F483460

General Info

Members Datasets Scaffolds Average Seq Length
851 486 1702 206

Family's Representative Sequence

Representative Sequence 3300020081|Ga0206354_11513705|Ga0206354_115137051
Length 240
Sequence MIRKSGYRFFRKDHAQSKSKSGMTKSSRSGAFSTMIFRLLAMACAIAFLVPASGQTPDLKTIAKQSGTPDIPGLKMVWLSPWGDVAKAHPWKNIIVHQTEGPAGSARGGAAEQHKNPTRRGVMVWVETDGTVYWAVSDDLVPTHTDGADRNDNKYIDNSKTYHQVNKDTSIGVEFAGNYPDVAKPVTQAQIDAWKVLVKVLSARYDIPLDHVYAHNWIDFKDARYCEGCALATLAREWGE

Samples

Sample ID Description Type Environment
1 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
2 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
55 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
56 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
57 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
58 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
62 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
63 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
64 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
96 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
97 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
98 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
99 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
101 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
103 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
150 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
151 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
152 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
154 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
157 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
158 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
159 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
160 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
161 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
162 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
163 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
164 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
165 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
166 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
167 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
168 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
169 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
170 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
171 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
172 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
173 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
174 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
175 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
176 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
177 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
178 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
179 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
180 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
181 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
182 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
183 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
184 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
185 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
186 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
187 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
188 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
189 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
190 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
191 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
192 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
193 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
194 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
195 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
196 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
197 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
198 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
199 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
200 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
201 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
202 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
203 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
204 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
205 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
206 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
207 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
208 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
209 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
210 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
211 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
212 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
213 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
214 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
215 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
216 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
217 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
218 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
219 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
220 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
221 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
222 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
223 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
224 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
225 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
226 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
227 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
228 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
229 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
230 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
231 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
232 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
233 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
234 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
235 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
236 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
237 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
238 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
239 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
240 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
241 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
242 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
243 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
244 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
245 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
246 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
247 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
248 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
249 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
250 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
251 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
252 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
253 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
254 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
255 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
256 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
257 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
258 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
259 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
260 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
261 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
262 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
263 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
264 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
265 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
266 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
267 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
268 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
269 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
270 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
271 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
272 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
273 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
274 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
275 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
276 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
277 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
278 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
279 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
280 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
281 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
282 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
283 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
284 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
285 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
286 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
287 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
288 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
289 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
290 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
291 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
292 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
293 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
294 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
295 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
296 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
297 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
298 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
299 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
300 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
301 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
302 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
303 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
304 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
