F483437
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 850 | 675 | 345 | 183 |
Family's Representative Sequence
| Representative Sequence | 3300049574|Ga0501038_0078411|Ga0501038_0078411_1869_2414 |
| Length | 181 |
| Sequence | MRIVGGEFRGRPLATPRSSAIRPTTDRTREAVFNVLAHRFAGRLEGARVLDLFAGTGALGLEALSRGASFCLFVEESAEGRGLIRENVGLQGRTKIFRRDATRLGEIGTMLPFDLFLADPPYGRDFAGKALAAARAGGWLRHGALCVVEEAAGAPFDAGTGFALVDEREYGDTVIRFLELA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2503198000 | Mesorhizobium opportunistum WSM2075 | Isolate | Nodule |
| 2 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 3 | 2508501123 | Mesorhizobium sp. WSM3626 | Isolate | Nodule |
| 4 | 2508501127 | Mesorhizobium sp. WSM2561 | Isolate | Nodule |
| 5 | 2509276018 | Mesorhizobium ciceri CMG6 | Isolate | Nodule |
| 6 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 7 | 2509276022 | Mesorhizobium australicum WSM2073 | Isolate | Nodule |
| 8 | 2510065057 | Sinorhizobium meliloti WSM1022 | Isolate | Nodule |
| 9 | 2510065059 | Mesorhizobium ciceri WSM4083 | Isolate | Nodule |
| 10 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 11 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 12 | 2512875016 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 13 | 2512875024 | Mesorhizobium loti R88b | Isolate | Nodule |
| 14 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 15 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 16 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 17 | 2513237090 | Mesorhizobium sp. WSM3224 | Isolate | Nodule |
| 18 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 19 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 20 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 21 | 2513237156 | Sinorhizobium medicae WSM1369 | Isolate | Nodule |
| 22 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 23 | 2513237164 | Mesorhizobium loti CJ3sym | Isolate | Nodule |
| 24 | 2513237305 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 25 | 2513237351 | Mesorhizobium alhagi CCNWXJ12-2 | Isolate | Nodule |
| 26 | 2515154107 | Sinorhizobium meliloti 4H41 | Isolate | Nodule |
| 27 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 28 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 29 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 30 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 31 | 2551306084 | Sinorhizobium meliloti 5A14 | Isolate | Nodule |
| 32 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 33 | 2551306086 | Sinorhizobium meliloti AK11 | Isolate | Nodule |
| 34 | 2551306087 | Sinorhizobium meliloti A0643DD | Isolate | Nodule |
| 35 | 2551306089 | Sinorhizobium meliloti 1A42 | Isolate | Nodule |
| 36 | 2551306090 | Sinorhizobium meliloti A0641M | Isolate | Nodule |
| 37 | 2551306091 | Sinorhizobium meliloti C0431A | Isolate | Nodule |
| 38 | 2551306092 | Sinorhizobium meliloti AK75 | Isolate | Nodule |
| 39 | 2588253730 | Mesorhizobium huakuii 7653R | Isolate | Rhizosphere |
| 40 | 2597489875 | Mesorhizobium ciceri ca181 | Isolate | Unclassified |
| 41 | 2599185301 | Mesorhizobium sp. NFR06 | Isolate | Rhizoplane |
| 42 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 43 | 2643221551 | Mesorhizobium sp. Root1471 | Isolate | Unclassified |
| 44 | 2643221555 | Mesorhizobium sp. Root554 | Isolate | Unclassified |
| 45 | 2643221564 | Mesorhizobium sp. Root157 | Isolate | Unclassified |
| 46 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 47 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 48 | 2643221623 | Aminobacter sp. DSM 101952 Root100 | Isolate | Unclassified |
| 49 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 50 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 51 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 52 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 53 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 54 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 55 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 56 | 2657244999 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 57 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 58 | 2693429783 | Mesorhizobium sp. LCM 4577 | Isolate | Rhizosphere |
| 59 | 2693429784 | Mesorhizobium sp. LCM 4576 | Isolate | Rhizosphere |
| 60 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 61 | 2738543024 | Aminobacter sp. AP02 | Isolate | Unclassified |
| 62 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 63 | 2757320392 | Phyllobacterium leguminum ORS 1419 | Isolate | Nodule |
| 64 | 2767802442 | Phyllobacterium brassicacearum 29-15 | Isolate | Rhizoplane |
| 65 | 2775506902 | Phyllobacterium zundukense Tri-48 | Isolate | Unclassified |
| 66 | 2775506904 | Phyllobacterium zundukense Tri-38 | Isolate | Unclassified |
| 67 | 2791355082 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 68 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 69 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 70 | 2791355094 | Sinorhizobium sp. BJ1 | Isolate | Nodule |
| 71 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 72 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 73 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 74 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 75 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 76 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 77 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 78 | 2802429268 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 79 | 2838074704 | Sinorhizobium terangae SEMIA 6460 | Isolate | Unclassified |
| 80 | 2839993093 | Phyllobacterium endophyticum PEPV15 | Isolate | Unclassified |
| 81 | 2840764183 | Phyllobacterium sophorae CCBAU 03422 | Isolate | Unclassified |
| 82 | 2841734538 | Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 | Isolate | Nodule |
| 83 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 84 | 2844009547 | Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 | Isolate | Nodule |
| 85 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 86 | 2847670302 | Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 | Isolate | Nodule |
| 87 | 2847686936 | Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 | Isolate | Nodule |
| 88 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 89 | 2855825444 | Sinorhizobium meliloti CXM1-105 | Isolate | Nodule |
| 90 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 91 | 2856314179 | Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 | Isolate | Nodule |
| 92 | 2856320880 | Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 | Isolate | Nodule |
| 93 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 94 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 95 | 2856342000 | Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 | Isolate | Nodule |
| 96 | 2856364286 | Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 | Isolate | Nodule |
| 97 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 98 | 2857367948 | Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 | Isolate | Nodule |
| 99 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 100 | 2869169390 | Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 | Isolate | Nodule |
| 101 | 2869234852 | Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 | Isolate | Nodule |
| 102 | 2869242130 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 | Isolate | Nodule |
| 103 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 104 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 105 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 106 | 2869271264 | Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | Isolate | Nodule |
| 107 | 2869278585 | Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 | Isolate | Nodule |
| 108 | 2869285874 | Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 | Isolate | Nodule |
| 109 | 2871429161 | Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 | Isolate | Nodule |
| 110 | 2871444079 | Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 | Isolate | Nodule |
| 111 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 112 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 113 | 2871466892 | Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 | Isolate | Nodule |
| 114 | 2871474448 | Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 | Isolate | Nodule |
| 115 | 2871481445 | Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 | Isolate | Nodule |
| 116 | 2871488783 | Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 | Isolate | Nodule |
| 117 | 2871495908 | Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 | Isolate | Nodule |
| 118 | 2874109183 | Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 | Isolate | Nodule |
| 119 | 2874116593 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 | Isolate | Nodule |
| 120 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 121 | 2874131515 | Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 | Isolate | Nodule |
| 122 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 123 | 2874146452 | Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 | Isolate | Nodule |
| 124 | 2874155637 | Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 | Isolate | Nodule |
| 125 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 126 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 127 | 2876363079 | Mesorhizobium loti R7ANS::ICEMlSym2042 | Isolate | Nodule |
| 128 | 2876377896 | Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 | Isolate | Nodule |
| 129 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 130 | 2876392853 | Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 | Isolate | Nodule |
| 131 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 132 | 2876406927 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 | Isolate | Nodule |
| 133 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 134 | 2876420981 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 | Isolate | Nodule |
| 135 | 2878035449 | Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 | Isolate | Nodule |
| 136 | 2878730984 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 | Isolate | Nodule |
| 137 | 2878738818 | Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 | Isolate | Nodule |
| 138 | 2878745973 | Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 | Isolate | Nodule |
| 139 | 2878753008 | Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 | Isolate | Nodule |
| 140 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 141 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 142 | 2878774303 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 | Isolate | Nodule |
| 143 | 2878788777 | Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 | Isolate | Nodule |
| 144 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 145 | 2881155292 | Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 | Isolate | Nodule |
| 146 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 147 | 2881845957 | Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 | Isolate | Nodule |
| 148 | 2881861095 | Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 | Isolate | Nodule |
| 149 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 150 | 2882912400 | Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 | Isolate | Nodule |
| 151 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 152 | 2885312484 | Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 | Isolate | Nodule |
| 153 | 2885318864 | Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 | Isolate | Nodule |
| 154 | 2885326080 | Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 | Isolate | Nodule |
| 155 | 2885334103 | Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 | Isolate | Nodule |
| 156 | 2885342637 | Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 | Isolate | Nodule |
| 157 | 2888337043 | Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 | Isolate | Nodule |
| 158 | 2888343758 | Mesorhizobium sp. AA22 | Isolate | Unclassified |
| 159 | 2888350351 | Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 | Isolate | Nodule |
| 160 | 2889010040 | Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 | Isolate | Nodule |
| 161 | 2889016732 | Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 | Isolate | Nodule |
| 162 | 2894652903 | Phyllobacterium sp. SYP-B3895 | Isolate | Rhizosphere |
| 163 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 164 | 2903448605 | Mesorhizobium japonicum Opo-235 | Isolate | Nodule |
| 165 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 166 | 2903521522 | Mesorhizobium loti R7ANS::ICEMlSym2014 | Isolate | Nodule |
| 167 | 2903528002 | Mesorhizobium loti R7ANS::ICEMlSym2037 | Isolate | Nodule |
| 168 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 169 | 2904578770 | Phyllobacterium sp. 586 | Isolate | Unclassified |
| 170 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 171 | 2906308376 | Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 | Isolate | Nodule |
| 172 | 2906321335 | Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 | Isolate | Nodule |
| 173 | 2906328253 | Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 | Isolate | Nodule |
| 174 | 2906354277 | Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 | Isolate | Nodule |
| 175 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 176 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 177 | 2906386501 | Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 | Isolate | Nodule |
| 178 | 2906393657 | Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 | Isolate | Nodule |
| 179 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 180 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 181 | 2906414383 | Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 | Isolate | Nodule |
| 182 | 2906427513 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 | Isolate | Nodule |
| 183 | 2913295892 | Sinorhizobium kostiensis DSM 13372 | Isolate | Nodule |
| 184 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 185 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 186 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 187 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 188 | 2916007675 | Sinorhizobium meliloti USDA1289 | Isolate | Nodule |
| 189 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 190 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 191 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 192 | 2916035215 | Sinorhizobium meliloti 3011 | Isolate | Nodule |
| 193 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 194 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 195 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 196 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 197 | 2916068649 | Sinorhizobium meliloti USDA1220 | Isolate | Nodule |
| 198 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 199 | 2919119836 | Phyllobacterium sp. 1468 | Isolate | Rhizosphere |
| 200 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 201 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 202 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 203 | 2921237296 | Sinorhizobium meliloti USDA1508 | Isolate | Nodule |
| 204 | 2921244191 | Sinorhizobium meliloti 2119 | Isolate | Nodule |
| 205 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 206 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 207 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 208 | 2921282425 | Sinorhizobium meliloti USDA1203 | Isolate | Nodule |
