F483482

General Info

Members Datasets Scaffolds Average Seq Length
851 363 1702 130

Family's Representative Sequence

Representative Sequence 3300050511|nmdc:mga08y16_797395_c1|nmdc:mga08y16_797395_c1_25_399
Length 124
Sequence MKIKLTNVYVDDQEKALRFYTDVLGFVKKADCSQGPFRWLTVASQEDPDGTELQLALNNNPAAKLQQGLPAAMFFTDDVRADYERMKAGGAEFTMPPTDVTASRIAMLNDTCGNLIQVTQLMRW

Samples

Sample ID Description Type Environment
1 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
2 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
66 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
67 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
70 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
71 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
72 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
76 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
81 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
82 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
83 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
84 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
85 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
88 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
90 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
91 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
92 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
93 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
100 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
101 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
102 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
103 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
104 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
105 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
106 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
107 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
108 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
109 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
110 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
111 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
112 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
113 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
114 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
115 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
116 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
117 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
118 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
119 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
126 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
127 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
128 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
129 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
130 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
185 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
186 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
188 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
189 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
190 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
191 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
192 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
193 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
194 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
195 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
196 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
197 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
198 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
199 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
200 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
201 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
202 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
203 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
204 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
205 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
206 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
207 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
208 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
209 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
210 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
211 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
212 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
213 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
214 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
215 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
216 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
217 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
218 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
219 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
220 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
221 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
222 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
223 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
224 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
225 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
226 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
227 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
228 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
229 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
230 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
231 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
232 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
233 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
234 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
235 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
236 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
237 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
238 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
239 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
240 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
241 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
242 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
243 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
244 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
245 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
246 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
247 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
248 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
249 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
250 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
251 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
252 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
253 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
254 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
255 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
256 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
257 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
258 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
259 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
260 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
261 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
262 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
263 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
264 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
265 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
266 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
267 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
268 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
269 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
270 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
271 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
272 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
273 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
274 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
275 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
276 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
277 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
278 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
279 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
280 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
281 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
282 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
283 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
284 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
285 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
286 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
287 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
288 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
289 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
290 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
291 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
292 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
293 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
294 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
295 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
296 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
297 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
298 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
299 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