305 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
306 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
307 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
308 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
309 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
310 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
311 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
312 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
313 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
314 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
315 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
316 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
317 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
318 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
319 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
320 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
321 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
322 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
323 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
324 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
325 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
326 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
327 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
328 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
329 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
330 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
331 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
332 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
333 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
334 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
335 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
336 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
337 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
338 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
339 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
340 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
341 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
342 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
343 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
344 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
345 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
346 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
347 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
348 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
349 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
350 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
351 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
352 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
353 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
354 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
355 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
356 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
357 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
358 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
359 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
360 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
361 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
362 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
363 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
364 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
365 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
366 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
367 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
368 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
369 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
370 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
371 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
372 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
373 2791355199
374 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
375 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
376 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
377 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
378 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
379 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
380 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
381 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
382 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
383 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
384 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
385 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
386 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
387 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
388 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
389 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
390 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
391 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
392 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
393 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
394 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
395 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
396 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
397 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
398 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
399 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
400 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
401 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
402 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
403 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
404 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
405 2904699407
406 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
407 2906610324
408 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
409 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
410 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
411 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
412 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
413 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
414 2922368715
415 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
416 2922425934
417 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
418 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
419 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
420 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
421 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
422 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
423 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
424 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
425 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
426 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
427 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
428 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
429 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
430 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
431 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
432 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
433 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
434 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
435 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
436 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
437 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
438 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
439 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
440 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
441 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
442 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
443 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
444 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
445 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
446 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
447 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
448 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
449 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
450 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
451 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
452 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
453 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
454 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
455 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
456 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
457 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
458 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
459 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
460 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
461 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
462 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
463 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
464 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
465 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
466 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
467 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
468 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
469 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
470 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
471 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
472 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
473 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
474 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
475 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
476 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
477 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
478 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
479 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
480 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
481 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
482 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
