F483437

General Info

Members Datasets Scaffolds Average Seq Length
850 675 345 183

Family's Representative Sequence

Representative Sequence 3300049574|Ga0501038_0078411|Ga0501038_0078411_1869_2414
Length 181
Sequence MRIVGGEFRGRPLATPRSSAIRPTTDRTREAVFNVLAHRFAGRLEGARVLDLFAGTGALGLEALSRGASFCLFVEESAEGRGLIRENVGLQGRTKIFRRDATRLGEIGTMLPFDLFLADPPYGRDFAGKALAAARAGGWLRHGALCVVEEAAGAPFDAGTGFALVDEREYGDTVIRFLELA

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
3 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
4 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
5 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
6 2509276019 Ensifer aridi TW10 Isolate Nodule
7 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
8 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
9 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
10 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
11 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
12 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
13 2512875024 Mesorhizobium loti R88b Isolate Nodule
14 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
15 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
16 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
17 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
18 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
19 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
20 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
21 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
22 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
23 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
24 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
25 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
26 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
27 2516143018 Ensifer sp. BR816 Isolate Nodule
28 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
29 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
30 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
31 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
32 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
33 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
34 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
35 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
36 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
37 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
38 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
39 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
40 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
41 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
42 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
43 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
44 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
45 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
46 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
47 2643221618 Ensifer sp. Root231 Isolate Unclassified
48 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
49 2643221626 Ensifer sp. Root31 Isolate Unclassified
50 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
51 2643221655 Ensifer sp. Root1252 Isolate Unclassified
52 2643221659 Ensifer sp. Root127 Isolate Unclassified
53 2643221698 Ensifer sp. Root142 Isolate Unclassified
54 2643221712 Ensifer sp. Root258 Isolate Unclassified
55 2643221723 Ensifer sp. Root278 Isolate Unclassified
56 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
57 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
58 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
59 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
60 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
61 2738543024 Aminobacter sp. AP02 Isolate Unclassified
62 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
63 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
64 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
65 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
66 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
67 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
68 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
69 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
70 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
71 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
72 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
73 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
74 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
75 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
76 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
77 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
78 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
79 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
80 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
81 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
82 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
83 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
84 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
85 2844163670 Ensifer sp. 1H6 Isolate Unclassified
86 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
87 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
88 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
89 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
90 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
91 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
92 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
93 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
94 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
95 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
96 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
97 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
98 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
99 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
100 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
101 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
102 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
103 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
104 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
105 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
106 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
107 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
108 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
109 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
110 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
111 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
112 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
113 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
114 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
115 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
116 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
117 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
118 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
119 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
120 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
121 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
122 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
123 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
124 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
125 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
126 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
127 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
128 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
129 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
130 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
131 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
132 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
133 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
134 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
135 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
136 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
137 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
138 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
139 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
140 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
141 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
142 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
143 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
144 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
145 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
146 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
147 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
148 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
149 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
150 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
151 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
152 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
153 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
154 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
155 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
156 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
157 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
158 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
159 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
160 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
161 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
162 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
163 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
164 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
165 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
166 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
167 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
168 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
169 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
170 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
171 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
172 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
173 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
174 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
175 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
176 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
177 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
178 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
179 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
180 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
181 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
182 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
183 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
184 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
185 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
186 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
187 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
188 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
189 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
190 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
191 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
192 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
193 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
194 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
195 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
196 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
197 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
198 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
199 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
200 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
201 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
202 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
203 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
204 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
205 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
206 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
207 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
208 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
209 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
210 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
211 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
212 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
213 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
214 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
215 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
216 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
217 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
