Bacteria 2109
738 Ga0496114_0068638 3300048917 Bacteria 2976
739 Ga0496114_0720912 3300048917 Bacteria 873
740 Ga0496115_0049228 3300048918 Bacteria 3372
741 Ga0496115_0244844 3300048918 Bacteria 1477
742 Ga0496115_0498392 3300048918 Bacteria 979
743 Ga0496115_0536108 3300048918 Bacteria 937
744 Ga0501306_043706 3300049127 Bacteria 701
745 Ga0501308_008285 3300049128 Bacteria 1109
746 Ga0501309_035398 3300049129 Bacteria 749
747 Ga0501309_052412 3300049129 Bacteria 643
748 Ga0501310_026825 3300049130 Bacteria 748
749 Ga0501310_045833 3300049130 Bacteria 621
750 Ga0501305_028057 3300049161 Bacteria 865
751 Ga0501305_036193 3300049161 Bacteria 788
752 Ga0501307_014933 3300049162 Bacteria 954
753 Ga0501311_019721 3300049527 Bacteria 906
754 Ga0501312_023399 3300049528 Bacteria 931
755 Ga0501312_028579 3300049528 Bacteria 865
756 Ga0501313_002921 3300049529 Bacteria 1656
757 Ga0501313_037658 3300049529 Bacteria 643
758 Ga0501314_001546 3300049530 Bacteria 1678
759 Ga0501315_011596 3300049531 Bacteria 1079
760 Ga0501315_023584 3300049531 Bacteria 846
761 Ga0501316_018174 3300049532 Bacteria 868
762 Ga0501317_022346 3300049533 Bacteria 866
763 Ga0501317_023869 3300049533 Bacteria 847
764 Ga0501317_059148 3300049533 Bacteria 625
765 Ga0501318_008088 3300049534 Bacteria 1116
766 Ga0501318_049957 3300049534 Bacteria 619
767 Ga0501319_007541 3300049535 Bacteria 825
768 Ga0501320_017798 3300049536 Bacteria 797
769 Ga0501320_024867 3300049536 Bacteria 715
770 Ga0501321_017056 3300049537 Bacteria 870
771 Ga0501321_025544 3300049537 Bacteria 762
772 Ga0501321_046818 3300049537 Bacteria 623
773 Ga0501322_005641 3300049538 Bacteria 871
774 Ga0501323_035436 3300049539 Bacteria 715
775 Ga0501324_011064 3300049540 Bacteria 830
776 Ga0501333_006357 3300049549 Bacteria 784
777 Ga0501334_05564 3300049550 Bacteria 833
778 Ga0501340_015684 3300049556 Bacteria 600
779 Ga0501031_0020283 3300049568 Bacteria 4334
780 Ga0501033_0266306 3300049570 Bacteria 1212
781 Ga0501037_0380735 3300049573 Unclassified 970
782 Ga0501038_0117739 3300049574 Bacteria 2194
783 Ga0501040_0063342 3300049576 Bacteria 2544
784 Ga0501041_0184200 3300049577 Bacteria 1307
785 Ga0501042_0003453 3300049578 Bacteria 9924
786 Ga0501043_0223678 3300049579 Bacteria 1455
787 Ga0501047_0313907 3300049581 Bacteria 1408
788 Ga0501068_0271784 3300049584 Bacteria 1082
789 Ga0501074_0004369 3300049590 Bacteria 10097
790 Ga0501075_0164802 3300049591 Bacteria 1691
791 Ga0501076_0010607 3300049592 Bacteria 6842
792 Ga0501077_0318514 3300049593 Unclassified 991
793 Ga0501081_0334129 3300049743 Bacteria 1115
794 Ga0501045_0004719 3300049824 Bacteria 9405
795 nmdc:mga0k408_301664_c1 3300050493 Bacteria 956
796 nmdc:mga05p37_160474_c1 3300050507 Bacteria 2746
797 nmdc:mga05p37_324766_c1 3300050507 Bacteria 1820
798 nmdc:mga05p37_32652_c1 3300050507 Bacteria 6368
799 nmdc:mga05p37_3884_c1 3300050507 Bacteria 11612
800 nmdc:mga05p37_410916_c1 3300050507 Bacteria 1578
801 nmdc:mga05p37_732682_c1 3300050507 Bacteria 1093
802 nmdc:mga09592_131261_c1 3300050508 Bacteria 2155
803 nmdc:mga0qj67_394148_c1 3300050509 Bacteria 1118
804 nmdc:mga0qj67_42241_c1 3300050509 Bacteria 3589
805 nmdc:mga0qj67_443165_c1 3300050509 Bacteria 1046
806 nmdc:mga06r32_200650_c1 3300050510 Bacteria 1983
807 nmdc:mga08y16_226876_c1 3300050511 Bacteria 1933
808 nmdc:mga08y16_279650_c1 3300050511 Bacteria 1722
809 nmdc:mga08y16_453912_c1 3300050511 Bacteria 1307
