F483466

General Info

Members Datasets Scaffolds Average Seq Length
851 472 1702 149

Family's Representative Sequence

Representative Sequence 3300035113|Ga0373936_0010947|Ga0373936_0010947_1047_1583
Length 178
Sequence MIERFPAKWVPVRGLRKHVKITSECKSSVLAMPRILKALFVLLAGSGAAEAGFRSPESLVRNVYAYYGHGVPELSKGLPRDEATARQFFDPSLRTPWRAVKSEPYDFLVQSPTWKLSAISISILRKQFDKTYVAVAFDNNGRAVTLNFILVNGPEGWVITDVESPHDSLRMFLDQFKN

Samples

Sample ID Description Type Environment
1 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
7 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
8 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
9 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
10 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
67 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
70 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
71 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
72 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
73 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
74 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
75 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
76 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
77 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
78 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
79 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
84 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
87 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
88 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
110 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
111 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
112 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
113 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
115 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
116 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
117 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
118 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
119 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
122 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
124 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
125 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
126 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
186 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
190 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
191 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
192 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
193 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
194 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
195 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
196 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
197 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
198 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
199 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
200 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
201 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
202 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
203 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
204 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
205 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
206 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
207 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
208 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
209 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
210 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
211 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
212 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
213 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
214 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
215 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
216 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
217 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
218 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
219 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
220 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
221 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
222 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
223 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
224 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
225 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
226 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
227 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
228 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
229 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
230 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
231 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
232 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
233 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
234 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
235 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
236 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
237 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
238 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
239 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
240 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
241 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
242 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
243 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
244 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
245 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
246 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
247 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
248 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
249 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
250 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
251 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
252 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
253 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
254 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
255 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
256 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
257 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
258 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
259 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
260 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
261 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
262 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
263 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
264 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
265 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
266 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
267 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
268 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
269 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
270 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
271 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
272 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
273 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
274 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
275 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
276 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
277 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
278 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
279 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
280 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
281 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
282 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
283 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
284 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
285 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
286 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
287 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
288 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
289 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
290 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
291 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
292 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
293 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
294 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
295 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
296 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
297 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
298 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
299 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
300 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
301 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
302 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
303 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
304 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
305 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
306 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
307 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
308 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
309 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
310 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
311 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
312 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
313 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
314 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
315 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
316 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
317 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
318 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
319 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
320 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
321 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