218 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
219 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
220 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
221 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
222 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
223 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
224 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
225 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
226 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
227 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
228 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
229 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
230 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
231 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
232 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
233 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
234 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
235 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
236 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
237 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
238 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
239 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
240 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
241 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
242 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
243 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
244 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
245 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
246 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
247 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
248 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
249 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
250 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
251 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
252 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
253 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
254 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
255 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
256 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
257 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
258 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
259 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
260 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
261 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
262 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
263 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
264 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
265 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
266 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
267 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
268 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
269 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
270 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
271 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
272 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
273 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
274 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
275 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
276 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
277 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
278 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
279 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
280 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
281 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
282 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
283 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
284 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
285 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
286 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
287 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
288 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
289 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
290 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
291 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
292 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
293 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
294 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
295 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
296 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
297 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
298 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
299 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
300 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
301 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
302 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
303 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
304 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
305 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
306 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
307 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
308 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
309 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
310 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
311 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
312 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
313 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
314 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
315 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
316 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
317 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
318 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
319 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
320 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
321 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
322 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
323 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
324 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
325 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
326 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
327 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
328 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
329 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
330 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
331 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
332 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
333 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
334 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
335 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
336 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
337 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
338 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
339 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
340 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
341 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
342 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
343 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
344 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
345 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
346 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
347 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
348 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
349 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
350 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
351 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
352 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
353 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
354 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
355 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
356 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
357 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
358 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
359 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
360 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
361 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
362 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
363 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
364 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
365 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
366 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
367 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
368 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
369 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
370 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
371 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
372 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
373 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
374 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
375 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
376 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
377 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
378 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
379 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
380 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
381 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
382 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
383 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
384 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
385 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
386 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
387 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
388 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
389 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
390 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
391 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
392 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
393 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
394 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
395 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
396 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
397 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
398 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
399 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
400 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
401 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
402 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
403 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
404 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
405 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
406 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
407 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
408 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
409 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
410 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
411 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
412 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
413 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
414 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
415 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
416 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
417 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
418 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
419 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
420 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
421 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
422 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
423 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
424 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
425 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
426 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
427 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
428 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
429 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
430 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
431 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
432 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
433 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
434 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
435 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
436 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
437 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
438 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