810 nmdc:mga08y16_757348_c1 3300050511 Bacteria 967
811 nmdc:mga0n895_23187_c1 3300050512 Bacteria 5830
812 nmdc:mga0n895_233827_c1 3300050512 Bacteria 1865
813 nmdc:mga0n895_255100_c1 3300050512 Bacteria 1780
814 nmdc:mga0n895_49031_c1 3300050512 Bacteria 4136
815 nmdc:mga0n895_691939_c1 3300050512 Bacteria 1016
816 nmdc:mga0n895_97557_c1 3300050512 Bacteria 2945
817 nmdc:mga0rr50_163953_c1 3300050513 Bacteria 1806
818 nmdc:mga0rr50_225145_c1 3300050513 Bacteria 1550
819 nmdc:mga0rr50_227075_c1 3300050513 Bacteria 1544
820 nmdc:mga0rr50_61698_c1 3300050513 Bacteria 2825
821 nmdc:mga0rr50_816596_c1 3300050513 Bacteria 795
822 nmdc:mga08x19_21343_c1 3300050514 Bacteria 3997
823 nmdc:mga08x19_7627_c1 3300050514 Bacteria 6428
824 nmdc:mga0a205_11019_c1 3300050515 Bacteria 8323
825 nmdc:mga0a205_131902_c1 3300050515 Bacteria 2399
826 nmdc:mga0a205_73625_c1 3300050515 Bacteria 3300
827 nmdc:mga0a205_84835_c1 3300050515 Bacteria 3060
828 nmdc:mga0a205_9253_c1 3300050515 Bacteria 8997
829 Ga0495601_0034346 3300053077 Bacteria 3163
830 Ga0495601_0054957 3300053077 Bacteria 2520
831 Ga0495601_0640352 3300053077 Bacteria 680
832 Ga0495612_0013749 3300053078 Bacteria 3260
833 Ga0495612_0043775 3300053078 Bacteria 1830
834 Ga0495612_0067760 3300053078 Bacteria 1485
835 Ga0495612_0114973 3300053078 Bacteria 1154
836 Ga0495612_0119716 3300053078 Bacteria 1132
837 Ga0495595_0001939 3300053084 Bacteria 8030
838 Ga0495595_0003589 3300053084 Bacteria 6163
839 Ga0495595_0020021 3300053084 Bacteria 2908
840 Ga0495595_0081902 3300053084 Bacteria 1538
841 Ga0495619_0016795 3300053085 Bacteria 4634
842 Ga0495619_0023324 3300053085 Bacteria 3966
843 Ga0495619_0047912 3300053085 Bacteria 2815
844 Ga0495619_0109009 3300053085 Bacteria 1890
845 Ga0501084_0046559 3300054114 Bacteria 3633
846 Ga0587101_038886 3300059623 Bacteria 776
847 Ga0587128_041480 3300059630 Bacteria 807
848 Ga0587079_087169 3300059647 Bacteria 724
849 Ga0587114_051953 3300059655 Bacteria 697
850 Ga0587119_010549 3300059658 Bacteria 1049
851 Ga0587119_042639 3300059658 Bacteria 656
852 Ga0466962_0025481 3300061719 Bacteria 2839
853 Ga0070706_100005766
854 JGI25407J50210_10002063
855 JGI25407J50210_10006527
856 JGI25407J50210_10021539
857 Ga0070690_100316732
858 Ga0070682_100847713
859 Ga0068868_100221493
860 Ga0070691_10027052
861 Ga0070669_100855584
862 Ga0070688_100197011
863 Ga0070709_10000604
864 Ga0070709_10004740
865 Ga0070709_10012599
866 Ga0070709_10091724
867 Ga0070709_10307707
868 Ga0070714_100001432
869 Ga0070714_100010107
870 Ga0070714_100048554
871 Ga0070714_100058629
872 Ga0070714_100075355
873 Ga0070714_100087900
874 Ga0070714_100089002
875 Ga0070714_100090409
876 Ga0070714_100094978
877 Ga0070714_100140205
878 Ga0070714_100446649
879 Ga0070714_100579041
880 Ga0070714_100583210
881 Ga0070714_101121627
882 Ga0070713_100001304
883 Ga0070713_100010956
884 Ga0070713_100032833
885 Ga0070713_100050629
886 Ga0070713_100103271
887 Ga0070713_100107186
888 Ga0070713_100157734
889 Ga0070713_100172590
890 Ga0070713_100279352
891 Ga0070713_101029183
892 Ga0070710_10001226
893 Ga0070710_10016179
894 Ga0070710_10018821
895 Ga0070710_10024996
896 Ga0070710_10110016
897 Ga0070710_10153050
898 Ga0070710_10334413
899 Ga0070711_100001594
900 Ga0070711_100025723
901 Ga0070711_100058730
902 Ga0070711_100125133
903 Ga0070711_100131796
904 Ga0070711_100185912
905 Ga0070711_100232292
906 Ga0070711_100267426