322 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
323 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
324 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
325 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
326 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
327 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
328 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
329 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
330 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
331 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
332 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
333 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
334 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
335 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
336 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
337 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
338 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
339 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
340 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
341 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
342 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
343 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
344 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
345 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
346 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
347 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
348 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
349 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
350 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
351 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
352 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
353 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
354 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
355 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
356 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
357 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
358 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
359 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
360 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
361 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
362 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
363 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
364 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
365 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
366 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
367 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
368 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
369 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
370 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
371 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
372 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
373 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
374 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
375 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
376 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
377 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
378 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
379 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
380 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
381 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
382 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
383 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
384 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
385 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
386 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
387 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
388 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
389 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
390 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
391 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
392 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
393 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
394 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
395 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
396 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
397 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
398 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
399 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
400 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
401 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
402 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
403 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
404 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
405 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
406 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
407 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
408 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
409 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
410 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
411 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
412 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
413 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
414 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
415 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
416 2922368715
417 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
418 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
419 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
420 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
421 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
422 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
423 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
424 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
425 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
426 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
427 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
428 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
429 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
430 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
431 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
432 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
433 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
434 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
435 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
436 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
437 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
438 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
439 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
440 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
441 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
442 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
443 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
444 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
445 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
446 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
447 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
448 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
449 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
450 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
451 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
452 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
453 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
454 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
455 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
456 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
457 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
458 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
459 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
460 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
461 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
462 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
463 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
464 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
465 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
466 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
467 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
468 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
469 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
470 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
471 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
472 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 89.41
Metatranscriptomes 0.35
Isolates 10.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.05
Nodule 8.58
Rhizoplane 4.7
Rhizosphere 70.15
Stem 0
Stem Tuber 0
Unclassified 0.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373936_0010947 3300035113 Bacteria 3428
2 JGI24739J22299_10091298 3300001989 Bacteria 927
3 JGI24737J22298_10016044 3300001990 Bacteria 2419
4 JGI24735J21928_10038934 3300002067 Bacteria 1391
5 rootH1_10030664 3300003323 Bacteria 1169
6 JGI25404J52841_10052526 3300003659 Bacteria 856
7 Ga0055539_1004110 3300003752 Bacteria 1961
8 Ga0055531_10007309 3300003794 Bacteria 6054
9 JGI25405J52794_10038633 3300003911 Bacteria 1006
10 Ga0065165_1002064 3300005262 Bacteria 18557
11 Ga0065165_1003028 3300005262 Bacteria 12656
12 Ga0065165_1011888 3300005262 Bacteria 3585
13 Ga0070683_100040860 3300005329 Bacteria 4264
14 Ga0070683_100124983 3300005329 Bacteria 2431
15 Ga0070690_100058433 3300005330 Bacteria 2476
16 Ga0070670_100107660 3300005331 Bacteria 2402
17 Ga0068869_100087092 3300005334 Bacteria 2343
18 Ga0070680_100031351 3300005336 Bacteria 4273
19 Ga0070680_100473502 3300005336 Bacteria 1070
20 Ga0070682_100305720 3300005337 Bacteria 1169
21 Ga0070682_100343976 3300005337 Bacteria 1109
22 Ga0070682_100509814 3300005337 Bacteria 934