| 209 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 210 | 2921296804 | Sinorhizobium meliloti USDA1200 | Isolate | Nodule |
| 211 | 2922130491 | Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 | Isolate | Nodule |
| 212 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 213 | 2922158528 | Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 | Isolate | Nodule |
| 214 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 215 | 2922178524 | Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 | Isolate | Nodule |
| 216 | 2922185730 | Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 | Isolate | Nodule |
| 217 | 2924144063 | Sinorhizobium meliloti USDA1022 | Isolate | Nodule |
| 218 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 219 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 220 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 221 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 222 | 2924179722 | Sinorhizobium meliloti USDA1280 | Isolate | Nodule |
| 223 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 224 | 2924193448 | Sinorhizobium meliloti USDA1158 | Isolate | Nodule |
| 225 | 2924200457 | Sinorhizobium meliloti USDA1007 | Isolate | Nodule |
| 226 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 227 | 2924214083 | Sinorhizobium meliloti USDA1702 | Isolate | Nodule |
| 228 | 2924221636 | Sinorhizobium meliloti USDA1416 | Isolate | Nodule |
| 229 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 230 | 2924718760 | Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 | Isolate | Nodule |
| 231 | 2924726620 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 | Isolate | Nodule |
| 232 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 233 | 2924741084 | Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 | Isolate | Nodule |
| 234 | 2924754689 | Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 | Isolate | Nodule |
| 235 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 236 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 237 | 2924784321 | Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | Isolate | Nodule |
| 238 | 2936996657 | Sinorhizobium meliloti USDA1025 | Isolate | Nodule |
| 239 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 240 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 241 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 242 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 243 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 244 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 245 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 246 | 2937049772 | Sinorhizobium meliloti USDA1691 | Isolate | Nodule |
| 247 | 2937056579 | Sinorhizobium meliloti USDA1357 | Isolate | Nodule |
| 248 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 249 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 250 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 251 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 252 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 253 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 254 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 255 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 256 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 257 | 2937126314 | Sinorhizobium meliloti USDA1612 | Isolate | Nodule |
| 258 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 259 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 260 | 2937836603 | Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 | Isolate | Nodule |
| 261 | 2937843397 | Mesorhizobium xinjiangense lm94 | Isolate | Rhizosphere |
| 262 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 263 | 2937861824 | Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 | Isolate | Nodule |
| 264 | 2937868953 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 | Isolate | Nodule |
| 265 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 266 | 2937891427 | Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 | Isolate | Nodule |
| 267 | 2937972304 | Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 | Isolate | Nodule |
| 268 | 2937980651 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 | Isolate | Nodule |
| 269 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 270 | 2938014810 | Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 | Isolate | Nodule |
| 271 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 272 | 2954011201 | Phyllobacterium ifrigiyense W4I11 | Isolate | Rhizosphere |
| 273 | 2957375807 | Sinorhizobium medicae USDA1632 | Isolate | Nodule |
| 274 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 275 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 276 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 277 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 278 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 279 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 280 | 2957422303 | Sinorhizobium meliloti USDA1497 | Isolate | Nodule |
| 281 | 2957430029 | Sinorhizobium meliloti USDA1590 | Isolate | Nodule |
| 282 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 283 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 284 | 2957450854 | Sinorhizobium meliloti USDA1655 | Isolate | Nodule |
| 285 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 286 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 287 | 2957471148 | Sinorhizobium meliloti USDA1204 | Isolate | Nodule |
| 288 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 289 | 2957484790 | Sinorhizobium meliloti USDA1464 | Isolate | Nodule |
| 290 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 291 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 292 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 293 | 2958034702 | Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 | Isolate | Nodule |
| 294 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 295 | 2958064165 | Mesorhizobium sp. SARCC-RB16n | Isolate | Unclassified |
| 296 | 2958071322 | Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 | Isolate | Nodule |
| 297 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 298 | 2958092219 | Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 | Isolate | Nodule |
| 299 | 2958100919 | Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 | Isolate | Nodule |
| 300 | 2958108152 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 | Isolate | Nodule |
| 301 | 2958115193 | Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 | Isolate | Nodule |
| 302 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 303 | 2958130278 | Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 | Isolate | Nodule |
| 304 | 2958137437 | Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 | Isolate | Nodule |
| 305 | 2958144490 | Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 | Isolate | Nodule |
| 306 | 2958158011 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 | Isolate | Nodule |
| 307 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 308 | 2958172287 | Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 | Isolate | Nodule |
| 309 | 2958179912 | Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 | Isolate | Nodule |
| 310 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 311 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 312 | 2960597568 | Sinorhizobium meliloti 3085 | Isolate | Nodule |
| 313 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 314 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 315 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 316 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 317 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 318 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 319 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 320 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 321 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 322 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 323 | 2960674078 | Sinorhizobium meliloti USDA1666 | Isolate | Nodule |
| 324 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 325 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 326 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 327 | 2961077736 | Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 | Isolate | Nodule |
| 328 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 329 | 2961127735 | Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 | Isolate | Nodule |
| 330 | 2961136820 | Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 | Isolate | Nodule |
| 331 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 332 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 333 | 2963644680 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 334 | 2964607997 | Sinorhizobium meliloti USDA1212 | Isolate | Nodule |
| 335 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 336 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 337 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 338 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 339 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 340 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 341 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 342 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 343 | 2964670856 | Sinorhizobium meliloti USDA1211 | Isolate | Nodule |
| 344 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 345 | 2964685014 | Sinorhizobium meliloti USDA1232 | Isolate | Nodule |
| 346 | 2964691889 | Sinorhizobium meliloti USDA1379 | Isolate | Nodule |
| 347 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 348 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 349 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 350 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 351 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 352 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 353 | 2965032056 | Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 | Isolate | Nodule |
| 354 | 2965040258 | Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 | Isolate | Nodule |
| 355 | 2965047637 | Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 | Isolate | Nodule |
| 356 | 2965062239 | Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 | Isolate | Nodule |
| 357 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 358 | 2965102966 | Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 | Isolate | Nodule |
| 359 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 360 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 361 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 362 | 2967686174 | Sinorhizobium medicae USDA1641 | Isolate | Nodule |
| 363 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 364 | 2967699805 | Sinorhizobium meliloti USDA1695 | Isolate | Nodule |
| 365 | 2967706974 | Sinorhizobium meliloti USDA1206 | Isolate | Nodule |
| 366 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 367 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 368 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 369 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 370 | 2967742019 | Sinorhizobium meliloti USDA1676 | Isolate | Nodule |
| 371 | 2967748971 | Sinorhizobium meliloti USDA1024A | Isolate | Nodule |
| 372 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 373 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 374 | 2967769361 | Sinorhizobium meliloti USDA1005 | Isolate | Nodule |
| 375 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 376 | 2967996073 | Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 | Isolate | Nodule |
| 377 | 2968003550 | Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 | Isolate | Nodule |
| 378 | 2968016561 | Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 | Isolate | Nodule |
| 379 | 2968083720 | Mesorhizobium erdmanii Opo-242 | Isolate | Unclassified |
| 380 | 2968091066 | Mesorhizobium sp. AA23 | Isolate | Unclassified |
| 381 | 2968097103 | Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 | Isolate | Nodule |
| 382 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 383 | 2968117919 | Mesorhizobium atlanticum CNPSo 3140 | Isolate | Unclassified |
| 384 | 2968128360 | Mesorhizobium sp. WSM3873 | Isolate | Unclassified |
| 385 | 2968138860 | Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 | Isolate | Nodule |
| 386 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 387 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 388 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 389 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 390 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 391 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 392 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 393 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 394 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 395 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 396 | 2970082768 | Sinorhizobium meliloti USDA1803 | Isolate | Nodule |
| 397 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 398 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 399 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 400 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 401 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 402 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 403 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 404 | 2970136068 | Sinorhizobium meliloti USDA1699 | Isolate | Nodule |
| 405 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 406 | 2970149975 | Sinorhizobium meliloti USDA1215 | Isolate | Nodule |
| 407 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 408 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 409 | 2970170962 | Sinorhizobium meliloti USDA1571 | Isolate | Nodule |
| 410 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 411 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 412 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 413 | 2970469710 | Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 | Isolate | Nodule |
| 414 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 415 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 416 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 417 | 2970524798 | Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 | Isolate | Nodule |
| 418 | 2970532167 | Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 | Isolate | Nodule |
| 419 | 2970540015 | Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 | Isolate | Nodule |
| 420 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 421 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 422 | 2970593180 | Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 | Isolate | Nodule |
| 423 | 2970619444 | Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 | Isolate | Nodule |
| 424 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 425 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 426 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 427 | 2977537788 | Sinorhizobium meliloti USDA1184 | Isolate | Nodule |
| 428 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 429 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 430 | 2977558990 | Sinorhizobium meliloti USDA1222 | Isolate | Nodule |
| 431 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 432 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 433 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 434 | 2977821940 | Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 | Isolate | Nodule |