300 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
301 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
302 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
303 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
304 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
305 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
306 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
307 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
308 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
310 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
311 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
312 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
313 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
314 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
315 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
316 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
317 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
318 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
319 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
320 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
321 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
322 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
323 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
324 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
325 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
326 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
327 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
328 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
329 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
330 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
331 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
332 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
333 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
334 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
335 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
336 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
337 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
338 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
339 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
340 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
341 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
342 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
343 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
344 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
345 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
346 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
347 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
348 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
349 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
350 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
351 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
352 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
353 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
354 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
355 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
356 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
357 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
358 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
359 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
360 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
361 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
362 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
363 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96
Metatranscriptomes 2.47
Isolates 1.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4
Nodule 0.35
Rhizoplane 5.52
Rhizosphere 85.19
Stem 0
Stem Tuber 0
Unclassified 7.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga08y16_797395_c1 3300050511 Bacteria 937
2 Ga0058861_11929295 3300004800 Bacteria 605
3 Ga0058860_10935839 3300004801 Unclassified 557
4 Ga0065707_10115429 3300005295 Bacteria 2267
5 Ga0070658_11662652 3300005327 Bacteria 553
6 Ga0070676_10545888 3300005328 Bacteria 829
7 Ga0070683_100068040 3300005329 Bacteria 3318
8 Ga0070683_100086599 3300005329 Unclassified 2937
9 Ga0070683_100126600 3300005329 Bacteria 2415
10 Ga0070683_100205261 3300005329 Bacteria 1872
11 Ga0070683_101744036 3300005329 Bacteria 599
12 Ga0070690_101382756 3300005330 Bacteria 566
13 Ga0070677_10068687 3300005333 Bacteria 1484
14 Ga0068869_101111120 3300005334 Bacteria 692
15 Ga0070680_100107989 3300005336 Bacteria 2315
16 Ga0070680_100450740 3300005336 Unclassified 1099
17 Ga0070680_101255906 3300005336 Bacteria 641
18 Ga0070682_100570142 3300005337 Unclassified 889
19 Ga0068868_100026632 3300005338 Bacteria 4409
20 Ga0070660_100802118 3300005339 Bacteria 792
21 Ga0070689_100203912 3300005340 Bacteria 1616
22 Ga0070689_100309186 3300005340 Bacteria 1317
23 Ga0070689_100386216 3300005340 Bacteria 1181
24 Ga0070687_100020198 3300005343 Bacteria 3111
25 Ga0070687_100066780 3300005343 Bacteria 1917
26 Ga0070687_100579203 3300005343 Bacteria 768
27 Ga0070661_100167319 3300005344 Bacteria 1668
28 Ga0070661_100942089 3300005344 Unclassified 714
29 Ga0070669_100083924 3300005353 Bacteria 2376
30 Ga0070669_100425390 3300005353 Bacteria 1091
31 Ga0070675_100378347 3300005354 Bacteria 1260
32 Ga0070675_100786195 3300005354 Bacteria 869
33 Ga0070674_100066012 3300005356 Bacteria 2541
34 Ga0070674_100127313 3300005356 Bacteria 1894
35 Ga0070673_100275431 3300005364 Unclassified 1474
36 Ga0070688_100066747 3300005365 Bacteria 2290
37 Ga0070688_100183605 3300005365 Bacteria 1452
38 Ga0070688_101380941 3300005365 Bacteria 570
39 Ga0070659_100024210 3300005366 Bacteria 4653
40 Ga0070667_100716828 3300005367 Bacteria 926
41 Ga0070709_10010996 3300005434 Bacteria 5028
42 Ga0070709_10128335 3300005434 Bacteria 1728
43 Ga0070709_10348764 3300005434 Unclassified 1093
44 Ga0070714_100002908 3300005435 Bacteria 12665
45 Ga0070714_100178359 3300005435 Bacteria 1932
46 Ga0070714_100654428 3300005435 Bacteria 1012
47 Ga0070714_101557054 3300005435 Bacteria 646
48 Ga0070713_100000425 3300005436 Bacteria 26954
49 Ga0070713_100009861 3300005436 Bacteria 6869
50 Ga0070713_100159914 3300005436 Bacteria 2010
51 Ga0070713_100479350 3300005436 Unclassified 1172
52 Ga0070713_100831931 3300005436 Bacteria 886
53 Ga0070713_100947687 3300005436 Bacteria 829
54 Ga0070713_101282413 3300005436 Bacteria 710
55 Ga0070713_101492200 3300005436 Unclassified 656
56 Ga0070710_10214813 3300005437 Bacteria 1221
57 Ga0070710_10218642 3300005437 Bacteria 1211
58 Ga0070710_10862324 3300005437 Bacteria 651
59 Ga0070711_100022278 3300005439 Bacteria 4104
60 Ga0070711_100201262 3300005439 Bacteria 1537
61 Ga0070711_101990281 3300005439 Bacteria 511
62 Ga0070705_100640938 3300005440 Unclassified 827
63 Ga0070700_100093123 3300005441 Bacteria 1970
64 Ga0070694_100007349 3300005444 Bacteria 6717
65 Ga0070694_100797581 3300005444 Bacteria 774
66 Ga0070708_100371406 3300005445 Bacteria 1348
67 Ga0070708_100499672 3300005445 Bacteria 1147
68 Ga0070708_100621277 3300005445 Bacteria 1018
69 Ga0070663_100786849 3300005455 Bacteria 815
70 Ga0070663_100937798 3300005455 Bacteria 749
71 Ga0070663_101556321 3300005455 Bacteria 589
72 Ga0070678_100402133 3300005456 Bacteria 1190
73 Ga0070678_100951082 3300005456 Bacteria 788
74 Ga0070681_10099004 3300005458 Bacteria 2862
75 Ga0070681_10552311 3300005458 Bacteria 1066
76 Ga0068867_100164964 3300005459 Bacteria 1750
77 Ga0070685_10030017 3300005466 Bacteria 3025
78 Ga0070706_100151661 3300005467 Bacteria 2163
79 Ga0070706_101352797 3300005467 Bacteria 652
80 Ga0070707_100143320 3300005468 Bacteria 2325
81 Ga0070707_100606203 3300005468 Bacteria 1057
82 Ga0070707_100732867 3300005468 Bacteria 952
83 Ga0070698_100005019 3300005471 Bacteria 14500
84 Ga0070698_100015709 3300005471 Bacteria 7996
85 Ga0070698_101692965 3300005471 Bacteria 585
86 Ga0070699_100052458 3300005518 Bacteria 3529
87 Ga0070699_101480625 3300005518 Bacteria 622
88 Ga0070679_100024576 3300005530 Bacteria 5906
89 Ga0070679_100054362 3300005530 Bacteria 3986
90 Ga0070679_100066217 3300005530 Bacteria 3601
91 Ga0070679_100081962 3300005530 Bacteria 3216
92 Ga0070679_100173074 3300005530 Bacteria 2131
93 Ga0070679_100324265 3300005530 Bacteria 1489
94 Ga0070679_100589349 3300005530 Bacteria 1055
95 Ga0070679_100607132 3300005530 Bacteria 1037
96 Ga0070679_101519791 3300005530 Bacteria 617
97 Ga0070684_100132632 3300005535 Bacteria 2248
98 Ga0070684_100219629 3300005535 Bacteria 1734
99 Ga0070684_100626237 3300005535 Bacteria 1001
100 Ga0070684_101656145 3300005535 Unclassified 604
101 Ga0070697_101061036 3300005536 Bacteria 721
102 Ga0070697_101726229 3300005536 Bacteria 560
103 Ga0070686_100716289 3300005544 Bacteria 799
104 Ga0070686_101429163 3300005544 Bacteria 581
105 Ga0070693_100065665 3300005547 Bacteria 2121
106 Ga0070704_100061254 3300005549 Bacteria 2692
107 Ga0070704_100262672 3300005549 Bacteria 1423
108 Ga0070704_102032396 3300005549 Unclassified 533
109 Ga0068855_100001832 3300005563 Bacteria 26521
110 Ga0068855_100007679 3300005563 Bacteria 13030
111 Ga0068855_100039193 3300005563 Bacteria 5625
112 Ga0068855_100039867 3300005563 Bacteria 5575
113 Ga0068855_100805566 3300005563 Bacteria 998
114 Ga0068855_101828737 3300005563 Bacteria 617
115 Ga0070664_100860317 3300005564 Bacteria 849
116 Ga0070664_101291962 3300005564 Bacteria 689
117 Ga0068857_100690049 3300005577 Bacteria 970