23 Ga0068868_100085706 3300005338 Bacteria 2531
24 Ga0070660_100027520 3300005339 Bacteria 4244
25 Ga0070660_100129460 3300005339 Bacteria 2019
26 Ga0070660_100501466 3300005339 Bacteria 1010
27 Ga0070691_10573157 3300005341 Bacteria 662
28 Ga0070687_100041461 3300005343 Bacteria 2327
29 Ga0070661_100215591 3300005344 Bacteria 1470
30 Ga0070661_100356765 3300005344 Bacteria 1148
31 Ga0070668_100230921 3300005347 Bacteria 1529
32 Ga0070668_100412166 3300005347 Bacteria 1155
33 Ga0070668_100514727 3300005347 Bacteria 1037
34 Ga0070669_100058994 3300005353 Bacteria 2817
35 Ga0070675_101030109 3300005354 Bacteria 756
36 Ga0070671_100021774 3300005355 Bacteria 5235
37 Ga0070671_100147730 3300005355 Bacteria 1985
38 Ga0070671_100533911 3300005355 Bacteria 1011
39 Ga0070671_101064369 3300005355 Bacteria 710
40 Ga0070674_100026402 3300005356 Bacteria 3793
41 Ga0070673_101206916 3300005364 Bacteria 709
42 Ga0070688_100118979 3300005365 Bacteria 1766
43 Ga0070659_100449371 3300005366 Bacteria 1093
44 Ga0070659_100746086 3300005366 Bacteria 849
45 Ga0070667_100274030 3300005367 Bacteria 1513
46 Ga0070709_10003840 3300005434 Bacteria 8090
47 Ga0070709_10006030 3300005434 Bacteria 6590
48 Ga0070709_10034153 3300005434 Bacteria 3082
49 Ga0070709_10524665 3300005434 Bacteria 903
50 Ga0070709_10830575 3300005434 Bacteria 727
51 Ga0070714_100025373 3300005435 Bacteria 4892
52 Ga0070714_100088472 3300005435 Bacteria 2710
53 Ga0070714_100829796 3300005435 Bacteria 896
54 Ga0070714_101411891 3300005435 Bacteria 680
55 Ga0070713_100002496 3300005436 Bacteria 12016
56 Ga0070713_100057994 3300005436 Bacteria 3227
57 Ga0070713_100285328 3300005436 Bacteria 1516
58 Ga0070713_100416342 3300005436 Bacteria 1257
59 Ga0070713_100601560 3300005436 Bacteria 1045
60 Ga0070710_10000607 3300005437 Bacteria 17023
61 Ga0070710_10002006 3300005437 Bacteria 9630
62 Ga0070710_10039407 3300005437 Bacteria 2600
63 Ga0070701_10054370 3300005438 Bacteria 2087
64 Ga0070711_100000904 3300005439 Bacteria 15636
65 Ga0070711_100002935 3300005439 Bacteria 9827
66 Ga0070711_100021030 3300005439 Bacteria 4214
67 Ga0070700_100101709 3300005441 Bacteria 1894
68 Ga0070708_100066842 3300005445 Bacteria 3227
69 Ga0070663_100037233 3300005455 Bacteria 3385
70 Ga0070663_100104110 3300005455 Bacteria 2122
71 Ga0070663_100274921 3300005455 Bacteria 1340
72 Ga0070663_100358876 3300005455 Bacteria 1182
73 Ga0070663_101312097 3300005455 Bacteria 639
74 Ga0070662_100067380 3300005457 Bacteria 2628
75 Ga0070662_100076992 3300005457 Bacteria 2474
76 Ga0070662_100258865 3300005457 Bacteria 1401
77 Ga0070681_10052349 3300005458 Bacteria 4071
78 Ga0070681_10128829 3300005458 Bacteria 2463
79 Ga0068867_100053065 3300005459 Bacteria 2993
80 Ga0070706_100564756 3300005467 Bacteria 1058
81 Ga0070706_102128892 3300005467 Bacteria 507
82 Ga0070707_100214697 3300005468 Bacteria 1875
83 Ga0070698_100154699 3300005471 Bacteria 2239
84 Ga0070679_100022625 3300005530 Bacteria 6145
85 Ga0070679_100048477 3300005530 Bacteria 4232
86 Ga0070684_100049187 3300005535 Bacteria 3658
87 Ga0070684_100096118 3300005535 Bacteria 2640
88 Ga0070684_100845264 3300005535 Bacteria 857
89 Ga0068853_100049149 3300005539 Bacteria 3623
90 Ga0068853_100340807 3300005539 Bacteria 1393
91 Ga0068853_101492193 3300005539 Bacteria 654
92 Ga0070672_100129159 3300005543 Bacteria 2075
93 Ga0070693_100137739 3300005547 Bacteria 1533
94 Ga0070693_100237645 3300005547 Bacteria 1202
95 Ga0070665_100060866 3300005548 Bacteria 3785
96 Ga0070665_100222947 3300005548 Bacteria 1886
97 Ga0070665_100952615 3300005548 Bacteria 871
98 Ga0068855_100023606 3300005563 Bacteria 7366
99 Ga0068855_100080363 3300005563 Bacteria 3780
100 Ga0068855_100562130 3300005563 Bacteria 1234
101 Ga0070664_100932124 3300005564 Bacteria 815
102 Ga0070664_101583659 3300005564 Bacteria 620
103 Ga0068857_100028618 3300005577 Bacteria 4916
104 Ga0068857_100053353 3300005577 Bacteria 3587
105 Ga0068857_100294601 3300005577 Bacteria 1495
106 Ga0068857_100405603 3300005577 Bacteria 1269
107 Ga0068854_100198840 3300005578 Bacteria 1574
108 Ga0068854_100358654 3300005578 Bacteria 1195
109 Ga0068856_100043549 3300005614 Bacteria 4416
110 Ga0070702_100180264 3300005615 Bacteria 1382
111 Ga0068852_100016567 3300005616 Bacteria 5754
112 Ga0068852_100072376 3300005616 Bacteria 3029
113 Ga0068852_100111785 3300005616 Bacteria 2485
114 Ga0068852_100736197 3300005616 Bacteria 998
115 Ga0068864_100356394 3300005618 Bacteria 1381
116 Ga0068866_10160919 3300005718 Bacteria 1309
117 Ga0068866_10171956 3300005718 Bacteria 1272
118 Ga0068851_10000888 3300005834 Bacteria 12916
119 Ga0068851_10241798 3300005834 Bacteria 1021
120 Ga0068863_100801016 3300005841 Bacteria 940
121 Ga0068858_100067277 3300005842 Bacteria 3318
122 Ga0068858_100926238 3300005842 Bacteria 853
123 Ga0068858_101837843 3300005842 Bacteria 599
124 Ga0068860_100194576 3300005843 Bacteria 1963
125 Ga0068860_100475525 3300005843 Bacteria 1245
126 Ga0068860_100910159 3300005843 Bacteria 896
127 Ga0068860_101361342 3300005843 Bacteria 731
128 Ga0068860_101483360 3300005843 Bacteria 700
129 Ga0068862_100059696 3300005844 Bacteria 3275
130 Ga0068862_100788739 3300005844 Bacteria 927
131 Ga0081455_10007525 3300005937 Bacteria 11455
132 Ga0081455_10010928 3300005937 Bacteria 9158
133 Ga0081540_1001581 3300005983 Bacteria 19462
134 Ga0081540_1005915 3300005983 Bacteria 9026
135 Ga0081540_1015842 3300005983 Bacteria 4752
136 Ga0081540_1036276 3300005983 Bacteria 2631
137 Ga0081540_1100207 3300005983 Bacteria 1250
138 Ga0070717_10001732 3300006028 Bacteria 15222
139 Ga0070717_10005433 3300006028 Bacteria 9305
140 Ga0070717_10249039 3300006028 Bacteria 1569
141 Ga0070717_10259321 3300006028 Bacteria 1538
142 Ga0070717_10886638 3300006028 Bacteria 812
143 Ga0070717_11045927 3300006028 Bacteria 744
144 Ga0070717_11301851 3300006028 Bacteria 661
145 Ga0075365_10146550 3300006038 Bacteria 1641
146 Ga0075365_10368954 3300006038 Bacteria 1012
147 Ga0075368_10041297 3300006042 Bacteria 1812
148 Ga0075368_10294074 3300006042 Bacteria 700
149 Ga0075363_100201652 3300006048 Bacteria 1137
150 Ga0075364_10118632 3300006051 Bacteria 1770
151 Ga0070715_10014329 3300006163 Bacteria 2934
152 Ga0070715_10422613 3300006163 Bacteria 746
153 Ga0070716_100021473 3300006173 Bacteria 3403
154 Ga0070716_100101860 3300006173 Bacteria 1762
155 Ga0070716_100200616 3300006173 Bacteria 1326
156 Ga0070716_100394080 3300006173 Bacteria 994
157 Ga0070712_100014960 3300006175 Bacteria 4988
158 Ga0070712_100025629 3300006175 Bacteria 3922
159 Ga0070712_100038446 3300006175 Bacteria 3270
160 Ga0070712_100074997 3300006175 Bacteria 2432
161 Ga0070712_100196732 3300006175 Bacteria 1581
162 Ga0070712_100596502 3300006175 Bacteria 934
163 Ga0075362_10188701 3300006177 Bacteria 1001
164 Ga0075367_10064128 3300006178 Bacteria 2197
165 Ga0075369_10176471 3300006186 Bacteria 982
166 Ga0075369_10261454 3300006186 Bacteria 805
167 Ga0075366_10094965 3300006195 Bacteria 1787
168 Ga0075366_10215403 3300006195 Bacteria 1169
169 Ga0097621_100231744 3300006237 Bacteria 1612
170 Ga0075370_10073969 3300006353 Bacteria 1952
171 Ga0075370_10205757 3300006353 Bacteria 1161
172 Ga0068871_100211336 3300006358 Bacteria 1678
173 Ga0068871_100721007 3300006358 Bacteria 915
174 Ga0068871_102117827 3300006358 Bacteria 536
175 Ga0075434_100124974 3300006871 Bacteria 2590
176 Ga0075436_100217544 3300006914 Bacteria 1355
177 Ga0097620_100188644 3300006931 Bacteria 2146
178 Ga0097620_100279529 3300006931 Bacteria 1762
179 Ga0075435_100099182 3300007076 Bacteria 2412
180 Ga0099794_10026500 3300007265 Bacteria 2680
181 Ga0099794_10125848 3300007265 Bacteria 1292
182 Ga0099794_10127925 3300007265 Bacteria 1281
183 Ga0099795_10077126 3300007788 Bacteria 1268
184 Ga0099795_10449699 3300007788 Bacteria 593
185 Ga0105240_10005415 3300009093 Bacteria 19031
186 Ga0105240_10052328 3300009093 Bacteria 5134
187 Ga0105240_10067914 3300009093 Bacteria 4417
188 Ga0105240_10136088 3300009093 Bacteria 2942
189 Ga0105245_10256723 3300009098 Bacteria 1700
190 Ga0105245_10319691 3300009098 Bacteria 1528
191 Ga0105245_10456309 3300009098 Bacteria 1287
192 Ga0105247_10305129 3300009101 Bacteria 1106
193 Ga0105247_10554970 3300009101 Bacteria 845
194 Ga0105243_10008287 3300009148 Bacteria 7984
195 Ga0105243_10398284 3300009148 Bacteria 1278
196 Ga0105243_10425918 3300009148 Bacteria 1239
197 Ga0105241_10081634 3300009174 Bacteria 2533
198 Ga0105241_10094659 3300009174 Bacteria 2363
199 Ga0105241_10293290 3300009174 Bacteria 1393
200 Ga0105241_10293324 3300009174 Bacteria 1393
201 Ga0105241_10572265 3300009174 Bacteria 1017
202 Ga0105241_10686743 3300009174 Bacteria 933
203 Ga0105242_10113877 3300009176 Bacteria 2310
204 Ga0105242_10114610 3300009176 Bacteria 2303
205 Ga0105248_10305894 3300009177 Bacteria 1790
206 Ga0105237_10003346 3300009545 Bacteria 19082
207 Ga0105237_10041885 3300009545 Bacteria 4617
208 Ga0105237_10113956 3300009545 Bacteria 2696
209 Ga0105237_10218096 3300009545 Bacteria 1908
210 Ga0105237_10230610 3300009545 Bacteria 1852
211 Ga0105237_10416824 3300009545 Bacteria 1348
212 Ga0105237_10756586 3300009545 Bacteria 978
213 Ga0105238_10010310 3300009551 Bacteria 9377
214 Ga0105238_10020057 3300009551 Bacteria 6805
215 Ga0105238_10044073 3300009551 Bacteria 4512
216 Ga0105238_10062848 3300009551 Bacteria 3713
217 Ga0105238_10116241 3300009551 Bacteria 2654
218 Ga0105238_10158595 3300009551 Bacteria 2238
219 Ga0105238_10577187 3300009551 Bacteria 1131
220 Ga0105238_11709538 3300009551 Bacteria 660
221 Ga0105238_12957057 3300009551 Bacteria 511
222 Ga0105249_10228299 3300009553 Bacteria 1835
223 Ga0099796_10024478 3300010159 Bacteria 1896
224 Ga0099796_10064790 3300010159 Bacteria 1305
225 Ga0105239_10008096 3300010375 Bacteria 11998
226 Ga0105239_10028412 3300010375 Bacteria 6152
227 Ga0105239_10085079 3300010375 Bacteria 3485
228 Ga0105239_10113299 3300010375 Bacteria 3008
229 Ga0105239_10208187 3300010375 Bacteria 2192
230 Ga0105239_10209832 3300010375 Bacteria 2183