| 435 | 2977828996 | Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 | Isolate | Nodule |
| 436 | 2977843712 | Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 | Isolate | Nodule |
| 437 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 438 | 2977858184 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 | Isolate | Nodule |
| 439 | 2977864932 | Mesorhizobium tamadayense DSM 28320 | Isolate | Nodule |
| 440 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 441 | 2977898635 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 | Isolate | Nodule |
| 442 | 2977907340 | Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 | Isolate | Nodule |
| 443 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 444 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 445 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 446 | 2977942078 | Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 | Isolate | Nodule |
| 447 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 448 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 449 | 2977971508 | Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 | Isolate | Nodule |
| 450 | 2977986579 | Mesorhizobium intechi BD68 | Isolate | Unclassified |
| 451 | 2979710463 | Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 | Isolate | Nodule |
| 452 | 2979764755 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 | Isolate | Nodule |
| 453 | 2979772303 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 | Isolate | Nodule |
| 454 | 2979779861 | Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 | Isolate | Nodule |
| 455 | 2979793036 | Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 | Isolate | Nodule |
| 456 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 457 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 458 | 2987645492 | Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 | Isolate | Nodule |
| 459 | 2987652177 | Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 | Isolate | Nodule |
| 460 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 461 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 462 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 463 | 2996310559 | Mesorhizobium zhangyense CGMCC 1.15528 | Isolate | Unclassified |
| 464 | 2996336353 | Mesorhizobium sp. YM1C-6-2 | Isolate | Unclassified |
| 465 | 2996341866 | Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 | Isolate | Nodule |
| 466 | 2996348954 | Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 | Isolate | Nodule |
| 467 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 468 | 3000135777 | Unclassified bacterium M00.F.Ca.ET.205.01.1.1 | Isolate | Unclassified |
| 469 | 3004167301 | Mesorhizobium loti 582 | Isolate | Unclassified |
| 470 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 471 | 3004195979 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 | Isolate | Nodule |
| 472 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 473 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 474 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 475 | 3004232784 | Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 | Isolate | Nodule |
| 476 | 3004239961 | Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 | Isolate | Nodule |
| 477 | 3004248173 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 | Isolate | Nodule |
| 478 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 479 | 3004275668 | Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 | Isolate | Nodule |
| 480 | 3004334049 | Mesorhizobium huakuii 583 | Isolate | Unclassified |
| 481 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 482 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 483 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 484 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 485 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 486 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 487 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 488 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 489 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 490 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 491 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 492 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 493 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 494 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 495 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 496 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 497 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 498 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 499 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 500 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 501 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 502 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 503 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 504 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 505 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 506 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 507 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 508 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 509 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 510 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 511 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 512 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 513 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 514 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 515 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 516 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 517 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 518 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 519 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 520 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 521 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 522 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 523 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 524 | 3300015684 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 | Metagenome | Unclassified |
| 525 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 526 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 527 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 528 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 529 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 530 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 531 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 532 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 533 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 534 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 535 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 536 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 537 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 538 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 539 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 540 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 541 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 542 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 543 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 544 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 545 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 546 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 547 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 548 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 549 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 550 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 551 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 552 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 553 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 554 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 555 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 556 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 557 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 558 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 559 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 560 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 561 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 562 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 563 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 564 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 565 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 566 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 567 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 568 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 569 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 570 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 571 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 572 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 573 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 574 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 575 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 576 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 577 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 578 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 579 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 580 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 581 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 582 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 583 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 584 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 585 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 586 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 587 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 588 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 589 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 590 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 591 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 592 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 593 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 594 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 595 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 596 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 597 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 598 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 599 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 600 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 601 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 602 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 603 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 604 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 605 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 606 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 607 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 608 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 609 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 610 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 611 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 612 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 613 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 614 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 615 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 616 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 617 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 618 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 619 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 620 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 621 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 622 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 623 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 624 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 625 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 626 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 627 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 628 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 629 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 630 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 631 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 632 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 633 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 634 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 635 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 636 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 637 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 638 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 639 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 640 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 641 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 642 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 643 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 644 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 645 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 646 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 647 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 648 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 649 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 650 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 651 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 652 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
| 653 | 643692032 | Sinorhizobium fredii NGR234 | Isolate | Nodule |
| 654 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 655 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 656 | 8002285264 | Aminobacter anthyllidis LMG 26462 | Isolate | Nodule |
| 657 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 658 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 659 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 660 | 8004312739 | Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 | Isolate | Nodule |
| 661 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 662 | 8004374579 | Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 | Isolate | Nodule |
| 663 | 8004387939 | Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 | Isolate | Nodule |
| 664 | 8004395343 | Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 | Isolate | Nodule |
| 665 | 8004445564 | Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 | Isolate | Nodule |
| 666 | 8004633249 | Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 | Isolate | Nodule |
| 667 | 8004640170 | Mesorhizobium sp. GbtcB19 | Isolate | Unclassified |
| 668 | 8004695233 | Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 | Isolate | Nodule |
| 669 | 8004703790 | Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 | Isolate | Nodule |
| 670 | 8004714634 | Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 | Isolate | Nodule |
| 671 | 8004727605 | Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 | Isolate | Nodule |
| 672 | 8045864390 | Aurantimonas endophytica KCTC 52296 | Isolate | Unclassified |
| 673 | 8049293176 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 674 | 8054558443 | Rhizobium alarense TRM95111 | Isolate | Nodule |