483 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
484 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
485 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
486 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 84.63
Metatranscriptomes 0.24
Isolates 15.13

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.52
Nodule 12.93
Rhizoplane 6.46
Rhizosphere 62.98
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0206354_11513705 3300020081 Bacteria 1339
2 JGI25165J46597_1027283 3300003214 Bacteria 739
3 JGI25153J46596_10008204 3300003215 Bacteria 5024
4 JGI25160J50197_1011166 3300003354 Bacteria 3202
5 Ga0065165_1028600 3300005262 Bacteria 1797
6 Ga0065715_10209158 3300005293 Bacteria 1322
7 Ga0070658_10183897 3300005327 Bacteria 1759
8 Ga0070658_10579576 3300005327 Bacteria 972
9 Ga0070683_100017013 3300005329 Bacteria 6417
10 Ga0070683_100046333 3300005329 Bacteria 4016
11 Ga0068869_100122239 3300005334 Bacteria 1992
12 Ga0070680_100032205 3300005336 Bacteria 4219
13 Ga0070680_100059350 3300005336 Bacteria 3129
14 Ga0070680_100102799 3300005336 Bacteria 2373
15 Ga0070680_100479552 3300005336 Bacteria 1063
16 Ga0070661_100240697 3300005344 Bacteria 1393
17 Ga0070668_100027166 3300005347 Bacteria 4344
18 Ga0070675_100223434 3300005354 Bacteria 1641
19 Ga0070673_100182429 3300005364 Bacteria 1797
20 Ga0070688_100188158 3300005365 Bacteria 1436
21 Ga0070709_10009409 3300005434 Bacteria 5390
22 Ga0070709_10019560 3300005434 Bacteria 3916
23 Ga0070709_10462628 3300005434 Bacteria 957
24 Ga0070714_100021066 3300005435 Bacteria 5330
25 Ga0070714_100126326 3300005435 Bacteria 2281
26 Ga0070714_100661914 3300005435 Bacteria 1006
27 Ga0070714_100711446 3300005435 Bacteria 969
28 Ga0070713_100051131 3300005436 Bacteria 3417
29 Ga0070713_100134866 3300005436 Bacteria 2181
30 Ga0070713_100192861 3300005436 Bacteria 1837
31 Ga0070713_100376442 3300005436 Bacteria 1322
32 Ga0070710_10001728 3300005437 Bacteria 10316
33 Ga0070710_10049770 3300005437 Bacteria 2345
34 Ga0070711_100003745 3300005439 Bacteria 8915
35 Ga0070711_100479976 3300005439 Bacteria 1022
36 Ga0070711_100717426 3300005439 Bacteria 843
37 Ga0070711_101068042 3300005439 Bacteria 695
38 Ga0070700_100241203 3300005441 Bacteria 1292
39 Ga0070663_100031371 3300005455 Bacteria 3652
40 Ga0070663_100137832 3300005455 Bacteria 1859
41 Ga0070678_100841512 3300005456 Bacteria 835
42 Ga0070662_100022905 3300005457 Bacteria 4284
43 Ga0070662_100063047 3300005457 Bacteria 2710
44 Ga0070662_100164109 3300005457 Bacteria 1739
45 Ga0070662_100374415 3300005457 Bacteria 1171
46 Ga0070681_10011424 3300005458 Bacteria 8790
47 Ga0070681_10057928 3300005458 Bacteria 3854
48 Ga0070681_10076669 3300005458 Bacteria 3301
49 Ga0070681_10143757 3300005458 Bacteria 2315
50 Ga0068867_100078350 3300005459 Bacteria 2485
51 Ga0070706_100566113 3300005467 Bacteria 1057
52 Ga0070698_100143279 3300005471 Bacteria 2340
53 Ga0070679_100101164 3300005530 Bacteria 2869
54 Ga0070679_100123755 3300005530 Bacteria 2569
55 Ga0070679_100437547 3300005530 Bacteria 1253
56 Ga0070684_100033483 3300005535 Bacteria 4387
57 Ga0070697_100074798 3300005536 Bacteria 2784
58 Ga0070697_100681778 3300005536 Bacteria 906
59 Ga0068853_100033950 3300005539 Bacteria 4328
60 Ga0068853_100143983 3300005539 Bacteria 2141
61 Ga0068853_100495762 3300005539 Bacteria 1153
62 Ga0070672_100251471 3300005543 Bacteria 1489
63 Ga0070672_100585569 3300005543 Bacteria 971
64 Ga0070672_100964967 3300005543 Bacteria 754
65 Ga0070665_100069904 3300005548 Bacteria 3518
66 Ga0070665_100101560 3300005548 Bacteria 2880
67 Ga0070665_100584585 3300005548 Bacteria 1130
68 Ga0068855_100084929 3300005563 Bacteria 3663
69 Ga0068855_100175718 3300005563 Bacteria 2423
70 Ga0068855_100224629 3300005563 Bacteria 2104
71 Ga0068855_100345747 3300005563 Bacteria 1639
72 Ga0068855_100418657 3300005563 Bacteria 1466
73 Ga0068855_100728766 3300005563 Bacteria 1059
74 Ga0070664_100453590 3300005564 Bacteria 1177
75 Ga0068857_100122148 3300005577 Bacteria 2346
76 Ga0068857_100282602 3300005577 Bacteria 1527
77 Ga0068857_100406229 3300005577 Bacteria 1268
78 Ga0068854_100065756 3300005578 Bacteria 2637
79 Ga0068854_100102168 3300005578 Bacteria 2150
80 Ga0068856_100009520 3300005614 Bacteria 9438
81 Ga0068856_100011946 3300005614 Bacteria 8407
82 Ga0068856_100753467 3300005614 Bacteria 994
83 Ga0068856_100855466 3300005614 Bacteria 929
84 Ga0068852_100106104 3300005616 Bacteria 2546
85 Ga0068852_100920685 3300005616 Bacteria 892
86 Ga0068859_101070173 3300005617 Bacteria 887
87 Ga0068864_100201028 3300005618 Bacteria 1830
88 Ga0068861_100078847 3300005719 Bacteria 2573
89 Ga0068861_100896273 3300005719 Bacteria 840
90 Ga0068851_10001257 3300005834 Bacteria 11037
91 Ga0068870_10266275 3300005840 Bacteria 1069
92 Ga0068863_100746210 3300005841 Bacteria 974
93 Ga0068858_100082707 3300005842 Bacteria 2985
94 Ga0068858_101001635 3300005842 Bacteria 819
95 Ga0068860_100076638 3300005843 Bacteria 3180
96 Ga0068862_100230606 3300005844 Bacteria 1679
97 Ga0081455_10007620 3300005937 Bacteria 11376
98 Ga0081455_10185253 3300005937 Bacteria 1573
99 Ga0081540_1009378 3300005983 Bacteria 6748
100 Ga0081540_1035271 3300005983 Bacteria 2685
101 Ga0081539_10203531 3300005985 Bacteria 912
102 Ga0070717_10045944 3300006028 Bacteria 3572
103 Ga0070717_10386359 3300006028 Bacteria 1256
104 Ga0075365_10057604 3300006038 Bacteria 2585
105 Ga0075365_10555854 3300006038 Bacteria 812
106 Ga0075368_10078092 3300006042 Bacteria 1344
107 Ga0075364_10085644 3300006051 Bacteria 2087
108 Ga0075432_10045074 3300006058 Bacteria 1547
109 Ga0070715_10002320 3300006163 Bacteria 5809
110 Ga0070716_100052455 3300006173 Bacteria 2322
111 Ga0070716_100159270 3300006173 Bacteria 1461
112 Ga0070716_100479778 3300006173 Bacteria 913
113 Ga0070712_100031693 3300006175 Bacteria 3563
114 Ga0070712_100043937 3300006175 Bacteria 3078
115 Ga0070712_100067607 3300006175 Bacteria 2543
116 Ga0070712_100146869 3300006175 Bacteria 1806
117 Ga0070712_100381895 3300006175 Bacteria 1160
118 Ga0075362_10061420 3300006177 Bacteria 1700
119 Ga0075367_10031122 3300006178 Bacteria 3063
120 Ga0075367_10197493 3300006178 Bacteria 1256
121 Ga0075367_10245826 3300006178 Bacteria 1121
122 Ga0075367_10313843 3300006178 Bacteria 988
123 Ga0075369_10066566 3300006186 Bacteria 1580
124 Ga0075369_10131077 3300006186 Bacteria 1139
125 Ga0075366_10264303 3300006195 Bacteria 1050
126 Ga0097621_100917010 3300006237 Bacteria 817
127 Ga0075370_10046993 3300006353 Bacteria 2444
128 Ga0075370_10281695 3300006353 Bacteria 987
129 Ga0075434_100147037 3300006871 Bacteria 2377
130 Ga0075434_100770445 3300006871 Bacteria 979
131 Ga0075429_100532400 3300006880 Bacteria 1030
132 Ga0097620_101070178 3300006931 Bacteria 887
133 Ga0075435_100762868 3300007076 Bacteria 842
134 Ga0099794_10035926 3300007265 Bacteria 2340
135 Ga0105240_10002281 3300009093 Bacteria 31075
136 Ga0105240_10036722 3300009093 Bacteria 6301
137 Ga0105240_10104287 3300009093 Bacteria 3443
138 Ga0105240_10171349 3300009093 Bacteria 2571
139 Ga0105240_10360254 3300009093 Bacteria 1647
140 Ga0111539_11191424 3300009094 Bacteria 885
141 Ga0105245_10035230 3300009098 Bacteria 4442
142 Ga0105247_10284099 3300009101 Bacteria 1142
143 Ga0105247_10396320 3300009101 Bacteria 982
144 Ga0114129_10493841 3300009147 Bacteria 1599
145 Ga0105243_10246570 3300009148 Bacteria 1592
146 Ga0105241_10000387 3300009174 Bacteria 33305
147 Ga0105241_10042939 3300009174 Bacteria 3423
148 Ga0105241_10063756 3300009174 Bacteria 2844
149 Ga0105241_10131441 3300009174 Bacteria 2027
150 Ga0105241_10532122 3300009174 Bacteria 1052
151 Ga0105242_10476171 3300009176 Bacteria 1182
152 Ga0105248_10029798 3300009177 Bacteria 6090
153 Ga0105248_10119519 3300009177 Bacteria 2972
154 Ga0105248_10261427 3300009177 Bacteria 1948
155 Ga0105237_10050609 3300009545 Bacteria 4174
156 Ga0105237_10082156 3300009545 Bacteria 3213
157 Ga0105237_11102881 3300009545 Bacteria 800
158 Ga0105238_10003351 3300009551 Bacteria 15986
159 Ga0105238_10071831 3300009551 Bacteria 3458
160 Ga0105249_10535492 3300009553 Bacteria 1220
161 Ga0105239_10039182 3300010375 Bacteria 5192
162 Ga0105239_10165080 3300010375 Bacteria 2476
163 Ga0105239_10294830 3300010375 Bacteria 1826
164 Ga0105239_10313205 3300010375 Bacteria 1769
165 Ga0105239_10443593 3300010375 Bacteria 1472
166 Ga0157370_10066200 3300013104 Bacteria 3417
167 Ga0157370_10173621 3300013104 Bacteria 2003
168 Ga0157370_10194758 3300013104 Bacteria 1881
169 Ga0157369_10120889 3300013105 Bacteria 2779
170 Ga0157369_10489602 3300013105 Bacteria 1272
171 Ga0157369_11176544 3300013105 Bacteria 783
172 Ga0157374_10065440 3300013296 Bacteria 3414
173 Ga0157374_10366694 3300013296 Bacteria 1433
174 Ga0157378_10024747 3300013297 Bacteria 5286
175 Ga0163162_10551862 3300013306 Bacteria 1280
176 Ga0163162_10905430 3300013306 Bacteria 995
177 Ga0157372_10222226 3300013307 Bacteria 2189
178 Ga0157375_10240441 3300013308 Bacteria 1970
179 Ga0157375_10284560 3300013308 Bacteria 1816
180 Ga0163163_10709005 3300014325 Bacteria 1070
181 Ga0157380_10459154 3300014326 Bacteria 1226
182 Ga0157376_10035591 3300014969 Bacteria 4029
183 Ga0213873_10009524 3300021358 Bacteria 2020
184 Ga0213872_10153813 3300021361 Bacteria 1004
185 Ga0213876_10059420 3300021384 Bacteria 2018
186 Ga0213876_10072780 3300021384 Bacteria 1815
187 Ga0213876_10190290 3300021384 Bacteria 1091
188 Ga0213871_10093318 3300021441 Bacteria 874
189 Ga0209148_1000333 3300025254 Bacteria 64490
190 Ga0209233_1043470 3300025261 Bacteria 957
191 Ga0209455_1003276 3300025272 Bacteria 5823
192 Ga0209758_1005697 3300025297 Bacteria 9410
193 Ga0207656_10004285 3300025321 Bacteria 4973
194 Ga0207692_10210132 3300025898 Bacteria 1149
195 Ga0207642_10371535 3300025899 Bacteria 849
196 Ga0207710_10014804 3300025900 Bacteria 3294
197 Ga0207688_10170976 3300025901 Bacteria 1292
198 Ga0207647_10024843 3300025904 Bacteria 3947
199 Ga0207685_10021870 3300025905 Bacteria 2151
200 Ga0207685_10116032 3300025905 Bacteria 1168
201 Ga0207699_10000504 3300025906 Bacteria 19475
202 Ga0207699_10172464 3300025906 Bacteria 1448
203 Ga0207699_10190077 3300025906 Bacteria 1385
204 Ga0207645_10083912 3300025907 Bacteria 2044