907 Ga0070705_100124497
908 Ga0070705_100233155
909 Ga0070694_100551079
910 Ga0070694_100614970
911 Ga0070708_100003157
912 Ga0070708_100014838
913 Ga0070708_100082938
914 Ga0070708_100463815
915 Ga0070662_100063964
916 Ga0070681_11234499
917 Ga0070706_100004585
918 Ga0070706_100005982
919 Ga0070706_100020154
920 Ga0070706_100038174
921 Ga0070706_100038414
922 Ga0070706_100040600
923 Ga0070706_100074804
924 Ga0070706_100098440
925 Ga0070706_100119969
926 Ga0070706_100172044
927 Ga0070706_100307882
928 Ga0070707_100003226
929 Ga0070707_100010507
930 Ga0070707_100024904
931 Ga0070707_100026432
932 Ga0070707_100039234
933 Ga0070707_100077825
934 Ga0070707_100085038
935 Ga0070707_100102432
936 Ga0070707_100112260
937 Ga0070707_100343838
938 Ga0070707_101126988
939 Ga0070698_100000028
940 Ga0070698_100002154
941 Ga0070698_100004320
942 Ga0070698_100004476
943 Ga0070698_100008436
944 Ga0070698_100009159
945 Ga0070698_100014786
946 Ga0070698_100017593
947 Ga0070698_100026422
948 Ga0070699_100011832
949 Ga0070699_100107379
950 Ga0070699_100179726
951 Ga0070679_100935873
952 Ga0070684_100082135
953 Ga0070697_100047964
954 Ga0070697_100076608
955 Ga0070697_100230745
956 Ga0070695_100207424
957 Ga0070695_100242819
958 Ga0070696_100083203
959 Ga0070693_100039735
960 Ga0070665_100499811
961 Ga0070665_100655168
962 Ga0068855_100400171
963 Ga0070664_100408824
964 Ga0068854_100291091
965 Ga0068856_100027245
966 Ga0068856_100034946
967 Ga0068856_100166097
968 Ga0068856_100330069
969 Ga0068856_100489717
970 Ga0070702_100378202
971 Ga0068864_100332868
972 Ga0068861_100026540
973 Ga0068861_100222762
974 Ga0068863_100138743
975 Ga0068863_100358050
976 Ga0068858_100059284
977 Ga0068862_101004186
978 Ga0081455_10000070
979 Ga0081455_10013067
980 Ga0081538_10003880
981 Ga0081538_10006034
982 Ga0081538_10007721
983 Ga0081538_10011876
984 Ga0081538_10012928
985 Ga0081538_10016498
986 Ga0081538_10048751
987 Ga0081538_10049744
988 Ga0081538_10098699
989 Ga0081540_1000808
990 Ga0081540_1064384
991 Ga0081539_10001909
992 Ga0070717_10000705
993 Ga0070717_10008702
994 Ga0070717_10012172
995 Ga0070717_10028616
996 Ga0070717_10034956
997 Ga0070717_10037356
998 Ga0070717_10066008
999 Ga0070717_10103512
1000 Ga0070717_10122246
1001 Ga0070717_10156429
1002 Ga0070717_10191190
1003 Ga0070717_10253420
1004 Ga0070717_10280562
1005 Ga0070717_10566968
1006 Ga0070717_10863054
1007 Ga0075432_10123509
1008 Ga0070715_10002144
1009 Ga0070715_10004360
1010 Ga0070715_10046495
1011 Ga0070715_10079548
1012 Ga0070715_10153615
1013 Ga0070715_10268087
1014 Ga0070716_100000290
1015 Ga0070716_100000969
1016 Ga0070716_100004287
1017 Ga0070716_100037736
1018 Ga0070716_100063412
1019 Ga0070712_100003115
1020 Ga0070712_100003133
1021 Ga0070712_100315380
1022 Ga0070712_100345844
1023 Ga0070712_100392543
1024 Ga0070712_100628789
1025 Ga0070712_100946264
1026 Ga0075428_100035383
1027 Ga0075428_100245979
1028 Ga0075428_100900274
1029 Ga0075428_101332387
1030 Ga0075430_100017260
1031 Ga0075431_100484235
1032 Ga0075433_10009794
1033 Ga0075433_10082152
1034 Ga0075433_10235954
1035 Ga0075433_10284919
1036 Ga0075434_100005930
1037 Ga0075434_100052605
1038 Ga0075434_100084213
1039 Ga0075434_100118566
1040 Ga0075434_100320497
1041 Ga0075429_100138410
1042 Ga0075429_100305323
1043 Ga0075429_100535307
1044 Ga0075436_100005367
1045 Ga0075436_100259946
1046 Ga0075436_100314370
1047 Ga0075435_100009622
1048 Ga0075435_100019512