439 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
440 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
441 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
442 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
443 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
444 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
445 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
446 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
447 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
448 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
449 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
450 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
451 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
452 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
453 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
454 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
455 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
456 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
457 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
458 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
459 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
460 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
461 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
462 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
463 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
464 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
465 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
466 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
467 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
468 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
469 3004167301 Mesorhizobium loti 582 Isolate Unclassified
470 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
471 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
472 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
473 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
474 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
475 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
476 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
477 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
478 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
479 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
480 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
481 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
482 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
483 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
484 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
485 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
486 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
487 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
488 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
489 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
490 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
491 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
492 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
493 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
494 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
495 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
496 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
497 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
498 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
499 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
500 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
501 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
502 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
503 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
504 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
505 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
506 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
507 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
508 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
509 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
510 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
511 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
512 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
513 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
514 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
515 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
516 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
517 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
518 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
519 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
520 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
521 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
522 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
523 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
524 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
525 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
526 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
527 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
528 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
529 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
530 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
531 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
532 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
533 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
534 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
535 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
536 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
537 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
538 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
539 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
540 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
541 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
542 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
543 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
544 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
545 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
546 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
547 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
548 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
549 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
550 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
551 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
552 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
553 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
554 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
555 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
556 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
557 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
558 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
559 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
560 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
561 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
562 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
563 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
564 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
565 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
566 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
567 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
568 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
569 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
570 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
571 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
572 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
573 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
574 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
575 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
576 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
577 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
578 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
579 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
580 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
581 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
582 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
583 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
584 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
585 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
586 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
587 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
588 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
589 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
590 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
591 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
592 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
593 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
594 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
595 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
596 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
597 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
598 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
599 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
600 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
601 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
602 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
603 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
604 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
605 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
606 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
607 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
608 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
609 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
610 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
611 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
612 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
613 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
614 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
615 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
616 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
617 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
618 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
619 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
620 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
621 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
622 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
623 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
624 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
625 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
626 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
627 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
628 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
629 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
630 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
631 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
632 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
633 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
634 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
635 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
636 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
637 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
638 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
639 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
640 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
641 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
642 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
643 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
644 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
645 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
646 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
647 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
648 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
649 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
650 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
651 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
652 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
653 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
654 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
655 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
656 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
657 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
658 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