118 Ga0068857_101170569 3300005577 Bacteria 744
119 Ga0068854_100152901 3300005578 Bacteria 1781
120 Ga0068856_100001927 3300005614 Bacteria 21632
121 Ga0068856_100006991 3300005614 Bacteria 11024
122 Ga0068856_100045302 3300005614 Bacteria 4331
123 Ga0068856_100382669 3300005614 Bacteria 1426
124 Ga0068856_100584513 3300005614 Bacteria 1138
125 Ga0068856_100729742 3300005614 Unclassified 1011
126 Ga0068856_100932059 3300005614 Bacteria 887
127 Ga0068856_100948038 3300005614 Bacteria 879
128 Ga0068856_101891892 3300005614 Unclassified 608
129 Ga0070702_100050057 3300005615 Bacteria 2385
130 Ga0070702_100161288 3300005615 Bacteria 1450
131 Ga0070702_100866833 3300005615 Bacteria 704
132 Ga0068852_100000066 3300005616 Bacteria 72069
133 Ga0068852_100430618 3300005616 Unclassified 1303
134 Ga0068852_101765077 3300005616 Unclassified 641
135 Ga0068859_100231724 3300005617 Bacteria 1935
136 Ga0068859_100608237 3300005617 Bacteria 1186
137 Ga0068859_101340737 3300005617 Bacteria 789
138 Ga0068864_100036707 3300005618 Bacteria 4179
139 Ga0068864_100359819 3300005618 Bacteria 1375
140 Ga0068866_10063690 3300005718 Unclassified 1923
141 Ga0068866_10664367 3300005718 Bacteria 711
142 Ga0068861_100147490 3300005719 Bacteria 1927
143 Ga0068870_10067682 3300005840 Bacteria 1938
144 Ga0068870_10145265 3300005840 Bacteria 1392
145 Ga0068863_100048380 3300005841 Unclassified 4033
146 Ga0068863_101058692 3300005841 Bacteria 815
147 Ga0068858_100060728 3300005842 Unclassified 3494
148 Ga0068860_100075102 3300005843 Unclassified 3215
149 Ga0068860_100277181 3300005843 Bacteria 1638
150 Ga0068860_100842060 3300005843 Bacteria 932
151 Ga0068862_100239792 3300005844 Bacteria 1648
152 Ga0068862_100292225 3300005844 Bacteria 1497
153 Ga0081455_10102294 3300005937 Bacteria 2297
154 Ga0081455_10194504 3300005937 Bacteria 1524
155 Ga0081540_1181999 3300005983 Bacteria 785
156 Ga0081540_1184768 3300005983 Bacteria 775
157 Ga0081539_10000329 3300005985 Bacteria 105307
158 Ga0081539_10069711 3300005985 Bacteria 1891
159 Ga0070717_10035206 3300006028 Bacteria 4052
160 Ga0070717_10036738 3300006028 Bacteria 3975
161 Ga0070717_10056203 3300006028 Bacteria 3251
162 Ga0070717_10500565 3300006028 Bacteria 1098
163 Ga0070717_10851641 3300006028 Bacteria 830
164 Ga0075368_10093495 3300006042 Bacteria 1231
165 Ga0075363_100114245 3300006048 Bacteria 1503
166 Ga0075363_100961819 3300006048 Bacteria 525
167 Ga0075364_11135152 3300006051 Bacteria 530
168 Ga0070715_10000009 3300006163 Bacteria 187315
169 Ga0070715_10220067 3300006163 Bacteria 976
170 Ga0070715_10297338 3300006163 Bacteria 862
171 Ga0070715_10491752 3300006163 Bacteria 701
172 Ga0070715_10876371 3300006163 Unclassified 551
173 Ga0070716_100011540 3300006173 Bacteria 4450
174 Ga0070716_100151910 3300006173 Bacteria 1491
175 Ga0070716_100386873 3300006173 Bacteria 1001
176 Ga0070716_100673962 3300006173 Bacteria 787
177 Ga0070716_101234718 3300006173 Bacteria 602
178 Ga0070712_100000258 3300006175 Bacteria 29603
179 Ga0070712_100024274 3300006175 Bacteria 4016
180 Ga0070712_100087092 3300006175 Bacteria 2278
181 Ga0070712_100926253 3300006175 Unclassified 752
182 Ga0075362_10235006 3300006177 Bacteria 898
183 Ga0075362_10235834 3300006177 Bacteria 897
184 Ga0075367_10018929 3300006178 Bacteria 3808
185 Ga0075367_10076661 3300006178 Bacteria 2018
186 Ga0097621_100000526 3300006237 Bacteria 26837
187 Ga0097621_100211852 3300006237 Bacteria 1686
188 Ga0075370_10062550 3300006353 Bacteria 2121
189 Ga0068871_100000606 3300006358 Bacteria 24637
190 Ga0068871_100211294 3300006358 Bacteria 1678
191 Ga0068871_100794807 3300006358 Bacteria 872
192 Ga0075428_102574494 3300006844 Bacteria 520
193 Ga0075430_100802690 3300006846 Bacteria 776
194 Ga0075431_100021329 3300006847 Bacteria 6622
195 Ga0075431_100269828 3300006847 Bacteria 1724
196 Ga0075433_10065908 3300006852 Bacteria 3177
197 Ga0075433_11279652 3300006852 Bacteria 636
198 Ga0075434_100009621 3300006871 Bacteria 9027
199 Ga0075434_100323440 3300006871 Bacteria 1563
200 Ga0075429_100173536 3300006880 Bacteria 1889
201 Ga0075429_100278807 3300006880 Bacteria 1464
202 Ga0075429_101557075 3300006880 Bacteria 575
203 Ga0075429_101859041 3300006880 Bacteria 522
204 Ga0068865_100009215 3300006881 Bacteria 6112
205 Ga0068865_101887354 3300006881 Bacteria 541
206 Ga0075436_100057628 3300006914 Bacteria 2683
207 Ga0075436_100444325 3300006914 Bacteria 944
208 Ga0075436_100452211 3300006914 Bacteria 935
209 Ga0075436_100485970 3300006914 Bacteria 902
210 Ga0075436_100862944 3300006914 Bacteria 676
211 Ga0097620_100231714 3300006931 Bacteria 1935
212 Ga0097620_100608325 3300006931 Bacteria 1186
213 Ga0097620_101340696 3300006931 Bacteria 789
214 Ga0075435_100234457 3300007076 Bacteria 1559
215 Ga0075435_100242875 3300007076 Bacteria 1532
216 Ga0075435_100480617 3300007076 Bacteria 1073
217 Ga0075435_100878252 3300007076 Unclassified 782
218 Ga0099794_10007873 3300007265 Bacteria 4403
219 Ga0099795_10159973 3300007788 Bacteria 929
220 Ga0105240_10000502 3300009093 Bacteria 72191
221 Ga0105240_10029937 3300009093 Bacteria 7084
222 Ga0105240_10076767 3300009093 Bacteria 4118
223 Ga0105240_10080962 3300009093 Bacteria 3992
224 Ga0105240_10082917 3300009093 Bacteria 3937
225 Ga0105240_10107400 3300009093 Bacteria 3384
226 Ga0105240_10118386 3300009093 Bacteria 3192
227 Ga0105240_10228251 3300009093 Bacteria 2165
228 Ga0105240_11183033 3300009093 Bacteria 810
229 Ga0111539_10001171 3300009094 Bacteria 34758
230 Ga0111539_10215907 3300009094 Bacteria 2234
231 Ga0105245_10244256 3300009098 Unclassified 1742
232 Ga0105245_10698318 3300009098 Bacteria 1048
233 Ga0105245_10799210 3300009098 Bacteria 981
234 Ga0105245_12085602 3300009098 Bacteria 621
235 Ga0105245_12188542 3300009098 Bacteria 607
236 Ga0114129_10008628 3300009147 Bacteria 14534
237 Ga0114129_10242805 3300009147 Bacteria 2421
238 Ga0114129_10476816 3300009147 Bacteria 1633
239 Ga0114129_10785239 3300009147 Bacteria 1216
240 Ga0114129_10907305 3300009147 Bacteria 1116
241 Ga0114129_12052753 3300009147 Bacteria 690
242 Ga0105241_10008473 3300009174 Bacteria 7562
243 Ga0105241_10101334 3300009174 Bacteria 2289
244 Ga0105241_10229619 3300009174 Unclassified 1564
245 Ga0105241_11479750 3300009174 Bacteria 653
246 Ga0105242_10050017 3300009176 Bacteria 3402
247 Ga0105248_10006300 3300009177 Bacteria 13020
248 Ga0105248_10176058 3300009177 Bacteria 2411
249 Ga0105248_11175766 3300009177 Bacteria 867
250 Ga0105248_11301154 3300009177 Bacteria 822
251 Ga0105237_10111272 3300009545 Bacteria 2730
252 Ga0105237_10132276 3300009545 Unclassified 2489
253 Ga0105237_10193023 3300009545 Bacteria 2036
254 Ga0105237_10494499 3300009545 Unclassified 1230
255 Ga0105237_10546756 3300009545 Bacteria 1165
256 Ga0105237_10816305 3300009545 Bacteria 939
257 Ga0105238_10004222 3300009551 Bacteria 14269
258 Ga0105238_10077633 3300009551 Bacteria 3312
259 Ga0105238_12255136 3300009551 Unclassified 579
260 Ga0105249_10513401 3300009553 Bacteria 1245
261 Ga0105249_10640386 3300009553 Bacteria 1120
262 Ga0099796_10164013 3300010159 Bacteria 882
263 Ga0099796_10381656 3300010159 Bacteria 614
264 Ga0105239_10010853 3300010375 Bacteria 10176
265 Ga0105239_10212390 3300010375 Bacteria 2169
266 Ga0105239_10709322 3300010375 Bacteria 1150
267 Ga0105239_10791388 3300010375 Bacteria 1086
268 Ga0105239_12041267 3300010375 Unclassified 666
269 Ga0105246_10486955 3300011119 Bacteria 1045
270 Ga0105246_10724406 3300011119 Bacteria 874
271 Ga0157373_10016821 3300013100 Bacteria 5332
272 Ga0157373_10524501 3300013100 Unclassified 857
273 Ga0157370_10000003 3300013104 Bacteria 367417
274 Ga0157370_10244900 3300013104 Bacteria 1659
275 Ga0157370_10356146 3300013104 Bacteria 1349
276 Ga0157370_10514451 3300013104 Bacteria 1099
277 Ga0157370_11163715 3300013104 Bacteria 696
278 Ga0157369_10000411 3300013105 Bacteria 56707
279 Ga0157369_10009687 3300013105 Bacteria 11017
280 Ga0157369_10011043 3300013105 Bacteria 10276
281 Ga0157369_10013414 3300013105 Bacteria 9265
282 Ga0157369_10013501 3300013105 Bacteria 9230
283 Ga0157369_10093436 3300013105 Bacteria 3211
284 Ga0157369_10114435 3300013105 Bacteria 2865
285 Ga0157369_10118201 3300013105 Bacteria 2814
286 Ga0157369_10857506 3300013105 Bacteria 932
287 Ga0157374_10001116 3300013296 Bacteria 23067
288 Ga0157374_10134820 3300013296 Bacteria 2393
289 Ga0157374_10173441 3300013296 Unclassified 2104
290 Ga0157374_10638482 3300013296 Unclassified 1076
291 Ga0157374_10894215 3300013296 Bacteria 905
292 Ga0157378_10000055 3300013297 Bacteria 97875
293 Ga0157378_10412253 3300013297 Bacteria 1334
294 Ga0157378_10575758 3300013297 Bacteria 1134
295 Ga0157378_11051009 3300013297 Bacteria 850
296 Ga0157378_11256812 3300013297 Bacteria 781
297 Ga0163162_10167855 3300013306 Bacteria 2319
298 Ga0163162_12211055 3300013306 Bacteria 631
299 Ga0157372_10000226 3300013307 Bacteria 62697
300 Ga0157372_10000778 3300013307 Bacteria 34511
301 Ga0157372_10000992 3300013307 Bacteria 31047
302 Ga0157372_10001764 3300013307 Bacteria 23462
303 Ga0157372_10028433 3300013307 Bacteria 6101
304 Ga0157372_10092374 3300013307 Bacteria 3443
305 Ga0157372_10124111 3300013307 Bacteria 2968
306 Ga0157372_10323994 3300013307 Unclassified 1794
307 Ga0157372_10400878 3300013307 Bacteria 1599
308 Ga0157372_10466332 3300013307 Unclassified 1472
309 Ga0157372_11439436 3300013307 Bacteria 794
310 Ga0157375_10078641 3300013308 Bacteria 3332
311 Ga0157375_10275724 3300013308 Unclassified 1844
312 Ga0157375_10792040 3300013308 Unclassified 1097
313 Ga0163163_10061187 3300014325 Bacteria 3730