1049 Ga0075435_100183728
1050 Ga0075435_100450679
1051 Ga0075435_100654929
1052 Ga0111539_10033094
1053 Ga0111539_10070191
1054 Ga0111539_10137331
1055 Ga0111539_10145250
1056 Ga0105245_10018238
1057 Ga0105245_10769375
1058 Ga0105247_10044871
1059 Ga0105247_10117174
1060 Ga0114129_10001806
1061 Ga0114129_10083953
1062 Ga0114129_10686301
1063 Ga0114129_10824811
1064 Ga0114129_11106077
1065 Ga0105241_10132241
1066 Ga0105248_10035656
1067 Ga0105249_10031124
1068 Ga0099796_10049711
1069 Ga0105239_10406683
1070 Ga0105239_10438556
1071 Ga0105239_10579072
1072 Ga0105239_11032448
1073 Ga0105246_10245292
1074 Ga0157370_10066648
1075 Ga0157369_10079993
1076 Ga0157369_11105518
1077 Ga0157374_10093628
1078 Ga0157378_10165730
1079 Ga0163162_10115326
1080 Ga0163162_10242440
1081 Ga0157372_10127391
1082 Ga0157372_10279830
1083 Ga0157372_10596515
1084 Ga0157375_10022078
1085 Ga0163163_10017671
1086 Ga0157379_10004985
1087 Ga0157376_10242068
1088 Ga0163161_10078643
1089 Ga0163161_10543693
1090 Ga0197907_10530067
1091 Ga0197907_11059048
1092 Ga0197907_11238878
1093 Ga0206356_11227511
1094 Ga0206349_1388505
1095 Ga0206349_1541577
1096 Ga0206349_1884858
1097 Ga0206355_1035705
1098 Ga0206355_1091329
1099 Ga0206355_1699087
1100 Ga0206351_10721053
1101 Ga0206350_10217589
1102 Ga0206350_10340345
1103 Ga0206354_11655940
1104 Ga0154015_1356672
1105 Ga0213873_10000154
1106 Ga0213876_10264912
1107 Ga0213875_10000453
1108 Ga0213875_10027769
1109 Ga0213875_10357734
1110 Ga0224712_10008546
1111 Ga0224712_10052531
1112 Ga0224712_10430300
1113 Ga0224712_10481637
1114 Ga0224572_1002018
1115 Ga0228598_1035959
1116 Ga0207692_10000993
1117 Ga0207692_10002662
1118 Ga0207692_10002729
1119 Ga0207692_10006476
1120 Ga0207692_10019350
1121 Ga0207692_10130803
1122 Ga0207692_10148538
1123 Ga0207692_10260727
1124 Ga0207710_10298197
1125 Ga0207647_10227282
1126 Ga0207685_10000642
1127 Ga0207685_10002737
1128 Ga0207685_10220832
1129 Ga0207699_10000384
1130 Ga0207699_10001474
1131 Ga0207699_10008057
1132 Ga0207699_10009676
1133 Ga0207699_10010456
1134 Ga0207699_10204548
1135 Ga0207699_10351431
1136 Ga0207684_10000506
1137 Ga0207684_10001501
1138 Ga0207684_10002941
1139 Ga0207684_10005160
1140 Ga0207684_10019358
1141 Ga0207684_10028810
1142 Ga0207684_10072054
1143 Ga0207684_10080815
1144 Ga0207684_10095844
1145 Ga0207684_10155534
1146 Ga0207684_10187739
1147 Ga0207654_10447061
1148 Ga0207671_10823399
1149 Ga0207693_10007215
1150 Ga0207693_10051475
1151 Ga0207693_10674910
1152 Ga0207663_10004564
1153 Ga0207663_10006491
1154 Ga0207663_10006959
1155 Ga0207663_10040878
1156 Ga0207663_10092353
1157 Ga0207663_10097314
1158 Ga0207663_10120270
1159 Ga0207663_10270588
1160 Ga0207663_10593040
1161 Ga0207660_10475672
1162 Ga0207646_10000253
1163 Ga0207646_10001795
1164 Ga0207646_10004352
1165 Ga0207646_10017683
1166 Ga0207646_10022370
1167 Ga0207646_10049506
1168 Ga0207646_10074220
1169 Ga0207646_10083370
1170 Ga0207646_10262233
1171 Ga0207646_10288204
1172 Ga0207646_10317556
1173 Ga0207646_10913133
1174 Ga0207681_10877021
1175 Ga0207687_10135705
1176 Ga0207687_10324470
1177 Ga0207700_10001332
1178 Ga0207700_10002045
1179 Ga0207700_10004412
1180 Ga0207700_10029337
1181 Ga0207700_10053007
1182 Ga0207700_10096325
1183 Ga0207700_10153461
1184 Ga0207700_10259945
1185 Ga0207700_10365592
1186 Ga0207700_10623969
1187 Ga0207700_10972665
1188 Ga0207664_10005699
1189 Ga0207664_10006841
1190 Ga0207664_10007708