231 Ga0105239_10344459 3300010375 Bacteria 1682
232 Ga0105239_10543450 3300010375 Bacteria 1323
233 Ga0105239_11497596 3300010375 Bacteria 780
234 Ga0105246_10216489 3300011119 Bacteria 1498
235 Ga0105246_11448542 3300011119 Bacteria 643
236 Ga0157369_10024515 3300013105 Bacteria 6709
237 Ga0157369_10161085 3300013105 Bacteria 2368
238 Ga0157374_10047745 3300013296 Bacteria 3971
239 Ga0157374_10481073 3300013296 Bacteria 1245
240 Ga0157374_11824708 3300013296 Bacteria 633
241 Ga0157378_10003448 3300013297 Bacteria 14024
242 Ga0157378_10161244 3300013297 Bacteria 2097
243 Ga0163162_10045197 3300013306 Bacteria 4412
244 Ga0157372_10358137 3300013307 Bacteria 1700
245 Ga0157372_10628709 3300013307 Bacteria 1251
246 Ga0157375_10005190 3300013308 Bacteria 11302
247 Ga0157375_10089512 3300013308 Bacteria 3134
248 Ga0157375_10104173 3300013308 Bacteria 2925
249 Ga0163163_10010706 3300014325 Bacteria 8267
250 Ga0163163_10099004 3300014325 Bacteria 2937
251 Ga0163163_10526889 3300014325 Bacteria 1244
252 Ga0157377_10179359 3300014745 Bacteria 1331
253 Ga0157379_10464139 3300014968 Bacteria 1170
254 Ga0157376_10153341 3300014969 Bacteria 2080
255 Ga0157376_11232003 3300014969 Bacteria 777
256 Ga0163161_10052359 3300017792 Bacteria 2959
257 Ga0163161_10346266 3300017792 Bacteria 1180
258 Ga0206353_11025617 3300020082 Bacteria 855
259 Ga0213873_10212344 3300021358 Bacteria 603
260 Ga0213872_10038195 3300021361 Bacteria 2192
261 Ga0213872_10103194 3300021361 Bacteria 1270
262 Ga0213876_10002435 3300021384 Bacteria 10949
263 Ga0213876_10114703 3300021384 Bacteria 1430
264 Ga0213876_10279873 3300021384 Bacteria 887
265 Ga0213871_10001476 3300021441 Bacteria 3962
266 Ga0207425_1014481 3300025245 Bacteria 1790
267 Ga0209677_103183 3300025253 Bacteria 5513
268 Ga0209148_1000679 3300025254 Bacteria 28441
269 Ga0209233_1025388 3300025261 Bacteria 1466
270 Ga0209455_1002958 3300025272 Bacteria 6248
271 Ga0209455_1018963 3300025272 Bacteria 1400
272 Ga0209455_1027494 3300025272 Bacteria 1007
273 Ga0209758_1000216 3300025297 Bacteria 125352
274 Ga0209758_1006973 3300025297 Bacteria 7875
275 Ga0209758_1024661 3300025297 Bacteria 2672
276 Ga0209758_1113837 3300025297 Bacteria 743
277 Ga0209256_1083170 3300025299 Bacteria 695
278 Ga0207426_1000688 3300025302 Bacteria 40584
279 Ga0207426_1057927 3300025302 Bacteria 1126
280 Ga0207426_1059836 3300025302 Bacteria 1100
281 Ga0209257_1001523 3300025304 Bacteria 27079
282 Ga0209257_1024969 3300025304 Bacteria 2054
283 Ga0207697_10046184 3300025315 Bacteria 1793
284 Ga0207697_10108459 3300025315 Bacteria 1188
285 Ga0207697_10120574 3300025315 Bacteria 1128
286 Ga0207656_10466189 3300025321 Bacteria 639
287 Ga0207692_10000383 3300025898 Bacteria 15330
288 Ga0207692_10062604 3300025898 Bacteria 1931
289 Ga0207692_10387815 3300025898 Bacteria 868
290 Ga0207642_10012609 3300025899 Bacteria 3058
291 Ga0207688_10032741 3300025901 Bacteria 2874
292 Ga0207688_10034652 3300025901 Bacteria 2796
293 Ga0207688_10252964 3300025901 Bacteria 1067
294 Ga0207647_10050890 3300025904 Bacteria 2563
295 Ga0207647_10433157 3300025904 Bacteria 738
296 Ga0207685_10174219 3300025905 Bacteria 992
297 Ga0207699_10001709 3300025906 Bacteria 10396
298 Ga0207699_10082450 3300025906 Bacteria 1998
299 Ga0207699_10089510 3300025906 Bacteria 1929
300 Ga0207699_10144955 3300025906 Bacteria 1565
301 Ga0207699_10273618 3300025906 Bacteria 1171
302 Ga0207699_11161572 3300025906 Bacteria 572
303 Ga0207699_11217348 3300025906 Bacteria 558
304 Ga0207705_10030470 3300025909 Bacteria 3850
305 Ga0207705_10552231 3300025909 Bacteria 895
306 Ga0207684_10097074 3300025910 Bacteria 2515
307 Ga0207654_10132583 3300025911 Bacteria 1579
308 Ga0207654_10444038 3300025911 Bacteria 909
309 Ga0207707_10080205 3300025912 Bacteria 2850
310 Ga0207707_10085916 3300025912 Bacteria 2749
311 Ga0207707_10167475 3300025912 Bacteria 1920
312 Ga0207695_10000599 3300025913 Bacteria 72238
313 Ga0207695_10060594 3300025913 Bacteria 3916
314 Ga0207695_10068011 3300025913 Bacteria 3651
315 Ga0207695_10093195 3300025913 Bacteria 3022
316 Ga0207671_10013507 3300025914 Bacteria 6500
317 Ga0207671_10075855 3300025914 Bacteria 2515
318 Ga0207671_10367455 3300025914 Bacteria 1142
319 Ga0207671_10408758 3300025914 Bacteria 1080
320 Ga0207671_10740892 3300025914 Bacteria 781
321 Ga0207671_11393622 3300025914 Bacteria 544
322 Ga0207693_10013300 3300025915 Bacteria 6638
323 Ga0207693_10018132 3300025915 Bacteria 5609
324 Ga0207693_10031918 3300025915 Bacteria 4161
325 Ga0207693_10049763 3300025915 Bacteria 3291
326 Ga0207693_10062394 3300025915 Bacteria 2920
327 Ga0207693_10384969 3300025915 Bacteria 1097
328 Ga0207663_10100457 3300025916 Bacteria 1942
329 Ga0207663_10422286 3300025916 Bacteria 1024
330 Ga0207663_10458466 3300025916 Bacteria 984
331 Ga0207663_10508535 3300025916 Bacteria 937
332 Ga0207663_10520354 3300025916 Bacteria 926
333 Ga0207663_10714521 3300025916 Bacteria 794
334 Ga0207663_11373900 3300025916 Bacteria 569
335 Ga0207660_10087621 3300025917 Bacteria 2301
336 Ga0207660_10118227 3300025917 Bacteria 2005
337 Ga0207662_10109643 3300025918 Bacteria 1720
338 Ga0207657_10036606 3300025919 Bacteria 4391
339 Ga0207657_10421192 3300025919 Bacteria 1049
340 Ga0207657_10646863 3300025919 Bacteria 823
341 Ga0207649_10124756 3300025920 Bacteria 1741
342 Ga0207649_10369559 3300025920 Bacteria 1066
343 Ga0207652_10501192 3300025921 Bacteria 1093
344 Ga0207646_10209185 3300025922 Bacteria 1762
345 Ga0207646_10667575 3300025922 Bacteria 931
346 Ga0207694_10000640 3300025924 Bacteria 31572
347 Ga0207694_10056620 3300025924 Bacteria 3045
348 Ga0207694_10096707 3300025924 Bacteria 2336
349 Ga0207694_10157083 3300025924 Bacteria 1835
350 Ga0207650_10700562 3300025925 Bacteria 855
351 Ga0207687_10007811 3300025927 Bacteria 7014
352 Ga0207687_10756630 3300025927 Bacteria 827
353 Ga0207687_11201174 3300025927 Bacteria 652
354 Ga0207700_10032556 3300025928 Bacteria 3720
355 Ga0207700_10048224 3300025928 Bacteria 3161
356 Ga0207700_10065658 3300025928 Bacteria 2770
357 Ga0207700_10069848 3300025928 Bacteria 2698
358 Ga0207700_10502082 3300025928 Bacteria 1073
359 Ga0207664_10030455 3300025929 Bacteria 4120
360 Ga0207664_10139714 3300025929 Bacteria 2048
361 Ga0207664_10909163 3300025929 Bacteria 790
362 Ga0207644_10235183 3300025931 Bacteria 1457
363 Ga0207644_10420986 3300025931 Bacteria 1094
364 Ga0207644_10647479 3300025931 Bacteria 879
365 Ga0207706_10032444 3300025933 Bacteria 4651
366 Ga0207706_10093340 3300025933 Bacteria 2646
367 Ga0207706_10254735 3300025933 Bacteria 1533
368 Ga0207686_10198241 3300025934 Bacteria 1436
369 Ga0207686_10389999 3300025934 Bacteria 1058
370 Ga0207686_10803193 3300025934 Bacteria 754
371 Ga0207709_10051154 3300025935 Bacteria 2531
372 Ga0207709_10264105 3300025935 Bacteria 1264
373 Ga0207709_10491594 3300025935 Bacteria 956
374 Ga0207670_10394720 3300025936 Bacteria 1105
375 Ga0207704_10036157 3300025938 Bacteria 2839
376 Ga0207665_10030324 3300025939 Bacteria 3573
377 Ga0207665_10120904 3300025939 Bacteria 1850
378 Ga0207665_10195935 3300025939 Bacteria 1470
379 Ga0207665_10708261 3300025939 Bacteria 792
380 Ga0207691_10022994 3300025940 Bacteria 5871
381 Ga0207711_11899596 3300025941 Bacteria 538
382 Ga0207689_10100125 3300025942 Bacteria 2381
383 Ga0207661_10089933 3300025944 Bacteria 2555
384 Ga0207661_11174753 3300025944 Bacteria 706
385 Ga0207661_11419612 3300025944 Bacteria 637
386 Ga0207679_10815836 3300025945 Bacteria 851
387 Ga0207679_10830799 3300025945 Bacteria 843
388 Ga0207667_10012446 3300025949 Bacteria 9802
389 Ga0207667_10286851 3300025949 Bacteria 1682
390 Ga0207667_10471158 3300025949 Bacteria 1275
391 Ga0207651_10193332 3300025960 Bacteria 1625
392 Ga0207712_10084824 3300025961 Bacteria 2316
393 Ga0207668_10295988 3300025972 Bacteria 1334
394 Ga0207668_10405599 3300025972 Bacteria 1153
395 Ga0207640_10441515 3300025981 Bacteria 1070
396 Ga0207640_10748384 3300025981 Bacteria 842
397 Ga0207658_10225530 3300025986 Bacteria 1579
398 Ga0207658_10556571 3300025986 Bacteria 1027
399 Ga0207677_10237041 3300026023 Bacteria 1473
400 Ga0207703_10038171 3300026035 Bacteria 3831
401 Ga0207703_10396633 3300026035 Bacteria 1279
402 Ga0207703_10481882 3300026035 Bacteria 1162
403 Ga0207639_10036279 3300026041 Bacteria 3652
404 Ga0207639_10045181 3300026041 Bacteria 3317
405 Ga0207639_10503187 3300026041 Bacteria 1107
406 Ga0207639_10576198 3300026041 Bacteria 1036
407 Ga0207639_11160594 3300026041 Bacteria 725
408 Ga0207678_10041803 3300026067 Bacteria 3974
409 Ga0207678_10109473 3300026067 Bacteria 2356
410 Ga0207678_10443126 3300026067 Bacteria 1128
411 Ga0207678_10533821 3300026067 Bacteria 1025
412 Ga0207678_10940230 3300026067 Bacteria 765
413 Ga0207708_10017021 3300026075 Bacteria 5472
414 Ga0207702_10139134 3300026078 Bacteria 2194
415 Ga0207641_10454062 3300026088 Bacteria 1239
416 Ga0207641_10717030 3300026088 Bacteria 986
417 Ga0207648_10026608 3300026089 Bacteria 5138
418 Ga0207676_10018203 3300026095 Bacteria 5103
419 Ga0207676_10897754 3300026095 Unclassified 869
420 Ga0207674_10025823 3300026116 Bacteria 6254
421 Ga0207674_10089416 3300026116 Bacteria 3072
422 Ga0207674_10187087 3300026116 Bacteria 2021
423 Ga0207674_10907554 3300026116 Bacteria 849
424 Ga0207683_10771521 3300026121 Bacteria 892
425 Ga0207698_10021988 3300026142 Bacteria 4422
426 Ga0207698_10184829 3300026142 Bacteria 1850
427 Ga0207698_10185223 3300026142 Bacteria 1848
428 Ga0207698_10341166 3300026142 Bacteria 1411
429 Ga0209588_1002153 3300027671 Bacteria 5317
430 Ga0209588_1134737 3300027671 Bacteria 787
431 Ga0209813_10134456 3300027866 Bacteria 873
432 Ga0268266_10039034 3300028379 Bacteria 4044
433 Ga0268266_10197185 3300028379 Bacteria 1841
434 Ga0268266_10553013 3300028379 Bacteria 1103
435 Ga0268266_10733454 3300028379 Bacteria 953
436 Ga0268266_10944067 3300028379 Bacteria 834
437 Ga0268265_10628835 3300028380 Bacteria 1029
438 Ga0268264_11772340 3300028381 Bacteria 628
439 Ga0265334_10030133 3300028573 Bacteria 2173