205 Ga0207643_10041524 3300025908 Bacteria 2592
206 Ga0207705_10162360 3300025909 Bacteria 1679
207 Ga0207705_10209292 3300025909 Bacteria 1479
208 Ga0207654_10000216 3300025911 Bacteria 35426
209 Ga0207654_10019900 3300025911 Bacteria 3550
210 Ga0207654_10068781 3300025911 Bacteria 2096
211 Ga0207654_10148413 3300025911 Bacteria 1503
212 Ga0207707_10055802 3300025912 Bacteria 3436
213 Ga0207707_10115666 3300025912 Bacteria 2344
214 Ga0207707_10139143 3300025912 Bacteria 2122
215 Ga0207695_10000378 3300025913 Bacteria 101352
216 Ga0207695_10000430 3300025913 Bacteria 92372
217 Ga0207695_10105010 3300025913 Bacteria 2812
218 Ga0207695_10129453 3300025913 Bacteria 2482
219 Ga0207671_10033677 3300025914 Bacteria 3810
220 Ga0207671_10083294 3300025914 Bacteria 2401
221 Ga0207671_10110183 3300025914 Bacteria 2094
222 Ga0207671_10248487 3300025914 Bacteria 1398
223 Ga0207693_10025530 3300025915 Bacteria 4684
224 Ga0207693_10033766 3300025915 Bacteria 4037
225 Ga0207693_10044027 3300025915 Bacteria 3508
226 Ga0207693_10067629 3300025915 Bacteria 2797
227 Ga0207693_10119437 3300025915 Bacteria 2070
228 Ga0207693_10343727 3300025915 Bacteria 1168
229 Ga0207663_10001929 3300025916 Bacteria 9819
230 Ga0207663_10093829 3300025916 Bacteria 1998
231 Ga0207663_10142006 3300025916 Bacteria 1674
232 Ga0207663_10364777 3300025916 Bacteria 1097
233 Ga0207660_10025526 3300025917 Bacteria 4011
234 Ga0207660_10195445 3300025917 Bacteria 1577
235 Ga0207652_10056429 3300025921 Bacteria 3381
236 Ga0207652_10485760 3300025921 Bacteria 1112
237 Ga0207694_10144232 3300025924 Bacteria 1916
238 Ga0207694_10397917 3300025924 Bacteria 1145
239 Ga0207650_10093653 3300025925 Bacteria 2300
240 Ga0207659_10365948 3300025926 Bacteria 1199
241 Ga0207700_10016961 3300025928 Bacteria 4851
242 Ga0207700_10059132 3300025928 Bacteria 2898
243 Ga0207700_10095415 3300025928 Bacteria 2359
244 Ga0207700_10205575 3300025928 Bacteria 1662
245 Ga0207700_10310110 3300025928 Bacteria 1365
246 Ga0207664_10080860 3300025929 Bacteria 2643
247 Ga0207664_10081282 3300025929 Bacteria 2636
248 Ga0207664_10482186 3300025929 Bacteria 1109
249 Ga0207664_10514551 3300025929 Bacteria 1072
250 Ga0207664_10544244 3300025929 Bacteria 1041
251 Ga0207664_10864497 3300025929 Bacteria 813
252 Ga0207706_10076445 3300025933 Bacteria 2945
253 Ga0207706_10096898 3300025933 Bacteria 2594
254 Ga0207706_10216254 3300025933 Bacteria 1679
255 Ga0207706_10254439 3300025933 Bacteria 1534
256 Ga0207709_10476534 3300025935 Bacteria 970
257 Ga0207704_10698843 3300025938 Bacteria 839
258 Ga0207665_10057167 3300025939 Bacteria 2635
259 Ga0207691_10090189 3300025940 Bacteria 2748
260 Ga0207691_10191231 3300025940 Bacteria 1785
261 Ga0207691_10514101 3300025940 Bacteria 1016
262 Ga0207711_10042154 3300025941 Bacteria 3889
263 Ga0207689_10078797 3300025942 Bacteria 2708
264 Ga0207689_10161979 3300025942 Bacteria 1843
265 Ga0207667_10024488 3300025949 Bacteria 6627
266 Ga0207667_10222852 3300025949 Bacteria 1932
267 Ga0207651_10204784 3300025960 Bacteria 1584
268 Ga0207651_10281018 3300025960 Bacteria 1376
269 Ga0207668_10137911 3300025972 Bacteria 1871
270 Ga0207668_10164505 3300025972 Bacteria 1732
271 Ga0207668_10702232 3300025972 Bacteria 889
272 Ga0207640_10940890 3300025981 Bacteria 757
273 Ga0207703_10084660 3300026035 Bacteria 2652
274 Ga0207703_10270090 3300026035 Bacteria 1540
275 Ga0207639_10008972 3300026041 Bacteria 6884
276 Ga0207639_10186507 3300026041 Bacteria 1769
277 Ga0207639_10418697 3300026041 Bacteria 1211
278 Ga0207639_10447573 3300026041 Bacteria 1172
279 Ga0207639_10637047 3300026041 Bacteria 985
280 Ga0207639_10720111 3300026041 Bacteria 926
281 Ga0207678_10066118 3300026067 Bacteria 3105
282 Ga0207678_10073230 3300026067 Bacteria 2936
283 Ga0207678_10153365 3300026067 Bacteria 1967
284 Ga0207678_10214575 3300026067 Bacteria 1647
285 Ga0207678_10439093 3300026067 Bacteria 1133
286 Ga0207708_10086210 3300026075 Bacteria 2416
287 Ga0207708_10194725 3300026075 Bacteria 1615
288 Ga0207702_10000006 3300026078 Bacteria 346370
289 Ga0207702_10008789 3300026078 Bacteria 8513
290 Ga0207702_10819842 3300026078 Bacteria 920
291 Ga0207641_10104036 3300026088 Bacteria 2506
292 Ga0207676_10074496 3300026095 Bacteria 2735
293 Ga0207674_10171670 3300026116 Bacteria 2122
294 Ga0207674_10314998 3300026116 Bacteria 1514
295 Ga0207675_100118379 3300026118 Bacteria 2505
296 Ga0207683_10059843 3300026121 Bacteria 3346
297 Ga0207683_10255210 3300026121 Bacteria 1600
298 Ga0207683_10285040 3300026121 Bacteria 1510
299 Ga0207683_10587998 3300026121 Bacteria 1030
300 Ga0207698_10310248 3300026142 Bacteria 1473
301 Ga0209589_1000007 3300027357 Bacteria 425699
302 Ga0209489_100008 3300027361 Bacteria 425699
303 Ga0209700_100009 3300027363 Bacteria 425699
304 Ga0209588_1072960 3300027671 Bacteria 1109
305 Ga0209813_10149597 3300027866 Bacteria 835
306 Ga0268266_10004436 3300028379 Bacteria 13434
307 Ga0268266_10348358 3300028379 Bacteria 1391
308 Ga0268266_10449984 3300028379 Bacteria 1224
309 Ga0268266_10490950 3300028379 Bacteria 1171
310 Ga0268266_11103901 3300028379 Bacteria 767
311 Ga0268265_10156211 3300028380 Bacteria 1931
312 Ga0268265_10199823 3300028380 Bacteria 1733
313 Ga0307517_10000196 3300028786 Bacteria 102384
314 Ga0307517_10184645 3300028786 Bacteria 1338
315 Ga0307515_10422208 3300028794 Bacteria 954
316 Ga0307511_10094657 3300030521 Bacteria 2000
317 Ga0265339_10045952 3300031249 Bacteria 2402
318 Ga0307513_10084886 3300031456 Bacteria 3251
319 Ga0307513_10254841 3300031456 Bacteria 1549
320 Ga0307513_10456134 3300031456 Bacteria 1002
321 Ga0307509_10107389 3300031507 Bacteria 2807
322 Ga0265314_10000530 3300031711 Bacteria 49260
323 Ga0265314_10049828 3300031711 Bacteria 2929
324 Ga0265342_10081785 3300031712 Bacteria 1864
325 Ga0307516_10490114 3300031730 Bacteria 884
326 Ga0307405_10367649 3300031731 Bacteria 1115
327 Ga0307412_10142903 3300031911 Bacteria 1755
328 Ga0307416_100178301 3300032002 Bacteria 1988
329 Ga0307415_100028295 3300032126 Bacteria 3564
330 Ga0307415_100280590 3300032126 Bacteria 1370
331 Ga0307507_10124911 3300033179 Bacteria 2040
332 Ga0307510_10055432 3300033180 Bacteria 4140
333 Ga0307510_10055803 3300033180 Bacteria 4122
334 Ga0307510_10079466 3300033180 Bacteria 3198
335 Ga0307510_10187543 3300033180 Bacteria 1621
336 Ga0315911_1000012 3300033442 Bacteria 248988
337 Ga0373926_0028411 3300035083 Bacteria 1963
338 Ga0373929_0051543 3300035085 Bacteria 942
339 Ga0373934_0011696 3300035086 Bacteria 3304
340 Ga0373940_0015398 3300035088 Bacteria 1880
341 Ga0373949_0038015 3300035090 Bacteria 1173
342 Ga0373923_0005452 3300035111 Bacteria 4318
343 Ga0373923_0012843 3300035111 Bacteria 3108
344 Ga0373923_0013360 3300035111 Bacteria 3059
345 Ga0373945_0161127 3300035116 Bacteria 914
346 Ga0373953_0010974 3300035117 Bacteria 3166
347 Ga0373954_0008981 3300035118 Bacteria 4398
348 Ga0373956_0016577 3300035119 Bacteria 3095
349 Ga0373956_0203973 3300035119 Bacteria 937
350 Ga0373957_0005372 3300035120 Bacteria 3967
351 Ga0373946_0390272 3300035171 Bacteria 701
352 Ga0373955_0024616 3300035172 Bacteria 3080
353 Ga0373924_0012206 3300035410 Bacteria 3207
354 Ga0373924_0021357 3300035410 Bacteria 2524
355 Ga0373924_0091239 3300035410 Bacteria 1303
356 Ga0373931_0007107 3300035691 Bacteria 5263
357 Ga0373935_0032397 3300035692 Bacteria 3248
358 Ga0373935_0164211 3300035692 Bacteria 1515
359 Ga0373935_0388744 3300035692 Bacteria 1000
360 Ga0373927_0011945 3300035695 Bacteria 5779
361 Ga0373927_0069442 3300035695 Bacteria 2280
362 Ga0373933_0000127 3300035724 Bacteria 48988
363 Ga0373933_0009762 3300035724 Bacteria 5253
364 Ga0373933_0013466 3300035724 Bacteria 4534
365 Ga0373947_0080852 3300035725 Bacteria 2011
366 Ga0373937_0176172 3300036401 Bacteria 2007
367 Ga0373937_0960072 3300036401 Bacteria 803
368 Ga0372808_016958 3300036459 Bacteria 1045
369 Ga0373925_0020068 3300037068 Bacteria 4863
370 Ga0373925_0077317 3300037068 Bacteria 2525
371 Ga0395900_0345879 3300037418 Bacteria 1461
372 Ga0395898_0011081 3300037466 Bacteria 9388
373 Ga0395905_0862032 3300037471 Bacteria 809
374 Ga0436364_1260262 3300037853 Bacteria 3350
375 Ga0395901_0350729 3300038443 Bacteria 1523
376 Ga0436365_0171700 3300039437 Bacteria 2174
377 Ga0436365_0336270 3300039437 Bacteria 1997
378 Ga0436365_0570400 3300039437 Bacteria 1937
379 Ga0436365_0753964 3300039437 Bacteria 1091
380 Ga0436365_0916174 3300039437 Bacteria 2014
381 Ga0436365_1077794 3300039437 Bacteria 5477
382 Ga0436365_1856792 3300039437 Bacteria 865
383 Ga0436360_0214793 3300039438 Bacteria 1829
384 Ga0436360_0469985 3300039438 Bacteria 797
385 Ga0436360_0523168 3300039438 Bacteria 1034
386 Ga0436360_1204674 3300039438 Bacteria 4718
387 Ga0436360_1234883 3300039438 Bacteria 2489
388 Ga0436361_0293327 3300039447 Bacteria 1671
389 Ga0436361_0383305 3300039447 Bacteria 1572
390 Ga0436361_0903396 3300039447 Bacteria 3493
391 Ga0436363_1634831 3300039450 Bacteria 1382
392 Ga0451789_0199537 3300041443 Bacteria 1296
393 Ga0451807_1755786 3300041486 Bacteria 955
394 Ga0451837_1123785 3300041494 Bacteria 763
395 Ga0451845_0638386 3300041501 Bacteria 1102
396 Ga0451849_1032934 3300041505 Bacteria 887
397 Ga0451843_0044726 3300041509 Bacteria 1438
398 Ga0451853_3641990 3300041512 Bacteria 1382
399 Ga0466972_0000115 3300044658 Bacteria 68073
400 Ga0466964_0224215 3300044706 Bacteria 914
401 Ga0466970_0086306 3300044765 Bacteria 1701
402 Ga0466970_0333355 3300044765 Bacteria 859
403 Ga0466970_0354654 3300044765 Bacteria 833
404 Ga0466957_0060425 3300044842 Bacteria 2324
405 Ga0466959_0163516 3300045049 Bacteria 1564
406 Ga0466967_0204169 3300045976 Bacteria 1872
407 Ga0466967_0366221 3300045976 Bacteria 1397
408 Ga0466967_0464684 3300045976 Bacteria 1238
409 Ga0495592_0007961 3300046454 Bacteria 7949
410 Ga0495592_0070623 3300046454 Bacteria 2543
411 Ga0495592_0082597 3300046454 Bacteria 2321
412 Ga0495592_0173501 3300046454 Bacteria 1474
413 Ga0495603_0002113 3300046455 Bacteria 11685
414 Ga0495603_0018580 3300046455 Bacteria 4205
415 Ga0495603_0091595 3300046455 Bacteria 1777
416 Ga0495629_0011347 3300046459 Bacteria 6473
417 Ga0495629_0097989 3300046459 Bacteria 2045