1191 Ga0207664_10013730
1192 Ga0207664_10031224
1193 Ga0207664_10053645
1194 Ga0207664_10072926
1195 Ga0207664_10122632
1196 Ga0207664_10148272
1197 Ga0207664_10335038
1198 Ga0207664_10342324
1199 Ga0207664_10365387
1200 Ga0207664_10510476
1201 Ga0207664_10611267
1202 Ga0207664_10797630
1203 Ga0207706_10061434
1204 Ga0207665_10000804
1205 Ga0207665_10001312
1206 Ga0207665_10002268
1207 Ga0207665_10007286
1208 Ga0207665_10039793
1209 Ga0207711_10035694
1210 Ga0207667_10377033
1211 Ga0207712_10550168
1212 Ga0207712_10678507
1213 Ga0207640_10240854
1214 Ga0207677_10163514
1215 Ga0207677_11242593
1216 Ga0207703_10041980
1217 Ga0207708_10000044
1218 Ga0207702_10018736
1219 Ga0207702_10063093
1220 Ga0207702_10357770
1221 Ga0207702_10888556
1222 Ga0207641_10060746
1223 Ga0207641_10149440
1224 Ga0207674_10112578
1225 Ga0207675_100097618
1226 Ga0207428_10029562
1227 Ga0268266_10159038
1228 Ga0265336_10002104
1229 Ga0265336_10023213
1230 Ga0265338_10000966
1231 Ga0265338_10002944
1232 Ga0265338_10102989
1233 Ga0265338_10128139
1234 Ga0316178_1001611
1235 Ga0265762_1029750
1236 Ga0265766_1013204
1237 Ga0265776_106205
1238 Ga0265760_10027645
1239 Ga0265760_10141670
1240 Ga0265325_10055484
1241 Ga0265340_10014578
1242 Ga0265339_10074003
1243 Ga0265316_10128468
1244 Ga0265313_10130904
1245 Ga0307410_10175339
1246 Ga0307410_10196992
1247 Ga0307406_10752973
1248 Ga0307407_10098643
1249 Ga0307407_10187309
1250 Ga0307407_10733809
1251 Ga0307409_100052676
1252 Ga0307409_100116986
1253 Ga0307409_100257557
1254 Ga0307409_100380934
1255 Ga0307416_100060630
1256 Ga0307416_100161748
1257 Ga0307416_100709173
1258 Ga0307414_10504542
1259 Ga0307415_100005975
1260 Ga0307415_100025403
1261 Ga0307415_100047887
1262 Ga0307415_100054722
1263 Ga0307415_100981856
1264 Ga0307510_10521745
1265 Ga0373948_0010140
1266 Ga0373950_0004752
1267 Ga0373959_0041849
1268 Ga0373934_0007401
1269 Ga0373934_0011720
1270 Ga0373949_0034634
1271 Ga0373951_0032926
1272 Ga0373952_0020300
1273 Ga0373923_0019707
1274 Ga0373923_0024852
1275 Ga0373923_0030953
1276 Ga0373923_0035542
1277 Ga0373936_0000776
1278 Ga0373936_0225728
1279 Ga0373941_0155676
1280 Ga0373945_0193107
1281 Ga0373953_0000633
1282 Ga0373953_0004067
1283 Ga0373953_0005368
1284 Ga0373954_0001328
1285 Ga0373954_0015306
1286 Ga0373956_0002275
1287 Ga0373956_0017570
1288 Ga0373956_0068803
1289 Ga0373957_0000105
1290 Ga0373957_0005099
1291 Ga0373957_0018046
1292 Ga0373957_0020283
1293 Ga0373943_0194963
1294 Ga0373943_0203535
1295 Ga0373943_0320160
1296 Ga0373946_0060758
1297 Ga0373946_0197428
1298 Ga0373946_0385789
1299 Ga0373955_0000005
1300 Ga0373955_0068163
1301 Ga0373942_0008585
1302 Ga0373961_0075606
1303 Ga0373924_0001034
1304 Ga0373924_0012430
1305 Ga0373924_0078247
1306 Ga0373931_0013251
1307 Ga0373931_0062277
1308 Ga0373935_0004473
1309 Ga0373935_0040866
1310 Ga0373935_0133635
1311 Ga0373935_0214113
1312 Ga0373935_0344443
1313 Ga0373935_0670830
1314 Ga0373927_0168576
1315 Ga0373933_0000043
1316 Ga0373933_0004400
1317 Ga0373933_0005196
1318 Ga0373933_0009228
1319 Ga0373947_0155585
1320 Ga0373947_0257092
1321 Ga0373937_0000951
1322 Ga0373937_0091646
1323 Ga0373937_0137630
1324 Ga0373937_0226876
1325 Ga0373937_0365079
1326 Ga0373937_0434962
1327 Ga0310112_037093
1328 Ga0373925_0055868
1329 Ga0373925_0068229
1330 Ga0373925_0097522
1331 Ga0373925_0119170
1332 Ga0373925_0168813
1333 Ga0373925_0502410
1334 Ga0395899_0291984
1335 Ga0395900_0015425