| 675 | 8055617313 | Mesorhizobium onobrychidis OM4 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 40.47 |
| Metatranscriptomes | 0.12 |
| Isolates | 59.41 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.88 |
| Nodule | 53.41 |
| Rhizoplane | 1.76 |
| Rhizosphere | 28.47 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.47 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25157J39369_1000447 | 3300002741 | Bacteria | 26448 |
| 2 | JGI25406J46586_10005473 | 3300003203 | Bacteria | 5889 |
| 3 | JGI25165J46597_1000070 | 3300003214 | Bacteria | 193557 |
| 4 | JGI25160J50197_1000002 | 3300003354 | Bacteria | 561707 |
| 5 | Ga0055526_1009355 | 3300003771 | Bacteria | 4727 |
| 6 | Ga0055524_1044712 | 3300003775 | Bacteria | 1074 |
| 7 | Ga0055536_1001370 | 3300003781 | Bacteria | 14808 |
| 8 | Ga0055531_10028993 | 3300003794 | Bacteria | 1894 |
| 9 | Ga0055543_1000306 | 3300004625 | Bacteria | 34217 |
| 10 | Ga0065165_1000058 | 3300005262 | Bacteria | 184784 |
| 11 | Ga0070658_10095915 | 3300005327 | Bacteria | 2448 |
| 12 | Ga0070669_100290272 | 3300005353 | Bacteria | 1313 |
| 13 | Ga0070674_100213010 | 3300005356 | Bacteria | 1499 |
| 14 | Ga0070673_100917602 | 3300005364 | Bacteria | 813 |
| 15 | Ga0070659_100373090 | 3300005366 | Bacteria | 1200 |
| 16 | Ga0068853_100079674 | 3300005539 | Bacteria | 2864 |
| 17 | Ga0068853_100123555 | 3300005539 | Bacteria | 2311 |
| 18 | Ga0070665_100108101 | 3300005548 | Bacteria | 2784 |
| 19 | Ga0068855_100631248 | 3300005563 | Bacteria | 1152 |
| 20 | Ga0068856_100284631 | 3300005614 | Bacteria | 1670 |
| 21 | Ga0081539_10003346 | 3300005985 | Bacteria | 19920 |
| 22 | Ga0075365_10092955 | 3300006038 | Bacteria | 2057 |
| 23 | Ga0075365_10184227 | 3300006038 | Bacteria | 1460 |
| 24 | Ga0075365_10266059 | 3300006038 | Bacteria | 1206 |
| 25 | Ga0075368_10001439 | 3300006042 | Bacteria | 7611 |
| 26 | Ga0075368_10253326 | 3300006042 | Bacteria | 752 |
| 27 | Ga0075363_100009749 | 3300006048 | Bacteria | 4524 |
| 28 | Ga0075363_100060285 | 3300006048 | Bacteria | 2042 |
| 29 | Ga0075364_10010273 | 3300006051 | Bacteria | 5650 |
| 30 | Ga0075364_10648888 | 3300006051 | Bacteria | 721 |
| 31 | Ga0075362_10137361 | 3300006177 | Bacteria | 1167 |
| 32 | Ga0075362_10164017 | 3300006177 | Bacteria | 1071 |
| 33 | Ga0075367_10003469 | 3300006178 | Bacteria | 7527 |
| 34 | Ga0075367_10011845 | 3300006178 | Bacteria | 4631 |
| 35 | Ga0075367_10163013 | 3300006178 | Bacteria | 1387 |
| 36 | Ga0075369_10001660 | 3300006186 | Bacteria | 7672 |
| 37 | Ga0075369_10021510 | 3300006186 | Bacteria | 2652 |
| 38 | Ga0075370_10009111 | 3300006353 | Bacteria | 5136 |
| 39 | Ga0075370_10078798 | 3300006353 | Bacteria | 1892 |
| 40 | Ga0079104_1002413 | 3300006946 | Bacteria | 10126 |
| 41 | Ga0079104_1009146 | 3300006946 | Bacteria | 3380 |
| 42 | Ga0105240_10161867 | 3300009093 | Bacteria | 2657 |
| 43 | Ga0105240_10170657 | 3300009093 | Bacteria | 2577 |
| 44 | Ga0105245_10139457 | 3300009098 | Bacteria | 2282 |
| 45 | Ga0105243_10475877 | 3300009148 | Bacteria | 1178 |
| 46 | Ga0105241_10055488 | 3300009174 | Bacteria | 3035 |
| 47 | Ga0105237_10074211 | 3300009545 | Bacteria | 3393 |
| 48 | Ga0105237_10682819 | 3300009545 | Bacteria | 1034 |
| 49 | Ga0105238_10007521 | 3300009551 | Bacteria | 10910 |
| 50 | Ga0105249_10617665 | 3300009553 | Bacteria | 1140 |
| 51 | Ga0105239_10025032 | 3300010375 | Bacteria | 6576 |
| 52 | Ga0105239_10211515 | 3300010375 | Bacteria | 2174 |
| 53 | Ga0105239_10525332 | 3300010375 | Bacteria | 1347 |
| 54 | Ga0105239_10863054 | 3300010375 | Bacteria | 1038 |
| 55 | Ga0105239_12320265 | 3300010375 | Bacteria | 624 |
| 56 | Ga0157370_10207966 | 3300013104 | Bacteria | 1814 |
| 57 | Ga0157370_10310372 | 3300013104 | Bacteria | 1455 |
| 58 | Ga0157369_10139711 | 3300013105 | Bacteria | 2564 |
| 59 | Ga0157378_10621747 | 3300013297 | Bacteria | 1093 |
| 60 | Ga0157380_10659433 | 3300014326 | Bacteria | 1045 |
| 61 | Ga0182008_10247166 | 3300014497 | Bacteria | 919 |
| 62 | Ga0182007_10047860 | 3300015262 | Bacteria | 1413 |
| 63 | Ga0183365_10597 | 3300015684 | Bacteria | 1219 |
| 64 | Ga0183363_1163 | 3300015690 | Bacteria | 15411 |
| 65 | Ga0163161_10280018 | 3300017792 | Bacteria | 1308 |
| 66 | Ga0163161_11042287 | 3300017792 | Bacteria | 700 |
| 67 | Ga0214544_1000008 | 3300021320 | Bacteria | 326027 |
| 68 | Ga0214542_1000010 | 3300021321 | Bacteria | 262816 |
| 69 | Ga0214543_1000003 | 3300021327 | Bacteria | 692327 |
| 70 | Ga0214543_1000004 | 3300021327 | Bacteria | 527190 |
| 71 | Ga0228711_1000137 | 3300022739 | Bacteria | 66265 |
| 72 | Ga0228710_1000031 | 3300022740 | Bacteria | 95534 |
| 73 | Ga0209436_100128 | 3300025208 | Bacteria | 37455 |
| 74 | Ga0209026_1000002 | 3300025250 | Bacteria | 1136158 |
| 75 | Ga0209148_1000123 | 3300025254 | Bacteria | 185406 |
| 76 | Ga0209759_1000381 | 3300025256 | Bacteria | 55381 |
| 77 | Ga0209233_1000131 | 3300025261 | Bacteria | 205257 |
| 78 | Ga0209233_1008273 | 3300025261 | Bacteria | 3232 |
| 79 | Ga0209455_1000129 | 3300025272 | Bacteria | 161691 |
| 80 | Ga0209130_1000008 | 3300025284 | Bacteria | 581232 |
| 81 | Ga0209676_1002487 | 3300025292 | Bacteria | 12955 |
| 82 | Ga0209025_1000956 | 3300025294 | Bacteria | 43592 |
| 83 | Ga0209564_1000091 | 3300025295 | Bacteria | 249103 |
| 84 | Ga0209758_1006066 | 3300025297 | Bacteria | 8906 |
| 85 | Ga0209758_1023562 | 3300025297 | Bacteria | 2780 |
| 86 | Ga0209050_1005659 | 3300025298 | Bacteria | 7737 |
| 87 | Ga0209256_1003090 | 3300025299 | Bacteria | 12218 |
| 88 | Ga0207426_1000016 | 3300025302 | Bacteria | 581232 |
| 89 | Ga0209051_1006780 | 3300025303 | Bacteria | 6383 |
| 90 | Ga0209257_1003908 | 3300025304 | Bacteria | 12125 |
| 91 | Ga0207647_10006200 | 3300025904 | Bacteria | 8713 |
| 92 | Ga0207647_10027535 | 3300025904 | Bacteria | 3705 |
| 93 | Ga0207705_10091952 | 3300025909 | Bacteria | 2223 |
| 94 | Ga0207695_10135869 | 3300025913 | Bacteria | 2412 |
| 95 | Ga0207695_10281109 | 3300025913 | Bacteria | 1558 |
| 96 | Ga0207695_10439553 | 3300025913 | Bacteria | 1188 |
| 97 | Ga0207695_10455735 | 3300025913 | Bacteria | 1162 |
| 98 | Ga0207671_10013865 | 3300025914 | Bacteria | 6400 |
| 99 | Ga0207671_10545458 | 3300025914 | Bacteria | 924 |
| 100 | Ga0207694_10146655 | 3300025924 | Bacteria | 1900 |
| 101 | Ga0207694_10801987 | 3300025924 | Bacteria | 795 |
| 102 | Ga0207669_10171165 | 3300025937 | Bacteria | 1546 |
| 103 | Ga0207639_10040735 | 3300026041 | Bacteria | 3469 |
| 104 | Ga0207639_10737318 | 3300026041 | Bacteria | 915 |
| 105 | Ga0207702_10284594 | 3300026078 | Bacteria | 1564 |
| 106 | Ga0207674_10079771 | 3300026116 | Bacteria | 3276 |
| 107 | Ga0207675_100027553 | 3300026118 | Bacteria | 5292 |
| 108 | Ga0209281_1000155 | 3300027111 | Bacteria | 164423 |
| 109 | Ga0209281_1001059 | 3300027111 | Bacteria | 20700 |
| 110 | Ga0209282_1000025 | 3300027666 | Bacteria | 168676 |
| 111 | Ga0209813_10006201 | 3300027866 | Bacteria | 2945 |
| 112 | Ga0268266_10083937 | 3300028379 | Bacteria | 2781 |
| 113 | Ga0268266_10233174 | 3300028379 | Bacteria | 1696 |
| 114 | Ga0307515_10000154 | 3300028794 | Bacteria | 166582 |
| 115 | Ga0307515_10008850 | 3300028794 | Bacteria | 19546 |
| 116 | Ga0307515_10261289 | 3300028794 | Bacteria | 1467 |
| 117 | Ga0307513_10001054 | 3300031456 | Bacteria | 40089 |
| 118 | Ga0307412_10261316 | 3300031911 | Bacteria | 1350 |
| 119 | Ga0307412_10392654 | 3300031911 | Bacteria | 1127 |
| 120 | Ga0315914_1000620 | 3300031967 | Bacteria | 46971 |
| 121 | Ga0307416_100610119 | 3300032002 | Bacteria | 1172 |
| 122 | Ga0316593_10045409 | 3300032168 | Bacteria | 1472 |
| 123 | Ga0315913_1000150 | 3300033430 | Bacteria | 47059 |
| 124 | Ga0315915_1000015 | 3300033464 | Bacteria | 168491 |
| 125 | Ga0316574_0417182 | 3300035398 | Bacteria | 844 |
| 126 | Ga0316582_0075988 | 3300036647 | Bacteria | 2183 |
| 127 | Ga0316584_0250718 | 3300036712 | Bacteria | 1293 |
| 128 | Ga0395899_0000073 | 3300037312 | Bacteria | 181387 |
| 129 | Ga0395899_0093240 | 3300037312 | Bacteria | 2180 |
| 130 | Ga0395900_0000027 | 3300037418 | Bacteria | 285957 |
| 131 | Ga0395900_0027106 | 3300037418 | Bacteria | 5866 |
| 132 | Ga0395900_0042607 | 3300037418 | Bacteria | 4678 |
| 133 | Ga0395900_0046988 | 3300037418 | Bacteria | 4445 |
| 134 | Ga0395898_0000255 | 3300037466 | Bacteria | 131017 |
| 135 | Ga0395898_0389364 | 3300037466 | Bacteria | 1329 |
| 136 | Ga0395905_0000032 | 3300037471 | Bacteria | 285932 |
| 137 | Ga0395905_0019317 | 3300037471 | Bacteria | 6461 |
| 138 | Ga0395905_0338771 | 3300037471 | Bacteria | 1395 |
| 139 | Ga0395905_0387328 | 3300037471 | Bacteria | 1292 |
| 140 | Ga0395905_0768327 | 3300037471 | Bacteria | 866 |
| 141 | Ga0395901_0000110 | 3300038443 | Bacteria | 112682 |
| 142 | Ga0395901_0046591 | 3300038443 | Bacteria | 4504 |
| 143 | Ga0395901_0057769 | 3300038443 | Bacteria | 4035 |
| 144 | Ga0395901_0131007 | 3300038443 | Bacteria | 2635 |
| 145 | Ga0395901_0488863 | 3300038443 | Bacteria | 1254 |
| 146 | Ga0395901_1013721 | 3300038443 | Bacteria | 805 |
| 147 | Ga0439438_088036 | 3300041405 | Bacteria | 758 |
| 148 | Ga0451793_0240457 | 3300041452 | Bacteria | 1080 |
| 149 | Ga0451855_0305276 | 3300041511 | Bacteria | 594 |
| 150 | Ga0439445_0081298 | 3300042004 | Bacteria | 905 |
| 151 | Ga0439449_0003709 | 3300042007 | Bacteria | 5925 |
| 152 | Ga0439449_0062432 | 3300042007 | Bacteria | 1374 |
| 153 | Ga0466960_0052067 | 3300044901 | Bacteria | 1979 |
| 154 | Ga0495638_0006132 | 3300046460 | Bacteria | 8795 |
| 155 | Ga0495638_0119176 | 3300046460 | Bacteria | 1561 |
| 156 | Ga0495637_0122161 | 3300046520 | Bacteria | 1001 |
| 157 | Ga0495643_0088549 | 3300046522 | Bacteria | 1600 |
| 158 | Ga0495648_0294686 | 3300046524 | Bacteria | 763 |
| 159 | Ga0495670_0021622 | 3300046691 | Bacteria | 3174 |
| 160 | Ga0495660_0234307 | 3300046810 | Bacteria | 859 |
| 161 | Ga0495676_0231892 | 3300047321 | Bacteria | 1268 |
| 162 | Ga0495681_0044497 | 3300047470 | Bacteria | 2133 |
| 163 | Ga0495686_0173026 | 3300047472 | Bacteria | 1255 |
| 164 | Ga0496102_0092038 | 3300048905 | Bacteria | 2808 |
| 165 | Ga0496103_0207909 | 3300048906 | Bacteria | 1259 |
| 166 | Ga0496106_0741651 | 3300048909 | Bacteria | 781 |
| 167 | Ga0496108_0161116 | 3300048911 | Bacteria | 1939 |
| 168 | Ga0496109_0407276 | 3300048912 | Bacteria | 1285 |
| 169 | Ga0496112_0476133 | 3300048915 | Bacteria | 1185 |
| 170 | Ga0496112_0801701 | 3300048915 | Bacteria | 866 |
| 171 | Ga0496113_0141688 | 3300048916 | Bacteria | 1892 |
| 172 | Ga0496113_0596114 | 3300048916 | Bacteria | 885 |
| 173 | Ga0496115_0486398 | 3300048918 | Bacteria | 993 |
| 174 | Ga0496115_0516257 | 3300048918 | Bacteria | 958 |
| 175 | Ga0496118_0132255 | 3300048921 | Bacteria | 1600 |
| 176 | Ga0496119_0068437 | 3300048922 | Bacteria | 2090 |
| 177 | Ga0496120_0005603 | 3300048923 | Bacteria | 9949 |
| 178 | Ga0496120_0152627 | 3300048923 | Bacteria | 1159 |
| 179 | Ga0496121_0206346 | 3300048924 | Bacteria | 1396 |
| 180 | Ga0496122_0399273 | 3300048925 | Bacteria | 699 |
| 181 | Ga0496125_0284127 | 3300048928 | Bacteria | 1023 |
| 182 | Ga0496126_0190705 | 3300048929 | Bacteria | 1736 |
| 183 | Ga0496126_0606100 | 3300048929 | Bacteria | 862 |
| 184 | Ga0501031_0020213 | 3300049568 | Bacteria | 4341 |
| 185 | Ga0501031_0047010 | 3300049568 | Bacteria | 2814 |
| 186 | Ga0501031_0050394 | 3300049568 | Bacteria | 2712 |
| 187 | Ga0501031_0076167 | 3300049568 | Bacteria | 2184 |
| 188 | Ga0501031_0275123 | 3300049568 | Bacteria | 1093 |
| 189 | Ga0501031_0278089 | 3300049568 | Bacteria | 1086 |
| 190 | Ga0501031_0385628 | 3300049568 | Bacteria | 906 |
| 191 | Ga0501032_0000081 | 3300049569 | Bacteria | 82613 |
| 192 | Ga0501032_0000116 | 3300049569 | Bacteria | 67350 |
| 193 | Ga0501032_0033707 | 3300049569 | Bacteria | 3507 |
| 194 | Ga0501032_0037313 | 3300049569 | Bacteria | 3314 |
| 195 | Ga0501032_0046609 | 3300049569 | Bacteria | 2929 |
| 196 | Ga0501032_0088912 | 3300049569 | Bacteria | 2051 |
| 197 | Ga0501032_0231339 | 3300049569 | Bacteria | 1202 |
| 198 | Ga0501032_0446993 | 3300049569 | Bacteria | 828 |
| 199 | Ga0501032_0527791 | 3300049569 | Bacteria | 753 |
| 200 | Ga0501033_0000097 | 3300049570 | Bacteria | 83228 |
| 201 | Ga0501033_0000501 | 3300049570 | Bacteria | 36835 |
| 202 | Ga0501033_0001994 | 3300049570 | Bacteria | 17795 |
| 203 | Ga0501033_0003939 | 3300049570 | Bacteria | 12043 |
| 204 | Ga0501033_0011792 | 3300049570 | Bacteria | 6681 |
| 205 | Ga0501033_0051935 | 3300049570 | Bacteria | 3038 |
| 206 | Ga0501033_0052388 | 3300049570 | Bacteria | 3025 |
| 207 | Ga0501033_0116853 | 3300049570 | Bacteria | 1938 |
| 208 | Ga0501033_0185335 | 3300049570 | Bacteria | 1491 |
| 209 | Ga0501033_0267328 | 3300049570 | Bacteria | 1209 |
| 210 | Ga0501033_0286940 | 3300049570 | Bacteria | 1161 |
| 211 | Ga0501033_0404655 | 3300049570 | Bacteria | 951 |
| 212 | Ga0501033_0708521 | 3300049570 | Bacteria | 684 |
| 213 | Ga0501034_0000186 | 3300049571 | Bacteria | 116500 |
| 214 | Ga0501034_0003453 | 3300049571 | Bacteria | 18014 |
| 215 | Ga0501034_0004432 | 3300049571 | Bacteria | 15628 |
| 216 | Ga0501034_0021271 | 3300049571 | Bacteria | 6615 |
| 217 | Ga0501034_0215003 | 3300049571 | Bacteria | 1876 |
| 218 | Ga0501034_0234953 | 3300049571 | Bacteria | 1781 |
| 219 | Ga0501034_0267581 | 3300049571 | Bacteria | 1651 |
| 220 | Ga0501034_0418751 | 3300049571 | Bacteria | 1261 |
| 221 | Ga0501034_0567156 | 3300049571 | Bacteria | 1043 |
| 222 | Ga0501034_0843928 | 3300049571 | Bacteria | 807 |
| 223 | Ga0501036_0000002 | 3300049572 | Bacteria | 293106 |
| 224 | Ga0501036_0001125 | 3300049572 | Bacteria | 20339 |
| 225 | Ga0501036_0039433 | 3300049572 | Bacteria | 3996 |
| 226 | Ga0501036_0414854 | 3300049572 | Bacteria | 1123 |
| 227 | Ga0501036_0650940 | 3300049572 | Bacteria | 872 |
| 228 | Ga0501037_0000095 | 3300049573 | Bacteria | 82641 |
| 229 | Ga0501037_0000108 | 3300049573 | Bacteria | 77753 |
| 230 | Ga0501037_0000451 | 3300049573 | Bacteria | 33602 |
| 231 | Ga0501037_0131132 | 3300049573 | Bacteria | 1797 |
| 232 | Ga0501038_0000002 | 3300049574 | Bacteria | 330446 |
| 233 | Ga0501038_0000126 | 3300049574 | Bacteria | 64756 |
| 234 | Ga0501038_0063134 | 3300049574 | Bacteria | 3163 |
| 235 | Ga0501038_0067643 | 3300049574 | Bacteria | 3038 |
| 236 | Ga0501038_0071665 | 3300049574 | Bacteria | 2938 |
| 237 | Ga0501038_0077899 | 3300049574 | Bacteria | 2798 |
| 238 | Ga0501038_0078411 | 3300049574 | Bacteria | 2787 |
| 239 | Ga0501039_0000002 | 3300049575 | Bacteria | 375152 |
| 240 | Ga0501039_0000003 | 3300049575 | Bacteria | 357424 |
| 241 | Ga0501039_0187939 | 3300049575 | Bacteria | 1624 |
| 242 | Ga0501039_0211894 | 3300049575 | Bacteria | 1523 |
| 243 | Ga0501040_0003171 | 3300049576 | Bacteria | 10652 |
| 244 | Ga0501042_0078294 | 3300049578 | Bacteria | 2368 |
| 245 | Ga0501043_0000081 | 3300049579 | Bacteria | 85059 |
| 246 | Ga0501043_0000140 | 3300049579 | Bacteria | 67478 |
| 247 | Ga0501043_0000162 | 3300049579 | Bacteria | 60676 |
| 248 | Ga0501043_0095551 | 3300049579 | Bacteria | 2336 |
| 249 | Ga0501043_0104122 | 3300049579 | Bacteria | 2230 |
| 250 | Ga0501043_0169788 | 3300049579 | Bacteria | 1702 |
| 251 | Ga0501043_0457414 | 3300049579 | Bacteria | 958 |
| 252 | Ga0501046_0023471 | 3300049580 | Bacteria | 5074 |
| 253 | Ga0501046_0147873 | 3300049580 | Bacteria | 1773 |
| 254 | Ga0501046_0271654 | 3300049580 | Bacteria | 1243 |
| 255 | Ga0501047_0001069 | 3300049581 | Bacteria | 27308 |