418 Ga0495629_0191783 3300046459 Bacteria 1414
419 Ga0495641_0069339 3300046461 Bacteria 1585
420 Ga0495641_0145310 3300046461 Bacteria 1060
421 Ga0495651_0034658 3300046462 Bacteria 3934
422 Ga0495651_0064389 3300046462 Bacteria 2801
423 Ga0495651_0067812 3300046462 Bacteria 2721
424 Ga0495651_0081450 3300046462 Bacteria 2443
425 Ga0495651_0213958 3300046462 Bacteria 1339
426 Ga0495653_0044912 3300046463 Bacteria 3427
427 Ga0495653_0168611 3300046463 Bacteria 1513
428 Ga0495653_0288275 3300046463 Bacteria 1075
429 Ga0495650_0030238 3300046471 Bacteria 2456
430 Ga0495580_0153623 3300046472 Bacteria 1594
431 Ga0495580_0156209 3300046472 Bacteria 1579
432 Ga0495582_0172000 3300046473 Bacteria 1233
433 Ga0495582_0242119 3300046473 Bacteria 1034
434 Ga0495605_0067160 3300046474 Bacteria 1702
435 Ga0495639_0125746 3300046475 Bacteria 1225
436 Ga0495639_0306766 3300046475 Bacteria 792
437 Ga0495662_0101095 3300046476 Bacteria 1410
438 Ga0495664_0015561 3300046477 Bacteria 4326
439 Ga0495664_0072085 3300046477 Bacteria 2063
440 Ga0495664_0430057 3300046477 Bacteria 791
441 Ga0495664_0511344 3300046477 Bacteria 717
442 Ga0495584_0313676 3300046491 Bacteria 796
443 Ga0495585_0035419 3300046492 Bacteria 2821
444 Ga0495585_0213446 3300046492 Bacteria 977
445 Ga0495594_0209602 3300046499 Bacteria 1111
446 Ga0495583_0071804 3300046506 Bacteria 1520
447 Ga0495606_0033946 3300046507 Bacteria 3510
448 Ga0495608_0007602 3300046511 Bacteria 7639
449 Ga0495608_0017173 3300046511 Bacteria 5009
450 Ga0495608_0036649 3300046511 Bacteria 3301
451 Ga0495610_0150730 3300046512 Bacteria 992
452 Ga0495618_0023754 3300046514 Bacteria 3794
453 Ga0495618_0059180 3300046514 Bacteria 2428
454 Ga0495618_0095690 3300046514 Bacteria 1899
455 Ga0495618_0147417 3300046514 Bacteria 1504
456 Ga0495628_0036737 3300046516 Bacteria 3930
457 Ga0495628_0059158 3300046516 Bacteria 3009
458 Ga0495628_0097416 3300046516 Bacteria 2272
459 Ga0495630_0025317 3300046517 Bacteria 4386
460 Ga0495630_0775522 3300046517 Bacteria 732
461 Ga0495631_0013532 3300046518 Bacteria 3959
462 Ga0495632_0139589 3300046519 Bacteria 1125
463 Ga0495643_0148047 3300046522 Bacteria 1165
464 Ga0495644_0055718 3300046523 Bacteria 1485
465 Ga0495666_0093591 3300046526 Bacteria 1417
466 Ga0495652_0015775 3300046529 Bacteria 6763
467 Ga0495652_0031931 3300046529 Bacteria 4608
468 Ga0495652_0103158 3300046529 Bacteria 2309
469 Ga0495652_0108169 3300046529 Bacteria 2241
470 Ga0495654_0164499 3300046530 Bacteria 972
471 Ga0495640_0021204 3300046533 Bacteria 4772
472 Ga0495640_0061745 3300046533 Bacteria 2544
473 Ga0495640_0188336 3300046533 Bacteria 1312
474 Ga0495586_0455558 3300046535 Bacteria 737
475 Ga0495587_0037948 3300046536 Bacteria 2890
476 Ga0495587_0052414 3300046536 Bacteria 2407
477 Ga0495587_0110531 3300046536 Bacteria 1579
478 Ga0495587_0159753 3300046536 Bacteria 1283
479 Ga0495598_0012886 3300046537 Bacteria 2062
480 Ga0495609_0041604 3300046538 Bacteria 2065
481 Ga0495621_0147619 3300046539 Bacteria 923
482 Ga0495645_0042408 3300046543 Bacteria 3317
483 Ga0495645_0087519 3300046543 Bacteria 2228
484 Ga0495645_0164803 3300046543 Bacteria 1529
485 Ga0495622_0054211 3300046557 Bacteria 1860
486 Ga0495667_0012960 3300046559 Bacteria 5652
487 Ga0495656_0074729 3300046615 Bacteria 1514
488 Ga0495668_0060076 3300046616 Bacteria 2097
489 Ga0495668_0137386 3300046616 Bacteria 1338
490 Ga0495634_0054103 3300046642 Bacteria 2687
491 Ga0495634_0060929 3300046642 Bacteria 2510
492 Ga0495634_0169241 3300046642 Bacteria 1374
493 Ga0495634_0172774 3300046642 Bacteria 1357
494 Ga0495625_0152730 3300046660 Bacteria 1551
495 Ga0495635_0005323 3300046663 Bacteria 8957
496 Ga0495635_0010033 3300046663 Bacteria 6623
497 Ga0495635_0034381 3300046663 Bacteria 3515
498 Ga0495635_0098258 3300046663 Bacteria 2001
499 Ga0495635_0213191 3300046663 Bacteria 1307
500 Ga0495635_0465831 3300046663 Bacteria 834
501 Ga0495659_0069232 3300046664 Bacteria 1319
502 Ga0495588_0075830 3300046674 Bacteria 1752
503 Ga0495657_0015963 3300046675 Bacteria 5479
504 Ga0495657_0029066 3300046675 Bacteria 3880
505 Ga0495657_0046936 3300046675 Bacteria 2922
506 Ga0495657_0313433 3300046675 Bacteria 933
507 Ga0495657_0393435 3300046675 Bacteria 816
508 Ga0495599_0029311 3300046678 Bacteria 3449
509 Ga0495599_0031147 3300046678 Bacteria 3348
510 Ga0495599_0063110 3300046678 Bacteria 2314
511 Ga0495623_0007605 3300046679 Bacteria 7036
512 Ga0495623_0020667 3300046679 Bacteria 4255
513 Ga0495623_0025325 3300046679 Bacteria 3821
514 Ga0495646_0096928 3300046680 Bacteria 1695
515 Ga0495647_0007620 3300046681 Bacteria 3633
516 Ga0495658_0009938 3300046683 Bacteria 4747
517 Ga0495658_0523871 3300046683 Bacteria 759
518 Ga0495658_0550903 3300046683 Bacteria 738
519 Ga0495669_0045946 3300046684 Bacteria 1948
520 Ga0495613_0058556 3300046689 Bacteria 2827
521 Ga0495613_0189607 3300046689 Bacteria 1454
522 Ga0495613_0379192 3300046689 Bacteria 967
523 Ga0495624_0085885 3300046690 Bacteria 1943
524 Ga0495624_0110047 3300046690 Bacteria 1694
525 Ga0495649_0029143 3300046694 Bacteria 3056
526 Ga0495589_0027272 3300046794 Bacteria 2888
527 Ga0495600_0013155 3300046809 Bacteria 5190
528 Ga0495600_0043692 3300046809 Bacteria 2922
529 Ga0495600_0124660 3300046809 Bacteria 1675
530 Ga0495600_0329441 3300046809 Bacteria 959
531 Ga0495581_0020718 3300047315 Bacteria 3813
532 Ga0495581_0103026 3300047315 Bacteria 1658
533 Ga0495581_0203272 3300047315 Bacteria 1159
534 Ga0495581_0464130 3300047315 Bacteria 737
535 Ga0495604_0055802 3300047317 Bacteria 3043
536 Ga0495604_0074965 3300047317 Bacteria 2548
537 Ga0495604_0132530 3300047317 Bacteria 1790
538 Ga0495604_0321161 3300047317 Bacteria 1035
539 Ga0495604_0327129 3300047317 Bacteria 1023
540 Ga0495636_0157458 3300047318 Bacteria 1022
541 Ga0495674_0025391 3300047319 Bacteria 5433
542 Ga0495674_0060972 3300047319 Bacteria 3289
543 Ga0495674_0137534 3300047319 Bacteria 2055
544 Ga0495674_0144545 3300047319 Bacteria 1997
545 Ga0495672_0045596 3300047320 Bacteria 2622
546 Ga0495672_0064571 3300047320 Bacteria 2095
547 Ga0495676_0150292 3300047321 Bacteria 1658
548 Ga0495676_0226190 3300047321 Bacteria 1287
549 Ga0495676_0454747 3300047321 Bacteria 844
550 Ga0495680_0001058 3300047322 Bacteria 30479
551 Ga0495680_0046680 3300047322 Bacteria 3413
552 Ga0495680_0279231 3300047322 Bacteria 1177
553 Ga0495680_0647123 3300047322 Bacteria 703
554 Ga0495675_0088957 3300047444 Bacteria 1939
555 Ga0495675_0093012 3300047444 Bacteria 1892
556 Ga0495675_0299957 3300047444 Bacteria 954
557 Ga0495679_052680 3300047446 Bacteria 1217
558 Ga0495673_0131080 3300047469 Bacteria 985
559 Ga0495673_0209773 3300047469 Bacteria 725
560 Ga0495684_0010360 3300047471 Bacteria 7211
561 Ga0495684_0023592 3300047471 Bacteria 4730
562 Ga0495684_0100768 3300047471 Bacteria 2184
563 Ga0495684_0272697 3300047471 Bacteria 1223
564 Ga0495686_0134841 3300047472 Bacteria 1461
565 Ga0495593_0009301 3300047673 Bacteria 5703
566 Ga0495593_0045487 3300047673 Bacteria 2342
567 Ga0495593_0095987 3300047673 Bacteria 1524
568 Ga0495602_0005801 3300048088 Bacteria 12957
569 Ga0495602_0122872 3300048088 Bacteria 2085
570 Ga0495602_0252436 3300048088 Bacteria 1313
571 Ga0495602_0262500 3300048088 Bacteria 1280
572 Ga0495614_0232388 3300048089 Bacteria 840
573 Ga0495626_0097215 3300048091 Bacteria 1288
574 Ga0495626_0252037 3300048091 Bacteria 708
575 Ga0496100_0241901 3300048903 Bacteria 1332
576 Ga0496100_0404352 3300048903 Bacteria 1040
577 Ga0496101_0115007 3300048904 Bacteria 2029
578 Ga0496102_0052661 3300048905 Bacteria 3709
579 Ga0496102_0214698 3300048905 Bacteria 1813
580 Ga0496104_0031124 3300048907 Bacteria 4961
581 Ga0496104_0108611 3300048907 Bacteria 2659
582 Ga0496104_0159707 3300048907 Bacteria 2162
583 Ga0496104_0189717 3300048907 Bacteria 1967
584 Ga0496104_0350380 3300048907 Bacteria 1389
585 Ga0496105_0003004 3300048908 Bacteria 12398
586 Ga0496105_0074842 3300048908 Bacteria 2797
587 Ga0496105_0431351 3300048908 Bacteria 1042
588 Ga0496106_0002353 3300048909 Bacteria 14077
589 Ga0496106_0011609 3300048909 Bacteria 6510
590 Ga0496106_0069365 3300048909 Bacteria 2690
591 Ga0496106_0606621 3300048909 Bacteria 876
592 Ga0496106_0726699 3300048909 Bacteria 790
593 Ga0496107_0106089 3300048910 Bacteria 2063
594 Ga0496107_0238432 3300048910 Bacteria 1353
595 Ga0496107_0265206 3300048910 Bacteria 1278
596 Ga0496107_0532457 3300048910 Bacteria 871
597 Ga0496108_0009483 3300048911 Bacteria 7881
598 Ga0496108_0061105 3300048911 Bacteria 3170
599 Ga0496108_0157391 3300048911 Bacteria 1962
600 Ga0496108_0509485 3300048911 Bacteria 1051
601 Ga0496108_1002694 3300048911 Bacteria 713
602 Ga0496109_0012953 3300048912 Bacteria 7210
603 Ga0496109_0280492 3300048912 Bacteria 1570
604 Ga0496109_0372254 3300048912 Bacteria 1349
605 Ga0496110_0031727 3300048913 Bacteria 4561
606 Ga0496110_0077249 3300048913 Bacteria 2962
607 Ga0496110_0193224 3300048913 Bacteria 1848
608 Ga0496110_0255154 3300048913 Bacteria 1596
609 Ga0496110_0392218 3300048913 Bacteria 1265
610 Ga0496110_0504835 3300048913 Bacteria 1101
611 Ga0496111_0046544 3300048914 Bacteria 3123
612 Ga0496112_0062388 3300048915 Bacteria 3676
613 Ga0496112_0144561 3300048915 Bacteria 2347
614 Ga0496112_0329957 3300048915 Bacteria 1469
615 Ga0496112_0438570 3300048915 Bacteria 1244
616 Ga0496113_0049105 3300048916 Bacteria 3141
617 Ga0496113_0050145 3300048916 Bacteria 3111
618 Ga0496113_0066210 3300048916 Bacteria 2736
619 Ga0496113_0170509 3300048916 Bacteria 1723
620 Ga0496114_0265556 3300048917 Bacteria 1512
621 Ga0496115_0030236 3300048918 Bacteria 4260
622 Ga0496115_0095345 3300048918 Bacteria 2435
623 Ga0496115_0221206 3300048918 Bacteria 1562
624 Ga0496115_0258543 3300048918 Bacteria 1432
625 Ga0496115_0311341 3300048918 Bacteria 1289
626 Ga0496115_0353003 3300048918 Bacteria 1199
627 Ga0496117_0079095 3300048920 Bacteria 2168
628 Ga0496118_0006821 3300048921 Bacteria 12391
629 Ga0496118_0042808 3300048921 Bacteria 3568
630 Ga0496118_0051234 3300048921 Bacteria 3160
631 Ga0496120_0008263 3300048923 Bacteria 7602
632 Ga0496121_0000125 3300048924 Bacteria 169274
633 Ga0496121_0000218 3300048924 Bacteria 126175