1336 Ga0395900_0328819
1337 Ga0395898_0018695
1338 Ga0395898_0681283
1339 Ga0395898_0836442
1340 Ga0395905_0117655
1341 Ga0436364_0431777
1342 Ga0436364_1160943
1343 Ga0436364_1206720
1344 Ga0395901_0003924
1345 Ga0395901_0081417
1346 Ga0395901_0419170
1347 Ga0436365_0529014
1348 Ga0436363_0731983
1349 Ga0436362_1289131
1350 Ga0439448_0086729
1351 Ga0439450_026072
1352 Ga0439451_054867
1353 Ga0439454_024067
1354 Ga0439455_0129471
1355 Ga0439456_073553
1356 Ga0439463_077625
1357 Ga0439460_0082928
1358 Ga0439440_0008607
1359 Ga0466969_0034109
1360 Ga0466969_0124266
1361 Ga0466972_0003105
1362 Ga0466966_0158205
1363 Ga0466966_0172832
1364 Ga0466961_0065229
1365 Ga0466961_0107908
1366 Ga0466963_0139989
1367 Ga0466963_0282319
1368 Ga0466971_0082601
1369 Ga0466971_0088643
1370 Ga0466970_0025651
1371 Ga0466970_0084836
1372 Ga0466957_0200621
1373 Ga0466958_0008482
1374 Ga0495592_0000092
1375 Ga0495592_0022414
1376 Ga0495592_0071795
1377 Ga0495592_0076386
1378 Ga0495592_0106217
1379 Ga0495603_0118767
1380 Ga0495629_0003314
1381 Ga0495629_0003661
1382 Ga0495629_0025285
1383 Ga0495629_0576292
1384 Ga0495641_0008076
1385 Ga0495641_0014110
1386 Ga0495651_0000066
1387 Ga0495651_0006931
1388 Ga0495651_0011774
1389 Ga0495651_0033166
1390 Ga0495651_0086916
1391 Ga0495653_0004729
1392 Ga0495653_0018365
1393 Ga0495653_0033826
1394 Ga0495653_0035799
1395 Ga0495653_0044544
1396 Ga0495653_0306726
1397 Ga0495580_0039310
1398 Ga0495580_0567492
1399 Ga0495582_0004853
1400 Ga0495582_0017308
1401 Ga0495582_0034908
1402 Ga0495605_0292211
1403 Ga0495639_0182393
1404 Ga0495662_0014032
1405 Ga0495662_0136704
1406 Ga0495664_0018432
1407 Ga0495664_0030915
1408 Ga0495664_0074201
1409 Ga0495608_0000070
1410 Ga0495608_0022587
1411 Ga0495608_0024087
1412 Ga0495608_0041140
1413 Ga0495608_0055683
1414 Ga0495618_0065186
1415 Ga0495618_0077752
1416 Ga0495618_0081384
1417 Ga0495628_0000829
1418 Ga0495628_0026167
1419 Ga0495628_0037057
1420 Ga0495628_0081973
1421 Ga0495628_0094225
1422 Ga0495628_0129988
1423 Ga0495628_0363557
1424 Ga0495628_0582697
1425 Ga0495630_0211054
1426 Ga0495630_0243288
1427 Ga0495630_0812347
1428 Ga0495630_0853510
1429 Ga0495666_0199154
1430 Ga0495642_0221014
1431 Ga0495652_0000232
1432 Ga0495652_0006959
1433 Ga0495652_0010261
1434 Ga0495652_0045104
1435 Ga0495652_0120137
1436 Ga0495652_0149636
1437 Ga0495652_0205291
1438 Ga0495652_0263285
1439 Ga0495665_0004219
1440 Ga0495640_0018902
1441 Ga0495640_0031768
1442 Ga0495640_0041803
1443 Ga0495640_0045456
1444 Ga0495640_0283935
1445 Ga0495640_0463342
1446 Ga0495586_0014146
1447 Ga0495587_0000077
1448 Ga0495587_0002793
1449 Ga0495587_0006338
1450 Ga0495587_0021693
1451 Ga0495587_0029964
1452 Ga0495587_0520807
1453 Ga0495609_0127833
1454 Ga0495609_0164241
1455 Ga0495645_0020924
1456 Ga0495645_0039049
1457 Ga0495645_0113708
1458 Ga0495645_0160121
1459 Ga0495633_0158987
1460 Ga0495667_0000071
1461 Ga0495667_0003348
1462 Ga0495667_0051639
1463 Ga0495667_0054331
1464 Ga0495667_0089470
1465 Ga0495667_0268831
1466 Ga0495656_0139854
1467 Ga0495656_0152025
1468 Ga0495634_0007920
1469 Ga0495634_0033601
1470 Ga0495634_0086203
1471 Ga0495634_0113068
1472 Ga0495634_0147014
1473 Ga0495634_0332239
1474 Ga0495611_0274192
1475 Ga0495635_0003963
1476 Ga0495635_0026444
1477 Ga0495635_0073633
1478 Ga0495635_0094017
1479 Ga0495659_0187535
1480 Ga0495661_0267740
1481 Ga0495657_0000095
1482 Ga0495657_0016622
1483 Ga0495657_0017707
1484 Ga0495657_0022581