| 256 | Ga0501047_0005496 | 3300049581 | Bacteria | 11927 |
| 257 | Ga0501047_0013509 | 3300049581 | Bacteria | 7741 |
| 258 | Ga0501047_0053713 | 3300049581 | Bacteria | 3896 |
| 259 | Ga0501047_0123024 | 3300049581 | Bacteria | 2475 |
| 260 | Ga0501047_0317862 | 3300049581 | Bacteria | 1397 |
| 261 | Ga0501047_0499200 | 3300049581 | Bacteria | 1043 |
| 262 | Ga0501047_0513635 | 3300049581 | Bacteria | 1024 |
| 263 | Ga0501067_0058678 | 3300049583 | Bacteria | 2131 |
| 264 | Ga0501067_0084208 | 3300049583 | Bacteria | 1764 |
| 265 | Ga0501068_0019640 | 3300049584 | Bacteria | 3927 |
| 266 | Ga0501068_0067416 | 3300049584 | Bacteria | 2181 |
| 267 | Ga0501069_0000118 | 3300049585 | Bacteria | 35026 |
| 268 | Ga0501069_0029569 | 3300049585 | Bacteria | 3007 |
| 269 | Ga0501070_0002038 | 3300049586 | Bacteria | 17765 |
| 270 | Ga0501070_0002088 | 3300049586 | Bacteria | 17529 |
| 271 | Ga0501070_0002773 | 3300049586 | Bacteria | 15291 |
| 272 | Ga0501070_0016450 | 3300049586 | Bacteria | 6216 |
| 273 | Ga0501070_0049174 | 3300049586 | Bacteria | 3502 |
| 274 | Ga0501070_0050792 | 3300049586 | Bacteria | 3441 |
| 275 | Ga0501070_0110816 | 3300049586 | Bacteria | 2268 |
| 276 | Ga0501070_0117985 | 3300049586 | Bacteria | 2192 |
| 277 | Ga0501070_0180593 | 3300049586 | Bacteria | 1737 |
| 278 | Ga0501070_0180900 | 3300049586 | Bacteria | 1735 |
| 279 | Ga0501071_0032926 | 3300049587 | Bacteria | 3682 |
| 280 | Ga0501071_0043090 | 3300049587 | Bacteria | 3235 |
| 281 | Ga0501073_0018852 | 3300049589 | Bacteria | 4986 |
| 282 | Ga0501073_0051879 | 3300049589 | Bacteria | 2873 |
| 283 | Ga0501073_0093871 | 3300049589 | Bacteria | 2084 |
| 284 | Ga0501074_0000062 | 3300049590 | Bacteria | 51831 |
| 285 | Ga0501074_0014987 | 3300049590 | Bacteria | 5642 |
| 286 | Ga0501074_0085970 | 3300049590 | Bacteria | 2253 |
| 287 | Ga0501079_0957325 | 3300049741 | Bacteria | 674 |
| 288 | Ga0501080_0000254 | 3300049742 | Bacteria | 40217 |
| 289 | Ga0501080_0016280 | 3300049742 | Bacteria | 6865 |
| 290 | Ga0501080_0037279 | 3300049742 | Bacteria | 4540 |
| 291 | Ga0501080_0059987 | 3300049742 | Bacteria | 3540 |
| 292 | Ga0501080_0608901 | 3300049742 | Bacteria | 969 |
| 293 | Ga0501083_0000453 | 3300049744 | Bacteria | 26265 |
| 294 | Ga0501035_0000017 | 3300049822 | Bacteria | 241915 |
| 295 | Ga0501035_0000100 | 3300049822 | Bacteria | 107321 |
| 296 | Ga0501035_0000895 | 3300049822 | Bacteria | 31521 |
| 297 | Ga0501035_0001153 | 3300049822 | Bacteria | 27594 |
| 298 | Ga0501035_0001764 | 3300049822 | Bacteria | 21833 |
| 299 | Ga0501035_0003584 | 3300049822 | Bacteria | 14832 |
| 300 | Ga0501035_0032885 | 3300049822 | Bacteria | 4716 |
| 301 | Ga0501035_0085431 | 3300049822 | Bacteria | 2781 |
| 302 | Ga0501035_0086759 | 3300049822 | Bacteria | 2757 |
| 303 | Ga0501035_0316305 | 3300049822 | Bacteria | 1312 |
| 304 | Ga0501044_0000002 | 3300049823 | Bacteria | 375152 |
| 305 | Ga0501044_0000751 | 3300049823 | Bacteria | 39231 |
| 306 | Ga0501044_0007931 | 3300049823 | Bacteria | 11669 |
| 307 | Ga0501044_0019122 | 3300049823 | Bacteria | 7333 |
| 308 | Ga0501044_0021530 | 3300049823 | Bacteria | 6876 |
| 309 | Ga0501044_0038386 | 3300049823 | Bacteria | 5001 |
| 310 | Ga0501044_0047079 | 3300049823 | Bacteria | 4461 |
| 311 | Ga0501044_0108794 | 3300049823 | Bacteria | 2781 |
| 312 | Ga0501044_0168991 | 3300049823 | Bacteria | 2159 |
| 313 | Ga0501044_0286715 | 3300049823 | Bacteria | 1579 |
| 314 | Ga0501044_0423824 | 3300049823 | Bacteria | 1240 |
| 315 | Ga0501044_0431691 | 3300049823 | Bacteria | 1226 |
| 316 | Ga0501044_0555498 | 3300049823 | Bacteria | 1045 |
| 317 | Ga0501044_0902010 | 3300049823 | Bacteria | 759 |
| 318 | Ga0501045_0020525 | 3300049824 | Bacteria | 4720 |
| 319 | Ga0501045_0090727 | 3300049824 | Bacteria | 2258 |
| 320 | nmdc:mga03683_79079_c1 | 3300050489 | Bacteria | 1417 |
| 321 | nmdc:mga03n38_143292_c1 | 3300050490 | Bacteria | 1196 |
| 322 | nmdc:mga03n38_144725_c1 | 3300050490 | Bacteria | 1190 |
| 323 | nmdc:mga00v17_129310_c1 | 3300050491 | Bacteria | 1613 |
| 324 | nmdc:mga0yw44_216513_c1 | 3300050492 | Bacteria | 1268 |
| 325 | nmdc:mga0yw44_21673_c1 | 3300050492 | Bacteria | 3590 |
| 326 | nmdc:mga0yw44_234290_c1 | 3300050492 | Bacteria | 1219 |
| 327 | nmdc:mga0yw44_56243_c1 | 3300050492 | Bacteria | 2396 |
| 328 | nmdc:mga06z11_43242_c1 | 3300050494 | Bacteria | 2265 |
| 329 | nmdc:mga06z11_47954_c1 | 3300050494 | Bacteria | 2172 |
| 330 | nmdc:mga04h51_47165_c1 | 3300050495 | Bacteria | 1431 |
| 331 | nmdc:mga07m45_3290_c1 | 3300050496 | Bacteria | 7776 |
| 332 | nmdc:mga07m45_33919_c1 | 3300050496 | Bacteria | 2836 |
| 333 | Ga0500610_0045343 | 3300053079 | Bacteria | 2282 |
| 334 | Ga0500610_0215050 | 3300053079 | Bacteria | 915 |
| 335 | Ga0500643_020686 | 3300053087 | Bacteria | 2145 |
| 336 | Ga0500556_0056626 | 3300053104 | Bacteria | 1433 |
| 337 | Ga0500608_100903 | 3300053122 | Bacteria | 1337 |
| 338 | Ga0500568_0000048 | 3300053139 | Bacteria | 119025 |
| 339 | Ga0500604_0032642 | 3300053151 | Bacteria | 1535 |
| 340 | Ga0500616_0082384 | 3300053153 | Bacteria | 1614 |
| 341 | Ga0500620_000328 | 3300053155 | Bacteria | 8982 |
| 342 | Ga0500620_053342 | 3300053155 | Bacteria | 1361 |
| 343 | Ga0500622_0000251 | 3300053156 | Bacteria | 54558 |
| 344 | Ga0501084_0856837 | 3300054114 | Bacteria | 765 |
| 345 | Ga0501082_0090342 | 3300060353 | Bacteria | 2644 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2657244999 | 2657681988 | 179 |
| 2 | iso_pu_bacteria | 2802429268 | 2804751006 | 179 |
| 3 | iso_pu_bacteria | 8045864390 | 8045866337 | 179 |
| 4 | iso_pu_bacteria | 2503198000 | 2503203113 | 180 |
| 5 | iso_pu_bacteria | 2508501122 | 2509107190 | 180 |
| 6 | iso_pu_bacteria | 2508501123 | 2509114897 | 180 |
| 7 | iso_pu_bacteria | 2508501127 | 2509145496 | 180 |
| 8 | iso_pu_bacteria | 2509276018 | 2509372692 | 180 |
| 9 | iso_pu_bacteria | 2509276019 | 2509374844 | 180 |
| 10 | iso_pu_bacteria | 2509276022 | 2509397573 | 180 |
| 11 | iso_pu_bacteria | 2510065057 | 2510304887 | 180 |
| 12 | iso_pu_bacteria | 2510065059 | 2510319764 | 180 |
| 13 | iso_pu_bacteria | 2511231052 | 2511500676 | 180 |
| 14 | iso_pu_bacteria | 2512047086 | 2512532098 | 180 |
| 15 | iso_pu_bacteria | 2512875016 | 2512930078 | 180 |
| 16 | iso_pu_bacteria | 2512875024 | 2512964756 | 180 |
| 17 | iso_pu_bacteria | 2512875026 | 2512972570 | 180 |
| 18 | iso_pu_bacteria | 2513237086 | 2513585759 | 180 |
| 19 | iso_pu_bacteria | 2513237089 | 2513606656 | 180 |
| 20 | iso_pu_bacteria | 2513237090 | 2513614282 | 180 |
| 21 | iso_pu_bacteria | 2513237091 | 2513616832 | 180 |
| 22 | iso_pu_bacteria | 2513237140 | 2513880754 | 180 |
| 23 | iso_pu_bacteria | 2513237143 | 2513903748 | 180 |
| 24 | iso_pu_bacteria | 2513237156 | 2513986152 | 180 |
| 25 | iso_pu_bacteria | 2513237160 | 2514007566 | 180 |
| 26 | iso_pu_bacteria | 2513237164 | 2514033138 | 180 |
| 27 | iso_pu_bacteria | 2513237305 | 2514419976 | 180 |
| 28 | iso_pu_bacteria | 2513237351 | 2514589713 | 180 |
| 29 | iso_pu_bacteria | 2515154107 | 2515607811 | 180 |
| 30 | iso_pu_bacteria | 2516143018 | 2516208554 | 180 |
| 31 | iso_pu_bacteria | 2516653046 | 2516891951 | 180 |
| 32 | iso_pu_bacteria | 2517487022 | 2517568763 | 180 |
| 33 | iso_pu_bacteria | 2524023207 | 2524450003 | 180 |
| 34 | iso_pu_bacteria | 2551306084 | 2551676540 | 180 |
| 35 | iso_pu_bacteria | 2551306085 | 2551686932 | 180 |
| 36 | iso_pu_bacteria | 2551306086 | 2551695770 | 180 |
| 37 | iso_pu_bacteria | 2551306087 | 2551699848 | 180 |
| 38 | iso_pu_bacteria | 2551306089 | 2551709879 | 180 |
| 39 | iso_pu_bacteria | 2551306090 | 2551723497 | 180 |
| 40 | iso_pu_bacteria | 2551306091 | 2551728082 | 180 |
| 41 | iso_pu_bacteria | 2551306092 | 2551738953 | 180 |
| 42 | iso_pu_bacteria | 2588253730 | 2588515695 | 180 |
| 43 | iso_pu_bacteria | 2597489875 | 2597814864 | 180 |
| 44 | iso_pu_bacteria | 2599185301 | 2599940982 | 180 |
| 45 | iso_pu_bacteria | 2599185352 | 2600191552 | 180 |
| 46 | iso_pu_bacteria | 2643221551 | 2643775729 | 180 |
| 47 | iso_pu_bacteria | 2643221555 | 2643794176 | 180 |
| 48 | iso_pu_bacteria | 2643221564 | 2643837254 | 180 |
| 49 | iso_pu_bacteria | 2643221595 | 2643986594 | 180 |
| 50 | iso_pu_bacteria | 2643221618 | 2644103090 | 180 |
| 51 | iso_pu_bacteria | 2643221623 | 2644133011 | 180 |
| 52 | iso_pu_bacteria | 2643221626 | 2644151981 | 180 |
| 53 | iso_pu_bacteria | 2643221627 | 2644157528 | 180 |
| 54 | iso_pu_bacteria | 2643221655 | 2644306017 | 180 |
| 55 | iso_pu_bacteria | 2643221659 | 2644330325 | 180 |
| 56 | iso_pu_bacteria | 2643221698 | 2644542928 | 180 |
| 57 | iso_pu_bacteria | 2643221712 | 2644619032 | 180 |
| 58 | iso_pu_bacteria | 2643221723 | 2644673935 | 180 |
| 59 | iso_pu_bacteria | 2687453392 | 2688599972 | 180 |
| 60 | iso_pu_bacteria | 2693429783 | 2694634074 | 180 |
| 61 | iso_pu_bacteria | 2693429784 | 2694638555 | 180 |
| 62 | iso_pu_bacteria | 2721755686 | 2723576799 | 180 |
| 63 | iso_pu_bacteria | 2738543024 | 2739306365 | 180 |
| 64 | iso_pu_bacteria | 2756170246 | 2756673473 | 180 |
| 65 | iso_pu_bacteria | 2757320392 | 2757569267 | 180 |
| 66 | iso_pu_bacteria | 2767802442 | 2770194742 | 180 |
| 67 | iso_pu_bacteria | 2775506902 | 2776272469 | 180 |
| 68 | iso_pu_bacteria | 2775506904 | 2776284409 | 180 |
| 69 | iso_pu_bacteria | 2791355082 | 2792583840 | 180 |
| 70 | iso_pu_bacteria | 2791355091 | 2792622360 | 180 |
| 71 | iso_pu_bacteria | 2791355092 | 2792628074 | 180 |
| 72 | iso_pu_bacteria | 2791355094 | 2792638671 | 180 |
| 73 | iso_pu_bacteria | 2791355123 | 2792748959 | 180 |
| 74 | iso_pu_bacteria | 2802428858 | 2802717408 | 180 |
| 75 | iso_pu_bacteria | 2802428859 | 2802723666 | 180 |
| 76 | iso_pu_bacteria | 2802428860 | 2802730886 | 180 |
| 77 | iso_pu_bacteria | 2802428861 | 2802735893 | 180 |
| 78 | iso_pu_bacteria | 2802428862 | 2802743898 | 180 |
| 79 | iso_pu_bacteria | 2802428863 | 2802752884 | 180 |
| 80 | iso_pu_bacteria | 2838074704 | 2838075456 | 180 |
| 81 | iso_pu_bacteria | 2839993093 | 2839994297 | 180 |
| 82 | iso_pu_bacteria | 2840764183 | 2840769292 | 180 |
| 83 | iso_pu_bacteria | 2841734538 | 2841740954 | 180 |
| 84 | iso_pu_bacteria | 2844002411 | 2844005934 | 180 |
| 85 | iso_pu_bacteria | 2844009547 | 2844015241 | 180 |
| 86 | iso_pu_bacteria | 2844163670 | 2844170653 | 180 |
| 87 | iso_pu_bacteria | 2847670302 | 2847671236 | 180 |
| 88 | iso_pu_bacteria | 2850079185 | 2850080126 | 180 |
| 89 | iso_pu_bacteria | 2855825444 | 2855831869 | 180 |
| 90 | iso_pu_bacteria | 2855839649 | 2855840156 | 180 |
| 91 | iso_pu_bacteria | 2856314179 | 2856316748 | 180 |
| 92 | iso_pu_bacteria | 2856320880 | 2856324561 | 180 |
| 93 | iso_pu_bacteria | 2856328259 | 2856333224 | 180 |
| 94 | iso_pu_bacteria | 2856334872 | 2856338667 | 180 |
| 95 | iso_pu_bacteria | 2856342000 | 2856348794 | 180 |
| 96 | iso_pu_bacteria | 2856364286 | 2856370903 | 180 |
| 97 | iso_pu_bacteria | 2857349434 | 2857356519 | 180 |
| 98 | iso_pu_bacteria | 2857367948 | 2857374838 | 180 |
| 99 | iso_pu_bacteria | 2858800743 | 2858804061 | 180 |
| 100 | iso_pu_bacteria | 2869169390 | 2869171211 | 180 |
| 101 | iso_pu_bacteria | 2869234852 | 2869235622 | 180 |
| 102 | iso_pu_bacteria | 2869242130 | 2869246487 | 180 |
| 103 | iso_pu_bacteria | 2869256925 | 2869259558 | 180 |
| 104 | iso_pu_bacteria | 2869264136 | 2869269810 | 180 |
| 105 | iso_pu_bacteria | 2869271264 | 2869276423 | 180 |
| 106 | iso_pu_bacteria | 2869278585 | 2869281437 | 180 |
| 107 | iso_pu_bacteria | 2869285874 | 2869292204 | 180 |
| 108 | iso_pu_bacteria | 2871429161 | 2871435411 | 180 |
| 109 | iso_pu_bacteria | 2871444079 | 2871444404 | 180 |
| 110 | iso_pu_bacteria | 2871451962 | 2871458520 | 180 |
| 111 | iso_pu_bacteria | 2871459585 | 2871465433 | 180 |
| 112 | iso_pu_bacteria | 2871466892 | 2871472771 | 180 |
| 113 | iso_pu_bacteria | 2871474448 | 2871479007 | 180 |
| 114 | iso_pu_bacteria | 2871481445 | 2871486402 | 180 |
| 115 | iso_pu_bacteria | 2871488783 | 2871489311 | 180 |
| 116 | iso_pu_bacteria | 2871495908 | 2871497659 | 180 |
| 117 | iso_pu_bacteria | 2874109183 | 2874114723 | 180 |
| 118 | iso_pu_bacteria | 2874116593 | 2874118884 | 180 |
| 119 | iso_pu_bacteria | 2874123672 | 2874131201 | 180 |
| 120 | iso_pu_bacteria | 2874131515 | 2874131847 | 180 |
| 121 | iso_pu_bacteria | 2874139085 | 2874140897 | 180 |
| 122 | iso_pu_bacteria | 2874146452 | 2874155113 | 180 |
| 123 | iso_pu_bacteria | 2874155637 | 2874161431 | 180 |
| 124 | iso_pu_bacteria | 2874162495 | 2874166928 | 180 |
| 125 | iso_pu_bacteria | 2874168670 | 2874170460 | 180 |
| 126 | iso_pu_bacteria | 2876363079 | 2876366358 | 180 |
| 127 | iso_pu_bacteria | 2876377896 | 2876384168 | 180 |
| 128 | iso_pu_bacteria | 2876386047 | 2876391935 | 180 |
| 129 | iso_pu_bacteria | 2876399893 | 2876404670 | 180 |
| 130 | iso_pu_bacteria | 2876406927 | 2876408765 | 180 |
| 131 | iso_pu_bacteria | 2876413966 | 2876420568 | 180 |
| 132 | iso_pu_bacteria | 2876420981 | 2876427023 | 180 |
| 133 | iso_pu_bacteria | 2878035449 | 2878037090 | 180 |
| 134 | iso_pu_bacteria | 2878730984 | 2878737830 | 180 |
| 135 | iso_pu_bacteria | 2878738818 | 2878742675 | 180 |
| 136 | iso_pu_bacteria | 2878745973 | 2878752546 | 180 |
| 137 | iso_pu_bacteria | 2878753008 | 2878753847 | 180 |
| 138 | iso_pu_bacteria | 2878760144 | 2878761882 | 180 |
| 139 | iso_pu_bacteria | 2878767105 | 2878768788 | 180 |
| 140 | iso_pu_bacteria | 2878774303 | 2878780499 | 180 |
| 141 | iso_pu_bacteria | 2878788777 | 2878794661 | 180 |
| 142 | iso_pu_bacteria | 2881147464 | 2881153006 | 180 |
| 143 | iso_pu_bacteria | 2881155292 | 2881156776 | 180 |
| 144 | iso_pu_bacteria | 2881161766 | 2881162192 | 180 |
| 145 | iso_pu_bacteria | 2881845957 | 2881846677 | 180 |
| 146 | iso_pu_bacteria | 2881861095 | 2881866172 | 180 |
| 147 | iso_pu_bacteria | 2882632389 | 2882635510 | 180 |
| 148 | iso_pu_bacteria | 2882912400 | 2882916909 | 180 |
| 149 | iso_pu_bacteria | 2885305155 | 2885311039 | 180 |
| 150 | iso_pu_bacteria | 2885312484 | 2885316528 | 180 |
| 151 | iso_pu_bacteria | 2885318864 | 2885322937 | 180 |
| 152 | iso_pu_bacteria | 2885326080 | 2885331534 | 180 |
| 153 | iso_pu_bacteria | 2885342637 | 2885347230 | 180 |
| 154 | iso_pu_bacteria | 2888337043 | 2888341149 | 180 |
| 155 | iso_pu_bacteria | 2888343758 | 2888348350 | 180 |
| 156 | iso_pu_bacteria | 2888350351 | 2888357356 | 180 |
| 157 | iso_pu_bacteria | 2889010040 | 2889012313 | 180 |
| 158 | iso_pu_bacteria | 2889016732 | 2889022794 | 180 |
| 159 | iso_pu_bacteria | 2894652903 | 2894655326 | 180 |
| 160 | iso_pu_bacteria | 2896384573 | 2896385439 | 180 |
| 161 | iso_pu_bacteria | 2903448605 | 2903452618 | 180 |
| 162 | iso_pu_bacteria | 2903492973 | 2903497191 | 180 |
| 163 | iso_pu_bacteria | 2903492973 | 2903505281 | 180 |
| 164 | iso_pu_bacteria | 2903521522 | 2903524226 | 180 |
| 165 | iso_pu_bacteria | 2903528002 | 2903533591 | 180 |
| 166 | iso_pu_bacteria | 2903540706 | 2903542457 | 180 |
| 167 | iso_pu_bacteria | 2904578770 | 2904579028 | 180 |
| 168 | iso_pu_bacteria | 2904659560 | 2904662234 | 180 |
| 169 | iso_pu_bacteria | 2906308376 | 2906314940 | 180 |
| 170 | iso_pu_bacteria | 2906321335 | 2906328112 | 180 |
| 171 | iso_pu_bacteria | 2906328253 | 2906332605 | 180 |
| 172 | iso_pu_bacteria | 2906354277 | 2906358139 | 180 |
| 173 | iso_pu_bacteria | 2906363423 | 2906365612 | 180 |
| 174 | iso_pu_bacteria | 2906370794 | 2906373493 | 180 |
| 175 | iso_pu_bacteria | 2906386501 | 2906389622 | 180 |
| 176 | iso_pu_bacteria | 2906393657 | 2906395132 | 180 |