634 Ga0496121_0014642 3300048924 Bacteria 8294
635 Ga0496121_0040659 3300048924 Bacteria 4075
636 Ga0496121_0042013 3300048924 Bacteria 3985
637 Ga0496121_0151748 3300048924 Bacteria 1704
638 Ga0496121_0188478 3300048924 Bacteria 1481
639 Ga0496121_0204559 3300048924 Bacteria 1404
640 Ga0496123_0102402 3300048926 Bacteria 1662
641 Ga0496123_0192476 3300048926 Bacteria 1054
642 Ga0496124_0001333 3300048927 Bacteria 37071
643 Ga0496125_0143980 3300048928 Bacteria 1651
644 Ga0496125_0235812 3300048928 Bacteria 1166
645 Ga0496125_0248178 3300048928 Bacteria 1125
646 Ga0496126_0006987 3300048929 Bacteria 12473
647 Ga0496126_0037108 3300048929 Bacteria 4551
648 Ga0496126_0037381 3300048929 Bacteria 4531
649 Ga0496126_0044315 3300048929 Bacteria 4097
650 Ga0496126_0120659 3300048929 Bacteria 2274
651 Ga0496126_0159522 3300048929 Bacteria 1928
652 Ga0496126_0398230 3300048929 Bacteria 1117
653 Ga0496126_0413623 3300048929 Bacteria 1091
654 Ga0496126_0467603 3300048929 Bacteria 1012
655 Ga0495682_0026008 3300049460 Bacteria 2176
656 Ga0501047_0206561 3300049581 Bacteria 1823
657 Ga0501067_0035168 3300049583 Bacteria 2782
658 Ga0501069_0241717 3300049585 Bacteria 1052
659 Ga0501070_0075966 3300049586 Bacteria 2781
660 Ga0501074_0030475 3300049590 Bacteria 3909
661 Ga0501076_0563273 3300049592 Bacteria 940
662 Ga0501080_0382784 3300049742 Bacteria 1267
663 Ga0501044_0076830 3300049823 Bacteria 3388
664 nmdc:mga03683_81501_c1 3300050489 Bacteria 1398
665 nmdc:mga03n38_18432_c1 3300050490 Bacteria 2756
666 nmdc:mga03n38_34933_c1 3300050490 Bacteria 2150
667 nmdc:mga00v17_261837_c1 3300050491 Bacteria 1122
668 nmdc:mga0yw44_259474_c1 3300050492 Bacteria 1158
669 nmdc:mga0yw44_97948_c2 3300050492 Bacteria 1284
670 nmdc:mga0k408_40526_c1 3300050493 Bacteria 2680
671 nmdc:mga0k408_555354_c1 3300050493 Bacteria 679
672 nmdc:mga0k408_84735_c1 3300050493 Bacteria 1237
673 nmdc:mga06z11_10371_c1 3300050494 Bacteria 3968
674 nmdc:mga06z11_142337_c1 3300050494 Bacteria 1357
675 nmdc:mga06z11_145385_c1 3300050494 Bacteria 993
676 nmdc:mga06z11_20797_c1 3300050494 Bacteria 3039
677 nmdc:mga06z11_209962_c1 3300050494 Bacteria 1134
678 nmdc:mga04h51_224471_c1 3300050495 Bacteria 745
679 nmdc:mga07m45_100196_c1 3300050496 Bacteria 1664
680 nmdc:mga07m45_2468_c1 3300050496 Bacteria 8671
681 nmdc:mga0n895_154768_c1 3300050512 Bacteria 2323
682 nmdc:mga0n895_359693_c1 3300050512 Bacteria 1474
683 nmdc:mga0n895_59955_c1 3300050512 Bacteria 3754
684 Ga0495601_0015350 3300053077 Bacteria 4630
685 Ga0495601_0077251 3300053077 Bacteria 2132
686 Ga0495601_0453411 3300053077 Bacteria 829
687 Ga0495612_0040204 3300053078 Bacteria 1904
688 Ga0495612_0143130 3300053078 Bacteria 1038
689 Ga0495655_0016459 3300053083 Bacteria 1593
690 Ga0495595_0003385 3300053084 Bacteria 6333
691 Ga0495595_0123258 3300053084 Bacteria 1263
692 Ga0495619_0006640 3300053085 Bacteria 7323
693 Ga0495619_0162021 3300053085 Bacteria 1545
694 Ga0500651_0138248 3300053093 Bacteria 1470
695 Ga0500651_0439829 3300053093 Bacteria 727
696 Ga0500566_0199347 3300053094 Bacteria 1012
697 Ga0500566_0232336 3300053094 Bacteria 909
698 Ga0500641_0015849 3300053096 Bacteria 2802
699 Ga0500554_000394 3300053102 Bacteria 9295
700 Ga0500555_103621 3300053103 Bacteria 721
701 Ga0500595_003114 3300053119 Bacteria 7852
702 Ga0500595_007614 3300053119 Bacteria 4484
703 Ga0500595_060471 3300053119 Bacteria 1146
704 Ga0500658_0140348 3300053134 Bacteria 1083
705 Ga0500561_0063441 3300053137 Bacteria 1041
706 Ga0500577_0172251 3300053142 Bacteria 926
707 Ga0500589_179002 3300053147 Bacteria 835
708 Ga0500603_002876 3300053150 Bacteria 3732
709 Ga0500638_105691 3300053162 Bacteria 1307
710 Ga0500639_067620 3300053163 Bacteria 1828
711 Ga0500639_096771 3300053163 Bacteria 1460
712 Ga0500636_0291832 3300053177 Bacteria 808
713 Ga0500637_0003914 3300053178 Bacteria 6952
714 Ga0500637_0155301 3300053178 Bacteria 1320
715 Ga0500596_001313 3300053735 Bacteria 5008
716 Ga0500661_007389 3300055283 Bacteria 2034
717 Ga0500661_008050 3300055283 Bacteria 1941
718 Ga0466962_0339483 3300061719 Bacteria 747
719 2507511801 2507262055 Bacteria 8048963
720 2508545467 2508501009 Bacteria 7784016
721 2508694282 2508501042 Bacteria 8719808
722 2513643371 2513237094 Bacteria 8789602
723 2513655733 2513237096 Bacteria 8722461
724 2513670917 2513237098 Bacteria 9902361
725 2513697274 2513237101 Bacteria 7952346
726 2513862784 2513237137 Bacteria 9558895
727 2513892958 2513237141 Bacteria 8496279
728 2513916189 2513237145 Bacteria 8979722
729 2515624792 2515154112 Bacteria 8294334
730 2517106144 2517093001 Bacteria 9002274
731 2517890204 2517572143 Bacteria 9484767
732 2524538333 2524023228 Bacteria 10118060
733 2617349554 2617270735 Bacteria 9163226
734 2671121659 2667528175 Bacteria 7532676
735 2723848675 2721755755 Bacteria 8322773
736 2728752107 2728368998 Bacteria 8720350
737 2793067820 2791355197 Bacteria 8420563
738 2793077523
739 2805919592 2802429603 Bacteria 8777136
740 2824623732 2824617872 Bacteria 8814715
741 2824633372 2824626560 Bacteria 8813858
742 2824642832 2824635225 Bacteria 8785348
743 2824652300 2824644064 Bacteria 8743947
744 2824670160 2824661429 Bacteria 9877870
745 2824722658 2824714736 Bacteria 8717648
746 2824732209 2824723954 Bacteria 8758240
747 2824777914 2824773399 Bacteria 8360218
748 2838130514 2838122688 Bacteria 8803140
749 2841942179 2841941048 Bacteria 8688029
750 2841963594 2841957949 Bacteria 8652217
751 2841971298 2841966195 Bacteria 8673214
752 2841981590 2841974524 Bacteria 8931498
753 2841987102 2841983080 Bacteria 8395090
754 2844321012 2844315083 Bacteria 8138177
755 2847943617 2847939898 Bacteria 8606328
756 2849077341 2849076700 Bacteria 7039503
757 2874593641 2874590934 Bacteria 8299676
758 2874606194 2874604998 Bacteria 7834745
759 2874648346 2874645413 Bacteria 8214782
760 2876774702 2876771140 Bacteria 8287509
761 2876816734 2876808645 Bacteria 8824342
762 2876821493 2876818435 Bacteria 8274608
763 2879079270 2879074833 Bacteria 8279565
764 2879102690 2879099564 Bacteria 10442239
765 2879113140 2879110137 Bacteria 8907982
766 2889036753 2889033259 Bacteria 9099371
767 2903734219 2903727486 Bacteria 8281579
768 2903755214 2903748898 Bacteria 9972761
769 2904692944 2904690495 Bacteria 9412302
770 2904710478
771 2906605299 2906602504 Bacteria 8295279
772 2906612032
773 2906634578 2906626472 Bacteria 8826946
774 2906636264 2906635258 Bacteria 8601019
775 2906663578 2906660503 Bacteria 8595048
776 2908740439 2908739725 Bacteria 8628932
777 2908758335 2908756301 Bacteria 8864324
778 2922363756 2922361189 Bacteria 7436256
779 2922370642
780 2922389692 2922386360 Bacteria 7017218
781 2922427263
782 2929620212 2929615660 Bacteria 9193770
783 2929629525 2929624759 Bacteria 9339455
784 2932791568 2932784394 Bacteria 9704911
785 2932799348 2932794094 Bacteria 7915132
786 2932802255 2932801729 Bacteria 7987968
787 2932816832 2932809354 Bacteria 9135765
788 2932823991 2932818245 Bacteria 9955613
789 2932835471 2932828146 Bacteria 9745859
790 2933582129 2933577622 Bacteria 9116884
791 2935621213 2935616580 Bacteria 9032984
792 2935636297 2935630451 Bacteria 8169952
793 2935643467 2935638405 Bacteria 10015038
794 2935650553 2935648319 Bacteria 8801166
795 2935662995 2935656913 Bacteria 8965014
796 2935671210 2935665750 Bacteria 9571747
797 2935681187 2935675223 Bacteria 9928132
798 2935689474 2935684952 Bacteria 9590419
799 2935700048 2935694250 Bacteria 9291695
800 2935710742 2935703347 Bacteria 10242284
801 2935720725 2935713505 Bacteria 9608509
802 2935727964 2935722832 Bacteria 9608746
803 2935737440 2935732158 Bacteria 9706831
804 2935746499 2935741537 Bacteria 9707219
805 2935757466 2935750917 Bacteria 9590372
806 2935763841 2935760218 Bacteria 9817913
807 2935807821 2935801545 Bacteria 9301974
808 2935818276 2935810662 Bacteria 9401221
809 2935832984 2935827899 Bacteria 10038562
810 2935844344 2935837841 Bacteria 9454360
811 2935859594 2935855204 Bacteria 9035059
812 2935871341 2935864058 Bacteria 9784707
813 2935879084 2935873716 Bacteria 9632195
814 2935889506 2935883170 Bacteria 7964738
815 2935965556 2935959822 Bacteria 7869783
816 2935990774 2935984226 Bacteria 8302647
817 2935996727 2935992306 Bacteria 9802711
818 2936008603 2936002035 Bacteria 9362176
819 2936017091 2936011229 Bacteria 8801034
820 2936027467 2936019824 Bacteria 8804134
821 2936036291 2936028420 Bacteria 8965941
822 2936044906 2936037263 Bacteria 9446081
823 2936050776 2936046547 Bacteria 8903709
824 2936062741 2936055302 Bacteria 8785755
825 2940563710 2940556831 Bacteria 9590747
826 2941512928 2941507105 Bacteria 8166816
827 2941520770 2941515067 Bacteria 8166720
828 2941528785 2941523033 Bacteria 8169134
829 2941537781 2941531003 Bacteria 7653939
830 2941542676 2941538514 Bacteria 9402094
831 3005476441 3005474847 Bacteria 9259049
832 3005601350 3005594810 Bacteria 8716512
833 3005716789 3005710791 Bacteria 7622528
834 3005724045 3005718088 Bacteria 8283608
835 8006928020 8006926726 Bacteria 6749210
836 8006937799 8006933436 Bacteria 10410654
837 8006973053 8006964411 Bacteria 8966052
838 8006977827 8006973647 Bacteria 10679141
839 8006986401 8006984368 Bacteria 9651211
840 8016519575 8016511872 Bacteria 9921665
841 8017065952 8017057580 Bacteria 10023680
842 8019560853 8019555841 Bacteria 9642137
843 8019570934 8019565922 Bacteria 9639779
844 8019578698 8019576017 Bacteria 10049540
845 8019596736 8019586578 Bacteria 10212056
846 8019604950 8019597564 Bacteria 10041141
847 8019653767 8019648815 Bacteria 10014479
848 8055750035 8055742211 Bacteria 9226248
849 8056676470 8056673599 Bacteria 7871253
850 8056682005 8056681323 Bacteria 8472857
851 8056969743 8056967851 Bacteria 9038162
852 Ga0206354_11513705
853 JGI25165J46597_1027283
854 JGI25153J46596_10008204
855 JGI25160J50197_1011166
856 Ga0065165_1028600
857 Ga0065715_10209158
858 Ga0070658_10183897
859 Ga0070658_10579576
860 Ga0070683_100017013
861 Ga0070683_100046333
862 Ga0068869_100122239
863 Ga0070680_100032205
864 Ga0070680_100059350
865 Ga0070680_100102799
866 Ga0070680_100479552
867 Ga0070661_100240697
868 Ga0070668_100027166
869 Ga0070675_100223434
870 Ga0070673_100182429
871 Ga0070688_100188158