1485 Ga0495657_0056956
1486 Ga0495599_0000331
1487 Ga0495599_0009664
1488 Ga0495599_0012091
1489 Ga0495599_0026910
1490 Ga0495599_0041226
1491 Ga0495599_0042920
1492 Ga0495599_0125263
1493 Ga0495599_0578608
1494 Ga0495623_0001233
1495 Ga0495623_0013202
1496 Ga0495623_0039712
1497 Ga0495623_0093951
1498 Ga0495623_0181474
1499 Ga0495646_0002846
1500 Ga0495646_0010735
1501 Ga0495646_0023620
1502 Ga0495646_0163773
1503 Ga0495646_0232027
1504 Ga0495658_0023824
1505 Ga0495613_0027049
1506 Ga0495613_0087106
1507 Ga0495613_0087757
1508 Ga0495613_0089302
1509 Ga0495613_0500070
1510 Ga0495624_0008506
1511 Ga0495624_0014188
1512 Ga0495624_0062979
1513 Ga0495624_0287875
1514 Ga0495624_0550035
1515 Ga0495600_0001235
1516 Ga0495600_0005735
1517 Ga0495600_0010034
1518 Ga0495600_0012615
1519 Ga0495600_0045663
1520 Ga0495600_0072349
1521 Ga0495581_0003544
1522 Ga0495581_0039124
1523 Ga0495604_0000087
1524 Ga0495604_0012709
1525 Ga0495604_0014967
1526 Ga0495604_0021296
1527 Ga0495604_0198054
1528 Ga0495636_0067411
1529 Ga0495674_0006513
1530 Ga0495674_0043705
1531 Ga0495674_0051395
1532 Ga0495674_0071507
1533 Ga0495674_0107595
1534 Ga0495674_0114419
1535 Ga0495674_0220078
1536 Ga0495674_0423188
1537 Ga0495676_0029423
1538 Ga0495676_0098396
1539 Ga0495680_0000225
1540 Ga0495680_0001403
1541 Ga0495680_0002555
1542 Ga0495680_0029233
1543 Ga0495680_0052003
1544 Ga0495680_0144636
1545 Ga0495683_0325825
1546 Ga0495675_0000651
1547 Ga0495675_0009443
1548 Ga0495675_0020165
1549 Ga0495675_0050700
1550 Ga0495675_0063331
1551 Ga0495675_0366797
1552 Ga0495684_0025680
1553 Ga0495684_0038444
1554 Ga0495684_0042288
1555 Ga0495593_0002417
1556 Ga0495593_0012570
1557 Ga0495602_0000419
1558 Ga0495602_0010581
1559 Ga0495602_0021863
1560 Ga0495602_0114740
1561 Ga0495602_0331026
1562 Ga0495602_0453934
1563 Ga0495614_0051169
1564 Ga0495615_0168422
1565 Ga0496100_0021800
1566 Ga0496101_0044335
1567 Ga0496101_0465383
1568 Ga0496101_0992869
1569 Ga0496102_0060132
1570 Ga0496102_0071570
1571 Ga0496104_0001701
1572 Ga0496104_0056756
1573 Ga0496104_0151268
1574 Ga0496104_0955147
1575 Ga0496105_0007991
1576 Ga0496105_0019792
1577 Ga0496105_0119401
1578 Ga0496106_0121329
1579 Ga0496107_0269354
1580 Ga0496108_0042939
1581 Ga0496109_0035309
1582 Ga0496110_0029218
1583 Ga0496110_0032544
1584 Ga0496110_0675081
1585 Ga0496111_0008909
1586 Ga0496112_0020605
1587 Ga0496112_0622532
1588 Ga0496113_0052089
1589 Ga0496113_0113770
1590 Ga0496114_0068638
1591 Ga0496114_0720912
1592 Ga0496115_0049228
1593 Ga0496115_0244844
1594 Ga0496115_0498392
1595 Ga0496115_0536108
1596 Ga0501306_043706
1597 Ga0501308_008285
1598 Ga0501309_035398
1599 Ga0501309_052412
1600 Ga0501310_026825
1601 Ga0501310_045833
1602 Ga0501305_028057
1603 Ga0501305_036193
1604 Ga0501307_014933
1605 Ga0501311_019721
1606 Ga0501312_023399
1607 Ga0501312_028579
1608 Ga0501313_002921
1609 Ga0501313_037658
1610 Ga0501314_001546
1611 Ga0501315_011596
1612 Ga0501315_023584
1613 Ga0501316_018174
1614 Ga0501317_022346
1615 Ga0501317_023869
1616 Ga0501317_059148
1617 Ga0501318_008088
1618 Ga0501318_049957
1619 Ga0501319_007541
1620 Ga0501320_017798
1621 Ga0501320_024867
1622 Ga0501321_017056
1623 Ga0501321_025544
1624 Ga0501321_046818
1625 Ga0501322_005641
1626 Ga0501323_035436
1627 Ga0501324_011064
1628 Ga0501333_006357
1629 Ga0501334_05564
1630 Ga0501340_015684
1631 Ga0501031_0020283
1632 Ga0501033_0266306
1633 Ga0501037_0380735
1634 Ga0501038_0117739