| 177 | iso_pu_bacteria | 2906401398 | 2906403877 | 180 |
| 178 | iso_pu_bacteria | 2906408224 | 2906412315 | 180 |
| 179 | iso_pu_bacteria | 2906414383 | 2906416886 | 180 |
| 180 | iso_pu_bacteria | 2906427513 | 2906434737 | 180 |
| 181 | iso_pu_bacteria | 2913295892 | 2913297890 | 180 |
| 182 | iso_pu_bacteria | 2915980308 | 2915982332 | 180 |
| 183 | iso_pu_bacteria | 2915986958 | 2915989363 | 180 |
| 184 | iso_pu_bacteria | 2915993759 | 2915999536 | 180 |
| 185 | iso_pu_bacteria | 2916000859 | 2916001489 | 180 |
| 186 | iso_pu_bacteria | 2916007675 | 2916010944 | 180 |
| 187 | iso_pu_bacteria | 2916014648 | 2916015288 | 180 |
| 188 | iso_pu_bacteria | 2916021584 | 2916022187 | 180 |
| 189 | iso_pu_bacteria | 2916028427 | 2916029465 | 180 |
| 190 | iso_pu_bacteria | 2916035215 | 2916041483 | 180 |
| 191 | iso_pu_bacteria | 2916041962 | 2916045888 | 180 |
| 192 | iso_pu_bacteria | 2916048683 | 2916051648 | 180 |
| 193 | iso_pu_bacteria | 2916055098 | 2916061796 | 180 |
| 194 | iso_pu_bacteria | 2916061851 | 2916062669 | 180 |
| 195 | iso_pu_bacteria | 2916068649 | 2916069529 | 180 |
| 196 | iso_pu_bacteria | 2916076590 | 2916082733 | 180 |
| 197 | iso_pu_bacteria | 2919119836 | 2919122145 | 180 |
| 198 | iso_pu_bacteria | 2920760137 | 2920763230 | 180 |
| 199 | iso_pu_bacteria | 2920822456 | 2920823469 | 180 |
| 200 | iso_pu_bacteria | 2921201388 | 2921205692 | 180 |
| 201 | iso_pu_bacteria | 2921237296 | 2921237737 | 180 |
| 202 | iso_pu_bacteria | 2921244191 | 2921250554 | 180 |
| 203 | iso_pu_bacteria | 2921250672 | 2921256552 | 180 |
| 204 | iso_pu_bacteria | 2921257292 | 2921258006 | 180 |
| 205 | iso_pu_bacteria | 2921263974 | 2921264524 | 180 |
| 206 | iso_pu_bacteria | 2921282425 | 2921284155 | 180 |
| 207 | iso_pu_bacteria | 2921289301 | 2921295737 | 180 |
| 208 | iso_pu_bacteria | 2921296804 | 2921303652 | 180 |
| 209 | iso_pu_bacteria | 2922130491 | 2922137276 | 180 |
| 210 | iso_pu_bacteria | 2922151315 | 2922151963 | 180 |
| 211 | iso_pu_bacteria | 2922158528 | 2922159915 | 180 |
| 212 | iso_pu_bacteria | 2922172374 | 2922175158 | 180 |
| 213 | iso_pu_bacteria | 2922178524 | 2922180246 | 180 |
| 214 | iso_pu_bacteria | 2922185730 | 2922189942 | 180 |
| 215 | iso_pu_bacteria | 2924144063 | 2924150533 | 180 |
| 216 | iso_pu_bacteria | 2924150972 | 2924151725 | 180 |
| 217 | iso_pu_bacteria | 2924158325 | 2924161348 | 180 |
| 218 | iso_pu_bacteria | 2924165586 | 2924169543 | 180 |
| 219 | iso_pu_bacteria | 2924172951 | 2924173907 | 180 |
| 220 | iso_pu_bacteria | 2924179722 | 2924180402 | 180 |
| 221 | iso_pu_bacteria | 2924186466 | 2924190515 | 180 |
| 222 | iso_pu_bacteria | 2924193448 | 2924199766 | 180 |
| 223 | iso_pu_bacteria | 2924200457 | 2924206738 | 180 |
| 224 | iso_pu_bacteria | 2924207177 | 2924213675 | 180 |
| 225 | iso_pu_bacteria | 2924214083 | 2924219060 | 180 |
| 226 | iso_pu_bacteria | 2924221636 | 2924225529 | 180 |
| 227 | iso_pu_bacteria | 2924228884 | 2924229509 | 180 |
| 228 | iso_pu_bacteria | 2924718760 | 2924720769 | 180 |
| 229 | iso_pu_bacteria | 2924726620 | 2924727722 | 180 |
| 230 | iso_pu_bacteria | 2924733363 | 2924735224 | 180 |
| 231 | iso_pu_bacteria | 2924741084 | 2924743152 | 180 |
| 232 | iso_pu_bacteria | 2924754689 | 2924762511 | 180 |
| 233 | iso_pu_bacteria | 2924762789 | 2924765778 | 180 |
| 234 | iso_pu_bacteria | 2924776078 | 2924780475 | 180 |
| 235 | iso_pu_bacteria | 2924784321 | 2924791899 | 180 |
| 236 | iso_pu_bacteria | 2936996657 | 2936999793 | 180 |
| 237 | iso_pu_bacteria | 2937002841 | 2937009411 | 180 |
| 238 | iso_pu_bacteria | 2937009748 | 2937016016 | 180 |
| 239 | iso_pu_bacteria | 2937016420 | 2937022457 | 180 |
| 240 | iso_pu_bacteria | 2937023124 | 2937026797 | 180 |
| 241 | iso_pu_bacteria | 2937029754 | 2937030153 | 180 |
| 242 | iso_pu_bacteria | 2937036028 | 2937037855 | 180 |
| 243 | iso_pu_bacteria | 2937042894 | 2937046550 | 180 |
| 244 | iso_pu_bacteria | 2937049772 | 2937052752 | 180 |
| 245 | iso_pu_bacteria | 2937056579 | 2937060893 | 180 |
| 246 | iso_pu_bacteria | 2937063883 | 2937070686 | 180 |
| 247 | iso_pu_bacteria | 2937071275 | 2937078342 | 180 |
| 248 | iso_pu_bacteria | 2937078374 | 2937080228 | 180 |
| 249 | iso_pu_bacteria | 2937084907 | 2937088959 | 180 |
| 250 | iso_pu_bacteria | 2937091812 | 2937094626 | 180 |
| 251 | iso_pu_bacteria | 2937098957 | 2937100004 | 180 |
| 252 | iso_pu_bacteria | 2937106411 | 2937109653 | 180 |
| 253 | iso_pu_bacteria | 2937113482 | 2937117025 | 180 |
| 254 | iso_pu_bacteria | 2937119839 | 2937125645 | 180 |
| 255 | iso_pu_bacteria | 2937126314 | 2937132371 | 180 |
| 256 | iso_pu_bacteria | 2937813078 | 2937821339 | 180 |
| 257 | iso_pu_bacteria | 2937822353 | 2937823185 | 180 |
| 258 | iso_pu_bacteria | 2937836603 | 2937838988 | 180 |
| 259 | iso_pu_bacteria | 2937843397 | 2937844240 | 180 |
| 260 | iso_pu_bacteria | 2937848649 | 2937855291 | 180 |
| 261 | iso_pu_bacteria | 2937861824 | 2937865891 | 180 |
| 262 | iso_pu_bacteria | 2937868953 | 2937872725 | 180 |
| 263 | iso_pu_bacteria | 2937877337 | 2937882999 | 180 |
| 264 | iso_pu_bacteria | 2937891427 | 2937896223 | 180 |
| 265 | iso_pu_bacteria | 2937972304 | 2937973751 | 180 |
| 266 | iso_pu_bacteria | 2937980651 | 2937981983 | 180 |
| 267 | iso_pu_bacteria | 2937994558 | 2937996250 | 180 |
| 268 | iso_pu_bacteria | 2938014810 | 2938016677 | 180 |
| 269 | iso_pu_bacteria | 2941499720 | 2941500623 | 180 |
| 270 | iso_pu_bacteria | 2954011201 | 2954014726 | 180 |
| 271 | iso_pu_bacteria | 2957375807 | 2957381383 | 180 |
| 272 | iso_pu_bacteria | 2957382221 | 2957388122 | 180 |
| 273 | iso_pu_bacteria | 2957388812 | 2957392622 | 180 |
| 274 | iso_pu_bacteria | 2957395598 | 2957398488 | 180 |
| 275 | iso_pu_bacteria | 2957402308 | 2957408178 | 180 |
| 276 | iso_pu_bacteria | 2957408893 | 2957414625 | 180 |
| 277 | iso_pu_bacteria | 2957415311 | 2957415662 | 180 |
| 278 | iso_pu_bacteria | 2957422303 | 2957427213 | 180 |
| 279 | iso_pu_bacteria | 2957430029 | 2957433800 | 180 |
| 280 | iso_pu_bacteria | 2957437181 | 2957443609 | 180 |
| 281 | iso_pu_bacteria | 2957443900 | 2957446386 | 180 |
| 282 | iso_pu_bacteria | 2957450854 | 2957457269 | 180 |
| 283 | iso_pu_bacteria | 2957457609 | 2957458177 | 180 |
| 284 | iso_pu_bacteria | 2957464669 | 2957470712 | 180 |
| 285 | iso_pu_bacteria | 2957471148 | 2957474776 | 180 |
| 286 | iso_pu_bacteria | 2957478035 | 2957484758 | 180 |
| 287 | iso_pu_bacteria | 2957484790 | 2957488381 | 180 |
| 288 | iso_pu_bacteria | 2957491536 | 2957495465 | 180 |
| 289 | iso_pu_bacteria | 2957498199 | 2957502235 | 180 |
| 290 | iso_pu_bacteria | 2957505466 | 2957509324 | 180 |
| 291 | iso_pu_bacteria | 2958034702 | 2958037399 | 180 |
| 292 | iso_pu_bacteria | 2958041894 | 2958047111 | 180 |
| 293 | iso_pu_bacteria | 2958064165 | 2958069644 | 180 |
| 294 | iso_pu_bacteria | 2958071322 | 2958076600 | 180 |
| 295 | iso_pu_bacteria | 2958084443 | 2958090125 | 180 |
| 296 | iso_pu_bacteria | 2958092219 | 2958094203 | 180 |
| 297 | iso_pu_bacteria | 2958100919 | 2958106484 | 180 |
| 298 | iso_pu_bacteria | 2958108152 | 2958110037 | 180 |
| 299 | iso_pu_bacteria | 2958122699 | 2958122873 | 180 |
| 300 | iso_pu_bacteria | 2958130278 | 2958136604 | 180 |
| 301 | iso_pu_bacteria | 2958137437 | 2958137455 | 180 |
| 302 | iso_pu_bacteria | 2958144490 | 2958150616 | 180 |
| 303 | iso_pu_bacteria | 2958158011 | 2958159643 | 180 |
| 304 | iso_pu_bacteria | 2958165035 | 2958166719 | 180 |
| 305 | iso_pu_bacteria | 2958172287 | 2958174174 | 180 |
| 306 | iso_pu_bacteria | 2958179912 | 2958186098 | 180 |
| 307 | iso_pu_bacteria | 2960584000 | 2960586276 | 180 |
| 308 | iso_pu_bacteria | 2960591022 | 2960593683 | 180 |
| 309 | iso_pu_bacteria | 2960597568 | 2960603159 | 180 |
| 310 | iso_pu_bacteria | 2960603979 | 2960604451 | 180 |
| 311 | iso_pu_bacteria | 2960610863 | 2960614863 | 180 |
| 312 | iso_pu_bacteria | 2960617483 | 2960621113 | 180 |
| 313 | iso_pu_bacteria | 2960624210 | 2960625604 | 180 |
| 314 | iso_pu_bacteria | 2960631154 | 2960633007 | 180 |
| 315 | iso_pu_bacteria | 2960637947 | 2960638265 | 180 |
| 316 | iso_pu_bacteria | 2960645483 | 2960650356 | 180 |
| 317 | iso_pu_bacteria | 2960652885 | 2960653636 | 180 |
| 318 | iso_pu_bacteria | 2960660292 | 2960664712 | 180 |
| 319 | iso_pu_bacteria | 2960667422 | 2960668332 | 180 |
| 320 | iso_pu_bacteria | 2960674078 | 2960675893 | 180 |
| 321 | iso_pu_bacteria | 2960680706 | 2960685556 | 180 |
| 322 | iso_pu_bacteria | 2960687367 | 2960691610 | 180 |
| 323 | iso_pu_bacteria | 2960693952 | 2960694924 | 180 |
| 324 | iso_pu_bacteria | 2961077736 | 2961084580 | 180 |
| 325 | iso_pu_bacteria | 2961114664 | 2961117388 | 180 |
| 326 | iso_pu_bacteria | 2961127735 | 2961129073 | 180 |
| 327 | iso_pu_bacteria | 2961136820 | 2961137784 | 180 |
| 328 | iso_pu_bacteria | 2961163497 | 2961165189 | 180 |
| 329 | iso_pu_bacteria | 2961170736 | 2961171547 | 180 |
| 330 | iso_pu_bacteria | 2963644680 | 2963649154 | 180 |
| 331 | iso_pu_bacteria | 2964607997 | 2964615235 | 180 |
| 332 | iso_pu_bacteria | 2964615318 | 2964616690 | 180 |
| 333 | iso_pu_bacteria | 2964621998 | 2964622650 | 180 |
| 334 | iso_pu_bacteria | 2964628898 | 2964633620 | 180 |
| 335 | iso_pu_bacteria | 2964636051 | 2964638222 | 180 |
| 336 | iso_pu_bacteria | 2964643177 | 2964649573 | 180 |
| 337 | iso_pu_bacteria | 2964649959 | 2964653538 | 180 |
| 338 | iso_pu_bacteria | 2964656573 | 2964657607 | 180 |
| 339 | iso_pu_bacteria | 2964663802 | 2964670447 | 180 |
| 340 | iso_pu_bacteria | 2964670856 | 2964677990 | 180 |
| 341 | iso_pu_bacteria | 2964678106 | 2964681369 | 180 |
| 342 | iso_pu_bacteria | 2964685014 | 2964685485 | 180 |
| 343 | iso_pu_bacteria | 2964691889 | 2964692255 | 180 |
| 344 | iso_pu_bacteria | 2964698721 | 2964699879 | 180 |
| 345 | iso_pu_bacteria | 2964705432 | 2964712576 | 180 |
| 346 | iso_pu_bacteria | 2964712639 | 2964715712 | 180 |
| 347 | iso_pu_bacteria | 2964719344 | 2964725164 | 180 |
| 348 | iso_pu_bacteria | 2965018300 | 2965020011 | 180 |
| 349 | iso_pu_bacteria | 2965025482 | 2965030496 | 180 |
| 350 | iso_pu_bacteria | 2965032056 | 2965035465 | 180 |
| 351 | iso_pu_bacteria | 2965040258 | 2965045947 | 180 |
| 352 | iso_pu_bacteria | 2965047637 | 2965054004 | 180 |
| 353 | iso_pu_bacteria | 2965062239 | 2965065720 | 180 |
| 354 | iso_pu_bacteria | 2965089291 | 2965091453 | 180 |
| 355 | iso_pu_bacteria | 2965102966 | 2965110650 | 180 |
| 356 | iso_pu_bacteria | 2967664464 | 2967667951 | 180 |
| 357 | iso_pu_bacteria | 2967671571 | 2967672071 | 180 |
| 358 | iso_pu_bacteria | 2967678726 | 2967683317 | 180 |
| 359 | iso_pu_bacteria | 2967686174 | 2967686685 | 180 |
| 360 | iso_pu_bacteria | 2967693043 | 2967696614 | 180 |
| 361 | iso_pu_bacteria | 2967699805 | 2967702377 | 180 |
| 362 | iso_pu_bacteria | 2967706974 | 2967711762 | 180 |
| 363 | iso_pu_bacteria | 2967714385 | 2967718194 | 180 |
| 364 | iso_pu_bacteria | 2967721400 | 2967725996 | 180 |
| 365 | iso_pu_bacteria | 2967728569 | 2967729901 | 180 |
| 366 | iso_pu_bacteria | 2967735183 | 2967738210 | 180 |
| 367 | iso_pu_bacteria | 2967742019 | 2967744773 | 180 |
| 368 | iso_pu_bacteria | 2967748971 | 2967755098 | 180 |
| 369 | iso_pu_bacteria | 2967755722 | 2967756693 | 180 |
| 370 | iso_pu_bacteria | 2967762386 | 2967767070 | 180 |
| 371 | iso_pu_bacteria | 2967769361 | 2967775345 | 180 |
| 372 | iso_pu_bacteria | 2967775926 | 2967779530 | 180 |
| 373 | iso_pu_bacteria | 2967996073 | 2967996377 | 180 |
| 374 | iso_pu_bacteria | 2968003550 | 2968004609 | 180 |
| 375 | iso_pu_bacteria | 2968016561 | 2968019761 | 180 |
| 376 | iso_pu_bacteria | 2968083720 | 2968084399 | 180 |
| 377 | iso_pu_bacteria | 2968097103 | 2968099851 | 180 |
| 378 | iso_pu_bacteria | 2968110612 | 2968113296 | 180 |
| 379 | iso_pu_bacteria | 2968117919 | 2968124127 | 180 |
| 380 | iso_pu_bacteria | 2968138860 | 2968144847 | 180 |
| 381 | iso_pu_bacteria | 2968171901 | 2968173650 | 180 |
| 382 | iso_pu_bacteria | 2970019648 | 2970024801 | 180 |
| 383 | iso_pu_bacteria | 2970026789 | 2970032492 | 180 |
| 384 | iso_pu_bacteria | 2970033650 | 2970037617 | 180 |
| 385 | iso_pu_bacteria | 2970040964 | 2970041976 | 180 |
| 386 | iso_pu_bacteria | 2970047711 | 2970054095 | 180 |
| 387 | iso_pu_bacteria | 2970054988 | 2970058789 | 180 |
| 388 | iso_pu_bacteria | 2970061556 | 2970063336 | 180 |
| 389 | iso_pu_bacteria | 2970068827 | 2970072803 | 180 |
| 390 | iso_pu_bacteria | 2970076120 | 2970081523 | 180 |
| 391 | iso_pu_bacteria | 2970082768 | 2970086248 | 180 |
| 392 | iso_pu_bacteria | 2970088815 | 2970095364 | 180 |
| 393 | iso_pu_bacteria | 2970095765 | 2970096214 | 180 |
| 394 | iso_pu_bacteria | 2970102677 | 2970106388 | 180 |
| 395 | iso_pu_bacteria | 2970109326 | 2970113567 | 180 |
| 396 | iso_pu_bacteria | 2970116247 | 2970116669 | 180 |
| 397 | iso_pu_bacteria | 2970122695 | 2970123813 | 180 |
| 398 | iso_pu_bacteria | 2970129317 | 2970132908 | 180 |
| 399 | iso_pu_bacteria | 2970136068 | 2970139856 | 180 |
| 400 | iso_pu_bacteria | 2970143518 | 2970145578 | 180 |
| 401 | iso_pu_bacteria | 2970149975 | 2970153708 | 180 |
| 402 | iso_pu_bacteria | 2970156795 | 2970161643 | 180 |
| 403 | iso_pu_bacteria | 2970164137 | 2970170283 | 180 |
| 404 | iso_pu_bacteria | 2970170962 | 2970177504 | 180 |
| 405 | iso_pu_bacteria | 2970177841 | 2970181439 | 180 |
| 406 | iso_pu_bacteria | 2970184632 | 2970190936 | 180 |
| 407 | iso_pu_bacteria | 2970191845 | 2970195857 | 180 |
| 408 | iso_pu_bacteria | 2970469710 | 2970473082 | 180 |
| 409 | iso_pu_bacteria | 2970489779 | 2970495227 | 180 |
| 410 | iso_pu_bacteria | 2970503327 | 2970504076 | 180 |
| 411 | iso_pu_bacteria | 2970510686 | 2970514861 | 180 |
| 412 | iso_pu_bacteria | 2970524798 | 2970531302 | 180 |
| 413 | iso_pu_bacteria | 2970532167 | 2970535437 | 180 |
| 414 | iso_pu_bacteria | 2970540015 | 2970545852 | 180 |
| 415 | iso_pu_bacteria | 2970547951 | 2970553025 | 180 |
| 416 | iso_pu_bacteria | 2970554993 | 2970556737 | 180 |
| 417 | iso_pu_bacteria | 2970593180 | 2970596041 | 180 |
| 418 | iso_pu_bacteria | 2970619444 | 2970623194 | 180 |
| 419 | iso_pu_bacteria | 2977516862 | 2977520661 | 180 |
| 420 | iso_pu_bacteria | 2977523885 | 2977530389 | 180 |
| 421 | iso_pu_bacteria | 2977530762 | 2977537638 | 180 |
| 422 | iso_pu_bacteria | 2977537788 | 2977544022 | 180 |
| 423 | iso_pu_bacteria | 2977544691 | 2977549882 | 180 |
| 424 | iso_pu_bacteria | 2977551784 | 2977555728 | 180 |
| 425 | iso_pu_bacteria | 2977558990 | 2977559508 | 180 |
| 426 | iso_pu_bacteria | 2977565890 | 2977572293 | 180 |
| 427 | iso_pu_bacteria | 2977572785 | 2977577612 | 180 |
| 428 | iso_pu_bacteria | 2977579622 | 2977585990 | 180 |
| 429 | iso_pu_bacteria | 2977821940 | 2977823065 | 180 |
| 430 | iso_pu_bacteria | 2977828996 | 2977831252 | 180 |
| 431 | iso_pu_bacteria | 2977843712 | 2977849461 | 180 |
| 432 | iso_pu_bacteria | 2977851361 | 2977858014 | 180 |
| 433 | iso_pu_bacteria | 2977858184 | 2977861376 | 180 |
| 434 | iso_pu_bacteria | 2977864932 | 2977871194 | 180 |
| 435 | iso_pu_bacteria | 2977872689 | 2977874138 | 180 |
| 436 | iso_pu_bacteria | 2977898635 | 2977904991 | 180 |
| 437 | iso_pu_bacteria | 2977907340 | 2977910252 | 180 |
| 438 | iso_pu_bacteria | 2977915119 | 2977919784 | 180 |
| 439 | iso_pu_bacteria | 2977922695 | 2977926972 | 180 |
| 440 | iso_pu_bacteria | 2977935797 | 2977939395 | 180 |
| 441 | iso_pu_bacteria | 2977942078 | 2977948739 | 180 |
| 442 | iso_pu_bacteria | 2977950692 | 2977951577 | 180 |
| 443 | iso_pu_bacteria | 2977957713 | 2977961902 | 180 |