659 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
660 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
661 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
662 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
663 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
664 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
665 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
666 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
667 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
668 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
669 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
670 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
671 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
672 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
673 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
674 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
675 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 40.47
Metatranscriptomes 0.12
Isolates 59.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.88
Nodule 53.41
Rhizoplane 1.76
Rhizosphere 28.47
Stem 0
Stem Tuber 0
Unclassified 8.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25157J39369_1000447 3300002741 Bacteria 26448
2 JGI25406J46586_10005473 3300003203 Bacteria 5889
3 JGI25165J46597_1000070 3300003214 Bacteria 193557
4 JGI25160J50197_1000002 3300003354 Bacteria 561707
5 Ga0055526_1009355 3300003771 Bacteria 4727
6 Ga0055524_1044712 3300003775 Bacteria 1074
7 Ga0055536_1001370 3300003781 Bacteria 14808
8 Ga0055531_10028993 3300003794 Bacteria 1894
9 Ga0055543_1000306 3300004625 Bacteria 34217
10 Ga0065165_1000058 3300005262 Bacteria 184784
11 Ga0070658_10095915 3300005327 Bacteria 2448
12 Ga0070669_100290272 3300005353 Bacteria 1313
13 Ga0070674_100213010 3300005356 Bacteria 1499
14 Ga0070673_100917602 3300005364 Bacteria 813
15 Ga0070659_100373090 3300005366 Bacteria 1200
16 Ga0068853_100079674 3300005539 Bacteria 2864
17 Ga0068853_100123555 3300005539 Bacteria 2311
18 Ga0070665_100108101 3300005548 Bacteria 2784
19 Ga0068855_100631248 3300005563 Bacteria 1152
20 Ga0068856_100284631 3300005614 Bacteria 1670
21 Ga0081539_10003346 3300005985 Bacteria 19920
22 Ga0075365_10092955 3300006038 Bacteria 2057
23 Ga0075365_10184227 3300006038 Bacteria 1460
24 Ga0075365_10266059 3300006038 Bacteria 1206
25 Ga0075368_10001439 3300006042 Bacteria 7611
26 Ga0075368_10253326 3300006042 Bacteria 752
27 Ga0075363_100009749 3300006048 Bacteria 4524
28 Ga0075363_100060285 3300006048 Bacteria 2042
29 Ga0075364_10010273 3300006051 Bacteria 5650
30 Ga0075364_10648888 3300006051 Bacteria 721
31 Ga0075362_10137361 3300006177 Bacteria 1167
32 Ga0075362_10164017 3300006177 Bacteria 1071
33 Ga0075367_10003469 3300006178 Bacteria 7527
34 Ga0075367_10011845 3300006178 Bacteria 4631
35 Ga0075367_10163013 3300006178 Bacteria 1387
36 Ga0075369_10001660 3300006186 Bacteria 7672
37 Ga0075369_10021510 3300006186 Bacteria 2652
38 Ga0075370_10009111 3300006353 Bacteria 5136
39 Ga0075370_10078798 3300006353 Bacteria 1892
40 Ga0079104_1002413 3300006946 Bacteria 10126
41 Ga0079104_1009146 3300006946 Bacteria 3380
42 Ga0105240_10161867 3300009093 Bacteria 2657
43 Ga0105240_10170657 3300009093 Bacteria 2577
44 Ga0105245_10139457 3300009098 Bacteria 2282
45 Ga0105243_10475877 3300009148 Bacteria 1178
46 Ga0105241_10055488 3300009174 Bacteria 3035
47 Ga0105237_10074211 3300009545 Bacteria 3393
48 Ga0105237_10682819 3300009545 Bacteria 1034
49 Ga0105238_10007521 3300009551 Bacteria 10910
50 Ga0105249_10617665 3300009553 Bacteria 1140
51 Ga0105239_10025032 3300010375 Bacteria 6576
52 Ga0105239_10211515 3300010375 Bacteria 2174
53 Ga0105239_10525332 3300010375 Bacteria 1347
54 Ga0105239_10863054 3300010375 Bacteria 1038
55 Ga0105239_12320265 3300010375 Bacteria 624
56 Ga0157370_10207966 3300013104 Bacteria 1814
57 Ga0157370_10310372 3300013104 Bacteria 1455
58 Ga0157369_10139711 3300013105 Bacteria 2564
59 Ga0157378_10621747 3300013297 Bacteria 1093
60 Ga0157380_10659433 3300014326 Bacteria 1045
61 Ga0182008_10247166 3300014497 Bacteria 919
62 Ga0182007_10047860 3300015262 Bacteria 1413
63 Ga0183365_10597 3300015684 Bacteria 1219
64 Ga0183363_1163 3300015690 Bacteria 15411
65 Ga0163161_10280018 3300017792 Bacteria 1308
66 Ga0163161_11042287 3300017792 Bacteria 700
67 Ga0214544_1000008 3300021320 Bacteria 326027
68 Ga0214542_1000010 3300021321 Bacteria 262816
69 Ga0214543_1000003 3300021327 Bacteria 692327
70 Ga0214543_1000004 3300021327 Bacteria 527190
71 Ga0228711_1000137 3300022739 Bacteria 66265
72 Ga0228710_1000031 3300022740 Bacteria 95534
73 Ga0209436_100128 3300025208 Bacteria 37455
74 Ga0209026_1000002 3300025250 Bacteria 1136158
75 Ga0209148_1000123 3300025254 Bacteria 185406
76 Ga0209759_1000381 3300025256 Bacteria 55381
77 Ga0209233_1000131 3300025261 Bacteria 205257
78 Ga0209233_1008273 3300025261 Bacteria 3232
79 Ga0209455_1000129 3300025272 Bacteria 161691
80 Ga0209130_1000008 3300025284 Bacteria 581232
81 Ga0209676_1002487 3300025292 Bacteria 12955
82 Ga0209025_1000956 3300025294 Bacteria 43592
83 Ga0209564_1000091 3300025295 Bacteria 249103
84 Ga0209758_1006066 3300025297 Bacteria 8906
85 Ga0209758_1023562 3300025297 Bacteria 2780
86 Ga0209050_1005659 3300025298 Bacteria 7737
87 Ga0209256_1003090 3300025299 Bacteria 12218
88 Ga0207426_1000016 3300025302 Bacteria 581232
89 Ga0209051_1006780 3300025303 Bacteria 6383
90 Ga0209257_1003908 3300025304 Bacteria 12125
91 Ga0207647_10006200 3300025904 Bacteria 8713
92 Ga0207647_10027535 3300025904 Bacteria 3705
93 Ga0207705_10091952 3300025909 Bacteria 2223
94 Ga0207695_10135869 3300025913 Bacteria 2412
95 Ga0207695_10281109 3300025913 Bacteria 1558
96 Ga0207695_10439553 3300025913 Bacteria 1188
97 Ga0207695_10455735 3300025913 Bacteria 1162
98 Ga0207671_10013865 3300025914 Bacteria 6400
99 Ga0207671_10545458 3300025914 Bacteria 924
100 Ga0207694_10146655 3300025924 Bacteria 1900
101 Ga0207694_10801987 3300025924 Bacteria 795
102 Ga0207669_10171165 3300025937 Bacteria 1546
103 Ga0207639_10040735 3300026041 Bacteria 3469
104 Ga0207639_10737318 3300026041 Bacteria 915
105 Ga0207702_10284594 3300026078 Bacteria 1564
106 Ga0207674_10079771 3300026116 Bacteria 3276
107 Ga0207675_100027553 3300026118 Bacteria 5292
108 Ga0209281_1000155 3300027111 Bacteria 164423
109 Ga0209281_1001059 3300027111 Bacteria 20700
110 Ga0209282_1000025 3300027666 Bacteria 168676
111 Ga0209813_10006201 3300027866 Bacteria 2945
112 Ga0268266_10083937 3300028379 Bacteria 2781
113 Ga0268266_10233174 3300028379 Bacteria 1696
114 Ga0307515_10000154 3300028794 Bacteria 166582
115 Ga0307515_10008850 3300028794 Bacteria 19546
116 Ga0307515_10261289 3300028794 Bacteria 1467
117 Ga0307513_10001054 3300031456 Bacteria 40089
118 Ga0307412_10261316 3300031911 Bacteria 1350
119 Ga0307412_10392654 3300031911 Bacteria 1127
120 Ga0315914_1000620 3300031967 Bacteria 46971
121 Ga0307416_100610119 3300032002 Bacteria 1172
122 Ga0316593_10045409 3300032168 Bacteria 1472
123 Ga0315913_1000150 3300033430 Bacteria 47059
124 Ga0315915_1000015 3300033464 Bacteria 168491
125 Ga0316574_0417182 3300035398 Bacteria 844
126 Ga0316582_0075988 3300036647 Bacteria 2183
127 Ga0316584_0250718 3300036712 Bacteria 1293
128 Ga0395899_0000073 3300037312 Bacteria 181387
129 Ga0395899_0093240 3300037312 Bacteria 2180
130 Ga0395900_0000027 3300037418 Bacteria 285957
131 Ga0395900_0027106 3300037418 Bacteria 5866
132 Ga0395900_0042607 3300037418 Bacteria 4678
133 Ga0395900_0046988 3300037418 Bacteria 4445
134 Ga0395898_0000255 3300037466 Bacteria 131017
135 Ga0395898_0389364 3300037466 Bacteria 1329
136 Ga0395905_0000032 3300037471 Bacteria 285932
137 Ga0395905_0019317 3300037471 Bacteria 6461
138 Ga0395905_0338771 3300037471 Bacteria 1395
139 Ga0395905_0387328 3300037471 Bacteria 1292
140 Ga0395905_0768327 3300037471 Bacteria 866
141 Ga0395901_0000110 3300038443 Bacteria 112682
142 Ga0395901_0046591 3300038443 Bacteria 4504
143 Ga0395901_0057769 3300038443 Bacteria 4035
144 Ga0395901_0131007 3300038443 Bacteria 2635
145 Ga0395901_0488863 3300038443 Bacteria 1254
146 Ga0395901_1013721 3300038443 Bacteria 805
147 Ga0439438_088036 3300041405 Bacteria 758
148 Ga0451793_0240457 3300041452 Bacteria 1080
149 Ga0451855_0305276 3300041511 Bacteria 594
150 Ga0439445_0081298 3300042004 Bacteria 905
151 Ga0439449_0003709 3300042007 Bacteria 5925
152 Ga0439449_0062432 3300042007 Bacteria 1374
153 Ga0466960_0052067 3300044901 Bacteria 1979
154 Ga0495638_0006132 3300046460 Bacteria 8795
155 Ga0495638_0119176 3300046460 Bacteria 1561
156 Ga0495637_0122161 3300046520 Bacteria 1001
157 Ga0495643_0088549 3300046522 Bacteria 1600
158 Ga0495648_0294686 3300046524 Bacteria 763
159 Ga0495670_0021622 3300046691 Bacteria 3174
160 Ga0495660_0234307 3300046810 Bacteria 859
161 Ga0495676_0231892 3300047321 Bacteria 1268
162 Ga0495681_0044497 3300047470 Bacteria 2133
163 Ga0495686_0173026 3300047472 Bacteria 1255
164 Ga0496102_0092038 3300048905 Bacteria 2808
165 Ga0496103_0207909 3300048906 Bacteria 1259
166 Ga0496106_0741651 3300048909 Bacteria 781
167 Ga0496108_0161116 3300048911 Bacteria 1939
168 Ga0496109_0407276 3300048912 Bacteria 1285
169 Ga0496112_0476133 3300048915 Bacteria 1185
170 Ga0496112_0801701 3300048915 Bacteria 866
171 Ga0496113_0141688 3300048916 Bacteria 1892
172 Ga0496113_0596114 3300048916 Bacteria 885
173 Ga0496115_0486398 3300048918 Bacteria 993
174 Ga0496115_0516257 3300048918 Bacteria 958
175 Ga0496118_0132255 3300048921 Bacteria 1600
176 Ga0496119_0068437 3300048922 Bacteria 2090
177 Ga0496120_0005603 3300048923 Bacteria 9949
178 Ga0496120_0152627 3300048923 Bacteria 1159
179 Ga0496121_0206346 3300048924 Bacteria 1396
180 Ga0496122_0399273 3300048925 Bacteria 699
181 Ga0496125_0284127 3300048928 Bacteria 1023
182 Ga0496126_0190705 3300048929 Bacteria 1736
183 Ga0496126_0606100 3300048929 Bacteria 862
184 Ga0501031_0020213 3300049568 Bacteria 4341
185 Ga0501031_0047010 3300049568 Bacteria 2814
186 Ga0501031_0050394 3300049568 Bacteria 2712
187 Ga0501031_0076167 3300049568 Bacteria 2184
188 Ga0501031_0275123 3300049568 Bacteria 1093
189 Ga0501031_0278089 3300049568 Bacteria 1086
190 Ga0501031_0385628 3300049568 Bacteria 906
191 Ga0501032_0000081 3300049569 Bacteria 82613
192 Ga0501032_0000116 3300049569 Bacteria 67350
193 Ga0501032_0033707 3300049569 Bacteria 3507
194 Ga0501032_0037313 3300049569 Bacteria 3314
195 Ga0501032_0046609 3300049569 Bacteria 2929
196 Ga0501032_0088912 3300049569 Bacteria 2051
197 Ga0501032_0231339 3300049569 Bacteria 1202
198 Ga0501032_0446993 3300049569 Bacteria 828
199 Ga0501032_0527791 3300049569 Bacteria 753
200 Ga0501033_0000097 3300049570 Bacteria 83228
201 Ga0501033_0000501 3300049570 Bacteria 36835
202 Ga0501033_0001994 3300049570 Bacteria 17795
203 Ga0501033_0003939 3300049570 Bacteria 12043
204 Ga0501033_0011792 3300049570 Bacteria 6681
205 Ga0501033_0051935 3300049570 Bacteria 3038
206 Ga0501033_0052388 3300049570 Bacteria 3025
207 Ga0501033_0116853 3300049570 Bacteria 1938
208 Ga0501033_0185335 3300049570 Bacteria 1491
209 Ga0501033_0267328 3300049570 Bacteria 1209
210 Ga0501033_0286940 3300049570 Bacteria 1161
211 Ga0501033_0404655 3300049570 Bacteria 951
212 Ga0501033_0708521 3300049570 Bacteria 684
213 Ga0501034_0000186 3300049571 Bacteria 116500
214 Ga0501034_0003453 3300049571 Bacteria 18014
215 Ga0501034_0004432 3300049571 Bacteria 15628
216 Ga0501034_0021271 3300049571 Bacteria 6615
217 Ga0501034_0215003 3300049571 Bacteria 1876
218 Ga0501034_0234953 3300049571 Bacteria 1781
219 Ga0501034_0267581 3300049571 Bacteria 1651
220 Ga0501034_0418751 3300049571 Bacteria 1261
221 Ga0501034_0567156 3300049571 Bacteria 1043
222 Ga0501034_0843928 3300049571 Bacteria 807
223 Ga0501036_0000002 3300049572 Bacteria 293106
224 Ga0501036_0001125 3300049572 Bacteria 20339
225 Ga0501036_0039433 3300049572 Bacteria 3996
226 Ga0501036_0414854 3300049572 Bacteria 1123
227 Ga0501036_0650940 3300049572 Bacteria 872
228 Ga0501037_0000095 3300049573 Bacteria 82641
229 Ga0501037_0000108 3300049573 Bacteria 77753
230 Ga0501037_0000451 3300049573 Bacteria 33602
231 Ga0501037_0131132 3300049573 Bacteria 1797
232 Ga0501038_0000002 3300049574 Bacteria 330446
233 Ga0501038_0000126 3300049574 Bacteria 64756
234 Ga0501038_0063134 3300049574 Bacteria 3163
235 Ga0501038_0067643 3300049574 Bacteria 3038
236 Ga0501038_0071665 3300049574 Bacteria 2938
237 Ga0501038_0077899 3300049574 Bacteria 2798
238 Ga0501038_0078411 3300049574 Bacteria 2787
239 Ga0501039_0000002 3300049575 Bacteria 375152
240 Ga0501039_0000003 3300049575 Bacteria 357424
241 Ga0501039_0187939 3300049575 Bacteria 1624
242 Ga0501039_0211894 3300049575 Bacteria 1523
243 Ga0501040_0003171 3300049576 Bacteria 10652
244 Ga0501042_0078294 3300049578 Bacteria 2368
245 Ga0501043_0000081 3300049579 Bacteria 85059