1635 Ga0501040_0063342
1636 Ga0501041_0184200
1637 Ga0501042_0003453
1638 Ga0501043_0223678
1639 Ga0501047_0313907
1640 Ga0501068_0271784
1641 Ga0501074_0004369
1642 Ga0501075_0164802
1643 Ga0501076_0010607
1644 Ga0501077_0318514
1645 Ga0501081_0334129
1646 Ga0501045_0004719
1647 nmdc:mga0k408_301664_c1
1648 nmdc:mga05p37_160474_c1
1649 nmdc:mga05p37_324766_c1
1650 nmdc:mga05p37_32652_c1
1651 nmdc:mga05p37_3884_c1
1652 nmdc:mga05p37_410916_c1
1653 nmdc:mga05p37_732682_c1
1654 nmdc:mga09592_131261_c1
1655 nmdc:mga0qj67_394148_c1
1656 nmdc:mga0qj67_42241_c1
1657 nmdc:mga0qj67_443165_c1
1658 nmdc:mga06r32_200650_c1
1659 nmdc:mga08y16_226876_c1
1660 nmdc:mga08y16_279650_c1
1661 nmdc:mga08y16_453912_c1
1662 nmdc:mga08y16_757348_c1
1663 nmdc:mga0n895_23187_c1
1664 nmdc:mga0n895_233827_c1
1665 nmdc:mga0n895_255100_c1
1666 nmdc:mga0n895_49031_c1
1667 nmdc:mga0n895_691939_c1
1668 nmdc:mga0n895_97557_c1
1669 nmdc:mga0rr50_163953_c1
1670 nmdc:mga0rr50_225145_c1
1671 nmdc:mga0rr50_227075_c1
1672 nmdc:mga0rr50_61698_c1
1673 nmdc:mga0rr50_816596_c1
1674 nmdc:mga08x19_21343_c1
1675 nmdc:mga08x19_7627_c1
1676 nmdc:mga0a205_11019_c1
1677 nmdc:mga0a205_131902_c1
1678 nmdc:mga0a205_73625_c1
1679 nmdc:mga0a205_84835_c1
1680 nmdc:mga0a205_9253_c1
1681 Ga0495601_0034346
1682 Ga0495601_0054957
1683 Ga0495601_0640352
1684 Ga0495612_0013749
1685 Ga0495612_0043775
1686 Ga0495612_0067760
1687 Ga0495612_0114973
1688 Ga0495612_0119716
1689 Ga0495595_0001939
1690 Ga0495595_0003589
1691 Ga0495595_0020021
1692 Ga0495595_0081902
1693 Ga0495619_0016795
1694 Ga0495619_0023324
1695 Ga0495619_0047912
1696 Ga0495619_0109009
1697 Ga0501084_0046559
1698 Ga0587101_038886
1699 Ga0587128_041480
1700 Ga0587079_087169
1701 Ga0587114_051953
1702 Ga0587119_010549
1703 Ga0587119_042639
1704 Ga0466962_0025481

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04264

YceI

YceI-like domain

38

203

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bwl-assembly1.cif.gz_A structure of antibiotic sequester from pseudomonas aerurinosa 0.9289 15 184
1y0g-assembly2.cif.gz_D crystal structure of the escherichia coli ycei protein, structural genomics 0.9274 15 185
1wub-assembly1.cif.gz_A crystal structure of the polyisoprenoid-binding protein, tt1927b, from thermus thermophilus hb8 0.9197 15 187
7bwl-assembly1.cif.gz_A structure of antibiotic sequester from pseudomonas aerurinosa 0.9181 15 184
1y0g-assembly2.cif.gz_D crystal structure of the escherichia coli ycei protein, structural genomics 0.9168 15 185
ID Description Score Start End Superfamily
af_Q2FUS9_3_167_2.40.128.110 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.9436 18 180 2.40.128.110
af_P0A8X2_23_191_2.40.128.110 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.934 15 185 2.40.128.110
af_P0A8X2_23_191_2.40.128.110 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.9233 15 185 2.40.128.110
1wubA00 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.9197 15 187 2.40.128.110
af_Q2FUS9_3_167_2.40.128.110 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.916 18 180 2.40.128.110
ID Description Score Start End GO Terms
AF-A0A7X0D6X4-F1-model_v4 Polyisoprenoid-binding protein YceI 0.9888 32 186
AF-A0A172X1R7-F1-model_v4 deleted 0.9883 5 186
AF-A0A7W1GQG4-F1-model_v4 YceI family protein 0.9867 19 185
AF-A0A1R4G6Y4-F1-model_v4 Protein yceI 0.9863 6 184
AF-A0A3N5FBD3-F1-model_v4 Polyisoprenoid-binding protein 0.9854 15 184

Map