314 Ga0163163_10093120 3300014325 Bacteria 3030
315 Ga0163163_10521147 3300014325 Bacteria 1251
316 Ga0157380_10156699 3300014326 Bacteria 1974
317 Ga0157380_10222393 3300014326 Bacteria 1690
318 Ga0182008_10033186 3300014497 Bacteria 2590
319 Ga0157377_10072869 3300014745 Bacteria 1989
320 Ga0157377_10279171 3300014745 Bacteria 1094
321 Ga0157379_10318422 3300014968 Unclassified 1420
322 Ga0157379_10341687 3300014968 Bacteria 1369
323 Ga0157379_10820861 3300014968 Bacteria 878
324 Ga0157379_10896117 3300014968 Bacteria 841
325 Ga0157376_10001809 3300014969 Bacteria 14225
326 Ga0157376_10014953 3300014969 Bacteria 5848
327 Ga0157376_10168875 3300014969 Bacteria 1990
328 Ga0157376_10597445 3300014969 Bacteria 1098
329 Ga0157376_10606335 3300014969 Bacteria 1090
330 Ga0157376_11630497 3300014969 Unclassified 680
331 Ga0157376_11715328 3300014969 Bacteria 663
332 Ga0197907_11406739 3300020069 Bacteria 1051
333 Ga0206356_10074695 3300020070 Bacteria 685
334 Ga0206356_11085863 3300020070 Bacteria 638
335 Ga0206349_1087972 3300020075 Bacteria 858
336 Ga0206349_1141559 3300020075 Bacteria 691
337 Ga0206349_1775809 3300020075 Bacteria 614
338 Ga0206352_10378737 3300020078 Bacteria 1544
339 Ga0206352_10864904 3300020078 Bacteria 842
340 Ga0206350_10077709 3300020080 Bacteria 1842
341 Ga0206350_10099212 3300020080 Bacteria 1472
342 Ga0206350_10607173 3300020080 Bacteria 1171
343 Ga0206353_11209812 3300020082 Bacteria 881
344 Ga0154015_1151287 3300020610 Unclassified 681
345 Ga0213874_10017894 3300021377 Bacteria 1908
346 Ga0213874_10217297 3300021377 Bacteria 693
347 Ga0213876_10031266 3300021384 Bacteria 2810
348 Ga0213876_10181802 3300021384 Bacteria 1118
349 Ga0213875_10327909 3300021388 Bacteria 726
350 Ga0228598_1025444 3300024227 Bacteria 1165
351 Ga0209148_1013844 3300025254 Bacteria 1440
352 Ga0207692_10034412 3300025898 Bacteria 2453
353 Ga0207692_10185572 3300025898 Bacteria 1214
354 Ga0207642_10124007 3300025899 Unclassified 1337
355 Ga0207647_10036256 3300025904 Bacteria 3135
356 Ga0207685_10000014 3300025905 Bacteria 180422
357 Ga0207699_10000012 3300025906 Bacteria 278800
358 Ga0207699_10004883 3300025906 Bacteria 6417
359 Ga0207643_10040635 3300025908 Bacteria 2619
360 Ga0207643_10060020 3300025908 Bacteria 2171
361 Ga0207705_10441610 3300025909 Unclassified 1008
362 Ga0207684_10004424 3300025910 Bacteria 13237
363 Ga0207684_10155385 3300025910 Bacteria 1969
364 Ga0207684_10959598 3300025910 Bacteria 717
365 Ga0207684_11539114 3300025910 Bacteria 540
366 Ga0207654_10339888 3300025911 Bacteria 1031
367 Ga0207707_10015054 3300025912 Bacteria 6735
368 Ga0207707_10359947 3300025912 Unclassified 1253
369 Ga0207707_10729466 3300025912 Bacteria 830
370 Ga0207695_10000438 3300025913 Bacteria 91252
371 Ga0207695_10000601 3300025913 Bacteria 72201
372 Ga0207695_10007383 3300025913 Bacteria 14022
373 Ga0207695_10060771 3300025913 Bacteria 3909
374 Ga0207695_10068148 3300025913 Bacteria 3647
375 Ga0207695_10319290 3300025913 Bacteria 1443
376 Ga0207695_10321793 3300025913 Unclassified 1436
377 Ga0207695_10547160 3300025913 Bacteria 1039
378 Ga0207695_10691278 3300025913 Bacteria 901
379 Ga0207695_11041866 3300025913 Bacteria 698
380 Ga0207671_10261312 3300025914 Bacteria 1363
381 Ga0207693_10000728 3300025915 Bacteria 29655
382 Ga0207693_10010173 3300025915 Bacteria 7640
383 Ga0207693_10080388 3300025915 Bacteria 2552
384 Ga0207693_10126282 3300025915 Bacteria 2010
385 Ga0207663_10033085 3300025916 Bacteria 3076
386 Ga0207663_10351153 3300025916 Bacteria 1116
387 Ga0207663_10635853 3300025916 Bacteria 841
388 Ga0207660_10267206 3300025917 Bacteria 1354
389 Ga0207660_10315715 3300025917 Unclassified 1247
390 Ga0207660_10450337 3300025917 Bacteria 1041
391 Ga0207662_10024882 3300025918 Bacteria 3446
392 Ga0207662_10076193 3300025918 Bacteria 2038
393 Ga0207662_10235854 3300025918 Bacteria 1196
394 Ga0207657_10335799 3300025919 Bacteria 1193
395 Ga0207652_10012480 3300025921 Bacteria 6866
396 Ga0207652_10075078 3300025921 Bacteria 2945
397 Ga0207652_10090965 3300025921 Bacteria 2682
398 Ga0207652_10155213 3300025921 Bacteria 2050
399 Ga0207652_10702121 3300025921 Unclassified 902
400 Ga0207652_11742858 3300025921 Bacteria 528
401 Ga0207652_11883760 3300025921 Bacteria 503
402 Ga0207646_10189777 3300025922 Unclassified 1856
403 Ga0207646_10306330 3300025922 Bacteria 1435
404 Ga0207646_10383829 3300025922 Bacteria 1269
405 Ga0207646_10767794 3300025922 Bacteria 860
406 Ga0207681_10139570 3300025923 Bacteria 1803
407 Ga0207681_10148389 3300025923 Bacteria 1754
408 Ga0207681_11138494 3300025923 Bacteria 655
409 Ga0207681_11249998 3300025923 Bacteria 624
410 Ga0207694_10019779 3300025924 Bacteria 5093
411 Ga0207694_10217571 3300025924 Bacteria 1557
412 Ga0207694_11231379 3300025924 Bacteria 633
413 Ga0207659_10098866 3300025926 Bacteria 2195
414 Ga0207659_10316079 3300025926 Bacteria 1287
415 Ga0207659_11523282 3300025926 Bacteria 572
416 Ga0207687_10766935 3300025927 Bacteria 821
417 Ga0207700_10000485 3300025928 Bacteria 23318
418 Ga0207700_10187181 3300025928 Bacteria 1737
419 Ga0207700_10444387 3300025928 Bacteria 1142
420 Ga0207664_10142099 3300025929 Bacteria 2032
421 Ga0207664_10269606 3300025929 Bacteria 1491
422 Ga0207664_10612123 3300025929 Bacteria 978
423 Ga0207690_10797574 3300025932 Bacteria 780
424 Ga0207706_10229394 3300025933 Bacteria 1625
425 Ga0207670_10066129 3300025936 Bacteria 2483
426 Ga0207669_10039929 3300025937 Bacteria 2718
427 Ga0207669_10095440 3300025937 Bacteria 1949
428 Ga0207704_10139727 3300025938 Unclassified 1692
429 Ga0207704_11615254 3300025938 Bacteria 557
430 Ga0207704_11662827 3300025938 Bacteria 549
431 Ga0207704_11746195 3300025938 Bacteria 535
432 Ga0207665_10004319 3300025939 Bacteria 9442
433 Ga0207665_10067596 3300025939 Bacteria 2434
434 Ga0207665_10317270 3300025939 Bacteria 1169
435 Ga0207665_10899137 3300025939 Bacteria 702
436 Ga0207711_10011129 3300025941 Bacteria 7477
437 Ga0207711_10050170 3300025941 Bacteria 3572
438 Ga0207711_11616364 3300025941 Bacteria 591
439 Ga0207661_10002167 3300025944 Bacteria 13529
440 Ga0207661_10073819 3300025944 Unclassified 2795
441 Ga0207661_10082034 3300025944 Bacteria 2665
442 Ga0207661_10112745 3300025944 Bacteria 2303
443 Ga0207661_10181246 3300025944 Bacteria 1840
444 Ga0207661_10407403 3300025944 Bacteria 1234
445 Ga0207661_11347642 3300025944 Bacteria 655
446 Ga0207661_12012189 3300025944 Bacteria 524
447 Ga0207679_10061118 3300025945 Bacteria 2803
448 Ga0207679_10233088 3300025945 Bacteria 1556
449 Ga0207679_11551287 3300025945 Bacteria 607
450 Ga0207667_10001848 3300025949 Bacteria 26581
451 Ga0207667_10028080 3300025949 Bacteria 6113
452 Ga0207667_10028330 3300025949 Bacteria 6084
453 Ga0207667_10595326 3300025949 Bacteria 1115
454 Ga0207667_11539677 3300025949 Bacteria 635
455 Ga0207651_10064324 3300025960 Bacteria 2567
456 Ga0207712_10411456 3300025961 Bacteria 1139
457 Ga0207668_10085141 3300025972 Bacteria 2306
458 Ga0207640_10104010 3300025981 Unclassified 1998
459 Ga0207640_10249561 3300025981 Bacteria 1376
460 Ga0207640_10357560 3300025981 Bacteria 1175
461 Ga0207640_11924084 3300025981 Bacteria 535
462 Ga0207658_10516299 3300025986 Bacteria 1066
463 Ga0207658_11075367 3300025986 Bacteria 735
464 Ga0207658_11253400 3300025986 Bacteria 678
465 Ga0207677_10007668 3300026023 Bacteria 5990
466 Ga0207677_12244698 3300026023 Bacteria 508
467 Ga0207703_10097432 3300026035 Unclassified 2485
468 Ga0207678_10709147 3300026067 Bacteria 886
469 Ga0207708_10144286 3300026075 Bacteria 1870
470 Ga0207708_10184628 3300026075 Bacteria 1657
471 Ga0207708_11165145 3300026075 Bacteria 673
472 Ga0207702_10004696 3300026078 Bacteria 12073
473 Ga0207702_10012969 3300026078 Bacteria 6932
474 Ga0207702_10022667 3300026078 Bacteria 5207
475 Ga0207702_10691020 3300026078 Bacteria 1005
476 Ga0207702_10703238 3300026078 Bacteria 996
477 Ga0207702_11031842 3300026078 Bacteria 816
478 Ga0207702_11087811 3300026078 Unclassified 793
479 Ga0207702_11589937 3300026078 Unclassified 647
480 Ga0207641_10027865 3300026088 Unclassified 4666
481 Ga0207641_10055360 3300026088 Bacteria 3368
482 Ga0207641_10342780 3300026088 Bacteria 1422
483 Ga0207648_10016054 3300026089 Bacteria 6861
484 Ga0207676_10045750 3300026095 Bacteria 3383
485 Ga0207676_10264394 3300026095 Bacteria 1555
486 Ga0207675_100163538 3300026118 Bacteria 2124
487 Ga0207675_100226825 3300026118 Bacteria 1801
488 Ga0207683_10260646 3300026121 Bacteria 1583
489 Ga0207698_10000017 3300026142 Bacteria 178846
490 Ga0207698_10484950 3300026142 Bacteria 1200
491 Ga0207698_10731081 3300026142 Bacteria 987
492 Ga0207698_11652122 3300026142 Bacteria 656
493 Ga0209179_1033832 3300027512 Bacteria 1058
494 Ga0209588_1000347 3300027671 Bacteria 12089
495 Ga0209813_10036206 3300027866 Bacteria 1481
496 Ga0207428_10012254 3300027907 Bacteria 7538
497 Ga0207428_10053441 3300027907 Bacteria 3221
498 Ga0268266_10030441 3300028379 Bacteria 4586
499 Ga0307517_10054602 3300028786 Bacteria 3945
500 Ga0307515_10597929 3300028794 Bacteria 713
501 Ga0265338_10001065 3300028800 Bacteria 45610
502 Ga0265338_10037851 3300028800 Bacteria 4581
503 Ga0265338_10080387 3300028800 Bacteria 2739
504 Ga0265338_10100224 3300028800 Unclassified 2363
505 Ga0265338_10224783 3300028800 Bacteria 1400
506 Ga0265338_10268165 3300028800 Bacteria 1252
507 Ga0265324_10300741 3300029957 Bacteria 546
508 Ga0265762_1102381 3300030760 Bacteria 636
509 Ga0265762_1139800 3300030760 Bacteria 568
510 Ga0265760_10000633 3300031090 Bacteria 9966
511 Ga0265330_10000318 3300031235 Bacteria 34504
512 Ga0265332_10010251 3300031238 Bacteria 4172
513 Ga0265332_10012316 3300031238 Bacteria 3795
514 Ga0265328_10013760 3300031239 Bacteria 3196
515 Ga0265328_10034957 3300031239 Bacteria 1859
516 Ga0265325_10000057 3300031241 Bacteria 77333
517 Ga0265325_10000556 3300031241 Bacteria 27056
518 Ga0265325_10054273 3300031241 Bacteria 2052
519 Ga0265329_10277860 3300031242 Bacteria 563
520 Ga0265340_10000034 3300031247 Bacteria 65594
521 Ga0265340_10336406 3300031247 Bacteria 667
522 Ga0265339_10003367 3300031249 Bacteria 11188
523 Ga0265339_10024335 3300031249 Bacteria 3490
524 Ga0265339_10028700 3300031249 Bacteria 3162
525 Ga0265339_10069913 3300031249 Bacteria 1873
526 Ga0265331_10110933 3300031250 Bacteria 1258
527 Ga0265327_10376787 3300031251 Unclassified 618
528 Ga0265316_10030329 3300031344 Unclassified 4434
529 Ga0265316_10041539 3300031344 Bacteria 3680
530 Ga0265316_10060061 3300031344 Bacteria 2955
531 Ga0265316_10111767 3300031344 Bacteria 2069
532 Ga0265316_10169655 3300031344 Bacteria 1628
533 Ga0307509_10264526 3300031507 Bacteria 1492
534 Ga0265313_10000001 3300031595 Bacteria 313647
535 Ga0265313_10206902 3300031595 Bacteria 814
536 Ga0265314_10000033 3300031711 Bacteria 254594
537 Ga0265314_10002726 3300031711 Bacteria 17658
538 Ga0265314_10005213 3300031711 Bacteria 11795
539 Ga0265314_10022455 3300031711 Bacteria 4833
540 Ga0265342_10001280 3300031712 Bacteria 23674
541 Ga0265342_10279688 3300031712 Unclassified 883
542 Ga0265342_10377910 3300031712 Bacteria 734
543 Ga0307406_11730476 3300031901 Bacteria 555
544 Ga0307407_10647769 3300031903 Bacteria 791
545 Ga0307507_10031897 3300033179 Bacteria 5517
546 Ga0373926_0086063 3300035083 Bacteria 1166
547 Ga0373934_0043428 3300035086 Bacteria 1776
548 Ga0373934_0243257 3300035086 Bacteria 743
549 Ga0373923_0129159 3300035111 Bacteria 1134
550 Ga0373936_0000019 3300035113 Bacteria 146661
551 Ga0373941_0237673 3300035115 Bacteria 706
552 Ga0373945_0089905 3300035116 Bacteria 1188
553 Ga0373953_0019700 3300035117 Bacteria 2513
554 Ga0373953_0029630 3300035117 Bacteria 2118
555 Ga0373954_0002403 3300035118 Bacteria 7844
556 Ga0373954_0009943 3300035118 Bacteria 4189
557 Ga0373954_0050991 3300035118 Bacteria 1943
558 Ga0373954_0421782 3300035118 Bacteria 660
559 Ga0373956_0009804 3300035119 Bacteria 3902
560 Ga0373956_0032621 3300035119 Bacteria 2285
561 Ga0373956_0319323 3300035119 Bacteria 740
562 Ga0373943_0002010 3300035170 Bacteria 9211
563 Ga0373943_0014720 3300035170 Bacteria 3547
564 Ga0373943_0017655 3300035170 Bacteria 3266
565 Ga0373943_0078305 3300035170 Bacteria 1690
566 Ga0373946_0265945 3300035171 Bacteria 840
567 Ga0373946_0409863 3300035171 Bacteria 685
568 Ga0373955_0002992 3300035172 Bacteria 7404
569 Ga0373955_0014829 3300035172 Bacteria 3802
570 Ga0373924_0003256 3300035410 Bacteria 5555
571 Ga0373924_0508232 3300035410 Bacteria 542
572 Ga0373931_0016813 3300035691 Bacteria 3607
573 Ga0373935_0058873 3300035692 Bacteria 2454
574 Ga0373935_0150702 3300035692 Bacteria 1578
575 Ga0373933_0018640 3300035724 Bacteria 3906
576 Ga0373933_0029878 3300035724 Bacteria 3154
577 Ga0373933_0085631 3300035724 Bacteria 1938
578 Ga0373933_0241925 3300035724 Bacteria 1161
579 Ga0373933_0891989 3300035724 Bacteria 585
580 Ga0373947_0065044 3300035725 Bacteria 2224
581 Ga0373947_0236801 3300035725 Bacteria 1204
582 Ga0373947_0336451 3300035725 Bacteria 1011
583 Ga0373937_0003715 3300036401 Bacteria 12892
584 Ga0373937_0067231 3300036401 Bacteria 3302
585 Ga0373937_0300670 3300036401 Bacteria 1517
586 Ga0373937_0628505 3300036401 Bacteria 1019
587 Ga0373937_0900261 3300036401 Bacteria 833
588 Ga0373925_0002572 3300037068 Bacteria 14446
589 Ga0373925_0013725 3300037068 Bacteria 5863
590 Ga0373925_0044057 3300037068 Bacteria 3313
591 Ga0373925_0186338 3300037068 Bacteria 1645
592 Ga0373925_0206365 3300037068 Bacteria 1564
593 Ga0373925_0472851 3300037068 Bacteria 1028
594 Ga0373925_1540590 3300037068 Bacteria 544
595 Ga0395899_0935334 3300037312 Bacteria 526
596 Ga0395900_0439394 3300037418 Bacteria 1262
597 Ga0395898_0407333 3300037466 Bacteria 1296
598 Ga0395905_0584042 3300037471 Bacteria 1019
599 Ga0395905_0644908 3300037471 Bacteria 961
600 Ga0395905_0741059 3300037471 Bacteria 885
601 Ga0395905_1725156 3300037471 Bacteria 531
602 Ga0436364_0218310 3300037853 Bacteria 1542
603 Ga0436364_0224412 3300037853 Bacteria 2796
604 Ga0436364_0393414 3300037853 Bacteria 1530
605 Ga0436364_0433388 3300037853 Bacteria 5066
606 Ga0436364_0563263 3300037853 Bacteria 1586
607 Ga0436364_0665489 3300037853 Bacteria 3308
608 Ga0436364_0765972 3300037853 Bacteria 737
609 Ga0436364_0949486 3300037853 Bacteria 1735
610 Ga0395901_0994891 3300038443 Bacteria 815
611 Ga0395901_0997542 3300038443 Bacteria 813
612 Ga0436365_0305842 3300039437 Bacteria 540
613 Ga0436365_0550717 3300039437 Bacteria 2416
614 Ga0436365_0750887 3300039437 Bacteria 5964
615 Ga0436365_1259721 3300039437 Bacteria 865
616 Ga0436365_1305789 3300039437 Bacteria 2376
617 Ga0436365_1472390 3300039437 Bacteria 1428
618 Ga0436360_0041073 3300039438 Bacteria 1076
619 Ga0436360_0072657 3300039438 Bacteria 595
620 Ga0436360_0501260 3300039438 Bacteria 673
621 Ga0436360_0655440 3300039438 Bacteria 769
622 Ga0436360_0749681 3300039438 Bacteria 1468
623 Ga0436360_0962901 3300039438 Bacteria 688
624 Ga0436360_1026804 3300039438 Unclassified 644
625 Ga0436360_1350811 3300039438 Bacteria 647
626 Ga0436361_0439291 3300039447 Bacteria 706
627 Ga0436361_0494835 3300039447 Bacteria 517
628 Ga0436361_0999823 3300039447 Bacteria 713
629 Ga0436363_0143555 3300039450 Bacteria 713
630 Ga0436363_0197920 3300039450 Bacteria 593
631 Ga0436363_0393655 3300039450 Bacteria 624
632 Ga0436363_0626676 3300039450 Unclassified 1143
633 Ga0436363_0885616 3300039450 Bacteria 874
634 Ga0436363_0959752 3300039450 Bacteria 1899
635 Ga0436362_0058185 3300039453 Bacteria 2804
636 Ga0436362_0132219 3300039453 Bacteria 706
637 Ga0436362_0569629 3300039453 Bacteria 5327
638 Ga0436362_0762569 3300039453 Bacteria 758
639 Ga0436362_0989829 3300039453 Bacteria 563
640 Ga0451853_0830407 3300041512 Bacteria 893
641 Ga0466966_0333294 3300044684 Bacteria 912
642 Ga0466967_0007004 3300045976 Bacteria 8070
643 Ga0466967_2249125 3300045976 Bacteria 541
644 Ga0495592_0071709 3300046454 Bacteria 2521
645 Ga0495592_0261878 3300046454 Bacteria 1139
646 Ga0495592_0815660 3300046454 Bacteria 553
647 Ga0495603_0422058 3300046455 Bacteria 764
648 Ga0495590_0112122 3300046457 Bacteria 974
649 Ga0495629_1133269 3300046459 Bacteria 505
650 Ga0495641_0098326 3300046461 Bacteria 1306
651 Ga0495651_0115189 3300046462 Bacteria 1982
652 Ga0495651_0169624 3300046462 Bacteria 1555
653 Ga0495653_0008912 3300046463 Bacteria 8203
654 Ga0495653_0979314 3300046463 Bacteria 501
655 Ga0495580_0007551 3300046472 Bacteria 8723
656 Ga0495580_0022268 3300046472 Bacteria 4665
657 Ga0495580_0030195 3300046472 Bacteria 3926
658 Ga0495580_0168574 3300046472 Bacteria 1514
659 Ga0495580_0237689 3300046472 Bacteria 1249
660 Ga0495580_0316430 3300046472 Bacteria 1061
661 Ga0495582_0006903 3300046473 Bacteria 6312
662 Ga0495582_0056175 3300046473 Bacteria 2170
663 Ga0495639_0061925 3300046475 Bacteria 1716
664 Ga0495664_0654701 3300046477 Bacteria 622
665 Ga0495664_0946489 3300046477 Bacteria 503
666 Ga0495594_0073779 3300046499 Bacteria 1900
667 Ga0495618_0516952 3300046514 Bacteria 718
668 Ga0495618_0561731 3300046514 Bacteria 682
669 Ga0495618_0706647 3300046514 Bacteria 592
670 Ga0495628_0222076 3300046516 Bacteria 1419
671 Ga0495628_0269716 3300046516 Bacteria 1266
672 Ga0495630_0454214 3300046517 Bacteria 982
673 Ga0495643_0358412 3300046522 Bacteria 651
674 Ga0495652_0023483 3300046529 Bacteria 5466
675 Ga0495665_0058778 3300046531 Bacteria 2030
676 Ga0495640_0045958 3300046533 Bacteria 3028
677 Ga0495587_0168283 3300046536 Bacteria 1245
678 Ga0495587_0516975 3300046536 Bacteria 659
679 Ga0495645_0114889 3300046543 Bacteria 1902
680 Ga0495645_0231593 3300046543 Bacteria 1237
681 Ga0495667_0023276 3300046559 Bacteria 4173
682 Ga0495667_0559360 3300046559 Bacteria 714
683 Ga0495667_0571162 3300046559 Bacteria 706
684 Ga0495656_0277992 3300046615 Bacteria 853
685 Ga0495634_0092910 3300046642 Bacteria 1957
686 Ga0495634_0613323 3300046642 Bacteria 631
687 Ga0495635_0013355 3300046663 Bacteria 5749
688 Ga0495635_0232030 3300046663 Bacteria 1247
689 Ga0495657_0008675 3300046675 Bacteria 7759
690 Ga0495657_0379423 3300046675 Bacteria 834
691 Ga0495599_0042370 3300046678 Bacteria 2856
692 Ga0495599_0199794 3300046678 Bacteria 1228
693 Ga0495623_0055909 3300046679 Bacteria 2485
694 Ga0495646_0087655 3300046680 Bacteria 1804
695 Ga0495647_0485931 3300046681 Bacteria 574
696 Ga0495658_0432458 3300046683 Bacteria 840
697 Ga0495613_0089659 3300046689 Bacteria 2228
698 Ga0495613_0351590 3300046689 Bacteria 1012
699 Ga0495600_0093859 3300046809 Bacteria 1956
700 Ga0495604_0017915 3300047317 Bacteria 5666
701 Ga0495604_0155374 3300047317 Bacteria 1621
702 Ga0495674_0120469 3300047319 Bacteria 2217
703 Ga0495674_0290822 3300047319 Bacteria 1336
704 Ga0495674_0448999 3300047319 Bacteria 1036
705 Ga0495680_0018594 3300047322 Bacteria 5891
706 Ga0495680_0809861 3300047322 Bacteria 611
707 Ga0495675_0013918 3300047444 Bacteria 5087
708 Ga0495675_0743154 3300047444 Bacteria 547
709 Ga0495684_0069511 3300047471 Bacteria 2677
710 Ga0495684_0473386 3300047471 Bacteria 866
711 Ga0495684_0691207 3300047471 Bacteria 678
712 Ga0495686_0002643 3300047472 Bacteria 16544
713 Ga0495686_0003457 3300047472 Bacteria 13688
714 Ga0495593_0398820 3300047673 Bacteria 688
715 Ga0495602_0132144 3300048088 Bacteria 1989
716 Ga0495602_0271429 3300048088 Bacteria 1253
717 Ga0495614_0530785 3300048089 Bacteria 562
718 Ga0496100_0123195 3300048903 Bacteria 1817
719 Ga0496100_0128835 3300048903 Bacteria 1780
720 Ga0496100_0727746 3300048903 Bacteria 775
721 Ga0496100_0876154 3300048903 Bacteria 705
722 Ga0496100_1479021 3300048903 Bacteria 536
723 Ga0496101_0111802 3300048904 Bacteria 2057
724 Ga0496101_0430147 3300048904 Bacteria 1041
725 Ga0496102_0204993 3300048905 Bacteria 1859
726 Ga0496102_1519950 3300048905 Bacteria 588
727 Ga0496102_1884936 3300048905 Bacteria 515
728 Ga0496103_0119949 3300048906 Bacteria 1675
729 Ga0496104_0020343 3300048907 Bacteria 6083
730 Ga0496104_0059371 3300048907 Bacteria 3621
731 Ga0496104_0080966 3300048907 Bacteria 3096
732 Ga0496104_0159786 3300048907 Bacteria 2162
733 Ga0496104_0296111 3300048907 Bacteria 1530
734 Ga0496104_0458505 3300048907 Unclassified 1186
735 Ga0496104_0608247 3300048907 Bacteria 1003
736 Ga0496104_0634852 3300048907 Bacteria 977
737 Ga0496104_0699898 3300048907 Bacteria 921
738 Ga0496105_0115131 3300048908 Bacteria 2218
739 Ga0496105_0151772 3300048908 Bacteria 1904
740 Ga0496105_0250263 3300048908 Bacteria 1436
741 Ga0496106_0095411 3300048909 Bacteria 2300
742 Ga0496107_0112485 3300048910 Bacteria 2002
743 Ga0496107_0342887 3300048910 Bacteria 1112
744 Ga0496107_0798832 3300048910 Bacteria 691
745 Ga0496108_1365680 3300048911 Bacteria 594
746 Ga0496109_0167772 3300048912 Bacteria 2059
747 Ga0496109_0303676 3300048912 Bacteria 1505
748 Ga0496109_2029842 3300048912 Bacteria 507
749 Ga0496110_0203060 3300048913 Bacteria 1801
750 Ga0496110_0464566 3300048913 Bacteria 1153
751 Ga0496111_0338366 3300048914 Bacteria 1114
752 Ga0496112_0065350 3300048915 Bacteria 3590
753 Ga0496112_0577592 3300048915 Bacteria 1057
754 Ga0496112_0624975 3300048915 Bacteria 1008
755 Ga0496112_0682815 3300048915 Bacteria 955
756 Ga0496113_0431429 3300048916 Bacteria 1059
757 Ga0496113_0832233 3300048916 Bacteria 732
758 Ga0496114_0002821 3300048917 Bacteria 13318
759 Ga0496115_0013816 3300048918 Bacteria 6115
760 Ga0496115_0054119 3300048918 Bacteria 3222
761 Ga0496115_0085448 3300048918 Bacteria 2573
762 Ga0496115_0089891 3300048918 Bacteria 2508
763 Ga0496115_0570835 3300048918 Bacteria 902
764 Ga0496115_0685285 3300048918 Unclassified 807
765 Ga0496120_0142348 3300048923 Bacteria 1216
766 Ga0496122_0605383 3300048925 Bacteria 512
767 Ga0501032_1082460 3300049569 Bacteria 503
768 Ga0501040_0097023 3300049576 Bacteria 2053
769 Ga0501041_0102869 3300049577 Bacteria 1769
770 Ga0501042_0130644 3300049578 Bacteria 1810
771 Ga0501042_0302113 3300049578 Bacteria 1156
772 Ga0501043_0268584 3300049579 Bacteria 1310
773 Ga0501047_0013018 3300049581 Bacteria 7877
774 Ga0501070_0128468 3300049586 Bacteria 2094
775 Ga0501071_0125180 3300049587 Bacteria 1907
776 Ga0501072_0329171 3300049588 Bacteria 1214
777 Ga0501072_1113730 3300049588 Bacteria 614
778 Ga0501075_0143358 3300049591 Bacteria 1821
779 Ga0501077_0091821 3300049593 Bacteria 1924
780 Ga0501081_0444500 3300049743 Bacteria 963
781 Ga0501083_0049311 3300049744 Bacteria 2838
782 Ga0501267_002675 3300049764 Bacteria 1596
783 Ga0501044_0014787 3300049823 Bacteria 8413
784 nmdc:mga03683_201254_c1 3300050489 Bacteria 914
785 nmdc:mga03n38_16046_c1 3300050490 Bacteria 2906
786 nmdc:mga03n38_303717_c1 3300050490 Bacteria 858
787 nmdc:mga00v17_275713_c1 3300050491 Bacteria 1091
788 nmdc:mga00v17_750224_c1 3300050491 Bacteria 624
789 nmdc:mga0yw44_499349_c1 3300050492 Bacteria 825
790 nmdc:mga06z11_1472_c1 3300050494 Bacteria 8770
791 nmdc:mga06z11_472396_c1 3300050494 Bacteria 759
792 nmdc:mga04h51_31928_c1 3300050495 Bacteria 1667
793 nmdc:mga07m45_41120_c1 3300050496 Bacteria 2588
794 nmdc:mga05p37_139888_c1 3300050507 Bacteria 2966
795 nmdc:mga05p37_387897_c1 3300050507 Bacteria 1634
796 nmdc:mga05p37_625811_c1 3300050507 Bacteria 1210
797 nmdc:mga05p37_75180_c1 3300050507 Bacteria 4158
798 nmdc:mga09592_128301_c1 3300050508 Bacteria 2181
799 nmdc:mga09592_1625546_c1 3300050508 Bacteria 523
800 nmdc:mga09592_346028_c1 3300050508 Bacteria 1287
801 nmdc:mga0qj67_1431309_c1 3300050509 Bacteria 533
802 nmdc:mga0qj67_174148_c1 3300050509 Bacteria 1747
803 nmdc:mga0qj67_506981_c1 3300050509 Bacteria 970
804 nmdc:mga06r32_109232_c1 3300050510 Bacteria 2720
805 nmdc:mga06r32_1261825_c1 3300050510 Bacteria 684
806 nmdc:mga08y16_14939_c1 3300050511 Bacteria 8166
807 nmdc:mga08y16_5092_c1 3300050511 Bacteria 13737
808 nmdc:mga08y16_645140_c1 3300050511 Bacteria 1063
809 nmdc:mga08y16_896592_c1 3300050511 Bacteria 873
810 nmdc:mga0n895_12675_c1 3300050512 Bacteria 7569
811 nmdc:mga0n895_249737_c1 3300050512 Bacteria 1800
812 nmdc:mga0rr50_125608_c1 3300050513 Bacteria 2048
813 nmdc:mga0rr50_266741_c1 3300050513 Bacteria 1426
814 nmdc:mga0rr50_876786_c1 3300050513 Unclassified 765
815 nmdc:mga08x19_294064_c1 3300050514 Bacteria 1127
816 nmdc:mga08x19_318438_c1 3300050514 Bacteria 1082
817 nmdc:mga08x19_371457_c1 3300050514 Bacteria 1001
818 nmdc:mga0a205_177820_c1 3300050515 Bacteria 2023
819 nmdc:mga0a205_762268_c1 3300050515 Bacteria 816
820 Ga0495601_1079194 3300053077 Bacteria 503
821 Ga0495612_0557656 3300053078 Bacteria 528
822 Ga0495595_0089408 3300053084 Bacteria 1476
823 Ga0500578_0411788 3300053086 Bacteria 777
824 Ga0500646_0002217 3300053090 Bacteria 5067
825 Ga0500566_0001824 3300053094 Bacteria 12529
826 Ga0500562_109910 3300053108 Bacteria 751
827 Ga0500652_191092 3300053131 Bacteria 835
828 Ga0500568_0037862 3300053139 Bacteria 1955
829 Ga0500585_182119 3300053144 Bacteria 712
830 Ga0500603_023057 3300053150 Bacteria 1546
831 Ga0500604_0191866 3300053151 Bacteria 702
832 Ga0500622_0111026 3300053156 Bacteria 1340
833 Ga0500622_0275526 3300053156 Bacteria 727
834 Ga0500639_118710 3300053163 Bacteria 1274
835 Ga0500636_0164578 3300053177 Bacteria 1206
836 Ga0587094_130750 3300059513 Unclassified 511
837 Ga0587115_102733 3300059626 Bacteria 532
838 Ga0587075_102023 3300059644 Bacteria 574
839 2694637199 2693429784 Bacteria 7241525
840 2869164955 2869162929 Bacteria 6399702
841 2874126307 2874123672 Bacteria 7238285
842 2903450797 2903448605 Bacteria 7357801
843 2924764348 2924762789 Bacteria 6561353
844 2937854120 2937848649 Bacteria 6983481
845 2968087948 2968083720 Bacteria 7351627
846 2977927466 2977922695 Bacteria 6956781
847 2977989318 2977986579 Bacteria 6581278
848 2987672806 2987666974 Bacteria 6509233
849 3004215788 3004211236 Bacteria 7417683
850 3004224565 3004218560 Bacteria 7421728
851 3004335051 3004334049 Bacteria 8449246
852 nmdc:mga08y16_797395_c1
853 Ga0058861_11929295
854 Ga0058860_10935839
855 Ga0065707_10115429
856 Ga0070658_11662652
857 Ga0070676_10545888
858 Ga0070683_100068040
859 Ga0070683_100086599
860 Ga0070683_100126600
861 Ga0070683_100205261
862 Ga0070683_101744036
863 Ga0070690_101382756
864 Ga0070677_10068687
865 Ga0068869_101111120
866 Ga0070680_100107989
867 Ga0070680_100450740
868 Ga0070680_101255906
869 Ga0070682_100570142
870 Ga0068868_100026632
871 Ga0070660_100802118
872 Ga0070689_100203912
873 Ga0070689_100309186
874 Ga0070689_100386216
875 Ga0070687_100020198
876 Ga0070687_100066780
877 Ga0070687_100579203
878 Ga0070661_100167319
879 Ga0070661_100942089
880 Ga0070669_100083924
881 Ga0070669_100425390
882 Ga0070675_100378347
883 Ga0070675_100786195
884 Ga0070674_100066012
885 Ga0070674_100127313
886 Ga0070673_100275431
887 Ga0070688_100066747
888 Ga0070688_100183605
889 Ga0070688_101380941
890 Ga0070659_100024210
891 Ga0070667_100716828
892 Ga0070709_10010996
893 Ga0070709_10128335
894 Ga0070709_10348764
895 Ga0070714_100002908
896 Ga0070714_100178359
897 Ga0070714_100654428
898 Ga0070714_101557054
899 Ga0070713_100000425
900 Ga0070713_100009861
901 Ga0070713_100159914
902 Ga0070713_100479350
903 Ga0070713_100831931
904 Ga0070713_100947687
905 Ga0070713_101282413
906 Ga0070713_101492200
907 Ga0070710_10214813
908 Ga0070710_10218642
909 Ga0070710_10862324
910 Ga0070711_100022278
911 Ga0070711_100201262
912 Ga0070711_101990281
913 Ga0070705_100640938
914 Ga0070700_100093123
915 Ga0070694_100007349
916 Ga0070694_100797581
917 Ga0070708_100371406
918 Ga0070708_100499672
919 Ga0070708_100621277
920 Ga0070663_100786849
921 Ga0070663_100937798
922 Ga0070663_101556321
923 Ga0070678_100402133
924 Ga0070678_100951082
925 Ga0070681_10099004
926 Ga0070681_10552311
927 Ga0068867_100164964
928 Ga0070685_10030017
929 Ga0070706_100151661
930 Ga0070706_101352797
931 Ga0070707_100143320
932 Ga0070707_100606203
933 Ga0070707_100732867
934 Ga0070698_100005019
935 Ga0070698_100015709
936 Ga0070698_101692965
937 Ga0070699_100052458
938 Ga0070699_101480625
939 Ga0070679_100024576
940 Ga0070679_100054362
941 Ga0070679_100066217
942 Ga0070679_100081962
943 Ga0070679_100173074
944 Ga0070679_100324265
945 Ga0070679_100589349
946 Ga0070679_100607132
947 Ga0070679_101519791
948 Ga0070684_100132632
949 Ga0070684_100219629
950 Ga0070684_100626237
951 Ga0070684_101656145
952 Ga0070697_101061036
953 Ga0070697_101726229
954 Ga0070686_100716289
955 Ga0070686_101429163
956 Ga0070693_100065665
957 Ga0070704_100061254
958 Ga0070704_100262672
959 Ga0070704_102032396
960 Ga0068855_100001832
961 Ga0068855_100007679
962 Ga0068855_100039193
963 Ga0068855_100039867
964 Ga0068855_100805566
965 Ga0068855_101828737
966 Ga0070664_100860317
967 Ga0070664_101291962
968 Ga0068857_100690049
969 Ga0068857_101170569
970 Ga0068854_100152901
971 Ga0068856_100001927
972 Ga0068856_100006991
973 Ga0068856_100045302
974 Ga0068856_100382669
975 Ga0068856_100584513
976 Ga0068856_100729742
977 Ga0068856_100932059
978 Ga0068856_100948038
979 Ga0068856_101891892
980 Ga0070702_100050057
981 Ga0070702_100161288
982 Ga0070702_100866833
983 Ga0068852_100000066
984 Ga0068852_100430618
985 Ga0068852_101765077
986 Ga0068859_100231724
987 Ga0068859_100608237
988 Ga0068859_101340737
989 Ga0068864_100036707
990 Ga0068864_100359819
991 Ga0068866_10063690
992 Ga0068866_10664367
993 Ga0068861_100147490
994 Ga0068870_10067682
995 Ga0068870_10145265
996 Ga0068863_100048380
997 Ga0068863_101058692
998 Ga0068858_100060728
999 Ga0068860_100075102
1000 Ga0068860_100277181
1001 Ga0068860_100842060
1002 Ga0068862_100239792
1003 Ga0068862_100292225
1004 Ga0081455_10102294
1005 Ga0081455_10194504
1006 Ga0081540_1181999
1007 Ga0081540_1184768
1008 Ga0081539_10000329
1009 Ga0081539_10069711
1010 Ga0070717_10035206
1011 Ga0070717_10036738
1012 Ga0070717_10056203
1013 Ga0070717_10500565
1014 Ga0070717_10851641
1015 Ga0075368_10093495
1016 Ga0075363_100114245
1017 Ga0075363_100961819
1018 Ga0075364_11135152
1019 Ga0070715_10000009
1020 Ga0070715_10220067
1021 Ga0070715_10297338
1022 Ga0070715_10491752
1023 Ga0070715_10876371
1024 Ga0070716_100011540
1025 Ga0070716_100151910
1026 Ga0070716_100386873
1027 Ga0070716_100673962
1028 Ga0070716_101234718
1029 Ga0070712_100000258
1030 Ga0070712_100024274
1031 Ga0070712_100087092
1032 Ga0070712_100926253
1033 Ga0075362_10235006
1034 Ga0075362_10235834
1035 Ga0075367_10018929
1036 Ga0075367_10076661
1037 Ga0097621_100000526
1038 Ga0097621_100211852
1039 Ga0075370_10062550
1040 Ga0068871_100000606
1041 Ga0068871_100211294
1042 Ga0068871_100794807
1043 Ga0075428_102574494
1044 Ga0075430_100802690
1045 Ga0075431_100021329
1046 Ga0075431_100269828
1047 Ga0075433_10065908
1048 Ga0075433_11279652
1049 Ga0075434_100009621
1050 Ga0075434_100323440
1051 Ga0075429_100173536
1052 Ga0075429_100278807
1053 Ga0075429_101557075
1054 Ga0075429_101859041
1055 Ga0068865_100009215
1056 Ga0068865_101887354
1057 Ga0075436_100057628
1058 Ga0075436_100444325
1059 Ga0075436_100452211
1060 Ga0075436_100485970
1061 Ga0075436_100862944
1062 Ga0097620_100231714
1063 Ga0097620_100608325
1064 Ga0097620_101340696
1065 Ga0075435_100234457
1066 Ga0075435_100242875
1067 Ga0075435_100480617
1068 Ga0075435_100878252
1069 Ga0099794_10007873
1070 Ga0099795_10159973
1071 Ga0105240_10000502
1072 Ga0105240_10029937
1073 Ga0105240_10076767
1074 Ga0105240_10080962
1075 Ga0105240_10082917
1076 Ga0105240_10107400
1077 Ga0105240_10118386
1078 Ga0105240_10228251
1079 Ga0105240_11183033
1080 Ga0111539_10001171
1081 Ga0111539_10215907
1082 Ga0105245_10244256
1083 Ga0105245_10698318
1084 Ga0105245_10799210
1085 Ga0105245_12085602
1086 Ga0105245_12188542
1087 Ga0114129_10008628
1088 Ga0114129_10242805
1089 Ga0114129_10476816
1090 Ga0114129_10785239
1091 Ga0114129_10907305
1092 Ga0114129_12052753
1093 Ga0105241_10008473
1094 Ga0105241_10101334
1095 Ga0105241_10229619
1096 Ga0105241_11479750
1097 Ga0105242_10050017
1098 Ga0105248_10006300
1099 Ga0105248_10176058
1100 Ga0105248_11175766
1101 Ga0105248_11301154
1102 Ga0105237_10111272
1103 Ga0105237_10132276
1104 Ga0105237_10193023
1105 Ga0105237_10494499
1106 Ga0105237_10546756
1107 Ga0105237_10816305
1108 Ga0105238_10004222
1109 Ga0105238_10077633
1110 Ga0105238_12255136
1111 Ga0105249_10513401
1112 Ga0105249_10640386
1113 Ga0099796_10164013
1114 Ga0099796_10381656
1115 Ga0105239_10010853
1116 Ga0105239_10212390
1117 Ga0105239_10709322
1118 Ga0105239_10791388
1119 Ga0105239_12041267
1120 Ga0105246_10486955
1121 Ga0105246_10724406
1122 Ga0157373_10016821
1123 Ga0157373_10524501
1124 Ga0157370_10000003
1125 Ga0157370_10244900
1126 Ga0157370_10356146
1127 Ga0157370_10514451
1128 Ga0157370_11163715
1129 Ga0157369_10000411
1130 Ga0157369_10009687
1131 Ga0157369_10011043
1132 Ga0157369_10013414
1133 Ga0157369_10013501
1134 Ga0157369_10093436
1135 Ga0157369_10114435
1136 Ga0157369_10118201
1137 Ga0157369_10857506
1138 Ga0157374_10001116
1139 Ga0157374_10134820
1140 Ga0157374_10173441
1141 Ga0157374_10638482
1142 Ga0157374_10894215
1143 Ga0157378_10000055
1144 Ga0157378_10412253
1145 Ga0157378_10575758
1146 Ga0157378_11051009
1147 Ga0157378_11256812
1148 Ga0163162_10167855
1149 Ga0163162_12211055
1150 Ga0157372_10000226
1151 Ga0157372_10000778
1152 Ga0157372_10000992
1153 Ga0157372_10001764
1154 Ga0157372_10028433
1155 Ga0157372_10092374
1156 Ga0157372_10124111
1157 Ga0157372_10323994
1158 Ga0157372_10400878
1159 Ga0157372_10466332
1160 Ga0157372_11439436
1161 Ga0157375_10078641
1162 Ga0157375_10275724
1163 Ga0157375_10792040
1164 Ga0163163_10061187
1165 Ga0163163_10093120
1166 Ga0163163_10521147
1167 Ga0157380_10156699
1168 Ga0157380_10222393
1169 Ga0182008_10033186
1170 Ga0157377_10072869
1171 Ga0157377_10279171
1172 Ga0157379_10318422
1173 Ga0157379_10341687
1174 Ga0157379_10820861
1175 Ga0157379_10896117
1176 Ga0157376_10001809
1177 Ga0157376_10014953
1178 Ga0157376_10168875
1179 Ga0157376_10597445
1180 Ga0157376_10606335
1181 Ga0157376_11630497
1182 Ga0157376_11715328
1183 Ga0197907_11406739
1184 Ga0206356_10074695
1185 Ga0206356_11085863
1186 Ga0206349_1087972
1187 Ga0206349_1141559
1188 Ga0206349_1775809
1189 Ga0206352_10378737
1190 Ga0206352_10864904
1191 Ga0206350_10077709
1192 Ga0206350_10099212
1193 Ga0206350_10607173
1194 Ga0206353_11209812
1195 Ga0154015_1151287
1196 Ga0213874_10017894
1197 Ga0213874_10217297
1198 Ga0213876_10031266
1199 Ga0213876_10181802
1200 Ga0213875_10327909
1201 Ga0228598_1025444
1202 Ga0209148_1013844
1203 Ga0207692_10034412
1204 Ga0207692_10185572
1205 Ga0207642_10124007
1206 Ga0207647_10036256
1207 Ga0207685_10000014
1208 Ga0207699_10000012
1209 Ga0207699_10004883
1210 Ga0207643_10040635
1211 Ga0207643_10060020
1212 Ga0207705_10441610
1213 Ga0207684_10004424
1214 Ga0207684_10155385
1215 Ga0207684_10959598
1216 Ga0207684_11539114
1217 Ga0207654_10339888
1218 Ga0207707_10015054
1219 Ga0207707_10359947
1220 Ga0207707_10729466
1221 Ga0207695_10000438
1222 Ga0207695_10000601
1223 Ga0207695_10007383
1224 Ga0207695_10060771
1225 Ga0207695_10068148
1226 Ga0207695_10319290
1227 Ga0207695_10321793
1228 Ga0207695_10547160
1229 Ga0207695_10691278
1230 Ga0207695_11041866
1231 Ga0207671_10261312
1232 Ga0207693_10000728
1233 Ga0207693_10010173
1234 Ga0207693_10080388
1235 Ga0207693_10126282
1236 Ga0207663_10033085
1237 Ga0207663_10351153
1238 Ga0207663_10635853
1239 Ga0207660_10267206
1240 Ga0207660_10315715
1241 Ga0207660_10450337
1242 Ga0207662_10024882
1243 Ga0207662_10076193
1244 Ga0207662_10235854
1245 Ga0207657_10335799
1246 Ga0207652_10012480
1247 Ga0207652_10075078
1248 Ga0207652_10090965
1249 Ga0207652_10155213
1250 Ga0207652_10702121
1251 Ga0207652_11742858
1252 Ga0207652_11883760
1253 Ga0207646_10189777
1254 Ga0207646_10306330
1255 Ga0207646_10383829
1256 Ga0207646_10767794
1257 Ga0207681_10139570
1258 Ga0207681_10148389
1259 Ga0207681_11138494
1260 Ga0207681_11249998
1261 Ga0207694_10019779
1262 Ga0207694_10217571
1263 Ga0207694_11231379
1264 Ga0207659_10098866
1265 Ga0207659_10316079
1266 Ga0207659_11523282
1267 Ga0207687_10766935
1268 Ga0207700_10000485
1269 Ga0207700_10187181
1270 Ga0207700_10444387
1271 Ga0207664_10142099
1272 Ga0207664_10269606
1273 Ga0207664_10612123
1274 Ga0207690_10797574
1275 Ga0207706_10229394
1276 Ga0207670_10066129
1277 Ga0207669_10039929
1278 Ga0207669_10095440
1279 Ga0207704_10139727
1280 Ga0207704_11615254
1281 Ga0207704_11662827
1282 Ga0207704_11746195
1283 Ga0207665_10004319
1284 Ga0207665_10067596
1285 Ga0207665_10317270
1286 Ga0207665_10899137
1287 Ga0207711_10011129
1288 Ga0207711_10050170
1289 Ga0207711_11616364
1290 Ga0207661_10002167
1291 Ga0207661_10073819
1292 Ga0207661_10082034
1293 Ga0207661_10112745
1294 Ga0207661_10181246
1295 Ga0207661_10407403
1296 Ga0207661_11347642
1297 Ga0207661_12012189
1298 Ga0207679_10061118
1299 Ga0207679_10233088
1300 Ga0207679_11551287
1301 Ga0207667_10001848
1302 Ga0207667_10028080
1303 Ga0207667_10028330
1304 Ga0207667_10595326
1305 Ga0207667_11539677
1306 Ga0207651_10064324
1307 Ga0207712_10411456
1308 Ga0207668_10085141
1309 Ga0207640_10104010
1310 Ga0207640_10249561
1311 Ga0207640_10357560
1312 Ga0207640_11924084
1313 Ga0207658_10516299
1314 Ga0207658_11075367
1315 Ga0207658_11253400
1316 Ga0207677_10007668
1317 Ga0207677_12244698
1318 Ga0207703_10097432
1319 Ga0207678_10709147
1320 Ga0207708_10144286
1321 Ga0207708_10184628
1322 Ga0207708_11165145
1323 Ga0207702_10004696
1324 Ga0207702_10012969
1325 Ga0207702_10022667
1326 Ga0207702_10691020
1327 Ga0207702_10703238
1328 Ga0207702_11031842
1329 Ga0207702_11087811
1330 Ga0207702_11589937
1331 Ga0207641_10027865
1332 Ga0207641_10055360
1333 Ga0207641_10342780
1334 Ga0207648_10016054
1335 Ga0207676_10045750
1336 Ga0207676_10264394
1337 Ga0207675_100163538
1338 Ga0207675_100226825
1339 Ga0207683_10260646
1340 Ga0207698_10000017
1341 Ga0207698_10484950
1342 Ga0207698_10731081
1343 Ga0207698_11652122
1344 Ga0209179_1033832
1345 Ga0209588_1000347
1346 Ga0209813_10036206
1347 Ga0207428_10012254
1348 Ga0207428_10053441
1349 Ga0268266_10030441
1350 Ga0307517_10054602
1351 Ga0307515_10597929
1352 Ga0265338_10001065
1353 Ga0265338_10037851
1354 Ga0265338_10080387
1355 Ga0265338_10100224
1356 Ga0265338_10224783
1357 Ga0265338_10268165
1358 Ga0265324_10300741
1359 Ga0265762_1102381
1360 Ga0265762_1139800
1361 Ga0265760_10000633
1362 Ga0265330_10000318
1363 Ga0265332_10010251
1364 Ga0265332_10012316
1365 Ga0265328_10013760
1366 Ga0265328_10034957
1367 Ga0265325_10000057
1368 Ga0265325_10000556
1369 Ga0265325_10054273
1370 Ga0265329_10277860
1371 Ga0265340_10000034
1372 Ga0265340_10336406
1373 Ga0265339_10003367
1374 Ga0265339_10024335
1375 Ga0265339_10028700
1376 Ga0265339_10069913
1377 Ga0265331_10110933
1378 Ga0265327_10376787
1379 Ga0265316_10030329
1380 Ga0265316_10041539
1381 Ga0265316_10060061
1382 Ga0265316_10111767
1383 Ga0265316_10169655
1384 Ga0307509_10264526
1385 Ga0265313_10000001
1386 Ga0265313_10206902
1387 Ga0265314_10000033
1388 Ga0265314_10002726
1389 Ga0265314_10005213
1390 Ga0265314_10022455
1391 Ga0265342_10001280
1392 Ga0265342_10279688
1393 Ga0265342_10377910
1394 Ga0307406_11730476
1395 Ga0307407_10647769
1396 Ga0307507_10031897
1397 Ga0373926_0086063
1398 Ga0373934_0043428
1399 Ga0373934_0243257
1400 Ga0373923_0129159
1401 Ga0373936_0000019
1402 Ga0373941_0237673
1403 Ga0373945_0089905
1404 Ga0373953_0019700
1405 Ga0373953_0029630
1406 Ga0373954_0002403
1407 Ga0373954_0009943
1408 Ga0373954_0050991
1409 Ga0373954_0421782
1410 Ga0373956_0009804
1411 Ga0373956_0032621
1412 Ga0373956_0319323
1413 Ga0373943_0002010
1414 Ga0373943_0014720
1415 Ga0373943_0017655
1416 Ga0373943_0078305
1417 Ga0373946_0265945
1418 Ga0373946_0409863
1419 Ga0373955_0002992
1420 Ga0373955_0014829
1421 Ga0373924_0003256
1422 Ga0373924_0508232
1423 Ga0373931_0016813
1424 Ga0373935_0058873
1425 Ga0373935_0150702
1426 Ga0373933_0018640
1427 Ga0373933_0029878
1428 Ga0373933_0085631
1429 Ga0373933_0241925
1430 Ga0373933_0891989
1431 Ga0373947_0065044
1432 Ga0373947_0236801
1433 Ga0373947_0336451
1434 Ga0373937_0003715
1435 Ga0373937_0067231
1436 Ga0373937_0300670
1437 Ga0373937_0628505
1438 Ga0373937_0900261
1439 Ga0373925_0002572
1440 Ga0373925_0013725
1441 Ga0373925_0044057
1442 Ga0373925_0186338
1443 Ga0373925_0206365
1444 Ga0373925_0472851
1445 Ga0373925_1540590
1446 Ga0395899_0935334
1447 Ga0395900_0439394
1448 Ga0395898_0407333
1449 Ga0395905_0584042
1450 Ga0395905_0644908
1451 Ga0395905_0741059
1452 Ga0395905_1725156
1453 Ga0436364_0218310
1454 Ga0436364_0224412
1455 Ga0436364_0393414
1456 Ga0436364_0433388
1457 Ga0436364_0563263
1458 Ga0436364_0665489
1459 Ga0436364_0765972
1460 Ga0436364_0949486
1461 Ga0395901_0994891
1462 Ga0395901_0997542
1463 Ga0436365_0305842
1464 Ga0436365_0550717
1465 Ga0436365_0750887
1466 Ga0436365_1259721
1467 Ga0436365_1305789
1468 Ga0436365_1472390
1469 Ga0436360_0041073
1470 Ga0436360_0072657
1471 Ga0436360_0501260
1472 Ga0436360_0655440
1473 Ga0436360_0749681
1474 Ga0436360_0962901
1475 Ga0436360_1026804
1476 Ga0436360_1350811
1477 Ga0436361_0439291
1478 Ga0436361_0494835
1479 Ga0436361_0999823
1480 Ga0436363_0143555
1481 Ga0436363_0197920
1482 Ga0436363_0393655
1483 Ga0436363_0626676
1484 Ga0436363_0885616
1485 Ga0436363_0959752
1486 Ga0436362_0058185
1487 Ga0436362_0132219
1488 Ga0436362_0569629
1489 Ga0436362_0762569
1490 Ga0436362_0989829
1491 Ga0451853_0830407
1492 Ga0466966_0333294
1493 Ga0466967_0007004
1494 Ga0466967_2249125
1495 Ga0495592_0071709
1496 Ga0495592_0261878
1497 Ga0495592_0815660
1498 Ga0495603_0422058
1499 Ga0495590_0112122
1500 Ga0495629_1133269
1501 Ga0495641_0098326
1502 Ga0495651_0115189
1503 Ga0495651_0169624
1504 Ga0495653_0008912
1505 Ga0495653_0979314
1506 Ga0495580_0007551
1507 Ga0495580_0022268
1508 Ga0495580_0030195
1509 Ga0495580_0168574
1510 Ga0495580_0237689
1511 Ga0495580_0316430
1512 Ga0495582_0006903
1513 Ga0495582_0056175
1514 Ga0495639_0061925
1515 Ga0495664_0654701
1516 Ga0495664_0946489
1517 Ga0495594_0073779
1518 Ga0495618_0516952
1519 Ga0495618_0561731
1520 Ga0495618_0706647
1521 Ga0495628_0222076
1522 Ga0495628_0269716
1523 Ga0495630_0454214
1524 Ga0495643_0358412
1525 Ga0495652_0023483
1526 Ga0495665_0058778
1527 Ga0495640_0045958
1528 Ga0495587_0168283
1529 Ga0495587_0516975
1530 Ga0495645_0114889
1531 Ga0495645_0231593
1532 Ga0495667_0023276
1533 Ga0495667_0559360
1534 Ga0495667_0571162
1535 Ga0495656_0277992
1536 Ga0495634_0092910
1537 Ga0495634_0613323
1538 Ga0495635_0013355
1539 Ga0495635_0232030
1540 Ga0495657_0008675
1541 Ga0495657_0379423
1542 Ga0495599_0042370
1543 Ga0495599_0199794
1544 Ga0495623_0055909
1545 Ga0495646_0087655
1546 Ga0495647_0485931
1547 Ga0495658_0432458
1548 Ga0495613_0089659
1549 Ga0495613_0351590
1550 Ga0495600_0093859
1551 Ga0495604_0017915
1552 Ga0495604_0155374
1553 Ga0495674_0120469
1554 Ga0495674_0290822
1555 Ga0495674_0448999
1556 Ga0495680_0018594
1557 Ga0495680_0809861
1558 Ga0495675_0013918
1559 Ga0495675_0743154
1560 Ga0495684_0069511
1561 Ga0495684_0473386
1562 Ga0495684_0691207
1563 Ga0495686_0002643
1564 Ga0495686_0003457
1565 Ga0495593_0398820
1566 Ga0495602_0132144
1567 Ga0495602_0271429
1568 Ga0495614_0530785
1569 Ga0496100_0123195
1570 Ga0496100_0128835
1571 Ga0496100_0727746
1572 Ga0496100_0876154
1573 Ga0496100_1479021
1574 Ga0496101_0111802
1575 Ga0496101_0430147
1576 Ga0496102_0204993
1577 Ga0496102_1519950
1578 Ga0496102_1884936
1579 Ga0496103_0119949
1580 Ga0496104_0020343
1581 Ga0496104_0059371
1582 Ga0496104_0080966
1583 Ga0496104_0159786
1584 Ga0496104_0296111
1585 Ga0496104_0458505
1586 Ga0496104_0608247
1587 Ga0496104_0634852
1588 Ga0496104_0699898
1589 Ga0496105_0115131
1590 Ga0496105_0151772
1591 Ga0496105_0250263
1592 Ga0496106_0095411
1593 Ga0496107_0112485
1594 Ga0496107_0342887
1595 Ga0496107_0798832
1596 Ga0496108_1365680
1597 Ga0496109_0167772
1598 Ga0496109_0303676
1599 Ga0496109_2029842
1600 Ga0496110_0203060
1601 Ga0496110_0464566
1602 Ga0496111_0338366
1603 Ga0496112_0065350
1604 Ga0496112_0577592
1605 Ga0496112_0624975
1606 Ga0496112_0682815
1607 Ga0496113_0431429
1608 Ga0496113_0832233
1609 Ga0496114_0002821
1610 Ga0496115_0013816
1611 Ga0496115_0054119
1612 Ga0496115_0085448
1613 Ga0496115_0089891
1614 Ga0496115_0570835
1615 Ga0496115_0685285
1616 Ga0496120_0142348
1617 Ga0496122_0605383
1618 Ga0501032_1082460
1619 Ga0501040_0097023
1620 Ga0501041_0102869
1621 Ga0501042_0130644
1622 Ga0501042_0302113
1623 Ga0501043_0268584
1624 Ga0501047_0013018
1625 Ga0501070_0128468
1626 Ga0501071_0125180
1627 Ga0501072_0329171
1628 Ga0501072_1113730
1629 Ga0501075_0143358
1630 Ga0501077_0091821
1631 Ga0501081_0444500
1632 Ga0501083_0049311
1633 Ga0501267_002675
1634 Ga0501044_0014787
1635 nmdc:mga03683_201254_c1
1636 nmdc:mga03n38_16046_c1
1637 nmdc:mga03n38_303717_c1
1638 nmdc:mga00v17_275713_c1
1639 nmdc:mga00v17_750224_c1
1640 nmdc:mga0yw44_499349_c1
1641 nmdc:mga06z11_1472_c1
1642 nmdc:mga06z11_472396_c1
1643 nmdc:mga04h51_31928_c1
1644 nmdc:mga07m45_41120_c1
1645 nmdc:mga05p37_139888_c1
1646 nmdc:mga05p37_387897_c1
1647 nmdc:mga05p37_625811_c1
1648 nmdc:mga05p37_75180_c1
1649 nmdc:mga09592_128301_c1
1650 nmdc:mga09592_1625546_c1
1651 nmdc:mga09592_346028_c1
1652 nmdc:mga0qj67_1431309_c1
1653 nmdc:mga0qj67_174148_c1
1654 nmdc:mga0qj67_506981_c1
1655 nmdc:mga06r32_109232_c1
1656 nmdc:mga06r32_1261825_c1
1657 nmdc:mga08y16_14939_c1
1658 nmdc:mga08y16_5092_c1
1659 nmdc:mga08y16_645140_c1
1660 nmdc:mga08y16_896592_c1
1661 nmdc:mga0n895_12675_c1
1662 nmdc:mga0n895_249737_c1
1663 nmdc:mga0rr50_125608_c1
1664 nmdc:mga0rr50_266741_c1
1665 nmdc:mga0rr50_876786_c1
1666 nmdc:mga08x19_294064_c1
1667 nmdc:mga08x19_318438_c1
1668 nmdc:mga08x19_371457_c1
1669 nmdc:mga0a205_177820_c1
1670 nmdc:mga0a205_762268_c1
1671 Ga0495601_1079194
1672 Ga0495612_0557656
1673 Ga0495595_0089408
1674 Ga0500578_0411788
1675 Ga0500646_0002217
1676 Ga0500566_0001824
1677 Ga0500562_109910
1678 Ga0500652_191092
1679 Ga0500568_0037862
1680 Ga0500585_182119
1681 Ga0500603_023057
1682 Ga0500604_0191866
1683 Ga0500622_0111026
1684 Ga0500622_0275526
1685 Ga0500639_118710
1686 Ga0500636_0164578
1687 Ga0587094_130750
1688 Ga0587115_102733
1689 Ga0587075_102023
1690 2694637199
1691 2869164955
1692 2874126307
1693 2903450797
1694 2924764348
1695 2937854120
1696 2968087948
1697 2977927466
1698 2977989318
1699 2987672806
1700 3004215788
1701 3004224565
1702 3004335051

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

2

118

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
4g6x-assembly1.cif.gz_A-2 crystal structure of glyoxalase/bleomycin resistance protein from catenulispora acidiphila. 0.8828 1 127
4g6x-assembly1.cif.gz_A-2 crystal structure of glyoxalase/bleomycin resistance protein from catenulispora acidiphila. 0.8639 1 127
2awn-assembly2.cif.gz_C crystal structure of the adp-mg-bound e. coli malk (crystallized with atp-mg) 0.8158 26 56
1v43-assembly1.cif.gz_A crystal structure of atpase subunit of abc sugar transporter 0.8055 26 56
1b9m-assembly1.cif.gz_A regulator from escherichia coli 0.7984 26 56
ID Description Score Start End Superfamily
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9324 79 124 3.30.720.110
4g6xA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.887 2 127 3.10.180.10
4g6xA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8672 2 127 3.10.180.10
af_Q4CX66_32_543_2.140.10.30 Mainly Beta;8 Propeller;Methanol Dehydrogenase; Chain A;Dipeptidylpeptidase IV, N-terminal domain 0.8413 26 56 2.140.10.30
af_P37009_273_344_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8349 26 56 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A0B8NSP5-F1-model_v4 Glyoxalase 0.9903 60 128
AF-A0A7Y2BBA9-F1-model_v4 VOC family protein 0.9826 64 128
AF-A0A1H4CK38-F1-model_v4 Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily protein 0.9785 74 128 GO:0051213
AF-A0A1G5PUD0-F1-model_v4 Glyoxalase-like domain-containing protein 0.9772 58 126
AF-A0A3L8PAT6-F1-model_v4 VOC family protein 0.9757 74 129

Map