246 Ga0501043_0000140 3300049579 Bacteria 67478
247 Ga0501043_0000162 3300049579 Bacteria 60676
248 Ga0501043_0095551 3300049579 Bacteria 2336
249 Ga0501043_0104122 3300049579 Bacteria 2230
250 Ga0501043_0169788 3300049579 Bacteria 1702
251 Ga0501043_0457414 3300049579 Bacteria 958
252 Ga0501046_0023471 3300049580 Bacteria 5074
253 Ga0501046_0147873 3300049580 Bacteria 1773
254 Ga0501046_0271654 3300049580 Bacteria 1243
255 Ga0501047_0001069 3300049581 Bacteria 27308
256 Ga0501047_0005496 3300049581 Bacteria 11927
257 Ga0501047_0013509 3300049581 Bacteria 7741
258 Ga0501047_0053713 3300049581 Bacteria 3896
259 Ga0501047_0123024 3300049581 Bacteria 2475
260 Ga0501047_0317862 3300049581 Bacteria 1397
261 Ga0501047_0499200 3300049581 Bacteria 1043
262 Ga0501047_0513635 3300049581 Bacteria 1024
263 Ga0501067_0058678 3300049583 Bacteria 2131
264 Ga0501067_0084208 3300049583 Bacteria 1764
265 Ga0501068_0019640 3300049584 Bacteria 3927
266 Ga0501068_0067416 3300049584 Bacteria 2181
267 Ga0501069_0000118 3300049585 Bacteria 35026
268 Ga0501069_0029569 3300049585 Bacteria 3007
269 Ga0501070_0002038 3300049586 Bacteria 17765
270 Ga0501070_0002088 3300049586 Bacteria 17529
271 Ga0501070_0002773 3300049586 Bacteria 15291
272 Ga0501070_0016450 3300049586 Bacteria 6216
273 Ga0501070_0049174 3300049586 Bacteria 3502
274 Ga0501070_0050792 3300049586 Bacteria 3441
275 Ga0501070_0110816 3300049586 Bacteria 2268
276 Ga0501070_0117985 3300049586 Bacteria 2192
277 Ga0501070_0180593 3300049586 Bacteria 1737
278 Ga0501070_0180900 3300049586 Bacteria 1735
279 Ga0501071_0032926 3300049587 Bacteria 3682
280 Ga0501071_0043090 3300049587 Bacteria 3235
281 Ga0501073_0018852 3300049589 Bacteria 4986
282 Ga0501073_0051879 3300049589 Bacteria 2873
283 Ga0501073_0093871 3300049589 Bacteria 2084
284 Ga0501074_0000062 3300049590 Bacteria 51831
285 Ga0501074_0014987 3300049590 Bacteria 5642
286 Ga0501074_0085970 3300049590 Bacteria 2253
287 Ga0501079_0957325 3300049741 Bacteria 674
288 Ga0501080_0000254 3300049742 Bacteria 40217
289 Ga0501080_0016280 3300049742 Bacteria 6865
290 Ga0501080_0037279 3300049742 Bacteria 4540
291 Ga0501080_0059987 3300049742 Bacteria 3540
292 Ga0501080_0608901 3300049742 Bacteria 969
293 Ga0501083_0000453 3300049744 Bacteria 26265
294 Ga0501035_0000017 3300049822 Bacteria 241915
295 Ga0501035_0000100 3300049822 Bacteria 107321
296 Ga0501035_0000895 3300049822 Bacteria 31521
297 Ga0501035_0001153 3300049822 Bacteria 27594
298 Ga0501035_0001764 3300049822 Bacteria 21833
299 Ga0501035_0003584 3300049822 Bacteria 14832
300 Ga0501035_0032885 3300049822 Bacteria 4716
301 Ga0501035_0085431 3300049822 Bacteria 2781
302 Ga0501035_0086759 3300049822 Bacteria 2757
303 Ga0501035_0316305 3300049822 Bacteria 1312
304 Ga0501044_0000002 3300049823 Bacteria 375152
305 Ga0501044_0000751 3300049823 Bacteria 39231
306 Ga0501044_0007931 3300049823 Bacteria 11669
307 Ga0501044_0019122 3300049823 Bacteria 7333
308 Ga0501044_0021530 3300049823 Bacteria 6876
309 Ga0501044_0038386 3300049823 Bacteria 5001
310 Ga0501044_0047079 3300049823 Bacteria 4461
311 Ga0501044_0108794 3300049823 Bacteria 2781
312 Ga0501044_0168991 3300049823 Bacteria 2159
313 Ga0501044_0286715 3300049823 Bacteria 1579
314 Ga0501044_0423824 3300049823 Bacteria 1240
315 Ga0501044_0431691 3300049823 Bacteria 1226
316 Ga0501044_0555498 3300049823 Bacteria 1045
317 Ga0501044_0902010 3300049823 Bacteria 759
318 Ga0501045_0020525 3300049824 Bacteria 4720
319 Ga0501045_0090727 3300049824 Bacteria 2258
320 nmdc:mga03683_79079_c1 3300050489 Bacteria 1417
321 nmdc:mga03n38_143292_c1 3300050490 Bacteria 1196
322 nmdc:mga03n38_144725_c1 3300050490 Bacteria 1190
323 nmdc:mga00v17_129310_c1 3300050491 Bacteria 1613
324 nmdc:mga0yw44_216513_c1 3300050492 Bacteria 1268
325 nmdc:mga0yw44_21673_c1 3300050492 Bacteria 3590
326 nmdc:mga0yw44_234290_c1 3300050492 Bacteria 1219
327 nmdc:mga0yw44_56243_c1 3300050492 Bacteria 2396
328 nmdc:mga06z11_43242_c1 3300050494 Bacteria 2265
329 nmdc:mga06z11_47954_c1 3300050494 Bacteria 2172
330 nmdc:mga04h51_47165_c1 3300050495 Bacteria 1431
331 nmdc:mga07m45_3290_c1 3300050496 Bacteria 7776
332 nmdc:mga07m45_33919_c1 3300050496 Bacteria 2836
333 Ga0500610_0045343 3300053079 Bacteria 2282
334 Ga0500610_0215050 3300053079 Bacteria 915
335 Ga0500643_020686 3300053087 Bacteria 2145
336 Ga0500556_0056626 3300053104 Bacteria 1433
337 Ga0500608_100903 3300053122 Bacteria 1337
338 Ga0500568_0000048 3300053139 Bacteria 119025
339 Ga0500604_0032642 3300053151 Bacteria 1535
340 Ga0500616_0082384 3300053153 Bacteria 1614
341 Ga0500620_000328 3300053155 Bacteria 8982
342 Ga0500620_053342 3300053155 Bacteria 1361
343 Ga0500622_0000251 3300053156 Bacteria 54558
344 Ga0501084_0856837 3300054114 Bacteria 765
345 Ga0501082_0090342 3300060353 Bacteria 2644

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2657244999 2657681988 179
2 iso_pu_bacteria 2802429268 2804751006 179
3 iso_pu_bacteria 8045864390 8045866337 179
4 iso_pu_bacteria 2503198000 2503203113 180
5 iso_pu_bacteria 2508501122 2509107190 180
6 iso_pu_bacteria 2508501123 2509114897 180
7 iso_pu_bacteria 2508501127 2509145496 180
8 iso_pu_bacteria 2509276018 2509372692 180
9 iso_pu_bacteria 2509276019 2509374844 180
10 iso_pu_bacteria 2509276022 2509397573 180
11 iso_pu_bacteria 2510065057 2510304887 180
12 iso_pu_bacteria 2510065059 2510319764 180
13 iso_pu_bacteria 2511231052 2511500676 180
14 iso_pu_bacteria 2512047086 2512532098 180
15 iso_pu_bacteria 2512875016 2512930078 180
16 iso_pu_bacteria 2512875024 2512964756 180
17 iso_pu_bacteria 2512875026 2512972570 180
18 iso_pu_bacteria 2513237086 2513585759 180
19 iso_pu_bacteria 2513237089 2513606656 180
20 iso_pu_bacteria 2513237090 2513614282 180
21 iso_pu_bacteria 2513237091 2513616832 180
22 iso_pu_bacteria 2513237140 2513880754 180
23 iso_pu_bacteria 2513237143 2513903748 180
24 iso_pu_bacteria 2513237156 2513986152 180
25 iso_pu_bacteria 2513237160 2514007566 180
26 iso_pu_bacteria 2513237164 2514033138 180
27 iso_pu_bacteria 2513237305 2514419976 180
28 iso_pu_bacteria 2513237351 2514589713 180
29 iso_pu_bacteria 2515154107 2515607811 180
30 iso_pu_bacteria 2516143018 2516208554 180
31 iso_pu_bacteria 2516653046 2516891951 180
32 iso_pu_bacteria 2517487022 2517568763 180
33 iso_pu_bacteria 2524023207 2524450003 180
34 iso_pu_bacteria 2551306084 2551676540 180
35 iso_pu_bacteria 2551306085 2551686932 180
36 iso_pu_bacteria 2551306086 2551695770 180
37 iso_pu_bacteria 2551306087 2551699848 180
38 iso_pu_bacteria 2551306089 2551709879 180
39 iso_pu_bacteria 2551306090 2551723497 180
40 iso_pu_bacteria 2551306091 2551728082 180
41 iso_pu_bacteria 2551306092 2551738953 180
42 iso_pu_bacteria 2588253730 2588515695 180
43 iso_pu_bacteria 2597489875 2597814864 180
44 iso_pu_bacteria 2599185301 2599940982 180
45 iso_pu_bacteria 2599185352 2600191552 180
46 iso_pu_bacteria 2643221551 2643775729 180
47 iso_pu_bacteria 2643221555 2643794176 180
48 iso_pu_bacteria 2643221564 2643837254 180
49 iso_pu_bacteria 2643221595 2643986594 180
50 iso_pu_bacteria 2643221618 2644103090 180
51 iso_pu_bacteria 2643221623 2644133011 180
52 iso_pu_bacteria 2643221626 2644151981 180
53 iso_pu_bacteria 2643221627 2644157528 180
54 iso_pu_bacteria 2643221655 2644306017 180
55 iso_pu_bacteria 2643221659 2644330325 180
56 iso_pu_bacteria 2643221698 2644542928 180
57 iso_pu_bacteria 2643221712 2644619032 180
58 iso_pu_bacteria 2643221723 2644673935 180
59 iso_pu_bacteria 2687453392 2688599972 180
60 iso_pu_bacteria 2693429783 2694634074 180
61 iso_pu_bacteria 2693429784 2694638555 180
62 iso_pu_bacteria 2721755686 2723576799 180
63 iso_pu_bacteria 2738543024 2739306365 180
64 iso_pu_bacteria 2756170246 2756673473 180
65 iso_pu_bacteria 2757320392 2757569267 180
66 iso_pu_bacteria 2767802442 2770194742 180
67 iso_pu_bacteria 2775506902 2776272469 180
68 iso_pu_bacteria 2775506904 2776284409 180
69 iso_pu_bacteria 2791355082 2792583840 180
70 iso_pu_bacteria 2791355091 2792622360 180
71 iso_pu_bacteria 2791355092 2792628074 180
72 iso_pu_bacteria 2791355094 2792638671 180
73 iso_pu_bacteria 2791355123 2792748959 180
74 iso_pu_bacteria 2802428858 2802717408 180
75 iso_pu_bacteria 2802428859 2802723666 180
76 iso_pu_bacteria 2802428860 2802730886 180
77 iso_pu_bacteria 2802428861 2802735893 180
78 iso_pu_bacteria 2802428862 2802743898 180
79 iso_pu_bacteria 2802428863 2802752884 180
80 iso_pu_bacteria 2838074704 2838075456 180
81 iso_pu_bacteria 2839993093 2839994297 180
82 iso_pu_bacteria 2840764183 2840769292 180
83 iso_pu_bacteria 2841734538 2841740954 180
84 iso_pu_bacteria 2844002411 2844005934 180
85 iso_pu_bacteria 2844009547 2844015241 180
86 iso_pu_bacteria 2844163670 2844170653 180
87 iso_pu_bacteria 2847670302 2847671236 180
88 iso_pu_bacteria 2850079185 2850080126 180
89 iso_pu_bacteria 2855825444 2855831869 180
90 iso_pu_bacteria 2855839649 2855840156 180
91 iso_pu_bacteria 2856314179 2856316748 180
92 iso_pu_bacteria 2856320880 2856324561 180
93 iso_pu_bacteria 2856328259 2856333224 180
94 iso_pu_bacteria 2856334872 2856338667 180
95 iso_pu_bacteria 2856342000 2856348794 180
96 iso_pu_bacteria 2856364286 2856370903 180
97 iso_pu_bacteria 2857349434 2857356519 180
98 iso_pu_bacteria 2857367948 2857374838 180
99 iso_pu_bacteria 2858800743 2858804061 180
100 iso_pu_bacteria 2869169390 2869171211 180
101 iso_pu_bacteria 2869234852 2869235622 180
102 iso_pu_bacteria 2869242130 2869246487 180
103 iso_pu_bacteria 2869256925 2869259558 180
104 iso_pu_bacteria 2869264136 2869269810 180
105 iso_pu_bacteria 2869271264 2869276423 180
106 iso_pu_bacteria 2869278585 2869281437 180
107 iso_pu_bacteria 2869285874 2869292204 180
108 iso_pu_bacteria 2871429161 2871435411 180
109 iso_pu_bacteria 2871444079 2871444404 180
110 iso_pu_bacteria 2871451962 2871458520 180
111 iso_pu_bacteria 2871459585 2871465433 180
112 iso_pu_bacteria 2871466892 2871472771 180
113 iso_pu_bacteria 2871474448 2871479007 180
114 iso_pu_bacteria 2871481445 2871486402 180
115 iso_pu_bacteria 2871488783 2871489311 180
116 iso_pu_bacteria 2871495908 2871497659 180
117 iso_pu_bacteria 2874109183 2874114723 180
118 iso_pu_bacteria 2874116593 2874118884 180
119 iso_pu_bacteria 2874123672 2874131201 180
120 iso_pu_bacteria 2874131515 2874131847 180
121 iso_pu_bacteria 2874139085 2874140897 180
122 iso_pu_bacteria 2874146452 2874155113 180
123 iso_pu_bacteria 2874155637 2874161431 180
124 iso_pu_bacteria 2874162495 2874166928 180
125 iso_pu_bacteria 2874168670 2874170460 180
126 iso_pu_bacteria 2876363079 2876366358 180
127 iso_pu_bacteria 2876377896 2876384168 180
128 iso_pu_bacteria 2876386047 2876391935 180
129 iso_pu_bacteria 2876399893 2876404670 180
130 iso_pu_bacteria 2876406927 2876408765 180
131 iso_pu_bacteria 2876413966 2876420568 180
132 iso_pu_bacteria 2876420981 2876427023 180
133 iso_pu_bacteria 2878035449 2878037090 180
134 iso_pu_bacteria 2878730984 2878737830 180
135 iso_pu_bacteria 2878738818 2878742675 180
136 iso_pu_bacteria 2878745973 2878752546 180
137 iso_pu_bacteria 2878753008 2878753847 180
138 iso_pu_bacteria 2878760144 2878761882 180
139 iso_pu_bacteria 2878767105 2878768788 180
140 iso_pu_bacteria 2878774303 2878780499 180
141 iso_pu_bacteria 2878788777 2878794661 180
142 iso_pu_bacteria 2881147464 2881153006 180
143 iso_pu_bacteria 2881155292 2881156776 180
144 iso_pu_bacteria 2881161766 2881162192 180
145 iso_pu_bacteria 2881845957 2881846677 180
146 iso_pu_bacteria 2881861095 2881866172 180
147 iso_pu_bacteria 2882632389 2882635510 180
148 iso_pu_bacteria 2882912400 2882916909 180
149 iso_pu_bacteria 2885305155 2885311039 180
150 iso_pu_bacteria 2885312484 2885316528 180
151 iso_pu_bacteria 2885318864 2885322937 180
152 iso_pu_bacteria 2885326080 2885331534 180
153 iso_pu_bacteria 2885342637 2885347230 180
154 iso_pu_bacteria 2888337043 2888341149 180
155 iso_pu_bacteria 2888343758 2888348350 180
156 iso_pu_bacteria 2888350351 2888357356 180
157 iso_pu_bacteria 2889010040 2889012313 180
158 iso_pu_bacteria 2889016732 2889022794 180
159 iso_pu_bacteria 2894652903 2894655326 180
160 iso_pu_bacteria 2896384573 2896385439 180
161 iso_pu_bacteria 2903448605 2903452618 180
162 iso_pu_bacteria 2903492973 2903497191 180
163 iso_pu_bacteria 2903492973 2903505281 180
164 iso_pu_bacteria 2903521522 2903524226 180
165 iso_pu_bacteria 2903528002 2903533591 180
166 iso_pu_bacteria 2903540706 2903542457 180
167 iso_pu_bacteria 2904578770 2904579028 180
168 iso_pu_bacteria 2904659560 2904662234 180
169 iso_pu_bacteria 2906308376 2906314940 180
170 iso_pu_bacteria 2906321335 2906328112 180
171 iso_pu_bacteria 2906328253 2906332605 180
172 iso_pu_bacteria 2906354277 2906358139 180
173 iso_pu_bacteria 2906363423 2906365612 180
174 iso_pu_bacteria 2906370794 2906373493 180
175 iso_pu_bacteria 2906386501 2906389622 180
176 iso_pu_bacteria 2906393657 2906395132 180
177 iso_pu_bacteria 2906401398 2906403877 180
178 iso_pu_bacteria 2906408224 2906412315 180
179 iso_pu_bacteria 2906414383 2906416886 180
180 iso_pu_bacteria 2906427513 2906434737 180
181 iso_pu_bacteria 2913295892 2913297890 180
182 iso_pu_bacteria 2915980308 2915982332 180
183 iso_pu_bacteria 2915986958 2915989363 180
184 iso_pu_bacteria 2915993759 2915999536 180
185 iso_pu_bacteria 2916000859 2916001489 180
186 iso_pu_bacteria 2916007675 2916010944 180
187 iso_pu_bacteria 2916014648 2916015288 180
188 iso_pu_bacteria 2916021584 2916022187 180
189 iso_pu_bacteria 2916028427 2916029465 180
190 iso_pu_bacteria 2916035215 2916041483 180
191 iso_pu_bacteria 2916041962 2916045888 180
192 iso_pu_bacteria 2916048683 2916051648 180
193 iso_pu_bacteria 2916055098 2916061796 180
194 iso_pu_bacteria 2916061851 2916062669 180
195 iso_pu_bacteria 2916068649 2916069529 180
196 iso_pu_bacteria 2916076590 2916082733 180
197 iso_pu_bacteria 2919119836 2919122145 180
198 iso_pu_bacteria 2920760137 2920763230 180
199 iso_pu_bacteria 2920822456 2920823469 180
200 iso_pu_bacteria 2921201388 2921205692 180
201 iso_pu_bacteria 2921237296 2921237737 180
202 iso_pu_bacteria 2921244191 2921250554 180
203 iso_pu_bacteria 2921250672 2921256552 180
204 iso_pu_bacteria 2921257292 2921258006 180
205 iso_pu_bacteria 2921263974 2921264524 180
206 iso_pu_bacteria 2921282425 2921284155 180
207 iso_pu_bacteria 2921289301 2921295737 180
208 iso_pu_bacteria 2921296804 2921303652 180
209 iso_pu_bacteria 2922130491 2922137276 180
210 iso_pu_bacteria 2922151315 2922151963 180
211 iso_pu_bacteria 2922158528 2922159915 180
212 iso_pu_bacteria 2922172374 2922175158 180
213 iso_pu_bacteria 2922178524 2922180246 180
214 iso_pu_bacteria 2922185730 2922189942 180
215 iso_pu_bacteria 2924144063 2924150533 180
216 iso_pu_bacteria 2924150972 2924151725 180
217 iso_pu_bacteria 2924158325 2924161348 180
218 iso_pu_bacteria 2924165586 2924169543 180
219 iso_pu_bacteria 2924172951 2924173907 180
220 iso_pu_bacteria 2924179722 2924180402 180
221 iso_pu_bacteria 2924186466 2924190515 180
222 iso_pu_bacteria 2924193448 2924199766 180
223 iso_pu_bacteria 2924200457 2924206738 180
224 iso_pu_bacteria 2924207177 2924213675 180
225 iso_pu_bacteria 2924214083 2924219060 180
226 iso_pu_bacteria 2924221636 2924225529 180
227 iso_pu_bacteria 2924228884 2924229509 180
228 iso_pu_bacteria 2924718760 2924720769 180
229 iso_pu_bacteria 2924726620 2924727722 180
230 iso_pu_bacteria 2924733363 2924735224 180
231 iso_pu_bacteria 2924741084 2924743152 180
232 iso_pu_bacteria 2924754689 2924762511 180
233 iso_pu_bacteria 2924762789 2924765778 180
234 iso_pu_bacteria 2924776078 2924780475 180
235 iso_pu_bacteria 2924784321 2924791899 180
236 iso_pu_bacteria 2936996657 2936999793 180
237 iso_pu_bacteria 2937002841 2937009411 180
238 iso_pu_bacteria 2937009748 2937016016 180
239 iso_pu_bacteria 2937016420 2937022457 180
240 iso_pu_bacteria 2937023124 2937026797 180
241 iso_pu_bacteria 2937029754 2937030153 180
242 iso_pu_bacteria 2937036028 2937037855 180
243 iso_pu_bacteria 2937042894 2937046550 180
244 iso_pu_bacteria 2937049772 2937052752 180
245 iso_pu_bacteria 2937056579 2937060893 180
246 iso_pu_bacteria 2937063883 2937070686 180
247 iso_pu_bacteria 2937071275 2937078342 180
248 iso_pu_bacteria 2937078374 2937080228 180
249 iso_pu_bacteria 2937084907 2937088959 180
250 iso_pu_bacteria 2937091812 2937094626 180
251 iso_pu_bacteria 2937098957 2937100004 180
252 iso_pu_bacteria 2937106411 2937109653 180
253 iso_pu_bacteria 2937113482 2937117025 180
254 iso_pu_bacteria 2937119839 2937125645 180
255 iso_pu_bacteria 2937126314 2937132371 180
256 iso_pu_bacteria 2937813078 2937821339 180
257 iso_pu_bacteria 2937822353 2937823185 180
258 iso_pu_bacteria 2937836603 2937838988 180
259 iso_pu_bacteria 2937843397 2937844240 180
260 iso_pu_bacteria 2937848649 2937855291 180
261 iso_pu_bacteria 2937861824 2937865891 180
262 iso_pu_bacteria 2937868953 2937872725 180
263 iso_pu_bacteria 2937877337 2937882999 180
264 iso_pu_bacteria 2937891427 2937896223 180
265 iso_pu_bacteria 2937972304 2937973751 180
266 iso_pu_bacteria 2937980651 2937981983 180
267 iso_pu_bacteria 2937994558 2937996250 180
268 iso_pu_bacteria 2938014810 2938016677 180
269 iso_pu_bacteria 2941499720 2941500623 180
270 iso_pu_bacteria 2954011201 2954014726 180
271 iso_pu_bacteria 2957375807 2957381383 180
272 iso_pu_bacteria 2957382221 2957388122 180
273 iso_pu_bacteria 2957388812 2957392622 180
274 iso_pu_bacteria 2957395598 2957398488 180
275 iso_pu_bacteria 2957402308 2957408178 180
276 iso_pu_bacteria 2957408893 2957414625 180
277 iso_pu_bacteria 2957415311 2957415662 180
278 iso_pu_bacteria 2957422303 2957427213 180
279 iso_pu_bacteria 2957430029 2957433800 180
280 iso_pu_bacteria 2957437181 2957443609 180
281 iso_pu_bacteria 2957443900 2957446386 180
282 iso_pu_bacteria 2957450854 2957457269 180
283 iso_pu_bacteria 2957457609 2957458177 180
284 iso_pu_bacteria 2957464669 2957470712 180
285 iso_pu_bacteria 2957471148 2957474776 180
286 iso_pu_bacteria 2957478035 2957484758 180
287 iso_pu_bacteria 2957484790 2957488381 180
288 iso_pu_bacteria 2957491536 2957495465 180
289 iso_pu_bacteria 2957498199 2957502235 180
290 iso_pu_bacteria 2957505466 2957509324 180
291 iso_pu_bacteria 2958034702 2958037399 180
292 iso_pu_bacteria 2958041894 2958047111 180
293 iso_pu_bacteria 2958064165 2958069644 180
294 iso_pu_bacteria 2958071322 2958076600 180
295 iso_pu_bacteria 2958084443 2958090125 180
296 iso_pu_bacteria 2958092219 2958094203 180
297 iso_pu_bacteria 2958100919 2958106484 180
298 iso_pu_bacteria 2958108152 2958110037 180
299 iso_pu_bacteria 2958122699 2958122873 180
300 iso_pu_bacteria 2958130278 2958136604 180
301 iso_pu_bacteria 2958137437 2958137455 180
302 iso_pu_bacteria 2958144490 2958150616 180
303 iso_pu_bacteria 2958158011 2958159643 180
304 iso_pu_bacteria 2958165035 2958166719 180
305 iso_pu_bacteria 2958172287 2958174174 180
306 iso_pu_bacteria 2958179912 2958186098 180
307 iso_pu_bacteria 2960584000 2960586276 180
308 iso_pu_bacteria 2960591022 2960593683 180
309 iso_pu_bacteria 2960597568 2960603159 180
310 iso_pu_bacteria 2960603979 2960604451 180
311 iso_pu_bacteria 2960610863 2960614863 180
312 iso_pu_bacteria 2960617483 2960621113 180
313 iso_pu_bacteria 2960624210 2960625604 180
314 iso_pu_bacteria 2960631154 2960633007 180
315 iso_pu_bacteria 2960637947 2960638265 180
316 iso_pu_bacteria 2960645483 2960650356 180
317 iso_pu_bacteria 2960652885 2960653636 180
318 iso_pu_bacteria 2960660292 2960664712 180
319 iso_pu_bacteria 2960667422 2960668332 180
320 iso_pu_bacteria 2960674078 2960675893 180
321 iso_pu_bacteria 2960680706 2960685556 180
322 iso_pu_bacteria 2960687367 2960691610 180
323 iso_pu_bacteria 2960693952 2960694924 180
324 iso_pu_bacteria 2961077736 2961084580 180
325 iso_pu_bacteria 2961114664 2961117388 180
326 iso_pu_bacteria 2961127735 2961129073 180
327 iso_pu_bacteria 2961136820 2961137784 180
328 iso_pu_bacteria 2961163497 2961165189 180
329 iso_pu_bacteria 2961170736 2961171547 180
330 iso_pu_bacteria 2963644680 2963649154 180
331 iso_pu_bacteria 2964607997 2964615235 180
332 iso_pu_bacteria 2964615318 2964616690 180
333 iso_pu_bacteria 2964621998 2964622650 180
334 iso_pu_bacteria 2964628898 2964633620 180
335 iso_pu_bacteria 2964636051 2964638222 180
336 iso_pu_bacteria 2964643177 2964649573 180
337 iso_pu_bacteria 2964649959 2964653538 180
338 iso_pu_bacteria 2964656573 2964657607 180
339 iso_pu_bacteria 2964663802 2964670447 180
340 iso_pu_bacteria 2964670856 2964677990 180
341 iso_pu_bacteria 2964678106 2964681369 180
342 iso_pu_bacteria 2964685014 2964685485 180
343 iso_pu_bacteria 2964691889 2964692255 180
344 iso_pu_bacteria 2964698721 2964699879 180
345 iso_pu_bacteria 2964705432 2964712576 180
346 iso_pu_bacteria 2964712639 2964715712 180
347 iso_pu_bacteria 2964719344 2964725164 180
348 iso_pu_bacteria 2965018300 2965020011 180
349 iso_pu_bacteria 2965025482 2965030496 180
350 iso_pu_bacteria 2965032056 2965035465 180
351 iso_pu_bacteria 2965040258 2965045947 180
352 iso_pu_bacteria 2965047637 2965054004 180
353 iso_pu_bacteria 2965062239 2965065720 180
354 iso_pu_bacteria 2965089291 2965091453 180
355 iso_pu_bacteria 2965102966 2965110650 180
356 iso_pu_bacteria 2967664464 2967667951 180
357 iso_pu_bacteria 2967671571 2967672071 180
358 iso_pu_bacteria 2967678726 2967683317 180
359 iso_pu_bacteria 2967686174 2967686685 180
360 iso_pu_bacteria 2967693043 2967696614 180
361 iso_pu_bacteria 2967699805 2967702377 180
362 iso_pu_bacteria 2967706974 2967711762 180
363 iso_pu_bacteria 2967714385 2967718194 180
364 iso_pu_bacteria 2967721400 2967725996 180
365 iso_pu_bacteria 2967728569 2967729901 180
366 iso_pu_bacteria 2967735183 2967738210 180
367 iso_pu_bacteria 2967742019 2967744773 180
368 iso_pu_bacteria 2967748971 2967755098 180
369 iso_pu_bacteria 2967755722 2967756693 180
370 iso_pu_bacteria 2967762386 2967767070 180
371 iso_pu_bacteria 2967769361 2967775345 180
372 iso_pu_bacteria 2967775926 2967779530 180
373 iso_pu_bacteria 2967996073 2967996377 180
374 iso_pu_bacteria 2968003550 2968004609 180
375 iso_pu_bacteria 2968016561 2968019761 180
376 iso_pu_bacteria 2968083720 2968084399 180
377 iso_pu_bacteria 2968097103 2968099851 180
378 iso_pu_bacteria 2968110612 2968113296 180
379 iso_pu_bacteria 2968117919 2968124127 180
380 iso_pu_bacteria 2968138860 2968144847 180
381 iso_pu_bacteria 2968171901 2968173650 180
382 iso_pu_bacteria 2970019648 2970024801 180
383 iso_pu_bacteria 2970026789 2970032492 180
384 iso_pu_bacteria 2970033650 2970037617 180
385 iso_pu_bacteria 2970040964 2970041976 180
386 iso_pu_bacteria 2970047711 2970054095 180
387 iso_pu_bacteria 2970054988 2970058789 180
388 iso_pu_bacteria 2970061556 2970063336 180
389 iso_pu_bacteria 2970068827 2970072803 180
390 iso_pu_bacteria 2970076120 2970081523 180
391 iso_pu_bacteria 2970082768 2970086248 180
392 iso_pu_bacteria 2970088815 2970095364 180
393 iso_pu_bacteria 2970095765 2970096214 180
394 iso_pu_bacteria 2970102677 2970106388 180
395 iso_pu_bacteria 2970109326 2970113567 180
396 iso_pu_bacteria 2970116247 2970116669 180
397 iso_pu_bacteria 2970122695 2970123813 180
398 iso_pu_bacteria 2970129317 2970132908 180
399 iso_pu_bacteria 2970136068 2970139856 180
400 iso_pu_bacteria 2970143518 2970145578 180
401 iso_pu_bacteria 2970149975 2970153708 180
402 iso_pu_bacteria 2970156795 2970161643 180
403 iso_pu_bacteria 2970164137 2970170283 180
404 iso_pu_bacteria 2970170962 2970177504 180
405 iso_pu_bacteria 2970177841 2970181439 180
406 iso_pu_bacteria 2970184632 2970190936 180
407 iso_pu_bacteria 2970191845 2970195857 180
408 iso_pu_bacteria 2970469710 2970473082 180
409 iso_pu_bacteria 2970489779 2970495227 180
410 iso_pu_bacteria 2970503327 2970504076 180
411 iso_pu_bacteria 2970510686 2970514861 180
412 iso_pu_bacteria 2970524798 2970531302 180
413 iso_pu_bacteria 2970532167 2970535437 180
414 iso_pu_bacteria 2970540015 2970545852 180
415 iso_pu_bacteria 2970547951 2970553025 180
416 iso_pu_bacteria 2970554993 2970556737 180
417 iso_pu_bacteria 2970593180 2970596041 180
418 iso_pu_bacteria 2970619444 2970623194 180
419 iso_pu_bacteria 2977516862 2977520661 180
420 iso_pu_bacteria 2977523885 2977530389 180
421 iso_pu_bacteria 2977530762 2977537638 180
422 iso_pu_bacteria 2977537788 2977544022 180
423 iso_pu_bacteria 2977544691 2977549882 180
424 iso_pu_bacteria 2977551784 2977555728 180
425 iso_pu_bacteria 2977558990 2977559508 180
426 iso_pu_bacteria 2977565890 2977572293 180
427 iso_pu_bacteria 2977572785 2977577612 180
428 iso_pu_bacteria 2977579622 2977585990 180
429 iso_pu_bacteria 2977821940 2977823065 180
430 iso_pu_bacteria 2977828996 2977831252 180
431 iso_pu_bacteria 2977843712 2977849461 180
432 iso_pu_bacteria 2977851361 2977858014 180
433 iso_pu_bacteria 2977858184 2977861376 180
434 iso_pu_bacteria 2977864932 2977871194 180
435 iso_pu_bacteria 2977872689 2977874138 180
436 iso_pu_bacteria 2977898635 2977904991 180
437 iso_pu_bacteria 2977907340 2977910252 180
438 iso_pu_bacteria 2977915119 2977919784 180
439 iso_pu_bacteria 2977922695 2977926972 180
440 iso_pu_bacteria 2977935797 2977939395 180
441 iso_pu_bacteria 2977942078 2977948739 180
442 iso_pu_bacteria 2977950692 2977951577 180
443 iso_pu_bacteria 2977957713 2977961902 180
444 iso_pu_bacteria 2977971508 2977974429 180
445 iso_pu_bacteria 2977986579 2977987294 180
446 iso_pu_bacteria 2979710463 2979717456 180
447 iso_pu_bacteria 2979764755 2979770975 180
448 iso_pu_bacteria 2979772303 2979779808 180
449 iso_pu_bacteria 2979779861 2979782623 180
450 iso_pu_bacteria 2979793036 2979799197 180
451 iso_pu_bacteria 2979808191 2979808711 180
452 iso_pu_bacteria 2987636660 2987640330 180
453 iso_pu_bacteria 2987645492 2987648878 180
454 iso_pu_bacteria 2987652177 2987658745 180
455 iso_pu_bacteria 2987659509 2987661196 180
456 iso_pu_bacteria 2987666974 2987673102 180
457 iso_pu_bacteria 2987673487 2987674678 180
458 iso_pu_bacteria 2996310559 2996316665 180
459 iso_pu_bacteria 2996336353 2996338173 180
460 iso_pu_bacteria 2996341866 2996344400 180
461 iso_pu_bacteria 2996348954 2996351794 180
462 iso_pu_bacteria 2996386984 2996391783 180
463 iso_pu_bacteria 3000135777 3000139072 180
464 iso_pu_bacteria 3004167301 3004170723 180
465 iso_pu_bacteria 3004188549 3004190245 180
466 iso_pu_bacteria 3004195979 3004202131 180
467 iso_pu_bacteria 3004203850 3004207901 180
468 iso_pu_bacteria 3004211236 3004214817 180
469 iso_pu_bacteria 3004218560 3004222592 180
470 iso_pu_bacteria 3004232784 3004234404 180
471 iso_pu_bacteria 3004239961 3004246913 180
472 iso_pu_bacteria 3004248173 3004253752 180
473 iso_pu_bacteria 3004268573 3004270851 180
474 iso_pu_bacteria 3004275668 3004278493 180
475 iso_pu_bacteria 3004334049 3004339609 180
476 iso_pu_bacteria 637000159 637079861 180
477 iso_pu_bacteria 643692032 643824627 180
478 iso_pu_bacteria 648276728 648741457 180
479 iso_pu_bacteria 649633066 649874450 180
480 iso_pu_bacteria 8002285264 8002287694 180
481 iso_pu_bacteria 8003992118 8003992569 180
482 iso_pu_bacteria 8003999396 8003999892 180
483 iso_pu_bacteria 8004300914 8004307365 180
484 iso_pu_bacteria 8004312739 8004320333 180
485 iso_pu_bacteria 8004361976 8004364495 180
486 iso_pu_bacteria 8004374579 8004375421 180
487 iso_pu_bacteria 8004387939 8004394815 180
488 iso_pu_bacteria 8004395343 8004400116 180
489 iso_pu_bacteria 8004633249 8004636618 180
490 iso_pu_bacteria 8004640170 8004642760 180
491 iso_pu_bacteria 8004695233 8004699748 180
492 iso_pu_bacteria 8004703790 8004711517 180
493 iso_pu_bacteria 8004714634 8004721201 180
494 iso_pu_bacteria 8004727605 8004728587 180
495 iso_pu_bacteria 8049293176 8049293583 180
496 iso_pu_bacteria 8054558443 8054562006 180
497 iso_pu_bacteria 8055617313 8055622546 180
498 3300049574 Ga0501038_0078411 Ga0501038_0078411_1869_2414 181
499 iso_pu_bacteria 2847686936 2847687384 182
500 iso_pu_bacteria 2869249662 2869254172 182
501 iso_pu_bacteria 2876392853 2876395603 182
502 iso_pu_bacteria 2885334103 2885337975 182
503 iso_pu_bacteria 2958115193 2958117634 182
504 iso_pu_bacteria 2968091066 2968094411 182
505 iso_pu_bacteria 2968128360 2968131457 182
506 iso_pu_bacteria 8004445564 8004446014 182
507 3300053155 Ga0500620_053342 Ga0500620_053342_456_1007 183
508 3300002741 JGI25157J39369_1000447 JGI25157J39369_100044725 184
509 3300003203 JGI25406J46586_10005473 JGI25406J46586_100054731 184
510 3300003214 JGI25165J46597_1000070 JGI25165J46597_1000070144 184
511 3300003354 JGI25160J50197_1000002 JGI25160J50197_1000002390 184
512 3300003771 Ga0055526_1009355 Ga0055526_10093554 184
513 3300003775 Ga0055524_1044712 Ga0055524_10447121 184
514 3300003781 Ga0055536_1001370 Ga0055536_10013704 184
515 3300003794 Ga0055531_10028993 Ga0055531_100289932 184
516 3300004625 Ga0055543_1000306 Ga0055543_100030610 184
517 3300005262 Ga0065165_1000058 Ga0065165_100005816 184
518 3300005327 Ga0070658_10095915 Ga0070658_100959152 184
519 3300005353 Ga0070669_100290272 Ga0070669_1002902722 184
520 3300005356 Ga0070674_100213010 Ga0070674_1002130102 184
521 3300005364 Ga0070673_100917602 Ga0070673_1009176021 184
522 3300005366 Ga0070659_100373090 Ga0070659_1003730901 184
523 3300005539 Ga0068853_100079674 Ga0068853_1000796742 184
524 3300005539 Ga0068853_100123555 Ga0068853_1001235552 184
525 3300005548 Ga0070665_100108101 Ga0070665_1001081012 184
526 3300005563 Ga0068855_100631248 Ga0068855_1006312481 184
527 3300005614 Ga0068856_100284631 Ga0068856_1002846312 184
528 3300005985 Ga0081539_10003346 Ga0081539_100033467 184
529 3300006038 Ga0075365_10092955 Ga0075365_100929552 184
530 3300006038 Ga0075365_10184227 Ga0075365_101842272 184
531 3300006038 Ga0075365_10266059 Ga0075365_102660592 184
532 3300006042 Ga0075368_10001439 Ga0075368_100014392 184
533 3300006042 Ga0075368_10253326 Ga0075368_102533261 184
534 3300006048 Ga0075363_100009749 Ga0075363_1000097493 184
535 3300006048 Ga0075363_100060285 Ga0075363_1000602852 184
536 3300006051 Ga0075364_10010273 Ga0075364_100102732 184
537 3300006051 Ga0075364_10648888 Ga0075364_106488881 184
538 3300006177 Ga0075362_10137361 Ga0075362_101373612 184
539 3300006177 Ga0075362_10164017 Ga0075362_101640172 184
540 3300006178 Ga0075367_10003469 Ga0075367_100034692 184
541 3300006178 Ga0075367_10011845 Ga0075367_100118454 184
542 3300006178 Ga0075367_10163013 Ga0075367_101630132 184
543 3300006186 Ga0075369_10001660 Ga0075369_100016602 184
544 3300006186 Ga0075369_10021510 Ga0075369_100215102 184
545 3300006353 Ga0075370_10009111 Ga0075370_100091113 184
546 3300006353 Ga0075370_10078798 Ga0075370_100787982 184
547 3300006946 Ga0079104_1002413 Ga0079104_10024139 184
548 3300006946 Ga0079104_1009146 Ga0079104_10091462 184
549 3300009093 Ga0105240_10161867 Ga0105240_101618673 184
550 3300009093 Ga0105240_10170657 Ga0105240_101706572 184
551 3300009098 Ga0105245_10139457 Ga0105245_101394572 184
552 3300009148 Ga0105243_10475877 Ga0105243_104758771 184
553 3300009174 Ga0105241_10055488 Ga0105241_100554882 184
554 3300009545 Ga0105237_10074211 Ga0105237_100742112 184
555 3300009545 Ga0105237_10682819 Ga0105237_106828191 184
556 3300009551 Ga0105238_10007521 Ga0105238_100075215 184
557 3300009553 Ga0105249_10617665 Ga0105249_106176652 184
558 3300010375 Ga0105239_10025032 Ga0105239_100250325 184
559 3300010375 Ga0105239_10211515 Ga0105239_102115152 184
560 3300010375 Ga0105239_10525332 Ga0105239_105253322 184
561 3300010375 Ga0105239_10863054 Ga0105239_108630542 184
562 3300010375 Ga0105239_12320265 Ga0105239_123202651 184
563 3300013104 Ga0157370_10207966 Ga0157370_102079662 184
564 3300013104 Ga0157370_10310372 Ga0157370_103103722 184
565 3300013105 Ga0157369_10139711 Ga0157369_101397112 184
566 3300013297 Ga0157378_10621747 Ga0157378_106217472 184
567 3300014326 Ga0157380_10659433 Ga0157380_106594332 184
568 3300014497 Ga0182008_10247166 Ga0182008_102471661 184
569 3300015262 Ga0182007_10047860 Ga0182007_100478602 184
570 3300015684 Ga0183365_10597 Ga0183365_105972 184
571 3300015690 Ga0183363_1163 Ga0183363_11633 184
572 3300017792 Ga0163161_10280018 Ga0163161_102800181 184
573 3300017792 Ga0163161_11042287 Ga0163161_110422871 184
574 3300021320 Ga0214544_1000008 Ga0214544_1000008269 184
575 3300021321 Ga0214542_1000010 Ga0214542_1000010226 184
576 3300021327 Ga0214543_1000003 Ga0214543_1000003122 184
577 3300021327 Ga0214543_1000004 Ga0214543_1000004248 184
578 3300022739 Ga0228711_1000137 Ga0228711_100013755 184
579 3300022740 Ga0228710_1000031 Ga0228710_10000319 184
580 3300025208 Ga0209436_100128 Ga0209436_10012811 184
581 3300025250 Ga0209026_1000002 Ga0209026_10000021075 184
582 3300025254 Ga0209148_1000123 Ga0209148_1000123163 184
583 3300025256 Ga0209759_1000381 Ga0209759_10003818 184
584 3300025261 Ga0209233_1000131 Ga0209233_1000131159 184
585 3300025261 Ga0209233_1008273 Ga0209233_10082733 184
586 3300025272 Ga0209455_1000129 Ga0209455_1000129132 184
587 3300025284 Ga0209130_1000008 Ga0209130_1000008154 184
588 3300025292 Ga0209676_1002487 Ga0209676_100248710 184
589 3300025294 Ga0209025_1000956 Ga0209025_10009569 184
590 3300025295 Ga0209564_1000091 Ga0209564_100009178 184
591 3300025297 Ga0209758_1006066 Ga0209758_10060663 184
592 3300025297 Ga0209758_1023562 Ga0209758_10235621 184
593 3300025298 Ga0209050_1005659 Ga0209050_10056592 184
594 3300025299 Ga0209256_1003090 Ga0209256_100309010 184
595 3300025302 Ga0207426_1000016 Ga0207426_1000016407 184
596 3300025303 Ga0209051_1006780 Ga0209051_10067802 184
597 3300025304 Ga0209257_1003908 Ga0209257_100390810 184
598 3300025904 Ga0207647_10006200 Ga0207647_100062002 184
599 3300025904 Ga0207647_10027535 Ga0207647_100275352 184
600 3300025909 Ga0207705_10091952 Ga0207705_100919522 184
601 3300025913 Ga0207695_10135869 Ga0207695_101358692 184
602 3300025913 Ga0207695_10281109 Ga0207695_102811092 184
603 3300025913 Ga0207695_10439553 Ga0207695_104395532 184
604 3300025913 Ga0207695_10455735 Ga0207695_104557352 184
605 3300025914 Ga0207671_10013865 Ga0207671_100138655 184
606 3300025914 Ga0207671_10545458 Ga0207671_105454581 184
607 3300025924 Ga0207694_10146655 Ga0207694_101466552 184
608 3300025924 Ga0207694_10801987 Ga0207694_108019871 184
609 3300025937 Ga0207669_10171165 Ga0207669_101711652 184
610 3300026041 Ga0207639_10040735 Ga0207639_100407352 184
611 3300026041 Ga0207639_10737318 Ga0207639_107373182 184
612 3300026078 Ga0207702_10284594 Ga0207702_102845942 184
613 3300026116 Ga0207674_10079771 Ga0207674_100797711 184
614 3300026118 Ga0207675_100027553 Ga0207675_1000275531 184
615 3300027111 Ga0209281_1000155 Ga0209281_100015510 184
616 3300027111 Ga0209281_1001059 Ga0209281_100105910 184
617 3300027666 Ga0209282_1000025 Ga0209282_1000025154 184
618 3300027866 Ga0209813_10006201 Ga0209813_100062012 184
619 3300028379 Ga0268266_10083937 Ga0268266_100839372 184
620 3300028379 Ga0268266_10233174 Ga0268266_102331742 184
621 3300028794 Ga0307515_10000154 Ga0307515_1000015469 184
622 3300028794 Ga0307515_10008850 Ga0307515_1000885013 184
623 3300028794 Ga0307515_10261289 Ga0307515_102612892 184
624 3300031456 Ga0307513_10001054 Ga0307513_1000105423 184
625 3300031911 Ga0307412_10261316 Ga0307412_102613162 184
626 3300031911 Ga0307412_10392654 Ga0307412_103926542 184
627 3300031967 Ga0315914_1000620 Ga0315914_100062035 184
628 3300032002 Ga0307416_100610119 Ga0307416_1006101192 184
629 3300032168 Ga0316593_10045409 Ga0316593_100454092 184
630 3300033430 Ga0315913_1000150 Ga0315913_10001509 184
631 3300033464 Ga0315915_1000015 Ga0315915_10000159 184
632 3300035398 Ga0316574_0417182 Ga0316574_0417182_148_726 184
633 3300036647 Ga0316582_0075988 Ga0316582_0075988_920_1498 184
634 3300036712 Ga0316584_0250718 Ga0316584_0250718_689_1267 184
635 3300037312 Ga0395899_0000073 Ga0395899_0000073_136339_136893 184
636 3300037312 Ga0395899_0093240 Ga0395899_0093240_801_1355 184
637 3300037418 Ga0395900_0000027 Ga0395900_0000027_240909_241463 184
638 3300037418 Ga0395900_0027106 Ga0395900_0027106_2665_3219 184
639 3300037418 Ga0395900_0042607 Ga0395900_0042607_647_1201 184
640 3300037418 Ga0395900_0046988 Ga0395900_0046988_218_772 184
641 3300037466 Ga0395898_0000255 Ga0395898_0000255_85969_86523 184
642 3300037466 Ga0395898_0389364 Ga0395898_0389364_755_1309 184
643 3300037471 Ga0395905_0000032 Ga0395905_0000032_44470_45024 184
644 3300037471 Ga0395905_0019317 Ga0395905_0019317_1593_2147 184
645 3300037471 Ga0395905_0338771 Ga0395905_0338771_778_1332 184
646 3300037471 Ga0395905_0387328 Ga0395905_0387328_229_783 184
647 3300037471 Ga0395905_0768327 Ga0395905_0768327_289_843 184
648 3300038443 Ga0395901_0000110 Ga0395901_0000110_44495_45049 184
649 3300038443 Ga0395901_0046591 Ga0395901_0046591_3496_4050 184
650 3300038443 Ga0395901_0057769 Ga0395901_0057769_2056_2643 184
651 3300038443 Ga0395901_0131007 Ga0395901_0131007_143_697 184
652 3300038443 Ga0395901_0488863 Ga0395901_0488863_157_711 184
653 3300038443 Ga0395901_1013721 Ga0395901_1013721_130_684 184
654 3300041405 Ga0439438_088036 Ga0439438_088036_89_649 184
655 3300041452 Ga0451793_0240457 Ga0451793_0240457_215_769 184
656 3300041511 Ga0451855_0305276 Ga0451855_0305276_18_572 184
657 3300042004 Ga0439445_0081298 Ga0439445_0081298_151_828 184
658 3300042007 Ga0439449_0003709 Ga0439449_0003709_4413_4973 184
659 3300042007 Ga0439449_0062432 Ga0439449_0062432_274_834 184
660 3300044901 Ga0466960_0052067 Ga0466960_0052067_177_731 184
661 3300046460 Ga0495638_0006132 Ga0495638_0006132_6437_6991 184
662 3300046460 Ga0495638_0119176 Ga0495638_0119176_962_1519 184
663 3300046520 Ga0495637_0122161 Ga0495637_0122161_240_794 184
664 3300046522 Ga0495643_0088549 Ga0495643_0088549_791_1345 184
665 3300046524 Ga0495648_0294686 Ga0495648_0294686_130_684 184
666 3300046691 Ga0495670_0021622 Ga0495670_0021622_889_1446 184
667 3300046810 Ga0495660_0234307 Ga0495660_0234307_254_808 184
668 3300047321 Ga0495676_0231892 Ga0495676_0231892_78_632 184
669 3300047470 Ga0495681_0044497 Ga0495681_0044497_518_1072 184
670 3300047472 Ga0495686_0173026 Ga0495686_0173026_628_1185 184
671 3300048905 Ga0496102_0092038 Ga0496102_0092038_669_1223 184
672 3300048906 Ga0496103_0207909 Ga0496103_0207909_177_731 184
673 3300048909 Ga0496106_0741651 Ga0496106_0741651_16_573 184
674 3300048911 Ga0496108_0161116 Ga0496108_0161116_97_693 184
675 3300048912 Ga0496109_0407276 Ga0496109_0407276_650_1204 184
676 3300048915 Ga0496112_0476133 Ga0496112_0476133_214_768 184
677 3300048915 Ga0496112_0801701 Ga0496112_0801701_166_720 184
678 3300048916 Ga0496113_0141688 Ga0496113_0141688_1247_1801 184
679 3300048916 Ga0496113_0596114 Ga0496113_0596114_209_781 184
680 3300048918 Ga0496115_0486398 Ga0496115_0486398_288_842 184
681 3300048918 Ga0496115_0516257 Ga0496115_0516257_382_936 184
682 3300048921 Ga0496118_0132255 Ga0496118_0132255_572_1126 184
683 3300048922 Ga0496119_0068437 Ga0496119_0068437_946_1500 184
684 3300048923 Ga0496120_0005603 Ga0496120_0005603_5232_5786 184
685 3300048923 Ga0496120_0152627 Ga0496120_0152627_438_992 184
686 3300048924 Ga0496121_0206346 Ga0496121_0206346_733_1287 184
687 3300048925 Ga0496122_0399273 Ga0496122_0399273_127_681 184
688 3300048928 Ga0496125_0284127 Ga0496125_0284127_201_755 184
689 3300048929 Ga0496126_0190705 Ga0496126_0190705_1110_1664 184
690 3300048929 Ga0496126_0606100 Ga0496126_0606100_97_651 184
691 3300049568 Ga0501031_0020213 Ga0501031_0020213_965_1519 184
692 3300049568 Ga0501031_0047010 Ga0501031_0047010_1377_1931 184
693 3300049568 Ga0501031_0050394 Ga0501031_0050394_1019_1573 184
694 3300049568 Ga0501031_0076167 Ga0501031_0076167_769_1323 184
695 3300049568 Ga0501031_0275123 Ga0501031_0275123_76_630 184
696 3300049568 Ga0501031_0278089 Ga0501031_0278089_139_699 184
697 3300049568 Ga0501031_0385628 Ga0501031_0385628_332_886 184
698 3300049569 Ga0501032_0000081 Ga0501032_0000081_21054_21608 184
699 3300049569 Ga0501032_0000116 Ga0501032_0000116_3555_4109 184
700 3300049569 Ga0501032_0033707 Ga0501032_0033707_2580_3134 184
701 3300049569 Ga0501032_0037313 Ga0501032_0037313_1560_2114 184
702 3300049569 Ga0501032_0046609 Ga0501032_0046609_374_928 184
703 3300049569 Ga0501032_0088912 Ga0501032_0088912_615_1169 184
704 3300049569 Ga0501032_0231339 Ga0501032_0231339_247_801 184
705 3300049569 Ga0501032_0446993 Ga0501032_0446993_22_576 184
706 3300049569 Ga0501032_0527791 Ga0501032_0527791_43_597 184
707 3300049570 Ga0501033_0000097 Ga0501033_0000097_54921_55475 184
708 3300049570 Ga0501033_0000501 Ga0501033_0000501_17704_18258 184
709 3300049570 Ga0501033_0001994 Ga0501033_0001994_11648_12202 184
710 3300049570 Ga0501033_0003939 Ga0501033_0003939_284_838 184
711 3300049570 Ga0501033_0011792 Ga0501033_0011792_3132_3686 184
712 3300049570 Ga0501033_0051935 Ga0501033_0051935_2111_2665 184
713 3300049570 Ga0501033_0052388 Ga0501033_0052388_1983_2537 184
714 3300049570 Ga0501033_0116853 Ga0501033_0116853_830_1384 184
715 3300049570 Ga0501033_0185335 Ga0501033_0185335_497_1051 184
716 3300049570 Ga0501033_0267328 Ga0501033_0267328_597_1151 184
717 3300049570 Ga0501033_0286940 Ga0501033_0286940_534_1115 184
718 3300049570 Ga0501033_0404655 Ga0501033_0404655_374_928 184
719 3300049570 Ga0501033_0708521 Ga0501033_0708521_24_578 184
720 3300049571 Ga0501034_0000186 Ga0501034_0000186_61024_61578 184
721 3300049571 Ga0501034_0003453 Ga0501034_0003453_10163_10717 184
722 3300049571 Ga0501034_0004432 Ga0501034_0004432_3427_3981 184
723 3300049571 Ga0501034_0021271 Ga0501034_0021271_4995_5549 184
724 3300049571 Ga0501034_0215003 Ga0501034_0215003_1253_1807 184
725 3300049571 Ga0501034_0234953 Ga0501034_0234953_755_1309 184
726 3300049571 Ga0501034_0267581 Ga0501034_0267581_656_1210 184
727 3300049571 Ga0501034_0418751 Ga0501034_0418751_673_1227 184
728 3300049571 Ga0501034_0567156 Ga0501034_0567156_359_913 184
729 3300049571 Ga0501034_0843928 Ga0501034_0843928_150_704 184
730 3300049572 Ga0501036_0000002 Ga0501036_0000002_237634_238188 184
731 3300049572 Ga0501036_0001125 Ga0501036_0001125_5972_6526 184
732 3300049572 Ga0501036_0039433 Ga0501036_0039433_2488_3042 184
733 3300049572 Ga0501036_0414854 Ga0501036_0414854_374_928 184
734 3300049572 Ga0501036_0650940 Ga0501036_0650940_293_847 184
735 3300049573 Ga0501037_0000095 Ga0501037_0000095_21082_21636 184
736 3300049573 Ga0501037_0000108 Ga0501037_0000108_18469_19023 184
737 3300049573 Ga0501037_0000451 Ga0501037_0000451_18564_19118 184
738 3300049573 Ga0501037_0131132 Ga0501037_0131132_340_894 184
739 3300049574 Ga0501038_0000002 Ga0501038_0000002_28281_28835 184
740 3300049574 Ga0501038_0000126 Ga0501038_0000126_3427_3981 184
741 3300049574 Ga0501038_0063134 Ga0501038_0063134_779_1333 184
742 3300049574 Ga0501038_0067643 Ga0501038_0067643_2111_2665 184
743 3300049574 Ga0501038_0071665 Ga0501038_0071665_2011_2565 184
744 3300049574 Ga0501038_0077899 Ga0501038_0077899_1260_1814 184
745 3300049575 Ga0501039_0000002 Ga0501039_0000002_319678_320232 184
746 3300049575 Ga0501039_0000003 Ga0501039_0000003_169549_170103 184
747 3300049575 Ga0501039_0187939 Ga0501039_0187939_1005_1559 184
748 3300049575 Ga0501039_0211894 Ga0501039_0211894_596_1150 184
749 3300049576 Ga0501040_0003171 Ga0501040_0003171_4259_4813 184
750 3300049578 Ga0501042_0078294 Ga0501042_0078294_373_927 184
751 3300049579 Ga0501043_0000081 Ga0501043_0000081_35730_36284 184
752 3300049579 Ga0501043_0000140 Ga0501043_0000140_54041_54595 184
753 3300049579 Ga0501043_0000162 Ga0501043_0000162_20610_21164 184
754 3300049579 Ga0501043_0095551 Ga0501043_0095551_583_1164 184
755 3300049579 Ga0501043_0104122 Ga0501043_0104122_1663_2217 184
756 3300049579 Ga0501043_0169788 Ga0501043_0169788_404_958 184
757 3300049579 Ga0501043_0457414 Ga0501043_0457414_237_791 184
758 3300049580 Ga0501046_0023471 Ga0501046_0023471_1993_2547 184
759 3300049580 Ga0501046_0147873 Ga0501046_0147873_1064_1618 184
760 3300049580 Ga0501046_0271654 Ga0501046_0271654_331_885 184
761 3300049581 Ga0501047_0001069 Ga0501047_0001069_5210_5764 184
762 3300049581 Ga0501047_0005496 Ga0501047_0005496_3417_3971 184
763 3300049581 Ga0501047_0013509 Ga0501047_0013509_4511_5065 184
764 3300049581 Ga0501047_0053713 Ga0501047_0053713_2969_3523 184
765 3300049581 Ga0501047_0123024 Ga0501047_0123024_1588_2142 184
766 3300049581 Ga0501047_0317862 Ga0501047_0317862_64_645 184
767 3300049581 Ga0501047_0499200 Ga0501047_0499200_116_670 184
768 3300049581 Ga0501047_0513635 Ga0501047_0513635_174_731 184
769 3300049583 Ga0501067_0058678 Ga0501067_0058678_321_875 184
770 3300049583 Ga0501067_0084208 Ga0501067_0084208_45_599 184
771 3300049584 Ga0501068_0019640 Ga0501068_0019640_23_577 184
772 3300049584 Ga0501068_0067416 Ga0501068_0067416_1217_1771 184
773 3300049585 Ga0501069_0000118 Ga0501069_0000118_19455_20009 184
774 3300049585 Ga0501069_0029569 Ga0501069_0029569_1698_2252 184
775 3300049586 Ga0501070_0002038 Ga0501070_0002038_4505_5059 184
776 3300049586 Ga0501070_0002088 Ga0501070_0002088_11446_12000 184
777 3300049586 Ga0501070_0002773 Ga0501070_0002773_13663_14217 184
778 3300049586 Ga0501070_0016450 Ga0501070_0016450_694_1248 184
779 3300049586 Ga0501070_0049174 Ga0501070_0049174_533_1087 184
780 3300049586 Ga0501070_0050792 Ga0501070_0050792_1338_1892 184
781 3300049586 Ga0501070_0110816 Ga0501070_0110816_1498_2079 184
782 3300049586 Ga0501070_0117985 Ga0501070_0117985_103_657 184
783 3300049586 Ga0501070_0180593 Ga0501070_0180593_749_1303 184
784 3300049586 Ga0501070_0180900 Ga0501070_0180900_770_1324 184
785 3300049587 Ga0501071_0032926 Ga0501071_0032926_985_1539 184
786 3300049587 Ga0501071_0043090 Ga0501071_0043090_151_705 184
787 3300049589 Ga0501073_0018852 Ga0501073_0018852_257_811 184
788 3300049589 Ga0501073_0051879 Ga0501073_0051879_25_588 184
789 3300049589 Ga0501073_0093871 Ga0501073_0093871_944_1498 184
790 3300049590 Ga0501074_0000062 Ga0501074_0000062_31187_31741 184
791 3300049590 Ga0501074_0014987 Ga0501074_0014987_4485_5039 184
792 3300049590 Ga0501074_0085970 Ga0501074_0085970_232_786 184
793 3300049741 Ga0501079_0957325 Ga0501079_0957325_40_594 184
794 3300049742 Ga0501080_0000254 Ga0501080_0000254_23074_23628 184
795 3300049742 Ga0501080_0016280 Ga0501080_0016280_4268_4822 184
796 3300049742 Ga0501080_0037279 Ga0501080_0037279_2677_3231 184
797 3300049742 Ga0501080_0059987 Ga0501080_0059987_935_1489 184
798 3300049742 Ga0501080_0608901 Ga0501080_0608901_51_608 184
799 3300049744 Ga0501083_0000453 Ga0501083_0000453_14456_15010 184
800 3300049822 Ga0501035_0000017 Ga0501035_0000017_235001_235555 184
801 3300049822 Ga0501035_0000100 Ga0501035_0000100_51847_52401 184
802 3300049822 Ga0501035_0000895 Ga0501035_0000895_30509_31090 184
803 3300049822 Ga0501035_0001153 Ga0501035_0001153_11776_12330 184
804 3300049822 Ga0501035_0001764 Ga0501035_0001764_4453_5007 184
805 3300049822 Ga0501035_0003584 Ga0501035_0003584_4671_5225 184
806 3300049822 Ga0501035_0032885 Ga0501035_0032885_3294_3857 184
807 3300049822 Ga0501035_0085431 Ga0501035_0085431_153_707 184
808 3300049822 Ga0501035_0086759 Ga0501035_0086759_2051_2605 184
809 3300049822 Ga0501035_0316305 Ga0501035_0316305_60_614 184
810 3300049823 Ga0501044_0000002 Ga0501044_0000002_54921_55475 184
811 3300049823 Ga0501044_0000751 Ga0501044_0000751_18582_19136 184
812 3300049823 Ga0501044_0007931 Ga0501044_0007931_6616_7170 184
813 3300049823 Ga0501044_0019122 Ga0501044_0019122_1313_1867 184
814 3300049823 Ga0501044_0021530 Ga0501044_0021530_3229_3792 184
815 3300049823 Ga0501044_0038386 Ga0501044_0038386_2696_3250 184
816 3300049823 Ga0501044_0047079 Ga0501044_0047079_153_707 184
817 3300049823 Ga0501044_0108794 Ga0501044_0108794_2075_2629 184
818 3300049823 Ga0501044_0168991 Ga0501044_0168991_1162_1743 184
819 3300049823 Ga0501044_0286715 Ga0501044_0286715_620_1177 184
820 3300049823 Ga0501044_0423824 Ga0501044_0423824_664_1218 184
821 3300049823 Ga0501044_0431691 Ga0501044_0431691_166_720 184
822 3300049823 Ga0501044_0555498 Ga0501044_0555498_82_639 184
823 3300049823 Ga0501044_0902010 Ga0501044_0902010_65_622 184
824 3300049824 Ga0501045_0020525 Ga0501045_0020525_3868_4422 184
825 3300049824 Ga0501045_0090727 Ga0501045_0090727_942_1496 184
826 3300050489 nmdc:mga03683_79079_c1 nmdc:mga03683_79079_c1_827_1381 184
827 3300050490 nmdc:mga03n38_143292_c1 nmdc:mga03n38_143292_c1_445_999 184
828 3300050490 nmdc:mga03n38_144725_c1 nmdc:mga03n38_144725_c1_38_592 184
829 3300050491 nmdc:mga00v17_129310_c1 nmdc:mga00v17_129310_c1_373_927 184
830 3300050492 nmdc:mga0yw44_216513_c1 nmdc:mga0yw44_216513_c1_178_735 184
831 3300050492 nmdc:mga0yw44_21673_c1 nmdc:mga0yw44_21673_c1_2725_3279 184
832 3300050492 nmdc:mga0yw44_234290_c1 nmdc:mga0yw44_234290_c1_169_744 184
833 3300050492 nmdc:mga0yw44_56243_c1 nmdc:mga0yw44_56243_c1_1662_2216 184
834 3300050494 nmdc:mga06z11_43242_c1 nmdc:mga06z11_43242_c1_73_627 184
835 3300050494 nmdc:mga06z11_47954_c1 nmdc:mga06z11_47954_c1_413_967 184
836 3300050495 nmdc:mga04h51_47165_c1 nmdc:mga04h51_47165_c1_117_671 184
837 3300050496 nmdc:mga07m45_3290_c1 nmdc:mga07m45_3290_c1_2725_3279 184
838 3300050496 nmdc:mga07m45_33919_c1 nmdc:mga07m45_33919_c1_1668_2222 184
839 3300053079 Ga0500610_0045343 Ga0500610_0045343_1561_2115 184
840 3300053079 Ga0500610_0215050 Ga0500610_0215050_111_665 184
841 3300053087 Ga0500643_020686 Ga0500643_020686_1267_1827 184
842 3300053104 Ga0500556_0056626 Ga0500556_0056626_384_941 184
843 3300053122 Ga0500608_100903 Ga0500608_100903_498_1118 184
844 3300053139 Ga0500568_0000048 Ga0500568_0000048_57965_58519 184
845 3300053151 Ga0500604_0032642 Ga0500604_0032642_660_1241 184
846 3300053153 Ga0500616_0082384 Ga0500616_0082384_871_1428 184
847 3300053155 Ga0500620_000328 Ga0500620_000328_5846_6400 184
848 3300053156 Ga0500622_0000251 Ga0500622_0000251_25902_26522 184
849 3300054114 Ga0501084_0856837 Ga0501084_0856837_35_589 184
850 3300060353 Ga0501082_0090342 Ga0501082_0090342_1453_2007 184

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03602

Cons_hypoth95

Conserved hypothetical protein 95

1

179

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fpo-assembly1.cif.gz_A putative methyltransferase yhhf from escherichia coli. 0.9014 1 184
6m1c-assembly1.cif.gz_A crystal structure of rsmd methyltransferase of m. tuberculosis in complex with sinefungin reveals key interactions 0.8984 1 183
2fpo-assembly4.cif.gz_D putative methyltransferase yhhf from escherichia coli. 0.8958 1 184
2fpo-assembly5.cif.gz_E putative methyltransferase yhhf from escherichia coli. 0.8953 1 184
2fpo-assembly6.cif.gz_F putative methyltransferase yhhf from escherichia coli. 0.8879 1 184
ID Description Score Start End Superfamily
af_P0ADX9_1_198_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9095 1 184 3.40.50.150
af_A0A1D6EFY7_537_616_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8975 44 106 3.40.50.150
2fpoF00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8957 1 184 3.40.50.150
af_Q2FZF6_1_156_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8955 25 183 3.40.50.150
af_P0ADX9_1_198_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8815 1 184 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A1A5RUM8-F1-model_v4 deleted 1.001 1 184
AF-A0A0Q8BD86-F1-model_v4 16S rRNA (Guanine(966)-N(2))-methyltransferase RsmD 0.9972 1 184 GO:0003676
GO:0008168
GO:0031167
AF-A0A529U2F3-F1-model_v4 deleted 0.9907 62 184
AF-A0A529U2F3-F1-model_v4 deleted 0.9749 62 184
AF-A0A0J6SAH4-F1-model_v4 DNA methyltransferase 0.9681 74 183 GO:0003676
GO:0008168
GO:0032259

Feature Viewer

pLDDT pTM Quality
94.01 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map