440 Ga0265323_10002430 3300028653 Bacteria 8548
441 Ga0265336_10001023 3300028666 Bacteria 13740
442 Ga0307517_10189560 3300028786 Bacteria 1308
443 Ga0265338_10000131 3300028800 Bacteria 137627
444 Ga0265324_10023007 3300029957 Bacteria 2223
445 Ga0265763_1033141 3300030763 Bacteria 595
446 Ga0265760_10299733 3300031090 Bacteria 569
447 Ga0265330_10004700 3300031235 Bacteria 6896
448 Ga0265330_10075698 3300031235 Bacteria 1453
449 Ga0265332_10013512 3300031238 Bacteria 3618
450 Ga0265332_10074910 3300031238 Bacteria 1439
451 Ga0265328_10081013 3300031239 Bacteria 1196
452 Ga0265325_10009995 3300031241 Bacteria 5514
453 Ga0265340_10074274 3300031247 Bacteria 1608
454 Ga0265339_10003767 3300031249 Bacteria 10572
455 Ga0265339_10088514 3300031249 Bacteria 1626
456 Ga0265331_10091628 3300031250 Bacteria 1404
457 Ga0265316_10399361 3300031344 Bacteria 990
458 Ga0307508_10000378 3300031616 Bacteria 53801
459 Ga0265314_10283562 3300031711 Bacteria 936
460 Ga0265342_10065784 3300031712 Bacteria 2124
461 Ga0373926_0123121 3300035083 Bacteria 979
462 Ga0373944_0116304 3300035089 Bacteria 918
463 Ga0373944_0128504 3300035089 Bacteria 879
464 Ga0373944_0180780 3300035089 Bacteria 756
465 Ga0373923_0036774 3300035111 Bacteria 2000
466 Ga0373923_0518015 3300035111 Bacteria 583
467 Ga0373936_0123633 3300035113 Bacteria 1107
468 Ga0373936_0151766 3300035113 Bacteria 1005
469 Ga0373945_0204214 3300035116 Bacteria 821
470 Ga0373953_0224685 3300035117 Bacteria 814
471 Ga0373954_0025848 3300035118 Bacteria 2688
472 Ga0373956_0071637 3300035119 Bacteria 1582
473 Ga0373957_0044832 3300035120 Bacteria 1674
474 Ga0373957_0160988 3300035120 Bacteria 925
475 Ga0373943_0007555 3300035170 Bacteria 4882
476 Ga0373943_0073131 3300035170 Bacteria 1740
477 Ga0373946_0003826 3300035171 Bacteria 5345
478 Ga0373946_0043723 3300035171 Bacteria 1847
479 Ga0373946_0081540 3300035171 Bacteria 1417
480 Ga0373955_0029054 3300035172 Bacteria 2872
481 Ga0373942_0224416 3300035207 Bacteria 631
482 Ga0373924_0552504 3300035410 Bacteria 518
483 Ga0373935_0001496 3300035692 Bacteria 12986
484 Ga0373935_0049588 3300035692 Bacteria 2661
485 Ga0373927_0004231 3300035695 Bacteria 10080
486 Ga0373927_0043976 3300035695 Bacteria 2890
487 Ga0373927_0051616 3300035695 Bacteria 2659
488 Ga0373927_0270030 3300035695 Bacteria 1118
489 Ga0373933_0923269 3300035724 Bacteria 575
490 Ga0373947_0014393 3300035725 Bacteria 4537
491 Ga0373947_0023786 3300035725 Bacteria 3566
492 Ga0373947_0043475 3300035725 Bacteria 2684
493 Ga0373937_0114276 3300036401 Bacteria 2513
494 Ga0373937_0352318 3300036401 Bacteria 1394
495 Ga0373925_0025651 3300037068 Bacteria 4309
496 Ga0373925_0064818 3300037068 Bacteria 2751
497 Ga0373925_0455022 3300037068 Bacteria 1048
498 Ga0373925_0922022 3300037068 Bacteria 720
499 Ga0395900_0002106 3300037418 Bacteria 22287
500 Ga0395900_0331503 3300037418 Bacteria 1500
501 Ga0395898_0003923 3300037466 Bacteria 16417
502 Ga0436364_0149566 3300037853 Bacteria 1321
503 Ga0436364_0259965 3300037853 Bacteria 1343
504 Ga0395901_0062385 3300038443 Bacteria 3879
505 Ga0395901_0080173 3300038443 Bacteria 3408
506 Ga0436365_0092040 3300039437 Bacteria 2282
507 Ga0436365_0323313 3300039437 Bacteria 23478
508 Ga0436365_0975447 3300039437 Bacteria 1016
509 Ga0436360_1119507 3300039438 Bacteria 4962
510 Ga0436360_1215647 3300039438 Bacteria 1103
511 Ga0436361_0006948 3300039447 Bacteria 1569
512 Ga0436361_0067260 3300039447 Bacteria 3175
513 Ga0436361_0439741 3300039447 Bacteria 1151
514 Ga0436363_0692628 3300039450 Bacteria 1016
515 Ga0436363_1150386 3300039450 Bacteria 669
516 Ga0436362_0137281 3300039453 Bacteria 3053
517 Ga0436362_0524871 3300039453 Bacteria 2827
518 Ga0451795_0238772 3300041456 Bacteria 699
519 Ga0451802_0760748 3300041460 Bacteria 1689
520 Ga0451833_0646072 3300041491 Bacteria 839
521 Ga0451851_0257865 3300041507 Bacteria 675
522 Ga0451853_2115719 3300041512 Bacteria 1232
523 Ga0451853_3712559 3300041512 Bacteria 1729
524 Ga0466969_0065668 3300044656 Bacteria 1754
525 Ga0466969_0363065 3300044656 Bacteria 656
526 Ga0466972_0024885 3300044658 Bacteria 2970
527 Ga0466966_0032028 3300044684 Bacteria 3410
528 Ga0466966_0832611 3300044684 Bacteria 556
529 Ga0466961_0322697 3300044693 Bacteria 942
530 Ga0466963_0023740 3300044694 Bacteria 3898
531 Ga0466963_0991814 3300044694 Bacteria 591
532 Ga0466971_0316122 3300044719 Bacteria 752
533 Ga0466970_0254172 3300044765 Bacteria 985
534 Ga0466970_0374721 3300044765 Bacteria 810
535 Ga0466957_0072367 3300044842 Bacteria 2134
536 Ga0466957_0097696 3300044842 Bacteria 1847
537 Ga0466960_0005188 3300044901 Bacteria 5148
538 Ga0466960_0255957 3300044901 Bacteria 974
539 Ga0466959_0112169 3300045049 Bacteria 1945
540 Ga0466967_0113820 3300045976 Bacteria 2490
541 Ga0466967_0179257 3300045976 Bacteria 1997
542 Ga0466967_2302095 3300045976 Bacteria 534
543 Ga0495592_0014218 3300046454 Bacteria 6047
544 Ga0495592_0070118 3300046454 Bacteria 2555
545 Ga0495592_0072474 3300046454 Bacteria 2506
546 Ga0495603_0032875 3300046455 Bacteria 3121
547 Ga0495603_0040333 3300046455 Bacteria 2794
548 Ga0495590_0391973 3300046457 Bacteria 532
549 Ga0495629_0004875 3300046459 Bacteria 10069
550 Ga0495629_0080242 3300046459 Bacteria 2278
551 Ga0495629_0370068 3300046459 Bacteria 976
552 Ga0495651_0002095 3300046462 Bacteria 15390
553 Ga0495580_0078167 3300046472 Bacteria 2308
554 Ga0495582_0000163 3300046473 Bacteria 35979
555 Ga0495582_0250687 3300046473 Bacteria 1015
556 Ga0495605_0153368 3300046474 Bacteria 1027
557 Ga0495639_0000628 3300046475 Bacteria 16332
558 Ga0495639_0160644 3300046475 Bacteria 1087
559 Ga0495662_0000977 3300046476 Bacteria 13972
560 Ga0495664_0020052 3300046477 Bacteria 3851
561 Ga0495664_0035362 3300046477 Bacteria 2941
562 Ga0495664_0104618 3300046477 Bacteria 1706
563 Ga0495584_0314827 3300046491 Bacteria 795
564 Ga0495594_0004175 3300046499 Bacteria 7416
565 Ga0495596_0235551 3300046500 Bacteria 711
566 Ga0495583_0198844 3300046506 Bacteria 815
567 Ga0495606_0030721 3300046507 Bacteria 3747
568 Ga0495606_0306716 3300046507 Bacteria 858
569 Ga0495608_0005251 3300046511 Bacteria 9254
570 Ga0495616_0035699 3300046513 Bacteria 2570
571 Ga0495616_0080486 3300046513 Bacteria 1560
572 Ga0495618_0625321 3300046514 Bacteria 639
573 Ga0495620_0085444 3300046515 Bacteria 1272
574 Ga0495628_0010023 3300046516 Bacteria 8062
575 Ga0495628_0144761 3300046516 Bacteria 1812
576 Ga0495630_0004963 3300046517 Bacteria 9358
577 Ga0495631_0257118 3300046518 Bacteria 744
578 Ga0495632_0118724 3300046519 Bacteria 1237
579 Ga0495637_0129085 3300046520 Bacteria 967
580 Ga0495643_0078400 3300046522 Bacteria 1724
581 Ga0495644_0053129 3300046523 Bacteria 1522
582 Ga0495666_0066443 3300046526 Bacteria 1719
583 Ga0495666_0471720 3300046526 Bacteria 562
584 Ga0495652_0021784 3300046529 Bacteria 5698
585 Ga0495652_0102747 3300046529 Bacteria 2315
586 Ga0495652_0127122 3300046529 Bacteria 2023
587 Ga0495665_0000509 3300046531 Bacteria 19621
588 Ga0495665_0004835 3300046531 Bacteria 7266
589 Ga0495665_0118444 3300046531 Bacteria 1387
590 Ga0495640_0015369 3300046533 Bacteria 5762
591 Ga0495640_0098620 3300046533 Bacteria 1920
592 Ga0495587_0013684 3300046536 Bacteria 5096
593 Ga0495598_0414239 3300046537 Bacteria 528
594 Ga0495621_0291024 3300046539 Bacteria 675
595 Ga0495597_0062422 3300046542 Bacteria 1621
596 Ga0495645_0068397 3300046543 Bacteria 2564
597 Ga0495645_0261069 3300046543 Bacteria 1147
598 Ga0495622_0003779 3300046557 Bacteria 7082
599 Ga0495633_0068705 3300046558 Bacteria 1654
600 Ga0495667_0015865 3300046559 Bacteria 5092
601 Ga0495667_0095573 3300046559 Bacteria 1924
602 Ga0495668_0121932 3300046616 Bacteria 1426
603 Ga0495634_0001271 3300046642 Bacteria 23127
604 Ga0495634_0050718 3300046642 Bacteria 2785
605 Ga0495611_0177877 3300046648 Bacteria 994
606 Ga0495635_0003007 3300046663 Bacteria 11582
607 Ga0495635_0072627 3300046663 Bacteria 2357
608 Ga0495661_0343375 3300046665 Bacteria 737
609 Ga0495657_0000445 3300046675 Bacteria 38585
610 Ga0495657_0065433 3300046675 Bacteria 2391
611 Ga0495599_0050997 3300046678 Bacteria 2593
612 Ga0495623_0009511 3300046679 Bacteria 6312
613 Ga0495646_0006264 3300046680 Bacteria 7547
614 Ga0495647_0000958 3300046681 Bacteria 8710
615 Ga0495647_0194125 3300046681 Bacteria 888
616 Ga0495658_0000512 3300046683 Bacteria 21274
617 Ga0495658_0014067 3300046683 Bacteria 4079
618 Ga0495658_0567100 3300046683 Bacteria 727
619 Ga0495669_0005806 3300046684 Bacteria 5146
620 Ga0495613_0003072 3300046689 Bacteria 12465
621 Ga0495613_0067476 3300046689 Bacteria 2611
622 Ga0495613_0110872 3300046689 Bacteria 1977
623 Ga0495624_0000980 3300046690 Bacteria 22564
624 Ga0495624_0094605 3300046690 Bacteria 1842
625 Ga0495600_0000243 3300046809 Bacteria 30003
626 Ga0495581_0004289 3300047315 Bacteria 8229
627 Ga0495581_0289158 3300047315 Bacteria 958
628 Ga0495604_0000525 3300047317 Bacteria 33842
629 Ga0495604_0169379 3300047317 Bacteria 1537
630 Ga0495636_0237681 3300047318 Bacteria 840
631 Ga0495674_0005410 3300047319 Bacteria 12255
632 Ga0495674_0072220 3300047319 Bacteria 2976
633 Ga0495676_0129137 3300047321 Bacteria 1827
634 Ga0495680_0000424 3300047322 Bacteria 47310
635 Ga0495687_012355 3300047443 Bacteria 4520
636 Ga0495675_0013349 3300047444 Bacteria 5184
637 Ga0495684_0016121 3300047471 Bacteria 5753
638 Ga0495593_0028923 3300047673 Bacteria 3042
639 Ga0495593_0138181 3300047673 Bacteria 1235
640 Ga0495602_0001865 3300048088 Bacteria 21070
641 Ga0495614_0402707 3300048089 Bacteria 643
642 Ga0495615_0246931 3300048090 Bacteria 564
643 Ga0496101_0140480 3300048904 Bacteria 1840
644 Ga0496101_0156280 3300048904 Bacteria 1747
645 Ga0496102_0135726 3300048905 Bacteria 2305
646 Ga0496102_0259303 3300048905 Bacteria 1639
647 Ga0496102_0353924 3300048905 Bacteria 1382
648 Ga0496102_1656282 3300048905 Bacteria 558
649 Ga0496103_0202513 3300048906 Bacteria 1276
650 Ga0496103_0250242 3300048906 Bacteria 1140
651 Ga0496104_0064729 3300048907 Bacteria 3468
652 Ga0496104_0232828 3300048907 Bacteria 1754
653 Ga0496105_0119337 3300048908 Bacteria 2175
654 Ga0496105_0262675 3300048908 Bacteria 1396
655 Ga0496105_0400827 3300048908 Bacteria 1089
656 Ga0496105_0823458 3300048908 Bacteria 704
657 Ga0496106_0158222 3300048909 Bacteria 1790
658 Ga0496106_0331499 3300048909 Bacteria 1222
659 Ga0496107_0005054 3300048910 Bacteria 8993
660 Ga0496108_0027898 3300048911 Bacteria 4668
661 Ga0496108_0034726 3300048911 Bacteria 4189
662 Ga0496109_0166190 3300048912 Bacteria 2069
663 Ga0496109_0895129 3300048912 Bacteria 825
664 Ga0496110_0005356 3300048913 Bacteria 10051
665 Ga0496110_0502530 3300048913 Bacteria 1104
666 Ga0496111_0436022 3300048914 Bacteria 967
667 Ga0496111_0980755 3300048914 Bacteria 606
668 Ga0496112_0088778 3300048915 Bacteria 3059
669 Ga0496112_0168733 3300048915 Bacteria 2154
670 Ga0496112_0572969 3300048915 Bacteria 1062
671 Ga0496112_0890118 3300048915 Bacteria 812
672 Ga0496113_0005822 3300048916 Bacteria 7732
673 Ga0496113_0015126 3300048916 Bacteria 5291
674 Ga0496114_0009352 3300048917 Bacteria 7779
675 Ga0496114_0767273 3300048917 Bacteria 842
676 Ga0496114_1449622 3300048917 Bacteria 574
677 Ga0496115_0003144 3300048918 Bacteria 11870
678 Ga0496115_0366231 3300048918 Bacteria 1174
679 Ga0496115_0386275 3300048918 Bacteria 1138
680 Ga0496115_0459137 3300048918 Bacteria 1028
681 Ga0496116_0031202 3300048919 Bacteria 3819
682 Ga0496116_0218953 3300048919 Bacteria 978
683 Ga0496117_0229073 3300048920 Bacteria 1028
684 Ga0496117_0360119 3300048920 Bacteria 748
685 Ga0496118_0090930 3300048921 Bacteria 2101
686 Ga0496119_0245173 3300048922 Bacteria 906
687 Ga0496119_0262052 3300048922 Bacteria 867
688 Ga0496121_0118979 3300048924 Bacteria 1998
689 Ga0496121_0267399 3300048924 Bacteria 1177
690 Ga0496124_0049370 3300048927 Bacteria 3590
691 Ga0496124_0145715 3300048927 Bacteria 1864
692 Ga0496125_0102715 3300048928 Bacteria 2100
693 Ga0496125_0166814 3300048928 Bacteria 1486
694 Ga0496125_0278909 3300048928 Bacteria 1037
695 Ga0496126_0078543 3300048929 Bacteria 2924
696 Ga0496126_0594224 3300048929 Bacteria 873
697 Ga0495682_0091091 3300049460 Bacteria 1095
698 Ga0501046_0316330 3300049580 Bacteria 1138
699 Ga0501047_0035246 3300049581 Bacteria 4834
700 Ga0501044_0041902 3300049823 Bacteria 4766
701 nmdc:mga03n38_197384_c1 3300050490 Bacteria 1040
702 nmdc:mga00v17_443656_c1 3300050491 Bacteria 843
703 nmdc:mga0yw44_40264_c1 3300050492 Bacteria 2775
704 nmdc:mga0yw44_83207_c2 3300050492 Bacteria 1318
705 nmdc:mga0k408_314896_c1 3300050493 Bacteria 934
706 nmdc:mga0k408_486778_c1 3300050493 Bacteria 732
707 nmdc:mga06z11_211734_c1 3300050494 Bacteria 1130
708 nmdc:mga07m45_115377_c1 3300050496 Bacteria 1549
709 nmdc:mga07m45_332209_c1 3300050496 Bacteria 883
710 nmdc:mga07m45_57098_c1 3300050496 Bacteria 2207
711 nmdc:mga0n895_66109_c1 3300050512 Bacteria 3580
712 nmdc:mga0rr50_989292_c1 3300050513 Bacteria 717
713 nmdc:mga0sz30_15236_c1 3300050516 Bacteria 3037
714 Ga0495601_0263903 3300053077 Bacteria 1124
715 Ga0495601_0811617 3300053077 Bacteria 594
716 Ga0495612_0185975 3300053078 Bacteria 913
717 Ga0495595_0031871 3300053084 Bacteria 2371
718 Ga0500578_0090500 3300053086 Bacteria 1942
719 Ga0500647_0334215 3300053091 Bacteria 636
720 Ga0500651_0238880 3300053093 Bacteria 1060
721 Ga0500651_0301127 3300053093 Bacteria 920
722 Ga0500566_0003972 3300053094 Bacteria 8827
723 Ga0500566_0013042 3300053094 Bacteria 4899
724 Ga0500566_0129050 3300053094 Bacteria 1355
725 Ga0500566_0257365 3300053094 Bacteria 845
726 Ga0500640_029606 3300053095 Bacteria 2395
727 Ga0500572_000670 3300053111 Bacteria 11297
728 Ga0500572_000830 3300053111 Bacteria 9731
729 Ga0500591_048991 3300053115 Bacteria 1985
730 Ga0500591_210192 3300053115 Bacteria 659
731 Ga0500595_000679 3300053119 Bacteria 20381
732 Ga0500595_040337 3300053119 Bacteria 1506
733 Ga0500608_090981 3300053122 Bacteria 1426
734 Ga0500608_138300 3300053122 Bacteria 1083
735 Ga0500614_001477 3300053123 Bacteria 5607
736 Ga0500626_030247 3300053128 Bacteria 2443
737 Ga0500559_0000240 3300053136 Bacteria 43636
738 Ga0500559_0001326 3300053136 Bacteria 14251
739 Ga0500559_0009454 3300053136 Bacteria 4217
740 Ga0500559_0038940 3300053136 Bacteria 2067
741 Ga0500577_0109158 3300053142 Bacteria 1140
742 Ga0500590_137397 3300053148 Bacteria 1122
743 Ga0500590_270889 3300053148 Bacteria 659
744 Ga0500603_000017 3300053150 Bacteria 56324
745 Ga0500619_081853 3300053154 Bacteria 1084
746 Ga0500620_009195 3300053155 Bacteria 2539
747 Ga0500630_001073 3300053159 Bacteria 12793
748 Ga0500638_000755 3300053162 Bacteria 8802
749 Ga0500638_009380 3300053162 Bacteria 4231
750 Ga0500638_161882 3300053162 Bacteria 984
751 Ga0500639_000306 3300053163 Bacteria 24115
752 Ga0500639_019769 3300053163 Bacteria 3552
753 Ga0500636_0000875 3300053177 Bacteria 16155
754 Ga0500636_0185328 3300053177 Bacteria 1113
755 Ga0500637_0000833 3300053178 Bacteria 12322
756 Ga0500637_0082556 3300053178 Bacteria 1857
757 Ga0500567_211355 3300053723 Bacteria 631
758 Ga0500609_004655 3300053731 Bacteria 1892
759 Ga0500596_000773 3300053735 Bacteria 6304
760 Ga0500596_002573 3300053735 Bacteria 3565
761 Ga0500601_004124 3300053737 Bacteria 1576
762 Ga0500601_005975 3300053737 Bacteria 1341
763 Ga0500661_000584 3300055283 Bacteria 6793
764 2509149593 2508501128 Bacteria 8613869
765 2511400345 2511231028 Bacteria 8046582
766 2513645102 2513237094 Bacteria 8789602
767 2513646187 2513237095 Bacteria 8976980
768 2513714984 2513237104 Bacteria 10034502
769 2513893877 2513237141 Bacteria 8496279
770 2517103555 2517093001 Bacteria 9002274
771 2524441062 2524023205 Bacteria 8918781
772 2528854172 2528768022 Bacteria 10457665
773 2745082415 2744054633 Bacteria 8678936
774 2793060278 2791355196 Bacteria 7323613
775 2818241474 2816332527 Bacteria 8933356
776 2824662390 2824661429 Bacteria 9877870
777 2841962276 2841957949 Bacteria 8652217
778 2842038654 2842038055 Bacteria 8002051
779 2842048401 2842045827 Bacteria 8006841
780 2844318053 2844315083 Bacteria 8138177
781 2874621643 2874620515 Bacteria 8290088
782 2874632722 2874628541 Bacteria 8630250
783 2876764505 2876761206 Bacteria 10111113
784 2876775079 2876771140 Bacteria 8287509
785 2876823894 2876818435 Bacteria 8274608
786 2879080522 2879074833 Bacteria 8279565
787 2879109371 2879099564 Bacteria 10442239
788 2885413030 2885409591 Bacteria 9235467
789 2888382848 2888378607 Bacteria 9652610
790 2888394949 2888388044 Bacteria 7304136
791 2903729638 2903727486 Bacteria 8281579
792 2904668641 2904666416 Bacteria 8226587
793 2906605786 2906602504 Bacteria 8295279
794 2906628240 2906626472 Bacteria 8826946
795 2922375179
796 2929615880 2929615660 Bacteria 9193770
797 2929630493 2929624759 Bacteria 9339455
798 2932792482 2932784394 Bacteria 9704911
799 2932813980 2932809354 Bacteria 9135765
800 2932819507 2932818245 Bacteria 9955613
801 2932833786 2932828146 Bacteria 9745859
802 2933578834 2933577622 Bacteria 9116884
803 2935611393 2935608549 Bacteria 8203142
804 2935618710 2935616580 Bacteria 9032984
805 2935644450 2935638405 Bacteria 10015038
806 2935674188 2935665750 Bacteria 9571747
807 2935678530 2935675223 Bacteria 9928132
808 2935687973 2935684952 Bacteria 9590419
809 2935701415 2935694250 Bacteria 9291695
810 2935708308 2935703347 Bacteria 10242284
811 2935714993 2935713505 Bacteria 9608509
812 2935726442 2935722832 Bacteria 9608746
813 2935733811 2935732158 Bacteria 9706831
814 2935743190 2935741537 Bacteria 9707219
815 2935754771 2935750917 Bacteria 9590372
816 2935765478 2935760218 Bacteria 9817913
817 2935805432 2935801545 Bacteria 9301974
818 2935816726 2935810662 Bacteria 9401221
819 2935820870 2935819856 Bacteria 8261050
820 2935833801 2935827899 Bacteria 10038562
821 2935839514 2935837841 Bacteria 9454360
822 2935850870 2935847175 Bacteria 8228321
823 2935857075 2935855204 Bacteria 9035059
824 2935864618 2935864058 Bacteria 9784707
825 2935876396 2935873716 Bacteria 9632195
826 2935913763 2935908558 Bacteria 8568796
827 2935920247 2935916978 Bacteria 9113783
828 2935930586 2935926038 Bacteria 8601059
829 2935939441 2935934488 Bacteria 8602579
830 2935946390 2935942939 Bacteria 8599779
831 2935955771 2935951376 Bacteria 8602333
832 2935966926 2935959822 Bacteria 7869783
833 2935972519 2935967501 Bacteria 8603075
834 2935981649 2935975950 Bacteria 8347125
835 2935997635 2935992306 Bacteria 9802711
836 2936007153 2936002035 Bacteria 9362176
837 2936043012 2936037263 Bacteria 9446081
838 2940559852 2940556831 Bacteria 9590747
839 2941540203 2941538514 Bacteria 9402094
840 3005713780 3005710791 Bacteria 7622528
841 3005721292 3005718088 Bacteria 8283608
842 8016514649 8016511872 Bacteria 9921665
843 8016591284 8016583857 Bacteria 10421953
844 8017061783 8017057580 Bacteria 10023680
845 8019581284 8019576017 Bacteria 10049540
846 8019602324 8019597564 Bacteria 10041141
847 8019644032 8019638758 Bacteria 9062356
848 8019657029 8019648815 Bacteria 10014479
849 8019688772 8019687851 Bacteria 8712826
850 8055747527 8055742211 Bacteria 9226248
851 8056972399 8056967851 Bacteria 9038162
852 Ga0373936_0010947
853 JGI24739J22299_10091298
854 JGI24737J22298_10016044
855 JGI24735J21928_10038934
856 rootH1_10030664
857 JGI25404J52841_10052526
858 Ga0055539_1004110
859 Ga0055531_10007309
860 JGI25405J52794_10038633
861 Ga0065165_1002064
862 Ga0065165_1003028
863 Ga0065165_1011888
864 Ga0070683_100040860
865 Ga0070683_100124983
866 Ga0070690_100058433
867 Ga0070670_100107660
868 Ga0068869_100087092
869 Ga0070680_100031351
870 Ga0070680_100473502
871 Ga0070682_100305720
872 Ga0070682_100343976
873 Ga0070682_100509814
874 Ga0068868_100085706
875 Ga0070660_100027520
876 Ga0070660_100129460
877 Ga0070660_100501466
878 Ga0070691_10573157
879 Ga0070687_100041461
880 Ga0070661_100215591
881 Ga0070661_100356765
882 Ga0070668_100230921
883 Ga0070668_100412166
884 Ga0070668_100514727
885 Ga0070669_100058994
886 Ga0070675_101030109
887 Ga0070671_100021774
888 Ga0070671_100147730
889 Ga0070671_100533911
890 Ga0070671_101064369
891 Ga0070674_100026402
892 Ga0070673_101206916
893 Ga0070688_100118979
894 Ga0070659_100449371
895 Ga0070659_100746086
896 Ga0070667_100274030
897 Ga0070709_10003840
898 Ga0070709_10006030
899 Ga0070709_10034153
900 Ga0070709_10524665
901 Ga0070709_10830575
902 Ga0070714_100025373
903 Ga0070714_100088472
904 Ga0070714_100829796
905 Ga0070714_101411891
906 Ga0070713_100002496
907 Ga0070713_100057994
908 Ga0070713_100285328
909 Ga0070713_100416342
910 Ga0070713_100601560
911 Ga0070710_10000607
912 Ga0070710_10002006
913 Ga0070710_10039407
914 Ga0070701_10054370
915 Ga0070711_100000904
916 Ga0070711_100002935
917 Ga0070711_100021030
918 Ga0070700_100101709
919 Ga0070708_100066842
920 Ga0070663_100037233
921 Ga0070663_100104110
922 Ga0070663_100274921
923 Ga0070663_100358876
924 Ga0070663_101312097
925 Ga0070662_100067380
926 Ga0070662_100076992
927 Ga0070662_100258865
928 Ga0070681_10052349
929 Ga0070681_10128829
930 Ga0068867_100053065
931 Ga0070706_100564756
932 Ga0070706_102128892
933 Ga0070707_100214697
934 Ga0070698_100154699
935 Ga0070679_100022625
936 Ga0070679_100048477
937 Ga0070684_100049187
938 Ga0070684_100096118
939 Ga0070684_100845264
940 Ga0068853_100049149
941 Ga0068853_100340807
942 Ga0068853_101492193
943 Ga0070672_100129159
944 Ga0070693_100137739
945 Ga0070693_100237645
946 Ga0070665_100060866
947 Ga0070665_100222947
948 Ga0070665_100952615
949 Ga0068855_100023606
950 Ga0068855_100080363
951 Ga0068855_100562130
952 Ga0070664_100932124
953 Ga0070664_101583659
954 Ga0068857_100028618
955 Ga0068857_100053353
956 Ga0068857_100294601
957 Ga0068857_100405603
958 Ga0068854_100198840
959 Ga0068854_100358654
960 Ga0068856_100043549
961 Ga0070702_100180264
962 Ga0068852_100016567
963 Ga0068852_100072376
964 Ga0068852_100111785
965 Ga0068852_100736197
966 Ga0068864_100356394
967 Ga0068866_10160919
968 Ga0068866_10171956
969 Ga0068851_10000888
970 Ga0068851_10241798
971 Ga0068863_100801016
972 Ga0068858_100067277
973 Ga0068858_100926238
974 Ga0068858_101837843
975 Ga0068860_100194576
976 Ga0068860_100475525
977 Ga0068860_100910159
978 Ga0068860_101361342
979 Ga0068860_101483360
980 Ga0068862_100059696
981 Ga0068862_100788739
982 Ga0081455_10007525
983 Ga0081455_10010928
984 Ga0081540_1001581
985 Ga0081540_1005915
986 Ga0081540_1015842
987 Ga0081540_1036276
988 Ga0081540_1100207
989 Ga0070717_10001732
990 Ga0070717_10005433
991 Ga0070717_10249039
992 Ga0070717_10259321
993 Ga0070717_10886638
994 Ga0070717_11045927
995 Ga0070717_11301851
996 Ga0075365_10146550
997 Ga0075365_10368954
998 Ga0075368_10041297
999 Ga0075368_10294074
1000 Ga0075363_100201652
1001 Ga0075364_10118632
1002 Ga0070715_10014329
1003 Ga0070715_10422613
1004 Ga0070716_100021473
1005 Ga0070716_100101860
1006 Ga0070716_100200616
1007 Ga0070716_100394080
1008 Ga0070712_100014960
1009 Ga0070712_100025629
1010 Ga0070712_100038446
1011 Ga0070712_100074997
1012 Ga0070712_100196732
1013 Ga0070712_100596502
1014 Ga0075362_10188701
1015 Ga0075367_10064128
1016 Ga0075369_10176471
1017 Ga0075369_10261454
1018 Ga0075366_10094965
1019 Ga0075366_10215403
1020 Ga0097621_100231744
1021 Ga0075370_10073969
1022 Ga0075370_10205757
1023 Ga0068871_100211336
1024 Ga0068871_100721007
1025 Ga0068871_102117827
1026 Ga0075434_100124974
1027 Ga0075436_100217544
1028 Ga0097620_100188644
1029 Ga0097620_100279529
1030 Ga0075435_100099182
1031 Ga0099794_10026500
1032 Ga0099794_10125848
1033 Ga0099794_10127925
1034 Ga0099795_10077126
1035 Ga0099795_10449699
1036 Ga0105240_10005415
1037 Ga0105240_10052328
1038 Ga0105240_10067914
1039 Ga0105240_10136088
1040 Ga0105245_10256723
1041 Ga0105245_10319691
1042 Ga0105245_10456309
1043 Ga0105247_10305129
1044 Ga0105247_10554970
1045 Ga0105243_10008287
1046 Ga0105243_10398284
1047 Ga0105243_10425918
1048 Ga0105241_10081634
1049 Ga0105241_10094659
1050 Ga0105241_10293290
1051 Ga0105241_10293324
1052 Ga0105241_10572265
1053 Ga0105241_10686743
1054 Ga0105242_10113877
1055 Ga0105242_10114610
1056 Ga0105248_10305894
1057 Ga0105237_10003346
1058 Ga0105237_10041885
1059 Ga0105237_10113956
1060 Ga0105237_10218096
1061 Ga0105237_10230610
1062 Ga0105237_10416824
1063 Ga0105237_10756586
1064 Ga0105238_10010310
1065 Ga0105238_10020057
1066 Ga0105238_10044073
1067 Ga0105238_10062848
1068 Ga0105238_10116241
1069 Ga0105238_10158595
1070 Ga0105238_10577187
1071 Ga0105238_11709538
1072 Ga0105238_12957057
1073 Ga0105249_10228299
1074 Ga0099796_10024478
1075 Ga0099796_10064790
1076 Ga0105239_10008096
1077 Ga0105239_10028412
1078 Ga0105239_10085079
1079 Ga0105239_10113299
1080 Ga0105239_10208187
1081 Ga0105239_10209832
1082 Ga0105239_10344459
1083 Ga0105239_10543450
1084 Ga0105239_11497596
1085 Ga0105246_10216489
1086 Ga0105246_11448542
1087 Ga0157369_10024515
1088 Ga0157369_10161085
1089 Ga0157374_10047745
1090 Ga0157374_10481073
1091 Ga0157374_11824708
1092 Ga0157378_10003448
1093 Ga0157378_10161244
1094 Ga0163162_10045197
1095 Ga0157372_10358137
1096 Ga0157372_10628709
1097 Ga0157375_10005190
1098 Ga0157375_10089512
1099 Ga0157375_10104173
1100 Ga0163163_10010706
1101 Ga0163163_10099004
1102 Ga0163163_10526889
1103 Ga0157377_10179359
1104 Ga0157379_10464139
1105 Ga0157376_10153341
1106 Ga0157376_11232003
1107 Ga0163161_10052359
1108 Ga0163161_10346266
1109 Ga0206353_11025617
1110 Ga0213873_10212344
1111 Ga0213872_10038195
1112 Ga0213872_10103194
1113 Ga0213876_10002435
1114 Ga0213876_10114703
1115 Ga0213876_10279873
1116 Ga0213871_10001476
1117 Ga0207425_1014481
1118 Ga0209677_103183
1119 Ga0209148_1000679
1120 Ga0209233_1025388
1121 Ga0209455_1002958
1122 Ga0209455_1018963
1123 Ga0209455_1027494
1124 Ga0209758_1000216
1125 Ga0209758_1006973
1126 Ga0209758_1024661
1127 Ga0209758_1113837
1128 Ga0209256_1083170
1129 Ga0207426_1000688
1130 Ga0207426_1057927
1131 Ga0207426_1059836
1132 Ga0209257_1001523
1133 Ga0209257_1024969
1134 Ga0207697_10046184
1135 Ga0207697_10108459
1136 Ga0207697_10120574
1137 Ga0207656_10466189
1138 Ga0207692_10000383
1139 Ga0207692_10062604
1140 Ga0207692_10387815
1141 Ga0207642_10012609
1142 Ga0207688_10032741
1143 Ga0207688_10034652
1144 Ga0207688_10252964
1145 Ga0207647_10050890
1146 Ga0207647_10433157
1147 Ga0207685_10174219
1148 Ga0207699_10001709
1149 Ga0207699_10082450
1150 Ga0207699_10089510
1151 Ga0207699_10144955
1152 Ga0207699_10273618
1153 Ga0207699_11161572
1154 Ga0207699_11217348
1155 Ga0207705_10030470
1156 Ga0207705_10552231
1157 Ga0207684_10097074
1158 Ga0207654_10132583
1159 Ga0207654_10444038
1160 Ga0207707_10080205
1161 Ga0207707_10085916
1162 Ga0207707_10167475
1163 Ga0207695_10000599
1164 Ga0207695_10060594
1165 Ga0207695_10068011
1166 Ga0207695_10093195
1167 Ga0207671_10013507
1168 Ga0207671_10075855
1169 Ga0207671_10367455
1170 Ga0207671_10408758
1171 Ga0207671_10740892
1172 Ga0207671_11393622
1173 Ga0207693_10013300
1174 Ga0207693_10018132
1175 Ga0207693_10031918
1176 Ga0207693_10049763
1177 Ga0207693_10062394
1178 Ga0207693_10384969
1179 Ga0207663_10100457
1180 Ga0207663_10422286
1181 Ga0207663_10458466
1182 Ga0207663_10508535
1183 Ga0207663_10520354
1184 Ga0207663_10714521
1185 Ga0207663_11373900
1186 Ga0207660_10087621
1187 Ga0207660_10118227
1188 Ga0207662_10109643
1189 Ga0207657_10036606
1190 Ga0207657_10421192
1191 Ga0207657_10646863
1192 Ga0207649_10124756
1193 Ga0207649_10369559
1194 Ga0207652_10501192
1195 Ga0207646_10209185
1196 Ga0207646_10667575
1197 Ga0207694_10000640
1198 Ga0207694_10056620
1199 Ga0207694_10096707
1200 Ga0207694_10157083
1201 Ga0207650_10700562
1202 Ga0207687_10007811
1203 Ga0207687_10756630
1204 Ga0207687_11201174
1205 Ga0207700_10032556
1206 Ga0207700_10048224
1207 Ga0207700_10065658
1208 Ga0207700_10069848
1209 Ga0207700_10502082
1210 Ga0207664_10030455
1211 Ga0207664_10139714
1212 Ga0207664_10909163
1213 Ga0207644_10235183
1214 Ga0207644_10420986
1215 Ga0207644_10647479
1216 Ga0207706_10032444
1217 Ga0207706_10093340
1218 Ga0207706_10254735
1219 Ga0207686_10198241
1220 Ga0207686_10389999
1221 Ga0207686_10803193
1222 Ga0207709_10051154
1223 Ga0207709_10264105
1224 Ga0207709_10491594
1225 Ga0207670_10394720
1226 Ga0207704_10036157
1227 Ga0207665_10030324
1228 Ga0207665_10120904
1229 Ga0207665_10195935
1230 Ga0207665_10708261
1231 Ga0207691_10022994
1232 Ga0207711_11899596
1233 Ga0207689_10100125
1234 Ga0207661_10089933
1235 Ga0207661_11174753
1236 Ga0207661_11419612
1237 Ga0207679_10815836
1238 Ga0207679_10830799
1239 Ga0207667_10012446
1240 Ga0207667_10286851
1241 Ga0207667_10471158
1242 Ga0207651_10193332
1243 Ga0207712_10084824
1244 Ga0207668_10295988
1245 Ga0207668_10405599
1246 Ga0207640_10441515
1247 Ga0207640_10748384
1248 Ga0207658_10225530
1249 Ga0207658_10556571
1250 Ga0207677_10237041
1251 Ga0207703_10038171
1252 Ga0207703_10396633
1253 Ga0207703_10481882
1254 Ga0207639_10036279
1255 Ga0207639_10045181
1256 Ga0207639_10503187
1257 Ga0207639_10576198
1258 Ga0207639_11160594
1259 Ga0207678_10041803
1260 Ga0207678_10109473
1261 Ga0207678_10443126
1262 Ga0207678_10533821
1263 Ga0207678_10940230
1264 Ga0207708_10017021
1265 Ga0207702_10139134
1266 Ga0207641_10454062
1267 Ga0207641_10717030
1268 Ga0207648_10026608
1269 Ga0207676_10018203
1270 Ga0207676_10897754
1271 Ga0207674_10025823
1272 Ga0207674_10089416
1273 Ga0207674_10187087
1274 Ga0207674_10907554
1275 Ga0207683_10771521
1276 Ga0207698_10021988
1277 Ga0207698_10184829
1278 Ga0207698_10185223
1279 Ga0207698_10341166
1280 Ga0209588_1002153
1281 Ga0209588_1134737
1282 Ga0209813_10134456
1283 Ga0268266_10039034
1284 Ga0268266_10197185
1285 Ga0268266_10553013
1286 Ga0268266_10733454
1287 Ga0268266_10944067
1288 Ga0268265_10628835
1289 Ga0268264_11772340
1290 Ga0265334_10030133
1291 Ga0265323_10002430
1292 Ga0265336_10001023
1293 Ga0307517_10189560
1294 Ga0265338_10000131
1295 Ga0265324_10023007
1296 Ga0265763_1033141
1297 Ga0265760_10299733
1298 Ga0265330_10004700
1299 Ga0265330_10075698
1300 Ga0265332_10013512
1301 Ga0265332_10074910
1302 Ga0265328_10081013
1303 Ga0265325_10009995
1304 Ga0265340_10074274
1305 Ga0265339_10003767
1306 Ga0265339_10088514
1307 Ga0265331_10091628
1308 Ga0265316_10399361
1309 Ga0307508_10000378