872 Ga0070709_10009409
873 Ga0070709_10019560
874 Ga0070709_10462628
875 Ga0070714_100021066
876 Ga0070714_100126326
877 Ga0070714_100661914
878 Ga0070714_100711446
879 Ga0070713_100051131
880 Ga0070713_100134866
881 Ga0070713_100192861
882 Ga0070713_100376442
883 Ga0070710_10001728
884 Ga0070710_10049770
885 Ga0070711_100003745
886 Ga0070711_100479976
887 Ga0070711_100717426
888 Ga0070711_101068042
889 Ga0070700_100241203
890 Ga0070663_100031371
891 Ga0070663_100137832
892 Ga0070678_100841512
893 Ga0070662_100022905
894 Ga0070662_100063047
895 Ga0070662_100164109
896 Ga0070662_100374415
897 Ga0070681_10011424
898 Ga0070681_10057928
899 Ga0070681_10076669
900 Ga0070681_10143757
901 Ga0068867_100078350
902 Ga0070706_100566113
903 Ga0070698_100143279
904 Ga0070679_100101164
905 Ga0070679_100123755
906 Ga0070679_100437547
907 Ga0070684_100033483
908 Ga0070697_100074798
909 Ga0070697_100681778
910 Ga0068853_100033950
911 Ga0068853_100143983
912 Ga0068853_100495762
913 Ga0070672_100251471
914 Ga0070672_100585569
915 Ga0070672_100964967
916 Ga0070665_100069904
917 Ga0070665_100101560
918 Ga0070665_100584585
919 Ga0068855_100084929
920 Ga0068855_100175718
921 Ga0068855_100224629
922 Ga0068855_100345747
923 Ga0068855_100418657
924 Ga0068855_100728766
925 Ga0070664_100453590
926 Ga0068857_100122148
927 Ga0068857_100282602
928 Ga0068857_100406229
929 Ga0068854_100065756
930 Ga0068854_100102168
931 Ga0068856_100009520
932 Ga0068856_100011946
933 Ga0068856_100753467
934 Ga0068856_100855466
935 Ga0068852_100106104
936 Ga0068852_100920685
937 Ga0068859_101070173
938 Ga0068864_100201028
939 Ga0068861_100078847
940 Ga0068861_100896273
941 Ga0068851_10001257
942 Ga0068870_10266275
943 Ga0068863_100746210
944 Ga0068858_100082707
945 Ga0068858_101001635
946 Ga0068860_100076638
947 Ga0068862_100230606
948 Ga0081455_10007620
949 Ga0081455_10185253
950 Ga0081540_1009378
951 Ga0081540_1035271
952 Ga0081539_10203531
953 Ga0070717_10045944
954 Ga0070717_10386359
955 Ga0075365_10057604
956 Ga0075365_10555854
957 Ga0075368_10078092
958 Ga0075364_10085644
959 Ga0075432_10045074
960 Ga0070715_10002320
961 Ga0070716_100052455
962 Ga0070716_100159270
963 Ga0070716_100479778
964 Ga0070712_100031693
965 Ga0070712_100043937
966 Ga0070712_100067607
967 Ga0070712_100146869
968 Ga0070712_100381895
969 Ga0075362_10061420
970 Ga0075367_10031122
971 Ga0075367_10197493
972 Ga0075367_10245826
973 Ga0075367_10313843
974 Ga0075369_10066566
975 Ga0075369_10131077
976 Ga0075366_10264303
977 Ga0097621_100917010
978 Ga0075370_10046993
979 Ga0075370_10281695
980 Ga0075434_100147037
981 Ga0075434_100770445
982 Ga0075429_100532400
983 Ga0097620_101070178
984 Ga0075435_100762868
985 Ga0099794_10035926
986 Ga0105240_10002281
987 Ga0105240_10036722
988 Ga0105240_10104287
989 Ga0105240_10171349
990 Ga0105240_10360254
991 Ga0111539_11191424
992 Ga0105245_10035230
993 Ga0105247_10284099
994 Ga0105247_10396320
995 Ga0114129_10493841
996 Ga0105243_10246570
997 Ga0105241_10000387
998 Ga0105241_10042939
999 Ga0105241_10063756
1000 Ga0105241_10131441
1001 Ga0105241_10532122
1002 Ga0105242_10476171
1003 Ga0105248_10029798
1004 Ga0105248_10119519
1005 Ga0105248_10261427
1006 Ga0105237_10050609
1007 Ga0105237_10082156
1008 Ga0105237_11102881
1009 Ga0105238_10003351
1010 Ga0105238_10071831
1011 Ga0105249_10535492
1012 Ga0105239_10039182
1013 Ga0105239_10165080
1014 Ga0105239_10294830
1015 Ga0105239_10313205
1016 Ga0105239_10443593
1017 Ga0157370_10066200
1018 Ga0157370_10173621
1019 Ga0157370_10194758
1020 Ga0157369_10120889
1021 Ga0157369_10489602
1022 Ga0157369_11176544
1023 Ga0157374_10065440
1024 Ga0157374_10366694
1025 Ga0157378_10024747
1026 Ga0163162_10551862
1027 Ga0163162_10905430
1028 Ga0157372_10222226
1029 Ga0157375_10240441
1030 Ga0157375_10284560
1031 Ga0163163_10709005
1032 Ga0157380_10459154
1033 Ga0157376_10035591
1034 Ga0213873_10009524
1035 Ga0213872_10153813
1036 Ga0213876_10059420
1037 Ga0213876_10072780
1038 Ga0213876_10190290
1039 Ga0213871_10093318
1040 Ga0209148_1000333
1041 Ga0209233_1043470
1042 Ga0209455_1003276
1043 Ga0209758_1005697
1044 Ga0207656_10004285
1045 Ga0207692_10210132
1046 Ga0207642_10371535
1047 Ga0207710_10014804
1048 Ga0207688_10170976
1049 Ga0207647_10024843
1050 Ga0207685_10021870
1051 Ga0207685_10116032
1052 Ga0207699_10000504
1053 Ga0207699_10172464
1054 Ga0207699_10190077
1055 Ga0207645_10083912
1056 Ga0207643_10041524
1057 Ga0207705_10162360
1058 Ga0207705_10209292
1059 Ga0207654_10000216
1060 Ga0207654_10019900
1061 Ga0207654_10068781
1062 Ga0207654_10148413
1063 Ga0207707_10055802
1064 Ga0207707_10115666
1065 Ga0207707_10139143
1066 Ga0207695_10000378
1067 Ga0207695_10000430
1068 Ga0207695_10105010
1069 Ga0207695_10129453
1070 Ga0207671_10033677
1071 Ga0207671_10083294
1072 Ga0207671_10110183
1073 Ga0207671_10248487
1074 Ga0207693_10025530
1075 Ga0207693_10033766
1076 Ga0207693_10044027
1077 Ga0207693_10067629
1078 Ga0207693_10119437
1079 Ga0207693_10343727
1080 Ga0207663_10001929
1081 Ga0207663_10093829
1082 Ga0207663_10142006
1083 Ga0207663_10364777
1084 Ga0207660_10025526
1085 Ga0207660_10195445
1086 Ga0207652_10056429
1087 Ga0207652_10485760
1088 Ga0207694_10144232
1089 Ga0207694_10397917
1090 Ga0207650_10093653
1091 Ga0207659_10365948
1092 Ga0207700_10016961
1093 Ga0207700_10059132
1094 Ga0207700_10095415
1095 Ga0207700_10205575
1096 Ga0207700_10310110
1097 Ga0207664_10080860
1098 Ga0207664_10081282
1099 Ga0207664_10482186
1100 Ga0207664_10514551
1101 Ga0207664_10544244
1102 Ga0207664_10864497
1103 Ga0207706_10076445
1104 Ga0207706_10096898
1105 Ga0207706_10216254
1106 Ga0207706_10254439
1107 Ga0207709_10476534
1108 Ga0207704_10698843
1109 Ga0207665_10057167
1110 Ga0207691_10090189
1111 Ga0207691_10191231
1112 Ga0207691_10514101
1113 Ga0207711_10042154
1114 Ga0207689_10078797
1115 Ga0207689_10161979
1116 Ga0207667_10024488
1117 Ga0207667_10222852
1118 Ga0207651_10204784
1119 Ga0207651_10281018
1120 Ga0207668_10137911
1121 Ga0207668_10164505
1122 Ga0207668_10702232
1123 Ga0207640_10940890
1124 Ga0207703_10084660
1125 Ga0207703_10270090
1126 Ga0207639_10008972
1127 Ga0207639_10186507
1128 Ga0207639_10418697
1129 Ga0207639_10447573
1130 Ga0207639_10637047
1131 Ga0207639_10720111
1132 Ga0207678_10066118
1133 Ga0207678_10073230
1134 Ga0207678_10153365
1135 Ga0207678_10214575
1136 Ga0207678_10439093
1137 Ga0207708_10086210
1138 Ga0207708_10194725
1139 Ga0207702_10000006
1140 Ga0207702_10008789
1141 Ga0207702_10819842
1142 Ga0207641_10104036
1143 Ga0207676_10074496
1144 Ga0207674_10171670
1145 Ga0207674_10314998
1146 Ga0207675_100118379
1147 Ga0207683_10059843
1148 Ga0207683_10255210
1149 Ga0207683_10285040
1150 Ga0207683_10587998
1151 Ga0207698_10310248
1152 Ga0209589_1000007
1153 Ga0209489_100008
1154 Ga0209700_100009
1155 Ga0209588_1072960
1156 Ga0209813_10149597
1157 Ga0268266_10004436
1158 Ga0268266_10348358
1159 Ga0268266_10449984
1160 Ga0268266_10490950
1161 Ga0268266_11103901
1162 Ga0268265_10156211
1163 Ga0268265_10199823
1164 Ga0307517_10000196
1165 Ga0307517_10184645
1166 Ga0307515_10422208
1167 Ga0307511_10094657
1168 Ga0265339_10045952
1169 Ga0307513_10084886
1170 Ga0307513_10254841
1171 Ga0307513_10456134
1172 Ga0307509_10107389
1173 Ga0265314_10000530
1174 Ga0265314_10049828
1175 Ga0265342_10081785
1176 Ga0307516_10490114
1177 Ga0307405_10367649
1178 Ga0307412_10142903
1179 Ga0307416_100178301
1180 Ga0307415_100028295
1181 Ga0307415_100280590
1182 Ga0307507_10124911
1183 Ga0307510_10055432
1184 Ga0307510_10055803
1185 Ga0307510_10079466
1186 Ga0307510_10187543
1187 Ga0315911_1000012
1188 Ga0373926_0028411
1189 Ga0373929_0051543
1190 Ga0373934_0011696
1191 Ga0373940_0015398
1192 Ga0373949_0038015
1193 Ga0373923_0005452
1194 Ga0373923_0012843
1195 Ga0373923_0013360
1196 Ga0373945_0161127
1197 Ga0373953_0010974
1198 Ga0373954_0008981
1199 Ga0373956_0016577
1200 Ga0373956_0203973
1201 Ga0373957_0005372
1202 Ga0373946_0390272
1203 Ga0373955_0024616
1204 Ga0373924_0012206
1205 Ga0373924_0021357
1206 Ga0373924_0091239
1207 Ga0373931_0007107
1208 Ga0373935_0032397
1209 Ga0373935_0164211
1210 Ga0373935_0388744
1211 Ga0373927_0011945
1212 Ga0373927_0069442
1213 Ga0373933_0000127
1214 Ga0373933_0009762
1215 Ga0373933_0013466
1216 Ga0373947_0080852
1217 Ga0373937_0176172
1218 Ga0373937_0960072
1219 Ga0372808_016958
1220 Ga0373925_0020068
1221 Ga0373925_0077317
1222 Ga0395900_0345879
1223 Ga0395898_0011081
1224 Ga0395905_0862032
1225 Ga0436364_1260262
1226 Ga0395901_0350729
1227 Ga0436365_0171700
1228 Ga0436365_0336270
1229 Ga0436365_0570400
1230 Ga0436365_0753964
1231 Ga0436365_0916174
1232 Ga0436365_1077794
1233 Ga0436365_1856792
1234 Ga0436360_0214793
1235 Ga0436360_0469985
1236 Ga0436360_0523168
1237 Ga0436360_1204674
1238 Ga0436360_1234883
1239 Ga0436361_0293327
1240 Ga0436361_0383305
1241 Ga0436361_0903396
1242 Ga0436363_1634831
1243 Ga0451789_0199537
1244 Ga0451807_1755786
1245 Ga0451837_1123785
1246 Ga0451845_0638386
1247 Ga0451849_1032934
1248 Ga0451843_0044726
1249 Ga0451853_3641990
1250 Ga0466972_0000115
1251 Ga0466964_0224215
1252 Ga0466970_0086306
1253 Ga0466970_0333355
1254 Ga0466970_0354654
1255 Ga0466957_0060425
1256 Ga0466959_0163516
1257 Ga0466967_0204169
1258 Ga0466967_0366221
1259 Ga0466967_0464684
1260 Ga0495592_0007961
1261 Ga0495592_0070623
1262 Ga0495592_0082597
1263 Ga0495592_0173501
1264 Ga0495603_0002113
1265 Ga0495603_0018580
1266 Ga0495603_0091595
1267 Ga0495629_0011347
1268 Ga0495629_0097989
1269 Ga0495629_0191783
1270 Ga0495641_0069339
1271 Ga0495641_0145310
1272 Ga0495651_0034658
1273 Ga0495651_0064389
1274 Ga0495651_0067812
1275 Ga0495651_0081450
1276 Ga0495651_0213958
1277 Ga0495653_0044912
1278 Ga0495653_0168611
1279 Ga0495653_0288275
1280 Ga0495650_0030238
1281 Ga0495580_0153623
1282 Ga0495580_0156209
1283 Ga0495582_0172000
1284 Ga0495582_0242119
1285 Ga0495605_0067160
1286 Ga0495639_0125746
1287 Ga0495639_0306766
1288 Ga0495662_0101095
1289 Ga0495664_0015561
1290 Ga0495664_0072085
1291 Ga0495664_0430057
1292 Ga0495664_0511344
1293 Ga0495584_0313676
1294 Ga0495585_0035419
1295 Ga0495585_0213446
1296 Ga0495594_0209602
1297 Ga0495583_0071804
1298 Ga0495606_0033946
1299 Ga0495608_0007602
1300 Ga0495608_0017173
1301 Ga0495608_0036649