| 444 | iso_pu_bacteria | 2977971508 | 2977974429 | 180 |
| 445 | iso_pu_bacteria | 2977986579 | 2977987294 | 180 |
| 446 | iso_pu_bacteria | 2979710463 | 2979717456 | 180 |
| 447 | iso_pu_bacteria | 2979764755 | 2979770975 | 180 |
| 448 | iso_pu_bacteria | 2979772303 | 2979779808 | 180 |
| 449 | iso_pu_bacteria | 2979779861 | 2979782623 | 180 |
| 450 | iso_pu_bacteria | 2979793036 | 2979799197 | 180 |
| 451 | iso_pu_bacteria | 2979808191 | 2979808711 | 180 |
| 452 | iso_pu_bacteria | 2987636660 | 2987640330 | 180 |
| 453 | iso_pu_bacteria | 2987645492 | 2987648878 | 180 |
| 454 | iso_pu_bacteria | 2987652177 | 2987658745 | 180 |
| 455 | iso_pu_bacteria | 2987659509 | 2987661196 | 180 |
| 456 | iso_pu_bacteria | 2987666974 | 2987673102 | 180 |
| 457 | iso_pu_bacteria | 2987673487 | 2987674678 | 180 |
| 458 | iso_pu_bacteria | 2996310559 | 2996316665 | 180 |
| 459 | iso_pu_bacteria | 2996336353 | 2996338173 | 180 |
| 460 | iso_pu_bacteria | 2996341866 | 2996344400 | 180 |
| 461 | iso_pu_bacteria | 2996348954 | 2996351794 | 180 |
| 462 | iso_pu_bacteria | 2996386984 | 2996391783 | 180 |
| 463 | iso_pu_bacteria | 3000135777 | 3000139072 | 180 |
| 464 | iso_pu_bacteria | 3004167301 | 3004170723 | 180 |
| 465 | iso_pu_bacteria | 3004188549 | 3004190245 | 180 |
| 466 | iso_pu_bacteria | 3004195979 | 3004202131 | 180 |
| 467 | iso_pu_bacteria | 3004203850 | 3004207901 | 180 |
| 468 | iso_pu_bacteria | 3004211236 | 3004214817 | 180 |
| 469 | iso_pu_bacteria | 3004218560 | 3004222592 | 180 |
| 470 | iso_pu_bacteria | 3004232784 | 3004234404 | 180 |
| 471 | iso_pu_bacteria | 3004239961 | 3004246913 | 180 |
| 472 | iso_pu_bacteria | 3004248173 | 3004253752 | 180 |
| 473 | iso_pu_bacteria | 3004268573 | 3004270851 | 180 |
| 474 | iso_pu_bacteria | 3004275668 | 3004278493 | 180 |
| 475 | iso_pu_bacteria | 3004334049 | 3004339609 | 180 |
| 476 | iso_pu_bacteria | 637000159 | 637079861 | 180 |
| 477 | iso_pu_bacteria | 643692032 | 643824627 | 180 |
| 478 | iso_pu_bacteria | 648276728 | 648741457 | 180 |
| 479 | iso_pu_bacteria | 649633066 | 649874450 | 180 |
| 480 | iso_pu_bacteria | 8002285264 | 8002287694 | 180 |
| 481 | iso_pu_bacteria | 8003992118 | 8003992569 | 180 |
| 482 | iso_pu_bacteria | 8003999396 | 8003999892 | 180 |
| 483 | iso_pu_bacteria | 8004300914 | 8004307365 | 180 |
| 484 | iso_pu_bacteria | 8004312739 | 8004320333 | 180 |
| 485 | iso_pu_bacteria | 8004361976 | 8004364495 | 180 |
| 486 | iso_pu_bacteria | 8004374579 | 8004375421 | 180 |
| 487 | iso_pu_bacteria | 8004387939 | 8004394815 | 180 |
| 488 | iso_pu_bacteria | 8004395343 | 8004400116 | 180 |
| 489 | iso_pu_bacteria | 8004633249 | 8004636618 | 180 |
| 490 | iso_pu_bacteria | 8004640170 | 8004642760 | 180 |
| 491 | iso_pu_bacteria | 8004695233 | 8004699748 | 180 |
| 492 | iso_pu_bacteria | 8004703790 | 8004711517 | 180 |
| 493 | iso_pu_bacteria | 8004714634 | 8004721201 | 180 |
| 494 | iso_pu_bacteria | 8004727605 | 8004728587 | 180 |
| 495 | iso_pu_bacteria | 8049293176 | 8049293583 | 180 |
| 496 | iso_pu_bacteria | 8054558443 | 8054562006 | 180 |
| 497 | iso_pu_bacteria | 8055617313 | 8055622546 | 180 |
| 498 | 3300049574 | Ga0501038_0078411 | Ga0501038_0078411_1869_2414 | 181 |
| 499 | iso_pu_bacteria | 2847686936 | 2847687384 | 182 |
| 500 | iso_pu_bacteria | 2869249662 | 2869254172 | 182 |
| 501 | iso_pu_bacteria | 2876392853 | 2876395603 | 182 |
| 502 | iso_pu_bacteria | 2885334103 | 2885337975 | 182 |
| 503 | iso_pu_bacteria | 2958115193 | 2958117634 | 182 |
| 504 | iso_pu_bacteria | 2968091066 | 2968094411 | 182 |
| 505 | iso_pu_bacteria | 2968128360 | 2968131457 | 182 |
| 506 | iso_pu_bacteria | 8004445564 | 8004446014 | 182 |
| 507 | 3300053155 | Ga0500620_053342 | Ga0500620_053342_456_1007 | 183 |
| 508 | 3300002741 | JGI25157J39369_1000447 | JGI25157J39369_100044725 | 184 |
| 509 | 3300003203 | JGI25406J46586_10005473 | JGI25406J46586_100054731 | 184 |
| 510 | 3300003214 | JGI25165J46597_1000070 | JGI25165J46597_1000070144 | 184 |
| 511 | 3300003354 | JGI25160J50197_1000002 | JGI25160J50197_1000002390 | 184 |
| 512 | 3300003771 | Ga0055526_1009355 | Ga0055526_10093554 | 184 |
| 513 | 3300003775 | Ga0055524_1044712 | Ga0055524_10447121 | 184 |
| 514 | 3300003781 | Ga0055536_1001370 | Ga0055536_10013704 | 184 |
| 515 | 3300003794 | Ga0055531_10028993 | Ga0055531_100289932 | 184 |
| 516 | 3300004625 | Ga0055543_1000306 | Ga0055543_100030610 | 184 |
| 517 | 3300005262 | Ga0065165_1000058 | Ga0065165_100005816 | 184 |
| 518 | 3300005327 | Ga0070658_10095915 | Ga0070658_100959152 | 184 |
| 519 | 3300005353 | Ga0070669_100290272 | Ga0070669_1002902722 | 184 |
| 520 | 3300005356 | Ga0070674_100213010 | Ga0070674_1002130102 | 184 |
| 521 | 3300005364 | Ga0070673_100917602 | Ga0070673_1009176021 | 184 |
| 522 | 3300005366 | Ga0070659_100373090 | Ga0070659_1003730901 | 184 |
| 523 | 3300005539 | Ga0068853_100079674 | Ga0068853_1000796742 | 184 |
| 524 | 3300005539 | Ga0068853_100123555 | Ga0068853_1001235552 | 184 |
| 525 | 3300005548 | Ga0070665_100108101 | Ga0070665_1001081012 | 184 |
| 526 | 3300005563 | Ga0068855_100631248 | Ga0068855_1006312481 | 184 |
| 527 | 3300005614 | Ga0068856_100284631 | Ga0068856_1002846312 | 184 |
| 528 | 3300005985 | Ga0081539_10003346 | Ga0081539_100033467 | 184 |
| 529 | 3300006038 | Ga0075365_10092955 | Ga0075365_100929552 | 184 |
| 530 | 3300006038 | Ga0075365_10184227 | Ga0075365_101842272 | 184 |
| 531 | 3300006038 | Ga0075365_10266059 | Ga0075365_102660592 | 184 |
| 532 | 3300006042 | Ga0075368_10001439 | Ga0075368_100014392 | 184 |
| 533 | 3300006042 | Ga0075368_10253326 | Ga0075368_102533261 | 184 |
| 534 | 3300006048 | Ga0075363_100009749 | Ga0075363_1000097493 | 184 |
| 535 | 3300006048 | Ga0075363_100060285 | Ga0075363_1000602852 | 184 |
| 536 | 3300006051 | Ga0075364_10010273 | Ga0075364_100102732 | 184 |
| 537 | 3300006051 | Ga0075364_10648888 | Ga0075364_106488881 | 184 |
| 538 | 3300006177 | Ga0075362_10137361 | Ga0075362_101373612 | 184 |
| 539 | 3300006177 | Ga0075362_10164017 | Ga0075362_101640172 | 184 |
| 540 | 3300006178 | Ga0075367_10003469 | Ga0075367_100034692 | 184 |
| 541 | 3300006178 | Ga0075367_10011845 | Ga0075367_100118454 | 184 |
| 542 | 3300006178 | Ga0075367_10163013 | Ga0075367_101630132 | 184 |
| 543 | 3300006186 | Ga0075369_10001660 | Ga0075369_100016602 | 184 |
| 544 | 3300006186 | Ga0075369_10021510 | Ga0075369_100215102 | 184 |
| 545 | 3300006353 | Ga0075370_10009111 | Ga0075370_100091113 | 184 |
| 546 | 3300006353 | Ga0075370_10078798 | Ga0075370_100787982 | 184 |
| 547 | 3300006946 | Ga0079104_1002413 | Ga0079104_10024139 | 184 |
| 548 | 3300006946 | Ga0079104_1009146 | Ga0079104_10091462 | 184 |
| 549 | 3300009093 | Ga0105240_10161867 | Ga0105240_101618673 | 184 |
| 550 | 3300009093 | Ga0105240_10170657 | Ga0105240_101706572 | 184 |
| 551 | 3300009098 | Ga0105245_10139457 | Ga0105245_101394572 | 184 |
| 552 | 3300009148 | Ga0105243_10475877 | Ga0105243_104758771 | 184 |
| 553 | 3300009174 | Ga0105241_10055488 | Ga0105241_100554882 | 184 |
| 554 | 3300009545 | Ga0105237_10074211 | Ga0105237_100742112 | 184 |
| 555 | 3300009545 | Ga0105237_10682819 | Ga0105237_106828191 | 184 |
| 556 | 3300009551 | Ga0105238_10007521 | Ga0105238_100075215 | 184 |
| 557 | 3300009553 | Ga0105249_10617665 | Ga0105249_106176652 | 184 |
| 558 | 3300010375 | Ga0105239_10025032 | Ga0105239_100250325 | 184 |
| 559 | 3300010375 | Ga0105239_10211515 | Ga0105239_102115152 | 184 |
| 560 | 3300010375 | Ga0105239_10525332 | Ga0105239_105253322 | 184 |
| 561 | 3300010375 | Ga0105239_10863054 | Ga0105239_108630542 | 184 |
| 562 | 3300010375 | Ga0105239_12320265 | Ga0105239_123202651 | 184 |
| 563 | 3300013104 | Ga0157370_10207966 | Ga0157370_102079662 | 184 |
| 564 | 3300013104 | Ga0157370_10310372 | Ga0157370_103103722 | 184 |
| 565 | 3300013105 | Ga0157369_10139711 | Ga0157369_101397112 | 184 |
| 566 | 3300013297 | Ga0157378_10621747 | Ga0157378_106217472 | 184 |
| 567 | 3300014326 | Ga0157380_10659433 | Ga0157380_106594332 | 184 |
| 568 | 3300014497 | Ga0182008_10247166 | Ga0182008_102471661 | 184 |
| 569 | 3300015262 | Ga0182007_10047860 | Ga0182007_100478602 | 184 |
| 570 | 3300015684 | Ga0183365_10597 | Ga0183365_105972 | 184 |
| 571 | 3300015690 | Ga0183363_1163 | Ga0183363_11633 | 184 |
| 572 | 3300017792 | Ga0163161_10280018 | Ga0163161_102800181 | 184 |
| 573 | 3300017792 | Ga0163161_11042287 | Ga0163161_110422871 | 184 |
| 574 | 3300021320 | Ga0214544_1000008 | Ga0214544_1000008269 | 184 |
| 575 | 3300021321 | Ga0214542_1000010 | Ga0214542_1000010226 | 184 |
| 576 | 3300021327 | Ga0214543_1000003 | Ga0214543_1000003122 | 184 |
| 577 | 3300021327 | Ga0214543_1000004 | Ga0214543_1000004248 | 184 |
| 578 | 3300022739 | Ga0228711_1000137 | Ga0228711_100013755 | 184 |
| 579 | 3300022740 | Ga0228710_1000031 | Ga0228710_10000319 | 184 |
| 580 | 3300025208 | Ga0209436_100128 | Ga0209436_10012811 | 184 |
| 581 | 3300025250 | Ga0209026_1000002 | Ga0209026_10000021075 | 184 |
| 582 | 3300025254 | Ga0209148_1000123 | Ga0209148_1000123163 | 184 |
| 583 | 3300025256 | Ga0209759_1000381 | Ga0209759_10003818 | 184 |
| 584 | 3300025261 | Ga0209233_1000131 | Ga0209233_1000131159 | 184 |
| 585 | 3300025261 | Ga0209233_1008273 | Ga0209233_10082733 | 184 |
| 586 | 3300025272 | Ga0209455_1000129 | Ga0209455_1000129132 | 184 |
| 587 | 3300025284 | Ga0209130_1000008 | Ga0209130_1000008154 | 184 |
| 588 | 3300025292 | Ga0209676_1002487 | Ga0209676_100248710 | 184 |
| 589 | 3300025294 | Ga0209025_1000956 | Ga0209025_10009569 | 184 |
| 590 | 3300025295 | Ga0209564_1000091 | Ga0209564_100009178 | 184 |
| 591 | 3300025297 | Ga0209758_1006066 | Ga0209758_10060663 | 184 |
| 592 | 3300025297 | Ga0209758_1023562 | Ga0209758_10235621 | 184 |
| 593 | 3300025298 | Ga0209050_1005659 | Ga0209050_10056592 | 184 |
| 594 | 3300025299 | Ga0209256_1003090 | Ga0209256_100309010 | 184 |
| 595 | 3300025302 | Ga0207426_1000016 | Ga0207426_1000016407 | 184 |
| 596 | 3300025303 | Ga0209051_1006780 | Ga0209051_10067802 | 184 |
| 597 | 3300025304 | Ga0209257_1003908 | Ga0209257_100390810 | 184 |
| 598 | 3300025904 | Ga0207647_10006200 | Ga0207647_100062002 | 184 |
| 599 | 3300025904 | Ga0207647_10027535 | Ga0207647_100275352 | 184 |
| 600 | 3300025909 | Ga0207705_10091952 | Ga0207705_100919522 | 184 |
| 601 | 3300025913 | Ga0207695_10135869 | Ga0207695_101358692 | 184 |
| 602 | 3300025913 | Ga0207695_10281109 | Ga0207695_102811092 | 184 |
| 603 | 3300025913 | Ga0207695_10439553 | Ga0207695_104395532 | 184 |
| 604 | 3300025913 | Ga0207695_10455735 | Ga0207695_104557352 | 184 |
| 605 | 3300025914 | Ga0207671_10013865 | Ga0207671_100138655 | 184 |
| 606 | 3300025914 | Ga0207671_10545458 | Ga0207671_105454581 | 184 |
| 607 | 3300025924 | Ga0207694_10146655 | Ga0207694_101466552 | 184 |
| 608 | 3300025924 | Ga0207694_10801987 | Ga0207694_108019871 | 184 |
| 609 | 3300025937 | Ga0207669_10171165 | Ga0207669_101711652 | 184 |
| 610 | 3300026041 | Ga0207639_10040735 | Ga0207639_100407352 | 184 |
| 611 | 3300026041 | Ga0207639_10737318 | Ga0207639_107373182 | 184 |
| 612 | 3300026078 | Ga0207702_10284594 | Ga0207702_102845942 | 184 |
| 613 | 3300026116 | Ga0207674_10079771 | Ga0207674_100797711 | 184 |
| 614 | 3300026118 | Ga0207675_100027553 | Ga0207675_1000275531 | 184 |
| 615 | 3300027111 | Ga0209281_1000155 | Ga0209281_100015510 | 184 |
| 616 | 3300027111 | Ga0209281_1001059 | Ga0209281_100105910 | 184 |
| 617 | 3300027666 | Ga0209282_1000025 | Ga0209282_1000025154 | 184 |
| 618 | 3300027866 | Ga0209813_10006201 | Ga0209813_100062012 | 184 |
| 619 | 3300028379 | Ga0268266_10083937 | Ga0268266_100839372 | 184 |
| 620 | 3300028379 | Ga0268266_10233174 | Ga0268266_102331742 | 184 |
| 621 | 3300028794 | Ga0307515_10000154 | Ga0307515_1000015469 | 184 |
| 622 | 3300028794 | Ga0307515_10008850 | Ga0307515_1000885013 | 184 |
| 623 | 3300028794 | Ga0307515_10261289 | Ga0307515_102612892 | 184 |
| 624 | 3300031456 | Ga0307513_10001054 | Ga0307513_1000105423 | 184 |
| 625 | 3300031911 | Ga0307412_10261316 | Ga0307412_102613162 | 184 |
| 626 | 3300031911 | Ga0307412_10392654 | Ga0307412_103926542 | 184 |
| 627 | 3300031967 | Ga0315914_1000620 | Ga0315914_100062035 | 184 |
| 628 | 3300032002 | Ga0307416_100610119 | Ga0307416_1006101192 | 184 |
| 629 | 3300032168 | Ga0316593_10045409 | Ga0316593_100454092 | 184 |
| 630 | 3300033430 | Ga0315913_1000150 | Ga0315913_10001509 | 184 |
| 631 | 3300033464 | Ga0315915_1000015 | Ga0315915_10000159 | 184 |
| 632 | 3300035398 | Ga0316574_0417182 | Ga0316574_0417182_148_726 | 184 |
| 633 | 3300036647 | Ga0316582_0075988 | Ga0316582_0075988_920_1498 | 184 |
| 634 | 3300036712 | Ga0316584_0250718 | Ga0316584_0250718_689_1267 | 184 |
| 635 | 3300037312 | Ga0395899_0000073 | Ga0395899_0000073_136339_136893 | 184 |
| 636 | 3300037312 | Ga0395899_0093240 | Ga0395899_0093240_801_1355 | 184 |
| 637 | 3300037418 | Ga0395900_0000027 | Ga0395900_0000027_240909_241463 | 184 |
| 638 | 3300037418 | Ga0395900_0027106 | Ga0395900_0027106_2665_3219 | 184 |
| 639 | 3300037418 | Ga0395900_0042607 | Ga0395900_0042607_647_1201 | 184 |
| 640 | 3300037418 | Ga0395900_0046988 | Ga0395900_0046988_218_772 | 184 |
| 641 | 3300037466 | Ga0395898_0000255 | Ga0395898_0000255_85969_86523 | 184 |
| 642 | 3300037466 | Ga0395898_0389364 | Ga0395898_0389364_755_1309 | 184 |
| 643 | 3300037471 | Ga0395905_0000032 | Ga0395905_0000032_44470_45024 | 184 |
| 644 | 3300037471 | Ga0395905_0019317 | Ga0395905_0019317_1593_2147 | 184 |
| 645 | 3300037471 | Ga0395905_0338771 | Ga0395905_0338771_778_1332 | 184 |
| 646 | 3300037471 | Ga0395905_0387328 | Ga0395905_0387328_229_783 | 184 |
| 647 | 3300037471 | Ga0395905_0768327 | Ga0395905_0768327_289_843 | 184 |
| 648 | 3300038443 | Ga0395901_0000110 | Ga0395901_0000110_44495_45049 | 184 |
| 649 | 3300038443 | Ga0395901_0046591 | Ga0395901_0046591_3496_4050 | 184 |
| 650 | 3300038443 | Ga0395901_0057769 | Ga0395901_0057769_2056_2643 | 184 |
| 651 | 3300038443 | Ga0395901_0131007 | Ga0395901_0131007_143_697 | 184 |
| 652 | 3300038443 | Ga0395901_0488863 | Ga0395901_0488863_157_711 | 184 |
| 653 | 3300038443 | Ga0395901_1013721 | Ga0395901_1013721_130_684 | 184 |
| 654 | 3300041405 | Ga0439438_088036 | Ga0439438_088036_89_649 | 184 |
| 655 | 3300041452 | Ga0451793_0240457 | Ga0451793_0240457_215_769 | 184 |
| 656 | 3300041511 | Ga0451855_0305276 | Ga0451855_0305276_18_572 | 184 |
| 657 | 3300042004 | Ga0439445_0081298 | Ga0439445_0081298_151_828 | 184 |
| 658 | 3300042007 | Ga0439449_0003709 | Ga0439449_0003709_4413_4973 | 184 |
| 659 | 3300042007 | Ga0439449_0062432 | Ga0439449_0062432_274_834 | 184 |
| 660 | 3300044901 | Ga0466960_0052067 | Ga0466960_0052067_177_731 | 184 |
| 661 | 3300046460 | Ga0495638_0006132 | Ga0495638_0006132_6437_6991 | 184 |
| 662 | 3300046460 | Ga0495638_0119176 | Ga0495638_0119176_962_1519 | 184 |
| 663 | 3300046520 | Ga0495637_0122161 | Ga0495637_0122161_240_794 | 184 |
| 664 | 3300046522 | Ga0495643_0088549 | Ga0495643_0088549_791_1345 | 184 |
| 665 | 3300046524 | Ga0495648_0294686 | Ga0495648_0294686_130_684 | 184 |
| 666 | 3300046691 | Ga0495670_0021622 | Ga0495670_0021622_889_1446 | 184 |
| 667 | 3300046810 | Ga0495660_0234307 | Ga0495660_0234307_254_808 | 184 |
| 668 | 3300047321 | Ga0495676_0231892 | Ga0495676_0231892_78_632 | 184 |
| 669 | 3300047470 | Ga0495681_0044497 | Ga0495681_0044497_518_1072 | 184 |
| 670 | 3300047472 | Ga0495686_0173026 | Ga0495686_0173026_628_1185 | 184 |
| 671 | 3300048905 | Ga0496102_0092038 | Ga0496102_0092038_669_1223 | 184 |