1310 Ga0265314_10283562
1311 Ga0265342_10065784
1312 Ga0373926_0123121
1313 Ga0373944_0116304
1314 Ga0373944_0128504
1315 Ga0373944_0180780
1316 Ga0373923_0036774
1317 Ga0373923_0518015
1318 Ga0373936_0123633
1319 Ga0373936_0151766
1320 Ga0373945_0204214
1321 Ga0373953_0224685
1322 Ga0373954_0025848
1323 Ga0373956_0071637
1324 Ga0373957_0044832
1325 Ga0373957_0160988
1326 Ga0373943_0007555
1327 Ga0373943_0073131
1328 Ga0373946_0003826
1329 Ga0373946_0043723
1330 Ga0373946_0081540
1331 Ga0373955_0029054
1332 Ga0373942_0224416
1333 Ga0373924_0552504
1334 Ga0373935_0001496
1335 Ga0373935_0049588
1336 Ga0373927_0004231
1337 Ga0373927_0043976
1338 Ga0373927_0051616
1339 Ga0373927_0270030
1340 Ga0373933_0923269
1341 Ga0373947_0014393
1342 Ga0373947_0023786
1343 Ga0373947_0043475
1344 Ga0373937_0114276
1345 Ga0373937_0352318
1346 Ga0373925_0025651
1347 Ga0373925_0064818
1348 Ga0373925_0455022
1349 Ga0373925_0922022
1350 Ga0395900_0002106
1351 Ga0395900_0331503
1352 Ga0395898_0003923
1353 Ga0436364_0149566
1354 Ga0436364_0259965
1355 Ga0395901_0062385
1356 Ga0395901_0080173
1357 Ga0436365_0092040
1358 Ga0436365_0323313
1359 Ga0436365_0975447
1360 Ga0436360_1119507
1361 Ga0436360_1215647
1362 Ga0436361_0006948
1363 Ga0436361_0067260
1364 Ga0436361_0439741
1365 Ga0436363_0692628
1366 Ga0436363_1150386
1367 Ga0436362_0137281
1368 Ga0436362_0524871
1369 Ga0451795_0238772
1370 Ga0451802_0760748
1371 Ga0451833_0646072
1372 Ga0451851_0257865
1373 Ga0451853_2115719
1374 Ga0451853_3712559
1375 Ga0466969_0065668
1376 Ga0466969_0363065
1377 Ga0466972_0024885
1378 Ga0466966_0032028
1379 Ga0466966_0832611
1380 Ga0466961_0322697
1381 Ga0466963_0023740
1382 Ga0466963_0991814
1383 Ga0466971_0316122
1384 Ga0466970_0254172
1385 Ga0466970_0374721
1386 Ga0466957_0072367
1387 Ga0466957_0097696
1388 Ga0466960_0005188
1389 Ga0466960_0255957
1390 Ga0466959_0112169
1391 Ga0466967_0113820
1392 Ga0466967_0179257
1393 Ga0466967_2302095
1394 Ga0495592_0014218
1395 Ga0495592_0070118
1396 Ga0495592_0072474
1397 Ga0495603_0032875
1398 Ga0495603_0040333
1399 Ga0495590_0391973
1400 Ga0495629_0004875
1401 Ga0495629_0080242
1402 Ga0495629_0370068
1403 Ga0495651_0002095
1404 Ga0495580_0078167
1405 Ga0495582_0000163
1406 Ga0495582_0250687
1407 Ga0495605_0153368
1408 Ga0495639_0000628
1409 Ga0495639_0160644
1410 Ga0495662_0000977
1411 Ga0495664_0020052
1412 Ga0495664_0035362
1413 Ga0495664_0104618
1414 Ga0495584_0314827
1415 Ga0495594_0004175
1416 Ga0495596_0235551
1417 Ga0495583_0198844
1418 Ga0495606_0030721
1419 Ga0495606_0306716
1420 Ga0495608_0005251
1421 Ga0495616_0035699
1422 Ga0495616_0080486
1423 Ga0495618_0625321
1424 Ga0495620_0085444
1425 Ga0495628_0010023
1426 Ga0495628_0144761
1427 Ga0495630_0004963
1428 Ga0495631_0257118
1429 Ga0495632_0118724
1430 Ga0495637_0129085
1431 Ga0495643_0078400
1432 Ga0495644_0053129
1433 Ga0495666_0066443
1434 Ga0495666_0471720
1435 Ga0495652_0021784
1436 Ga0495652_0102747
1437 Ga0495652_0127122
1438 Ga0495665_0000509
1439 Ga0495665_0004835
1440 Ga0495665_0118444
1441 Ga0495640_0015369
1442 Ga0495640_0098620
1443 Ga0495587_0013684
1444 Ga0495598_0414239
1445 Ga0495621_0291024
1446 Ga0495597_0062422
1447 Ga0495645_0068397
1448 Ga0495645_0261069
1449 Ga0495622_0003779
1450 Ga0495633_0068705
1451 Ga0495667_0015865
1452 Ga0495667_0095573
1453 Ga0495668_0121932
1454 Ga0495634_0001271
1455 Ga0495634_0050718
1456 Ga0495611_0177877
1457 Ga0495635_0003007
1458 Ga0495635_0072627
1459 Ga0495661_0343375
1460 Ga0495657_0000445
1461 Ga0495657_0065433
1462 Ga0495599_0050997
1463 Ga0495623_0009511
1464 Ga0495646_0006264
1465 Ga0495647_0000958
1466 Ga0495647_0194125
1467 Ga0495658_0000512
1468 Ga0495658_0014067
1469 Ga0495658_0567100
1470 Ga0495669_0005806
1471 Ga0495613_0003072
1472 Ga0495613_0067476
1473 Ga0495613_0110872
1474 Ga0495624_0000980
1475 Ga0495624_0094605
1476 Ga0495600_0000243
1477 Ga0495581_0004289
1478 Ga0495581_0289158
1479 Ga0495604_0000525
1480 Ga0495604_0169379
1481 Ga0495636_0237681
1482 Ga0495674_0005410
1483 Ga0495674_0072220
1484 Ga0495676_0129137
1485 Ga0495680_0000424
1486 Ga0495687_012355
1487 Ga0495675_0013349
1488 Ga0495684_0016121
1489 Ga0495593_0028923
1490 Ga0495593_0138181
1491 Ga0495602_0001865
1492 Ga0495614_0402707
1493 Ga0495615_0246931
1494 Ga0496101_0140480
1495 Ga0496101_0156280
1496 Ga0496102_0135726
1497 Ga0496102_0259303
1498 Ga0496102_0353924
1499 Ga0496102_1656282
1500 Ga0496103_0202513
1501 Ga0496103_0250242
1502 Ga0496104_0064729
1503 Ga0496104_0232828
1504 Ga0496105_0119337
1505 Ga0496105_0262675
1506 Ga0496105_0400827
1507 Ga0496105_0823458
1508 Ga0496106_0158222
1509 Ga0496106_0331499
1510 Ga0496107_0005054
1511 Ga0496108_0027898
1512 Ga0496108_0034726
1513 Ga0496109_0166190
1514 Ga0496109_0895129
1515 Ga0496110_0005356
1516 Ga0496110_0502530
1517 Ga0496111_0436022
1518 Ga0496111_0980755
1519 Ga0496112_0088778
1520 Ga0496112_0168733
1521 Ga0496112_0572969
1522 Ga0496112_0890118
1523 Ga0496113_0005822
1524 Ga0496113_0015126
1525 Ga0496114_0009352
1526 Ga0496114_0767273
1527 Ga0496114_1449622
1528 Ga0496115_0003144
1529 Ga0496115_0366231
1530 Ga0496115_0386275
1531 Ga0496115_0459137
1532 Ga0496116_0031202
1533 Ga0496116_0218953
1534 Ga0496117_0229073
1535 Ga0496117_0360119
1536 Ga0496118_0090930
1537 Ga0496119_0245173
1538 Ga0496119_0262052
1539 Ga0496121_0118979
1540 Ga0496121_0267399
1541 Ga0496124_0049370
1542 Ga0496124_0145715
1543 Ga0496125_0102715
1544 Ga0496125_0166814
1545 Ga0496125_0278909
1546 Ga0496126_0078543
1547 Ga0496126_0594224
1548 Ga0495682_0091091
1549 Ga0501046_0316330
1550 Ga0501047_0035246
1551 Ga0501044_0041902
1552 nmdc:mga03n38_197384_c1
1553 nmdc:mga00v17_443656_c1
1554 nmdc:mga0yw44_40264_c1
1555 nmdc:mga0yw44_83207_c2
1556 nmdc:mga0k408_314896_c1
1557 nmdc:mga0k408_486778_c1
1558 nmdc:mga06z11_211734_c1
1559 nmdc:mga07m45_115377_c1
1560 nmdc:mga07m45_332209_c1
1561 nmdc:mga07m45_57098_c1
1562 nmdc:mga0n895_66109_c1
1563 nmdc:mga0rr50_989292_c1
1564 nmdc:mga0sz30_15236_c1
1565 Ga0495601_0263903
1566 Ga0495601_0811617
1567 Ga0495612_0185975
1568 Ga0495595_0031871
1569 Ga0500578_0090500
1570 Ga0500647_0334215
1571 Ga0500651_0238880
1572 Ga0500651_0301127
1573 Ga0500566_0003972
1574 Ga0500566_0013042
1575 Ga0500566_0129050
1576 Ga0500566_0257365
1577 Ga0500640_029606
1578 Ga0500572_000670
1579 Ga0500572_000830
1580 Ga0500591_048991
1581 Ga0500591_210192
1582 Ga0500595_000679
1583 Ga0500595_040337
1584 Ga0500608_090981
1585 Ga0500608_138300
1586 Ga0500614_001477
1587 Ga0500626_030247
1588 Ga0500559_0000240
1589 Ga0500559_0001326
1590 Ga0500559_0009454
1591 Ga0500559_0038940
1592 Ga0500577_0109158
1593 Ga0500590_137397
1594 Ga0500590_270889
1595 Ga0500603_000017
1596 Ga0500619_081853
1597 Ga0500620_009195
1598 Ga0500630_001073
1599 Ga0500638_000755
1600 Ga0500638_009380
1601 Ga0500638_161882
1602 Ga0500639_000306
1603 Ga0500639_019769
1604 Ga0500636_0000875
1605 Ga0500636_0185328
1606 Ga0500637_0000833
1607 Ga0500637_0082556
1608 Ga0500567_211355
1609 Ga0500609_004655
1610 Ga0500596_000773
1611 Ga0500596_002573
1612 Ga0500601_004124
1613 Ga0500601_005975
1614 Ga0500661_000584
1615 2509149593
1616 2511400345
1617 2513645102
1618 2513646187
1619 2513714984
1620 2513893877
1621 2517103555
1622 2524441062
1623 2528854172
1624 2745082415
1625 2793060278
1626 2818241474
1627 2824662390
1628 2841962276
1629 2842038654
1630 2842048401
1631 2844318053
1632 2874621643
1633 2874632722
1634 2876764505
1635 2876775079
1636 2876823894
1637 2879080522
1638 2879109371
1639 2885413030
1640 2888382848
1641 2888394949
1642 2903729638
1643 2904668641
1644 2906605786
1645 2906628240
1646 2922375179
1647 2929615880
1648 2929630493
1649 2932792482
1650 2932813980
1651 2932819507
1652 2932833786
1653 2933578834
1654 2935611393
1655 2935618710
1656 2935644450
1657 2935674188
1658 2935678530
1659 2935687973
1660 2935701415
1661 2935708308
1662 2935714993
1663 2935726442
1664 2935733811
1665 2935743190
1666 2935754771
1667 2935765478
1668 2935805432
1669 2935816726
1670 2935820870
1671 2935833801
1672 2935839514
1673 2935850870
1674 2935857075
1675 2935864618
1676 2935876396
1677 2935913763
1678 2935920247
1679 2935930586
1680 2935939441
1681 2935946390
1682 2935955771
1683 2935966926
1684 2935972519
1685 2935981649
1686 2935997635
1687 2936007153
1688 2936043012
1689 2940559852
1690 2941540203
1691 3005713780
1692 3005721292
1693 8016514649
1694 8016591284
1695 8017061783
1696 8019581284
1697 8019602324
1698 8019644032
1699 8019657029
1700 8019688772
1701 8055747527
1702 8056972399

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3att-assembly1.cif.gz_A crystal structure of rv3168 with atp 0.8092 89 124
4eag-assembly1.cif.gz_B co-crystal structure of an chimeric ampk core with atp 0.8009 90 119
8guo-assembly1.cif.gz_B crystal structure of the nuclease domain of esad in complex with esag from staphylococcus aureus 0.7923 84 119
5vtm-assembly1.cif.gz_X the crystal structure of minor pseudopilin ternary complex of xcpvwx from the type 2 secretion system of pseudomonas aeruginosa 0.7904 99 134
3sao-assembly2.cif.gz_B the siderocalin ex-fabp functions through dual ligand specificities 0.77 85 124
ID Description Score Start End Superfamily
3attA01 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.8092 89 124 3.30.200.20
3te5B01 Mainly Beta;Single Sheet;N-terminal domain of TfIIb; 0.8047 90 121 2.20.25.290
af_Q42809_18_86_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.7914 89 121 3.30.200.20
4r80B00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7655 81 133 3.10.450.630
af_A4I9V7_1_112_2.40.128.20 Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain 0.7628 89 133 2.40.128.20
ID Description Score Start End GO Terms
AF-A0A4D7AWC1-F1-model_v4 DUF3828 domain-containing protein 0.8928 89 134
AF-A0A443JWF3-F1-model_v4 deleted 0.8706 86 130
AF-A0A7Y5SD29-F1-model_v4 DUF4878 domain-containing protein 0.859 81 134
AF-A0A7Y2P3C2-F1-model_v4 DUF4878 domain-containing protein 0.8438 88 134
AF-A0A7V2S5I2-F1-model_v4 DUF4783 domain-containing protein 0.8383 84 133

Map