1302 Ga0495610_0150730
1303 Ga0495618_0023754
1304 Ga0495618_0059180
1305 Ga0495618_0095690
1306 Ga0495618_0147417
1307 Ga0495628_0036737
1308 Ga0495628_0059158
1309 Ga0495628_0097416
1310 Ga0495630_0025317
1311 Ga0495630_0775522
1312 Ga0495631_0013532
1313 Ga0495632_0139589
1314 Ga0495643_0148047
1315 Ga0495644_0055718
1316 Ga0495666_0093591
1317 Ga0495652_0015775
1318 Ga0495652_0031931
1319 Ga0495652_0103158
1320 Ga0495652_0108169
1321 Ga0495654_0164499
1322 Ga0495640_0021204
1323 Ga0495640_0061745
1324 Ga0495640_0188336
1325 Ga0495586_0455558
1326 Ga0495587_0037948
1327 Ga0495587_0052414
1328 Ga0495587_0110531
1329 Ga0495587_0159753
1330 Ga0495598_0012886
1331 Ga0495609_0041604
1332 Ga0495621_0147619
1333 Ga0495645_0042408
1334 Ga0495645_0087519
1335 Ga0495645_0164803
1336 Ga0495622_0054211
1337 Ga0495667_0012960
1338 Ga0495656_0074729
1339 Ga0495668_0060076
1340 Ga0495668_0137386
1341 Ga0495634_0054103
1342 Ga0495634_0060929
1343 Ga0495634_0169241
1344 Ga0495634_0172774
1345 Ga0495625_0152730
1346 Ga0495635_0005323
1347 Ga0495635_0010033
1348 Ga0495635_0034381
1349 Ga0495635_0098258
1350 Ga0495635_0213191
1351 Ga0495635_0465831
1352 Ga0495659_0069232
1353 Ga0495588_0075830
1354 Ga0495657_0015963
1355 Ga0495657_0029066
1356 Ga0495657_0046936
1357 Ga0495657_0313433
1358 Ga0495657_0393435
1359 Ga0495599_0029311
1360 Ga0495599_0031147
1361 Ga0495599_0063110
1362 Ga0495623_0007605
1363 Ga0495623_0020667
1364 Ga0495623_0025325
1365 Ga0495646_0096928
1366 Ga0495647_0007620
1367 Ga0495658_0009938
1368 Ga0495658_0523871
1369 Ga0495658_0550903
1370 Ga0495669_0045946
1371 Ga0495613_0058556
1372 Ga0495613_0189607
1373 Ga0495613_0379192
1374 Ga0495624_0085885
1375 Ga0495624_0110047
1376 Ga0495649_0029143
1377 Ga0495589_0027272
1378 Ga0495600_0013155
1379 Ga0495600_0043692
1380 Ga0495600_0124660
1381 Ga0495600_0329441
1382 Ga0495581_0020718
1383 Ga0495581_0103026
1384 Ga0495581_0203272
1385 Ga0495581_0464130
1386 Ga0495604_0055802
1387 Ga0495604_0074965
1388 Ga0495604_0132530
1389 Ga0495604_0321161
1390 Ga0495604_0327129
1391 Ga0495636_0157458
1392 Ga0495674_0025391
1393 Ga0495674_0060972
1394 Ga0495674_0137534
1395 Ga0495674_0144545
1396 Ga0495672_0045596
1397 Ga0495672_0064571
1398 Ga0495676_0150292
1399 Ga0495676_0226190
1400 Ga0495676_0454747
1401 Ga0495680_0001058
1402 Ga0495680_0046680
1403 Ga0495680_0279231
1404 Ga0495680_0647123
1405 Ga0495675_0088957
1406 Ga0495675_0093012
1407 Ga0495675_0299957
1408 Ga0495679_052680
1409 Ga0495673_0131080
1410 Ga0495673_0209773
1411 Ga0495684_0010360
1412 Ga0495684_0023592
1413 Ga0495684_0100768
1414 Ga0495684_0272697
1415 Ga0495686_0134841
1416 Ga0495593_0009301
1417 Ga0495593_0045487
1418 Ga0495593_0095987
1419 Ga0495602_0005801
1420 Ga0495602_0122872
1421 Ga0495602_0252436
1422 Ga0495602_0262500
1423 Ga0495614_0232388
1424 Ga0495626_0097215
1425 Ga0495626_0252037
1426 Ga0496100_0241901
1427 Ga0496100_0404352
1428 Ga0496101_0115007
1429 Ga0496102_0052661
1430 Ga0496102_0214698
1431 Ga0496104_0031124
1432 Ga0496104_0108611
1433 Ga0496104_0159707
1434 Ga0496104_0189717
1435 Ga0496104_0350380
1436 Ga0496105_0003004
1437 Ga0496105_0074842
1438 Ga0496105_0431351
1439 Ga0496106_0002353
1440 Ga0496106_0011609
1441 Ga0496106_0069365
1442 Ga0496106_0606621
1443 Ga0496106_0726699
1444 Ga0496107_0106089
1445 Ga0496107_0238432
1446 Ga0496107_0265206
1447 Ga0496107_0532457
1448 Ga0496108_0009483
1449 Ga0496108_0061105
1450 Ga0496108_0157391
1451 Ga0496108_0509485
1452 Ga0496108_1002694
1453 Ga0496109_0012953
1454 Ga0496109_0280492
1455 Ga0496109_0372254
1456 Ga0496110_0031727
1457 Ga0496110_0077249
1458 Ga0496110_0193224
1459 Ga0496110_0255154
1460 Ga0496110_0392218
1461 Ga0496110_0504835
1462 Ga0496111_0046544
1463 Ga0496112_0062388
1464 Ga0496112_0144561
1465 Ga0496112_0329957
1466 Ga0496112_0438570
1467 Ga0496113_0049105
1468 Ga0496113_0050145
1469 Ga0496113_0066210
1470 Ga0496113_0170509
1471 Ga0496114_0265556
1472 Ga0496115_0030236
1473 Ga0496115_0095345
1474 Ga0496115_0221206
1475 Ga0496115_0258543
1476 Ga0496115_0311341
1477 Ga0496115_0353003
1478 Ga0496117_0079095
1479 Ga0496118_0006821
1480 Ga0496118_0042808
1481 Ga0496118_0051234
1482 Ga0496120_0008263
1483 Ga0496121_0000125
1484 Ga0496121_0000218
1485 Ga0496121_0014642
1486 Ga0496121_0040659
1487 Ga0496121_0042013
1488 Ga0496121_0151748
1489 Ga0496121_0188478
1490 Ga0496121_0204559
1491 Ga0496123_0102402
1492 Ga0496123_0192476
1493 Ga0496124_0001333
1494 Ga0496125_0143980
1495 Ga0496125_0235812
1496 Ga0496125_0248178
1497 Ga0496126_0006987
1498 Ga0496126_0037108
1499 Ga0496126_0037381
1500 Ga0496126_0044315
1501 Ga0496126_0120659
1502 Ga0496126_0159522
1503 Ga0496126_0398230
1504 Ga0496126_0413623
1505 Ga0496126_0467603
1506 Ga0495682_0026008
1507 Ga0501047_0206561
1508 Ga0501067_0035168
1509 Ga0501069_0241717
1510 Ga0501070_0075966
1511 Ga0501074_0030475
1512 Ga0501076_0563273
1513 Ga0501080_0382784
1514 Ga0501044_0076830
1515 nmdc:mga03683_81501_c1
1516 nmdc:mga03n38_18432_c1
1517 nmdc:mga03n38_34933_c1
1518 nmdc:mga00v17_261837_c1
1519 nmdc:mga0yw44_259474_c1
1520 nmdc:mga0yw44_97948_c2
1521 nmdc:mga0k408_40526_c1
1522 nmdc:mga0k408_555354_c1
1523 nmdc:mga0k408_84735_c1
1524 nmdc:mga06z11_10371_c1
1525 nmdc:mga06z11_142337_c1
1526 nmdc:mga06z11_145385_c1
1527 nmdc:mga06z11_20797_c1
1528 nmdc:mga06z11_209962_c1
1529 nmdc:mga04h51_224471_c1
1530 nmdc:mga07m45_100196_c1
1531 nmdc:mga07m45_2468_c1
1532 nmdc:mga0n895_154768_c1
1533 nmdc:mga0n895_359693_c1
1534 nmdc:mga0n895_59955_c1
1535 Ga0495601_0015350
1536 Ga0495601_0077251
1537 Ga0495601_0453411
1538 Ga0495612_0040204
1539 Ga0495612_0143130
1540 Ga0495655_0016459
1541 Ga0495595_0003385
1542 Ga0495595_0123258
1543 Ga0495619_0006640
1544 Ga0495619_0162021
1545 Ga0500651_0138248
1546 Ga0500651_0439829
1547 Ga0500566_0199347
1548 Ga0500566_0232336
1549 Ga0500641_0015849
1550 Ga0500554_000394
1551 Ga0500555_103621
1552 Ga0500595_003114
1553 Ga0500595_007614
1554 Ga0500595_060471
1555 Ga0500658_0140348
1556 Ga0500561_0063441
1557 Ga0500577_0172251
1558 Ga0500589_179002
1559 Ga0500603_002876
1560 Ga0500638_105691
1561 Ga0500639_067620
1562 Ga0500639_096771
1563 Ga0500636_0291832
1564 Ga0500637_0003914
1565 Ga0500637_0155301
1566 Ga0500596_001313
1567 Ga0500661_007389
1568 Ga0500661_008050
1569 Ga0466962_0339483
1570 2507511801
1571 2508545467
1572 2508694282
1573 2513643371
1574 2513655733
1575 2513670917
1576 2513697274
1577 2513862784
1578 2513892958
1579 2513916189
1580 2515624792
1581 2517106144
1582 2517890204
1583 2524538333
1584 2617349554
1585 2671121659
1586 2723848675
1587 2728752107
1588 2793067820
1589 2793077523
1590 2805919592
1591 2824623732
1592 2824633372
1593 2824642832
1594 2824652300
1595 2824670160
1596 2824722658
1597 2824732209
1598 2824777914
1599 2838130514
1600 2841942179
1601 2841963594
1602 2841971298
1603 2841981590
1604 2841987102
1605 2844321012
1606 2847943617
1607 2849077341
1608 2874593641
1609 2874606194
1610 2874648346
1611 2876774702
1612 2876816734
1613 2876821493
1614 2879079270
1615 2879102690
1616 2879113140
1617 2889036753
1618 2903734219
1619 2903755214
1620 2904692944
1621 2904710478
1622 2906605299
1623 2906612032
1624 2906634578
1625 2906636264
1626 2906663578
1627 2908740439
1628 2908758335
1629 2922363756
1630 2922370642
1631 2922389692
1632 2922427263
1633 2929620212
1634 2929629525
1635 2932791568
1636 2932799348
1637 2932802255
1638 2932816832
1639 2932823991
1640 2932835471
1641 2933582129
1642 2935621213
1643 2935636297
1644 2935643467
1645 2935650553
1646 2935662995
1647 2935671210
1648 2935681187
1649 2935689474
1650 2935700048
1651 2935710742
1652 2935720725
1653 2935727964
1654 2935737440
1655 2935746499
1656 2935757466
1657 2935763841
1658 2935807821
1659 2935818276
1660 2935832984
1661 2935844344
1662 2935859594
1663 2935871341
1664 2935879084
1665 2935889506
1666 2935965556
1667 2935990774
1668 2935996727
1669 2936008603
1670 2936017091
1671 2936027467
1672 2936036291
1673 2936044906
1674 2936050776
1675 2936062741
1676 2940563710
1677 2941512928
1678 2941520770
1679 2941528785
1680 2941537781
1681 2941542676
1682 3005476441
1683 3005601350
1684 3005716789
1685 3005724045
1686 8006928020
1687 8006937799
1688 8006973053
1689 8006977827
1690 8006986401
1691 8016519575
1692 8017065952
1693 8019560853
1694 8019570934
1695 8019578698
1696 8019596736
1697 8019604950
1698 8019653767
1699 8055750035
1700 8056676470
1701 8056682005
1702 8056969743

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01510

Amidase_2

N-acetylmuramoyl-L-alanine amidase

87

229

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
1yb0-assembly1.cif.gz_B structure of plyl 0.6593 39 202
2ar3-assembly1.cif.gz_C e90a mutant structure of plyl 0.6547 53 204
1lba-assembly1.cif.gz_A the structure of bacteriophage t7 lysozyme, a zinc amidase and an inhibitor of t7 rna polymerase 0.6523 53 180
6ssc-assembly1.cif.gz_A n-acetylmuramoyl-l-alanine amidase lysc from clostridium intestinale urnw 0.6323 33 193
6srt-assembly1.cif.gz_A endolysine n-acetylmuramoyl-l-alanine amidase lyscs from clostridium intestinale urnw 0.6284 33 193
ID Description Score Start End Superfamily
4bpaB01 Alpha Beta;3-Layer(aba) Sandwich;Lysozyme-like;Peptidoglycan recognition protein-like 0.7205 54 184 3.40.80.10
af_F1QTZ2_58_235_3.40.80.10 Alpha Beta;3-Layer(aba) Sandwich;Lysozyme-like;Peptidoglycan recognition protein-like 0.6531 55 203 3.40.80.10
1lbaA00 Alpha Beta;3-Layer(aba) Sandwich;Lysozyme-like;Peptidoglycan recognition protein-like 0.6523 53 180 3.40.80.10
af_I6Y3Z2_28_190_3.40.80.10 Alpha Beta;3-Layer(aba) Sandwich;Lysozyme-like;Peptidoglycan recognition protein-like 0.6391 56 202 3.40.80.10
2ar3A00 Alpha Beta;3-Layer(aba) Sandwich;Lysozyme-like;Peptidoglycan recognition protein-like 0.6388 39 204 3.40.80.10
ID Description Score Start End GO Terms
AF-A0A0D7QB77-F1-model_v4 N-acetylmuramoyl-L-alanine amidase 0.8905 24 205 GO:0008745
GO:0009253
AF-A0A533J1I9-F1-model_v4 deleted 0.886 25 205
AF-A0A418VH81-F1-model_v4 N-acetylmuramoyl-L-alanine amidase 0.8828 23 201 GO:0008745
GO:0009253
AF-A0A533J1I9-F1-model_v4 deleted 0.8767 25 205
AF-A0A431M0D8-F1-model_v4 N-acetylmuramoyl-L-alanine amidase 0.876 24 201 GO:0008745
GO:0009253

Map