| 672 | 3300048906 | Ga0496103_0207909 | Ga0496103_0207909_177_731 | 184 |
| 673 | 3300048909 | Ga0496106_0741651 | Ga0496106_0741651_16_573 | 184 |
| 674 | 3300048911 | Ga0496108_0161116 | Ga0496108_0161116_97_693 | 184 |
| 675 | 3300048912 | Ga0496109_0407276 | Ga0496109_0407276_650_1204 | 184 |
| 676 | 3300048915 | Ga0496112_0476133 | Ga0496112_0476133_214_768 | 184 |
| 677 | 3300048915 | Ga0496112_0801701 | Ga0496112_0801701_166_720 | 184 |
| 678 | 3300048916 | Ga0496113_0141688 | Ga0496113_0141688_1247_1801 | 184 |
| 679 | 3300048916 | Ga0496113_0596114 | Ga0496113_0596114_209_781 | 184 |
| 680 | 3300048918 | Ga0496115_0486398 | Ga0496115_0486398_288_842 | 184 |
| 681 | 3300048918 | Ga0496115_0516257 | Ga0496115_0516257_382_936 | 184 |
| 682 | 3300048921 | Ga0496118_0132255 | Ga0496118_0132255_572_1126 | 184 |
| 683 | 3300048922 | Ga0496119_0068437 | Ga0496119_0068437_946_1500 | 184 |
| 684 | 3300048923 | Ga0496120_0005603 | Ga0496120_0005603_5232_5786 | 184 |
| 685 | 3300048923 | Ga0496120_0152627 | Ga0496120_0152627_438_992 | 184 |
| 686 | 3300048924 | Ga0496121_0206346 | Ga0496121_0206346_733_1287 | 184 |
| 687 | 3300048925 | Ga0496122_0399273 | Ga0496122_0399273_127_681 | 184 |
| 688 | 3300048928 | Ga0496125_0284127 | Ga0496125_0284127_201_755 | 184 |
| 689 | 3300048929 | Ga0496126_0190705 | Ga0496126_0190705_1110_1664 | 184 |
| 690 | 3300048929 | Ga0496126_0606100 | Ga0496126_0606100_97_651 | 184 |
| 691 | 3300049568 | Ga0501031_0020213 | Ga0501031_0020213_965_1519 | 184 |
| 692 | 3300049568 | Ga0501031_0047010 | Ga0501031_0047010_1377_1931 | 184 |
| 693 | 3300049568 | Ga0501031_0050394 | Ga0501031_0050394_1019_1573 | 184 |
| 694 | 3300049568 | Ga0501031_0076167 | Ga0501031_0076167_769_1323 | 184 |
| 695 | 3300049568 | Ga0501031_0275123 | Ga0501031_0275123_76_630 | 184 |
| 696 | 3300049568 | Ga0501031_0278089 | Ga0501031_0278089_139_699 | 184 |
| 697 | 3300049568 | Ga0501031_0385628 | Ga0501031_0385628_332_886 | 184 |
| 698 | 3300049569 | Ga0501032_0000081 | Ga0501032_0000081_21054_21608 | 184 |
| 699 | 3300049569 | Ga0501032_0000116 | Ga0501032_0000116_3555_4109 | 184 |
| 700 | 3300049569 | Ga0501032_0033707 | Ga0501032_0033707_2580_3134 | 184 |
| 701 | 3300049569 | Ga0501032_0037313 | Ga0501032_0037313_1560_2114 | 184 |
| 702 | 3300049569 | Ga0501032_0046609 | Ga0501032_0046609_374_928 | 184 |
| 703 | 3300049569 | Ga0501032_0088912 | Ga0501032_0088912_615_1169 | 184 |
| 704 | 3300049569 | Ga0501032_0231339 | Ga0501032_0231339_247_801 | 184 |
| 705 | 3300049569 | Ga0501032_0446993 | Ga0501032_0446993_22_576 | 184 |
| 706 | 3300049569 | Ga0501032_0527791 | Ga0501032_0527791_43_597 | 184 |
| 707 | 3300049570 | Ga0501033_0000097 | Ga0501033_0000097_54921_55475 | 184 |
| 708 | 3300049570 | Ga0501033_0000501 | Ga0501033_0000501_17704_18258 | 184 |
| 709 | 3300049570 | Ga0501033_0001994 | Ga0501033_0001994_11648_12202 | 184 |
| 710 | 3300049570 | Ga0501033_0003939 | Ga0501033_0003939_284_838 | 184 |
| 711 | 3300049570 | Ga0501033_0011792 | Ga0501033_0011792_3132_3686 | 184 |
| 712 | 3300049570 | Ga0501033_0051935 | Ga0501033_0051935_2111_2665 | 184 |
| 713 | 3300049570 | Ga0501033_0052388 | Ga0501033_0052388_1983_2537 | 184 |
| 714 | 3300049570 | Ga0501033_0116853 | Ga0501033_0116853_830_1384 | 184 |
| 715 | 3300049570 | Ga0501033_0185335 | Ga0501033_0185335_497_1051 | 184 |
| 716 | 3300049570 | Ga0501033_0267328 | Ga0501033_0267328_597_1151 | 184 |
| 717 | 3300049570 | Ga0501033_0286940 | Ga0501033_0286940_534_1115 | 184 |
| 718 | 3300049570 | Ga0501033_0404655 | Ga0501033_0404655_374_928 | 184 |
| 719 | 3300049570 | Ga0501033_0708521 | Ga0501033_0708521_24_578 | 184 |
| 720 | 3300049571 | Ga0501034_0000186 | Ga0501034_0000186_61024_61578 | 184 |
| 721 | 3300049571 | Ga0501034_0003453 | Ga0501034_0003453_10163_10717 | 184 |
| 722 | 3300049571 | Ga0501034_0004432 | Ga0501034_0004432_3427_3981 | 184 |
| 723 | 3300049571 | Ga0501034_0021271 | Ga0501034_0021271_4995_5549 | 184 |
| 724 | 3300049571 | Ga0501034_0215003 | Ga0501034_0215003_1253_1807 | 184 |
| 725 | 3300049571 | Ga0501034_0234953 | Ga0501034_0234953_755_1309 | 184 |
| 726 | 3300049571 | Ga0501034_0267581 | Ga0501034_0267581_656_1210 | 184 |
| 727 | 3300049571 | Ga0501034_0418751 | Ga0501034_0418751_673_1227 | 184 |
| 728 | 3300049571 | Ga0501034_0567156 | Ga0501034_0567156_359_913 | 184 |
| 729 | 3300049571 | Ga0501034_0843928 | Ga0501034_0843928_150_704 | 184 |
| 730 | 3300049572 | Ga0501036_0000002 | Ga0501036_0000002_237634_238188 | 184 |
| 731 | 3300049572 | Ga0501036_0001125 | Ga0501036_0001125_5972_6526 | 184 |
| 732 | 3300049572 | Ga0501036_0039433 | Ga0501036_0039433_2488_3042 | 184 |
| 733 | 3300049572 | Ga0501036_0414854 | Ga0501036_0414854_374_928 | 184 |
| 734 | 3300049572 | Ga0501036_0650940 | Ga0501036_0650940_293_847 | 184 |
| 735 | 3300049573 | Ga0501037_0000095 | Ga0501037_0000095_21082_21636 | 184 |
| 736 | 3300049573 | Ga0501037_0000108 | Ga0501037_0000108_18469_19023 | 184 |
| 737 | 3300049573 | Ga0501037_0000451 | Ga0501037_0000451_18564_19118 | 184 |
| 738 | 3300049573 | Ga0501037_0131132 | Ga0501037_0131132_340_894 | 184 |
| 739 | 3300049574 | Ga0501038_0000002 | Ga0501038_0000002_28281_28835 | 184 |
| 740 | 3300049574 | Ga0501038_0000126 | Ga0501038_0000126_3427_3981 | 184 |
| 741 | 3300049574 | Ga0501038_0063134 | Ga0501038_0063134_779_1333 | 184 |
| 742 | 3300049574 | Ga0501038_0067643 | Ga0501038_0067643_2111_2665 | 184 |
| 743 | 3300049574 | Ga0501038_0071665 | Ga0501038_0071665_2011_2565 | 184 |
| 744 | 3300049574 | Ga0501038_0077899 | Ga0501038_0077899_1260_1814 | 184 |
| 745 | 3300049575 | Ga0501039_0000002 | Ga0501039_0000002_319678_320232 | 184 |
| 746 | 3300049575 | Ga0501039_0000003 | Ga0501039_0000003_169549_170103 | 184 |
| 747 | 3300049575 | Ga0501039_0187939 | Ga0501039_0187939_1005_1559 | 184 |
| 748 | 3300049575 | Ga0501039_0211894 | Ga0501039_0211894_596_1150 | 184 |
| 749 | 3300049576 | Ga0501040_0003171 | Ga0501040_0003171_4259_4813 | 184 |
| 750 | 3300049578 | Ga0501042_0078294 | Ga0501042_0078294_373_927 | 184 |
| 751 | 3300049579 | Ga0501043_0000081 | Ga0501043_0000081_35730_36284 | 184 |
| 752 | 3300049579 | Ga0501043_0000140 | Ga0501043_0000140_54041_54595 | 184 |
| 753 | 3300049579 | Ga0501043_0000162 | Ga0501043_0000162_20610_21164 | 184 |
| 754 | 3300049579 | Ga0501043_0095551 | Ga0501043_0095551_583_1164 | 184 |
| 755 | 3300049579 | Ga0501043_0104122 | Ga0501043_0104122_1663_2217 | 184 |
| 756 | 3300049579 | Ga0501043_0169788 | Ga0501043_0169788_404_958 | 184 |
| 757 | 3300049579 | Ga0501043_0457414 | Ga0501043_0457414_237_791 | 184 |
| 758 | 3300049580 | Ga0501046_0023471 | Ga0501046_0023471_1993_2547 | 184 |
| 759 | 3300049580 | Ga0501046_0147873 | Ga0501046_0147873_1064_1618 | 184 |
| 760 | 3300049580 | Ga0501046_0271654 | Ga0501046_0271654_331_885 | 184 |
| 761 | 3300049581 | Ga0501047_0001069 | Ga0501047_0001069_5210_5764 | 184 |
| 762 | 3300049581 | Ga0501047_0005496 | Ga0501047_0005496_3417_3971 | 184 |
| 763 | 3300049581 | Ga0501047_0013509 | Ga0501047_0013509_4511_5065 | 184 |
| 764 | 3300049581 | Ga0501047_0053713 | Ga0501047_0053713_2969_3523 | 184 |
| 765 | 3300049581 | Ga0501047_0123024 | Ga0501047_0123024_1588_2142 | 184 |
| 766 | 3300049581 | Ga0501047_0317862 | Ga0501047_0317862_64_645 | 184 |
| 767 | 3300049581 | Ga0501047_0499200 | Ga0501047_0499200_116_670 | 184 |
| 768 | 3300049581 | Ga0501047_0513635 | Ga0501047_0513635_174_731 | 184 |
| 769 | 3300049583 | Ga0501067_0058678 | Ga0501067_0058678_321_875 | 184 |
| 770 | 3300049583 | Ga0501067_0084208 | Ga0501067_0084208_45_599 | 184 |
| 771 | 3300049584 | Ga0501068_0019640 | Ga0501068_0019640_23_577 | 184 |
| 772 | 3300049584 | Ga0501068_0067416 | Ga0501068_0067416_1217_1771 | 184 |
| 773 | 3300049585 | Ga0501069_0000118 | Ga0501069_0000118_19455_20009 | 184 |
| 774 | 3300049585 | Ga0501069_0029569 | Ga0501069_0029569_1698_2252 | 184 |
| 775 | 3300049586 | Ga0501070_0002038 | Ga0501070_0002038_4505_5059 | 184 |
| 776 | 3300049586 | Ga0501070_0002088 | Ga0501070_0002088_11446_12000 | 184 |
| 777 | 3300049586 | Ga0501070_0002773 | Ga0501070_0002773_13663_14217 | 184 |
| 778 | 3300049586 | Ga0501070_0016450 | Ga0501070_0016450_694_1248 | 184 |
| 779 | 3300049586 | Ga0501070_0049174 | Ga0501070_0049174_533_1087 | 184 |
| 780 | 3300049586 | Ga0501070_0050792 | Ga0501070_0050792_1338_1892 | 184 |
| 781 | 3300049586 | Ga0501070_0110816 | Ga0501070_0110816_1498_2079 | 184 |
| 782 | 3300049586 | Ga0501070_0117985 | Ga0501070_0117985_103_657 | 184 |
| 783 | 3300049586 | Ga0501070_0180593 | Ga0501070_0180593_749_1303 | 184 |
| 784 | 3300049586 | Ga0501070_0180900 | Ga0501070_0180900_770_1324 | 184 |
| 785 | 3300049587 | Ga0501071_0032926 | Ga0501071_0032926_985_1539 | 184 |
| 786 | 3300049587 | Ga0501071_0043090 | Ga0501071_0043090_151_705 | 184 |
| 787 | 3300049589 | Ga0501073_0018852 | Ga0501073_0018852_257_811 | 184 |
| 788 | 3300049589 | Ga0501073_0051879 | Ga0501073_0051879_25_588 | 184 |
| 789 | 3300049589 | Ga0501073_0093871 | Ga0501073_0093871_944_1498 | 184 |
| 790 | 3300049590 | Ga0501074_0000062 | Ga0501074_0000062_31187_31741 | 184 |
| 791 | 3300049590 | Ga0501074_0014987 | Ga0501074_0014987_4485_5039 | 184 |
| 792 | 3300049590 | Ga0501074_0085970 | Ga0501074_0085970_232_786 | 184 |
| 793 | 3300049741 | Ga0501079_0957325 | Ga0501079_0957325_40_594 | 184 |
| 794 | 3300049742 | Ga0501080_0000254 | Ga0501080_0000254_23074_23628 | 184 |
| 795 | 3300049742 | Ga0501080_0016280 | Ga0501080_0016280_4268_4822 | 184 |
| 796 | 3300049742 | Ga0501080_0037279 | Ga0501080_0037279_2677_3231 | 184 |
| 797 | 3300049742 | Ga0501080_0059987 | Ga0501080_0059987_935_1489 | 184 |
| 798 | 3300049742 | Ga0501080_0608901 | Ga0501080_0608901_51_608 | 184 |
| 799 | 3300049744 | Ga0501083_0000453 | Ga0501083_0000453_14456_15010 | 184 |
| 800 | 3300049822 | Ga0501035_0000017 | Ga0501035_0000017_235001_235555 | 184 |
| 801 | 3300049822 | Ga0501035_0000100 | Ga0501035_0000100_51847_52401 | 184 |
| 802 | 3300049822 | Ga0501035_0000895 | Ga0501035_0000895_30509_31090 | 184 |
| 803 | 3300049822 | Ga0501035_0001153 | Ga0501035_0001153_11776_12330 | 184 |
| 804 | 3300049822 | Ga0501035_0001764 | Ga0501035_0001764_4453_5007 | 184 |
| 805 | 3300049822 | Ga0501035_0003584 | Ga0501035_0003584_4671_5225 | 184 |
| 806 | 3300049822 | Ga0501035_0032885 | Ga0501035_0032885_3294_3857 | 184 |
| 807 | 3300049822 | Ga0501035_0085431 | Ga0501035_0085431_153_707 | 184 |
| 808 | 3300049822 | Ga0501035_0086759 | Ga0501035_0086759_2051_2605 | 184 |
| 809 | 3300049822 | Ga0501035_0316305 | Ga0501035_0316305_60_614 | 184 |
| 810 | 3300049823 | Ga0501044_0000002 | Ga0501044_0000002_54921_55475 | 184 |
| 811 | 3300049823 | Ga0501044_0000751 | Ga0501044_0000751_18582_19136 | 184 |
| 812 | 3300049823 | Ga0501044_0007931 | Ga0501044_0007931_6616_7170 | 184 |
| 813 | 3300049823 | Ga0501044_0019122 | Ga0501044_0019122_1313_1867 | 184 |
| 814 | 3300049823 | Ga0501044_0021530 | Ga0501044_0021530_3229_3792 | 184 |
| 815 | 3300049823 | Ga0501044_0038386 | Ga0501044_0038386_2696_3250 | 184 |
| 816 | 3300049823 | Ga0501044_0047079 | Ga0501044_0047079_153_707 | 184 |
| 817 | 3300049823 | Ga0501044_0108794 | Ga0501044_0108794_2075_2629 | 184 |
| 818 | 3300049823 | Ga0501044_0168991 | Ga0501044_0168991_1162_1743 | 184 |
| 819 | 3300049823 | Ga0501044_0286715 | Ga0501044_0286715_620_1177 | 184 |
| 820 | 3300049823 | Ga0501044_0423824 | Ga0501044_0423824_664_1218 | 184 |
| 821 | 3300049823 | Ga0501044_0431691 | Ga0501044_0431691_166_720 | 184 |
| 822 | 3300049823 | Ga0501044_0555498 | Ga0501044_0555498_82_639 | 184 |
| 823 | 3300049823 | Ga0501044_0902010 | Ga0501044_0902010_65_622 | 184 |
| 824 | 3300049824 | Ga0501045_0020525 | Ga0501045_0020525_3868_4422 | 184 |
| 825 | 3300049824 | Ga0501045_0090727 | Ga0501045_0090727_942_1496 | 184 |
| 826 | 3300050489 | nmdc:mga03683_79079_c1 | nmdc:mga03683_79079_c1_827_1381 | 184 |
| 827 | 3300050490 | nmdc:mga03n38_143292_c1 | nmdc:mga03n38_143292_c1_445_999 | 184 |
| 828 | 3300050490 | nmdc:mga03n38_144725_c1 | nmdc:mga03n38_144725_c1_38_592 | 184 |
| 829 | 3300050491 | nmdc:mga00v17_129310_c1 | nmdc:mga00v17_129310_c1_373_927 | 184 |
| 830 | 3300050492 | nmdc:mga0yw44_216513_c1 | nmdc:mga0yw44_216513_c1_178_735 | 184 |
| 831 | 3300050492 | nmdc:mga0yw44_21673_c1 | nmdc:mga0yw44_21673_c1_2725_3279 | 184 |
| 832 | 3300050492 | nmdc:mga0yw44_234290_c1 | nmdc:mga0yw44_234290_c1_169_744 | 184 |
| 833 | 3300050492 | nmdc:mga0yw44_56243_c1 | nmdc:mga0yw44_56243_c1_1662_2216 | 184 |
| 834 | 3300050494 | nmdc:mga06z11_43242_c1 | nmdc:mga06z11_43242_c1_73_627 | 184 |
| 835 | 3300050494 | nmdc:mga06z11_47954_c1 | nmdc:mga06z11_47954_c1_413_967 | 184 |
| 836 | 3300050495 | nmdc:mga04h51_47165_c1 | nmdc:mga04h51_47165_c1_117_671 | 184 |
| 837 | 3300050496 | nmdc:mga07m45_3290_c1 | nmdc:mga07m45_3290_c1_2725_3279 | 184 |
| 838 | 3300050496 | nmdc:mga07m45_33919_c1 | nmdc:mga07m45_33919_c1_1668_2222 | 184 |
| 839 | 3300053079 | Ga0500610_0045343 | Ga0500610_0045343_1561_2115 | 184 |
| 840 | 3300053079 | Ga0500610_0215050 | Ga0500610_0215050_111_665 | 184 |
| 841 | 3300053087 | Ga0500643_020686 | Ga0500643_020686_1267_1827 | 184 |
| 842 | 3300053104 | Ga0500556_0056626 | Ga0500556_0056626_384_941 | 184 |
| 843 | 3300053122 | Ga0500608_100903 | Ga0500608_100903_498_1118 | 184 |
| 844 | 3300053139 | Ga0500568_0000048 | Ga0500568_0000048_57965_58519 | 184 |
| 845 | 3300053151 | Ga0500604_0032642 | Ga0500604_0032642_660_1241 | 184 |
| 846 | 3300053153 | Ga0500616_0082384 | Ga0500616_0082384_871_1428 | 184 |
| 847 | 3300053155 | Ga0500620_000328 | Ga0500620_000328_5846_6400 | 184 |
| 848 | 3300053156 | Ga0500622_0000251 | Ga0500622_0000251_25902_26522 | 184 |
| 849 | 3300054114 | Ga0501084_0856837 | Ga0501084_0856837_35_589 | 184 |
| 850 | 3300060353 | Ga0501082_0090342 | Ga0501082_0090342_1453_2007 | 184 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2fpo-assembly1.cif.gz_A | putative methyltransferase yhhf from escherichia coli. | 0.9014 | 1 | 184 |
| 6m1c-assembly1.cif.gz_A | crystal structure of rsmd methyltransferase of m. tuberculosis in complex with sinefungin reveals key interactions | 0.8984 | 1 | 183 |
| 2fpo-assembly4.cif.gz_D | putative methyltransferase yhhf from escherichia coli. | 0.8958 | 1 | 184 |
| 2fpo-assembly5.cif.gz_E | putative methyltransferase yhhf from escherichia coli. | 0.8953 | 1 | 184 |
| 2fpo-assembly6.cif.gz_F | putative methyltransferase yhhf from escherichia coli. | 0.8879 | 1 | 184 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0ADX9_1_198_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9095 | 1 | 184 | 3.40.50.150 |
| af_A0A1D6EFY7_537_616_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8975 | 44 | 106 | 3.40.50.150 |
| 2fpoF00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8957 | 1 | 184 | 3.40.50.150 |
| af_Q2FZF6_1_156_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8955 | 25 | 183 | 3.40.50.150 |
| af_P0ADX9_1_198_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8815 | 1 | 184 | 3.40.50.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1A5RUM8-F1-model_v4 | deleted | 1.001 | 1 | 184 |
|
| AF-A0A0Q8BD86-F1-model_v4 | 16S rRNA (Guanine(966)-N(2))-methyltransferase RsmD | 0.9972 | 1 | 184 |
GO:0003676
GO:0008168 GO:0031167 |
| AF-A0A529U2F3-F1-model_v4 | deleted | 0.9907 | 62 | 184 |
|
| AF-A0A529U2F3-F1-model_v4 | deleted | 0.9749 | 62 | 184 |
|
| AF-A0A0J6SAH4-F1-model_v4 | DNA methyltransferase | 0.9681 | 74 | 183 |
GO:0003676
GO:0008168 GO:0032259 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar