F483395

General Info

Members Datasets Scaffolds Average Seq Length
849 368 825 319

Family's Representative Sequence

Representative Sequence 3300014326|Ga0157380_10000018|Ga0157380_1000001885
Length 321
Sequence LKSSKEIIDLARQTFDIEAEAIAGLKPFINDDFVESVKLIYSAKGRVIVTGIGKSAIIANKIVATFNSTGTPAVFLHAADAIHGDLGMIQQNDVIICISKSGNTSEIKVLVPLLKNGGNKLIAIVGNMDSYLAGSADLVLNTTIEKEACPNNLAPTTSTTAQLAMGDALAVCLLDYRGFTSGDFARFHPGGALGKRLYLRVGDLYKHNAQPGVNENAGIEEIIMEISSKRLGATAVINDHKLAGIITDGDLRRMMQQHKPLDKVKAKDIMTVNPKTADPEMMAVDALRMMKEFNITQLVVTDKMKYLGFVHLHDLLREGII

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
4 2738541278 Niastella sp. CF465 Isolate Unclassified
5 2738541302 Pedobacter sp. CF074 Isolate Unclassified
6 2739367651 Pedobacter sp. OK291 Isolate Unclassified
7 2739367656 Pedobacter sp. CF523 Isolate Unclassified
8 2739367663 Pedobacter sp. YR510 Isolate Unclassified
9 2818991437 Pedobacter terrae 518 Isolate Unclassified
10 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
11 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
12 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
13 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
14 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
15 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
16 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
17 2884634485 Algoriphagus kandeliae XY-J91 Isolate Unclassified
18 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
19 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
20 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
21 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
22 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
23 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
24 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
25 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
26 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
27 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
28 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
29 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
30 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
31 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
32 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
33 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
34 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
35 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
36 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
37 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
38 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
39 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
40 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
41 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
42 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
43 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
44 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
45 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
46 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
47 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
48 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
49 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
50 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
51 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
52 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
53 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
54 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
55 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
56 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
57 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
58 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
59 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
60 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
61 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
62 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
63 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
64 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
65 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
66 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
67 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
68 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
69 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
70 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
71 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
72 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
73 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
74 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
75 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
76 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
77 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
78 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
79 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
80 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
81 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
82 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
83 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
84 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
85 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
86 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
87 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
88 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
89 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
90 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
91 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
92 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
93 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
94 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
95 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
96 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
97 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
98 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
99 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
100 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
101 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
102 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
103 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
104 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
105 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
106 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
107 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
108 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
109 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
110 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
111 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
112 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
113 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
114 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
115 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
116 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
117 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
118 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
119 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
120 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
121 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
122 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
123 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
124 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
125 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
126 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
127 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
128 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
129 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
130 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
131 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
132 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
133 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
134 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
135 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
136 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
137 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
138 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
139 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
140 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
141 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
142 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
143 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
144 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
145 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
147 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
149 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
150 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
151 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
153 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
154 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
155 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
157 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
211 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
215 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
216 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
217 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
218 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
219 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
220 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
221 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
222 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
223 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
224 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
225 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
226 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
227 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
228 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
229 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
230 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
231 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
232 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
233 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
234 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
235 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
236 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
237 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
238 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
239 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
240 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
241 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
242 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
243 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
244 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
245 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
246 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
247 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
248 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
249 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
250 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
251 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
252 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
253 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
254 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
255 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
256 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
257 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
258 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
259 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
260 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
261 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
262 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
263 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
264 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
265 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
266 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
267 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
268 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
269 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
270 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
271 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
272 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
273 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
274 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
275 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
276 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
277 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
278 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
279 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
280 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
281 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
282 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
283 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
284 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
285 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
286 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
287 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
288 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
289 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
290 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
291 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
292 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
293 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
294 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
295 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
296 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
297 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
298 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
299 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
300 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
301 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
303 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
304 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
305 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
306 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
307 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
308 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
309 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
310 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
311 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
312 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
313 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
314 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
315 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
316 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
317 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
318 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
319 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
320 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
321 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
322 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
323 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
324 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
325 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
326 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
327 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
328 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
329 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
330 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
331 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
332 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
333 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
334 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
335 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
336 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
337 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
338 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
339 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
340 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
341 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
342 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
343 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
344 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
345 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
346 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
347 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
348 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
349 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
350 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
351 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
352 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
353 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
354 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
355 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
356 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
357 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
358 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
359 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
360 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
361 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
362 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
363 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
364 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
365 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
366 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
367 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
368 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.06
Metatranscriptomes 0
Isolates 2.94

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.24
Nodule 0
Rhizoplane 0.71
Rhizosphere 84.81
Stem 0
Stem Tuber 0
Unclassified 6.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_4233568 2162886011 Unclassified 1547
2 MRS1b_contig_448359 2162886011 Bacteria 1369
3 MBSR1b_contig_1406278 2162886012 Bacteria 2197
4 MBSR1b_contig_7589204 2162886012 Bacteria 2472
5 JGI24744J21845_10003674 3300002077 Bacteria 3161
6 JGI24751J29686_10000540 3300002459 Bacteria 10612
7 JGI25152J39213_1000647 3300002773 Bacteria 18444
8 JGI25150J39212_1000009 3300002774 Bacteria 249509
9 JGI25151J46595_10000017 3300003187 Bacteria 249509
10 JGI25153J46596_10000023 3300003215 Bacteria 249509
11 JGI25153J46596_10023575 3300003215 Bacteria 2239
12 rootH1_10004252 3300003316 Bacteria 8332
13 rootH1_10013495 3300003316 Bacteria 2356
14 rootH1_10013813 3300003316 Bacteria 11218
15 rootH1_10013813 3300003323 Bacteria 1368
16 rootH2_10019275 3300003320 Bacteria 26987
17 rootH2_10039673 3300003320 Bacteria 11437
18 rootH2_10075767 3300003320 Bacteria 1678
19 rootH2_10135544 3300003320 Bacteria 6928
20 rootH2_10166600 3300003320 Bacteria 4060
21 rootH2_10213033 3300003320 Bacteria 2091
22 rootH2_10232790 3300003320 Bacteria 1248
23 rootL2_10000984 3300003322 Bacteria 19559
24 rootL2_10001672 3300003322 Bacteria 4737
25 rootL2_10023331 3300003322 Bacteria 2597
26 rootL2_10041649 3300003322 Bacteria 1912
27 rootL2_10062550 3300003322 Bacteria 3641
28 rootL2_10082800 3300003322 Bacteria 3650
29 rootH1_10003699 3300003323 Bacteria 25103
30 rootH1_10011437 3300003323 Bacteria 74019
31 rootH1_10044529 3300003323 Bacteria 12446
32 rootH1_10064744 3300003323 Bacteria 6408
33 rootH1_10175021 3300003323 Bacteria 3205
34 rootH1_10311342 3300003323 Bacteria 1623
35 JGI25160J50197_1001239 3300003354 Bacteria 12966
36 Ga0055535_1003210 3300003761 Bacteria 4823
37 Ga0055542_1004148 3300003762 Bacteria 3639
38 Ga0055536_1000011 3300003781 Bacteria 275969
39 Ga0055528_1001011 3300003790 Bacteria 18675
40 Ga0055530_10000880 3300003791 Bacteria 24686
41 Ga0055530_10002755 3300003791 Bacteria 10873
42 Ga0055531_10000054 3300003794 Bacteria 123684
43 Ga0055543_1014584 3300004625 Bacteria 1529
44 Ga0065165_1000027 3300005262 Bacteria 228507
45 Ga0065714_10004769 3300005288 Bacteria 5412
46 Ga0065714_10073672 3300005288 Bacteria 3137
47 Ga0065704_10101212 3300005289 Unclassified 2240
48 Ga0065712_10072246 3300005290 Bacteria 4834
49 Ga0065712_10080579 3300005290 Bacteria 3089
50 Ga0065712_10084814 3300005290 Bacteria 2739
51 Ga0065712_10109904 3300005290 Bacteria 1844
52 Ga0065715_10113921 3300005293 Bacteria 2470
53 Ga0070658_10051009 3300005327 Bacteria 3353
54 Ga0070658_10121863 3300005327 Bacteria 2167
55 Ga0070683_100000327 3300005329 Bacteria 32861
56 Ga0070683_100015832 3300005329 Bacteria 6632
57 Ga0070683_100047014 3300005329 Bacteria 3987
58 Ga0070683_100069592 3300005329 Bacteria 3281
59 Ga0070683_100160628 3300005329 Bacteria 2132
60 Ga0070683_100192250 3300005329 Bacteria 1938
61 Ga0070683_100208963 3300005329 Bacteria 1854
62 Ga0070690_100006021 3300005330 Bacteria 6857
63 Ga0070670_100002147 3300005331 Bacteria 16194
64 Ga0070670_100026886 3300005331 Bacteria 4949
65 Ga0070670_100088497 3300005331 Bacteria 2662
66 Ga0070670_100193003 3300005331 Bacteria 1769
67 Ga0070677_10105904 3300005333 Bacteria 1248
68 Ga0068869_100004838 3300005334 Bacteria 8409
69 Ga0068869_100007443 3300005334 Bacteria 6998
70 Ga0068869_100009710 3300005334 Bacteria 6249
71 Ga0068869_100033079 3300005334 Bacteria 3649
72 Ga0068869_100135103 3300005334 Bacteria 1899
73 Ga0070666_10010282 3300005335 Bacteria 5848
74 Ga0070666_10015901 3300005335 Bacteria 4806
75 Ga0070666_10057022 3300005335 Bacteria 2639
76 Ga0070680_100030529 3300005336 Bacteria 4329
77 Ga0070680_100039686 3300005336 Bacteria 3809
78 Ga0070682_100036209 3300005337 Unclassified 3016
79 Ga0068868_100001123 3300005338 Bacteria 18309
80 Ga0068868_100009009 3300005338 Bacteria 7164
81 Ga0068868_100155187 3300005338 Bacteria 1888
82 Ga0068868_100237886 3300005338 Archaea 1529
83 Ga0070660_100000435 3300005339 Bacteria 27665
84 Ga0070660_100243923 3300005339 Bacteria 1464
85 Ga0070689_100013812 3300005340 Bacteria 5850
86 Ga0070689_100014333 3300005340 Bacteria 5756
87 Ga0070689_100014980 3300005340 Bacteria 5645
88 Ga0070691_10087870 3300005341 Bacteria 1529
89 Ga0070661_100003284 3300005344 Bacteria 11166
90 Ga0070661_100011988 3300005344 Bacteria 6056
91 Ga0070661_100120125 3300005344 Unclassified 1968
92 Ga0070668_100165525 3300005347 Bacteria 1797
93 Ga0070669_100006429 3300005353 Bacteria 8458
94 Ga0070669_100014257 3300005353 Bacteria 5656
95 Ga0070669_100024594 3300005353 Bacteria 4320
96 Ga0070669_100038623 3300005353 Bacteria 3466
97 Ga0070675_100055992 3300005354 Bacteria 3248
98 Ga0070675_100117262 3300005354 Bacteria 2259
99 Ga0070671_100053038 3300005355 Bacteria 3371
100 Ga0070671_100144493 3300005355 Bacteria 2008
101 Ga0070671_100268721 3300005355 Bacteria 1449
102 Ga0070674_100020838 3300005356 Bacteria 4198
103 Ga0070673_100040106 3300005364 Bacteria 3590
104 Ga0070673_100042302 3300005364 Bacteria 3512
105 Ga0070673_100118290 3300005364 Bacteria 2206
106 Ga0070673_100149021 3300005364 Unclassified 1980
107 Ga0070673_100293831 3300005364 Bacteria 1429
108 Ga0070688_100084798 3300005365 Bacteria 2058
109 Ga0070659_100008871 3300005366 Bacteria 7367
110 Ga0070659_100009567 3300005366 Bacteria 7122
111 Ga0070659_100019255 3300005366 Bacteria 5168
112 Ga0070667_100018912 3300005367 Bacteria 5712
113 Ga0070667_100050896 3300005367 Bacteria 3491
114 Ga0070667_100222256 3300005367 Bacteria 1681
115 Ga0070700_100035240 3300005441 Bacteria 3027
116 Ga0070663_100209846 3300005455 Bacteria 1524
117 Ga0070663_100428230 3300005455 Bacteria 1087
118 Ga0070678_100011344 3300005456 Bacteria 5491
119 Ga0070678_100119505 3300005456 Bacteria 2076
120 Ga0070662_100000209 3300005457 Bacteria 34168
121 Ga0070662_100046050 3300005457 Bacteria 3133
122 Ga0070681_10012536 3300005458 Bacteria 8413
123 Ga0070681_10051031 3300005458 Bacteria 4126
124 Ga0070681_10102633 3300005458 Bacteria 2805
125 Ga0068867_100003103 3300005459 Bacteria 11709
126 Ga0068867_100039779 3300005459 Bacteria 3430
127 Ga0068867_100257655 3300005459 Unclassified 1421
128 Ga0068867_100274327 3300005459 Bacteria 1380
129 Ga0070685_10004060 3300005466 Bacteria 7394
130 Ga0070685_10123337 3300005466 Bacteria 1611
131 Ga0070685_10262349 3300005466 Unclassified 1149
132 Ga0070698_100000282 3300005471 Bacteria 51827
133 Ga0070698_100002541 3300005471 Bacteria 20094
134 Ga0070698_100006847 3300005471 Bacteria 12348
135 Ga0070679_100094063 3300005530 Bacteria 2984
136 Ga0070684_100000290 3300005535 Bacteria 34902
137 Ga0070684_100001419 3300005535 Bacteria 17242
138 Ga0070684_100080123 3300005535 Bacteria 2888
139 Ga0070684_100094748 3300005535 Bacteria 2659
140 Ga0068853_100009821 3300005539 Bacteria 7723
141 Ga0068853_100010194 3300005539 Bacteria 7596
142 Ga0068853_100029290 3300005539 Bacteria 4639
143 Ga0068853_100041203 3300005539 Bacteria 3943
144 Ga0068853_100087689 3300005539 Bacteria 2731
145 Ga0068853_100417602 3300005539 Bacteria 1258
146 Ga0070672_100008190 3300005543 Bacteria 7143
147 Ga0070672_100079570 3300005543 Bacteria 2624
148 Ga0070672_100147053 3300005543 Bacteria 1947
149 Ga0070686_100042729 3300005544 Bacteria 2841
150 Ga0070686_100072943 3300005544 Bacteria 2252
151 Ga0070665_100000014 3300005548 Bacteria 484881
152 Ga0070665_100229319 3300005548 Bacteria 1857
153 Ga0068855_100000081 3300005563 Bacteria 115707
154 Ga0068855_100013609 3300005563 Bacteria 9810
155 Ga0068855_100023253 3300005563 Bacteria 7424
156 Ga0068855_100024021 3300005563 Bacteria 7298
157 Ga0068855_100059131 3300005563 Bacteria 4486
158 Ga0068855_100062546 3300005563 Unclassified 4345
159 Ga0068855_100198910 3300005563 Bacteria 2257
160 Ga0068855_100680977 3300005563 Bacteria 1102
161 Ga0070664_100000509 3300005564 Bacteria 29514
162 Ga0070664_100005422 3300005564 Bacteria 10239
163 Ga0070664_100008601 3300005564 Bacteria 8259
164 Ga0070664_100391241 3300005564 Unclassified 1270
165 Ga0068857_100000579 3300005577 Bacteria 26747
166 Ga0068857_100002654 3300005577 Bacteria 14675
167 Ga0068857_100008029 3300005577 Bacteria 9102
168 Ga0068857_100073334 3300005577 Bacteria 3050
169 Ga0068857_100160766 3300005577 Bacteria 2038
170 Ga0068857_100164503 3300005577 Bacteria 2014
171 Ga0068854_100032309 3300005578 Bacteria 3641
172 Ga0068854_100046669 3300005578 Bacteria 3085
173 Ga0068854_100071526 3300005578 Bacteria 2538
174 Ga0068854_100093732 3300005578 Bacteria 2239
175 Ga0068856_100024646 3300005614 Bacteria 5857
176 Ga0068856_100054252 3300005614 Bacteria 3953
177 Ga0068856_100067961 3300005614 Bacteria 3522
178 Ga0068856_100077785 3300005614 Bacteria 3288
179 Ga0068852_100014577 3300005616 Bacteria 6057
180 Ga0068852_100035186 3300005616 Bacteria 4175
181 Ga0068852_100075342 3300005616 Bacteria 2976
182 Ga0068852_100090210 3300005616 Bacteria 2741
183 Ga0068852_100197709 3300005616 Bacteria 1901
184 Ga0068852_100366226 3300005616 Bacteria 1411
185 Ga0068852_100368481 3300005616 Unclassified 1407
186 Ga0068859_100000289 3300005617 Bacteria 49979
187 Ga0068859_100017809 3300005617 Bacteria 7141
188 Ga0068859_100086698 3300005617 Bacteria 3178
189 Ga0068864_100002659 3300005618 Bacteria 14761
190 Ga0068864_100004779 3300005618 Bacteria 11103
191 Ga0068864_100043128 3300005618 Bacteria 3862
192 Ga0068864_100088090 3300005618 Bacteria 2734
193 Ga0068864_100127278 3300005618 Bacteria 2284
194 Ga0068864_100257686 3300005618 Bacteria 1622
195 Ga0068864_100303098 3300005618 Unclassified 1496
196 Ga0068864_100644796 3300005618 Unclassified 1031
197 Ga0068866_10014018 3300005718 Bacteria 3530
198 Ga0068866_10031820 3300005718 Unclassified 2545
199 Ga0068861_100001502 3300005719 Bacteria 14807
200 Ga0068861_100020793 3300005719 Bacteria 4707
201 Ga0068861_100049553 3300005719 Bacteria 3181
202 Ga0068861_100164123 3300005719 Bacteria 1835
203 Ga0068861_100462228 3300005719 Bacteria 1139
204 Ga0068851_10008435 3300005834 Bacteria 4762
205 Ga0068870_10002263 3300005840 Bacteria 7992
206 Ga0068870_10095513 3300005840 Bacteria 1670
207 Ga0068863_100026959 3300005841 Bacteria 5479
208 Ga0068863_100405149 3300005841 Bacteria 1334
209 Ga0068863_100481938 3300005841 Bacteria 1220
210 Ga0068858_100104708 3300005842 Bacteria 2640
211 Ga0068858_100119796 3300005842 Bacteria 2460
212 Ga0068858_100527839 3300005842 Bacteria 1142
213 Ga0068860_100008699 3300005843 Bacteria 10113
214 Ga0068860_100054588 3300005843 Bacteria 3798
215 Ga0068860_100343310 3300005843 Unclassified 1468
216 Ga0068862_100011939 3300005844 Bacteria 7176
217 Ga0068862_100027366 3300005844 Bacteria 4799
218 Ga0068862_100058506 3300005844 Bacteria 3306
219 Ga0068862_100132285 3300005844 Bacteria 2207
220 Ga0068862_100306494 3300005844 Bacteria 1462
221 Ga0075366_10096980 3300006195 Bacteria 1768
222 Ga0097621_100000036 3300006237 Bacteria 67999
223 Ga0097621_100070027 3300006237 Bacteria 2896
224 Ga0097621_100215805 3300006237 Bacteria 1670
225 Ga0097621_100225479 3300006237 Unclassified 1634
226 Ga0068871_100005055 3300006358 Bacteria 9209
227 Ga0068871_100033550 3300006358 Bacteria 4066
228 Ga0068871_100326025 3300006358 Unclassified 1353
229 Ga0068871_100343538 3300006358 Unclassified 1318
230 Ga0075428_100006607 3300006844 Bacteria 12900
231 Ga0075428_100093975 3300006844 Bacteria 3269
232 Ga0075428_100152663 3300006844 Bacteria 2509
233 Ga0075428_100294134 3300006844 Bacteria 1746
234 Ga0075430_100104237 3300006846 Bacteria 2368
235 Ga0075430_100175362 3300006846 Bacteria 1783
236 Ga0075431_100055523 3300006847 Bacteria 4085
237 Ga0075431_100110345 3300006847 Bacteria 2839
238 Ga0075431_100127855 3300006847 Bacteria 2622
239 Ga0075431_100147598 3300006847 Unclassified 2423
240 Ga0075429_100000136 3300006880 Bacteria 44169
241 Ga0075429_100001725 3300006880 Bacteria 18078
242 Ga0068865_100095874 3300006881 Bacteria 2162
243 Ga0097620_100000289 3300006931 Bacteria 49979
244 Ga0097620_100017809 3300006931 Bacteria 7141
245 Ga0097620_100086694 3300006931 Bacteria 3178
246 Ga0097620_100446771 3300006931 Bacteria 1389
247 Ga0105240_10000106 3300009093 Bacteria 171825
248 Ga0105240_10000606 3300009093 Bacteria 66467
249 Ga0105240_10002298 3300009093 Bacteria 30947
250 Ga0105240_10003660 3300009093 Bacteria 23789
251 Ga0105240_10006503 3300009093 Bacteria 17166
252 Ga0105240_10062121 3300009093 Bacteria 4652
253 Ga0105240_10067774 3300009093 Bacteria 4423
254 Ga0105240_10085981 3300009093 Bacteria 3852
255 Ga0105240_10363012 3300009093 Bacteria 1640
256 Ga0111539_10000601 3300009094 Bacteria 46564
257 Ga0111539_10033061 3300009094 Bacteria 6280
258 Ga0111539_10077796 3300009094 Bacteria 3904
259 Ga0111539_10157727 3300009094 Bacteria 2655
260 Ga0111539_10571069 3300009094 Unclassified 1317
261 Ga0111539_10632485 3300009094 Bacteria 1246
262 Ga0105247_10001391 3300009101 Bacteria 17555
263 Ga0114129_10004956 3300009147 Bacteria 18775
264 Ga0114129_10007484 3300009147 Bacteria 15553
265 Ga0114129_10039792 3300009147 Bacteria 6631
266 Ga0114129_10138808 3300009147 Bacteria 3334
267 Ga0105243_10120919 3300009148 Bacteria 2207
268 Ga0105241_10004142 3300009174 Bacteria 10702
269 Ga0105241_10033823 3300009174 Bacteria 3839
270 Ga0105241_10034973 3300009174 Bacteria 3778
271 Ga0105241_10169024 3300009174 Bacteria 1804
272 Ga0105242_10078638 3300009176 Bacteria 2753
273 Ga0105242_10084012 3300009176 Bacteria 2667
274 Ga0105237_10003013 3300009545 Bacteria 20323
275 Ga0105237_10014210 3300009545 Bacteria 8336
276 Ga0105237_10016066 3300009545 Bacteria 7784
277 Ga0105237_10036411 3300009545 Bacteria 4980
278 Ga0105237_10137911 3300009545 Bacteria 2434
279 Ga0105237_10186331 3300009545 Bacteria 2075
280 Ga0105238_10002205 3300009551 Bacteria 19643
281 Ga0105238_10080747 3300009551 Bacteria 3241
282 Ga0105249_10000635 3300009553 Bacteria 32011
283 Ga0105249_10001404 3300009553 Bacteria 21086
284 Ga0105249_10044696 3300009553 Bacteria 4027
285 Ga0105249_10054284 3300009553 Unclassified 3664
286 Ga0105249_10144835 3300009553 Bacteria 2281
287 Ga0105249_10175047 3300009553 Bacteria 2084
288 Ga0105249_10455591 3300009553 Bacteria 1318
289 Ga0105239_10000404 3300010375 Bacteria 63332
290 Ga0105239_10006097 3300010375 Bacteria 14036
291 Ga0105239_10006227 3300010375 Bacteria 13883
292 Ga0105239_10015063 3300010375 Bacteria 8572
293 Ga0105239_10205164 3300010375 Bacteria 2209
294 Ga0105239_10347541 3300010375 Bacteria 1674
295 Ga0105246_10024851 3300011119 Bacteria 3899
296 Ga0105246_10039983 3300011119 Bacteria 3162
297 Ga0157373_10002753 3300013100 Bacteria 13315
298 Ga0157373_10026532 3300013100 Bacteria 4183
299 Ga0157371_10000009 3300013102 Bacteria 392895
300 Ga0157371_10000518 3300013102 Bacteria 46197
301 Ga0157371_10002698 3300013102 Bacteria 16766
302 Ga0157371_10004536 3300013102 Bacteria 12096
303 Ga0157371_10012494 3300013102 Bacteria 6489
304 Ga0157371_10036915 3300013102 Bacteria 3500
305 Ga0157371_10203478 3300013102 Bacteria 1420
306 Ga0157370_10000408 3300013104 Bacteria 54355
307 Ga0157370_10016291 3300013104 Bacteria 7532
308 Ga0157370_10018111 3300013104 Bacteria 7090
309 Ga0157370_10055556 3300013104 Bacteria 3771
310 Ga0157370_10061782 3300013104 Bacteria 3555
311 Ga0157370_10070626 3300013104 Bacteria 3296
312 Ga0157370_10087246 3300013104 Bacteria 2931
313 Ga0157370_10434281 3300013104 Bacteria 1207
314 Ga0157369_10000006 3300013105 Bacteria 412230
315 Ga0157369_10075403 3300013105 Bacteria 3617
316 Ga0157369_10182337 3300013105 Unclassified 2209
317 Ga0157369_10252579 3300013105 Bacteria 1840
318 Ga0157374_10000027 3300013296 Bacteria 233444
319 Ga0157374_10000587 3300013296 Bacteria 32144
320 Ga0157374_10000745 3300013296 Bacteria 28347
321 Ga0157374_10028707 3300013296 Bacteria 5028
322 Ga0157374_10062246 3300013296 Bacteria 3497
323 Ga0157374_10125984 3300013296 Bacteria 2476
324 Ga0157374_10184131 3300013296 Bacteria 2041
325 Ga0157378_10015554 3300013297 Bacteria 6664
326 Ga0157378_10035720 3300013297 Bacteria 4397
327 Ga0157378_10150092 3300013297 Bacteria 2171
328 Ga0157378_10330464 3300013297 Unclassified 1483
329 Ga0163162_10000177 3300013306 Bacteria 58576
330 Ga0163162_10002271 3300013306 Bacteria 18040
331 Ga0163162_10002571 3300013306 Bacteria 17169
332 Ga0163162_10002830 3300013306 Bacteria 16503
333 Ga0163162_10010645 3300013306 Bacteria 8945
334 Ga0163162_10023096 3300013306 Bacteria 6135
335 Ga0163162_10068630 3300013306 Bacteria 3597
336 Ga0163162_10077356 3300013306 Bacteria 3390
337 Ga0163162_10138178 3300013306 Bacteria 2548
338 Ga0163162_10172929 3300013306 Bacteria 2285
339 Ga0163162_10201986 3300013306 Bacteria 2116
340 Ga0163162_10434663 3300013306 Archaea 1445
341 Ga0157372_10002627 3300013307 Bacteria 19456
342 Ga0157372_10018986 3300013307 Bacteria 7399
343 Ga0157372_10022449 3300013307 Bacteria 6830
344 Ga0157372_10026460 3300013307 Bacteria 6312
345 Ga0157372_10029218 3300013307 Bacteria 6018
346 Ga0157372_10052938 3300013307 Bacteria 4522
347 Ga0157372_10078140 3300013307 Bacteria 3739
348 Ga0157372_10080014 3300013307 Bacteria 3697
349 Ga0157372_10117112 3300013307 Bacteria 3055
350 Ga0157372_10190194 3300013307 Bacteria 2377
351 Ga0157372_10197822 3300013307 Bacteria 2328
352 Ga0157375_10000067 3300013308 Bacteria 110313
353 Ga0157375_10011638 3300013308 Bacteria 7774
354 Ga0157375_10085934 3300013308 Bacteria 3196
355 Ga0163163_10000432 3300014325 Bacteria 38603
356 Ga0163163_10014374 3300014325 Bacteria 7277
357 Ga0163163_10040694 3300014325 Bacteria 4540
358 Ga0163163_10107022 3300014325 Bacteria 2823
359 Ga0163163_10128193 3300014325 Bacteria 2576
360 Ga0163163_10172155 3300014325 Bacteria 2212
361 Ga0157380_10000018 3300014326 Bacteria 116537
362 Ga0157380_10028507 3300014326 Bacteria 4257
363 Ga0157380_10050708 3300014326 Bacteria 3279
364 Ga0157380_10069798 3300014326 Bacteria 2837
365 Ga0157380_10102592 3300014326 Bacteria 2385
366 Ga0157380_10370164 3300014326 Bacteria 1348
367 Ga0157379_10008380 3300014968 Bacteria 8984
368 Ga0157379_10028680 3300014968 Bacteria 4950
369 Ga0157379_10059561 3300014968 Bacteria 3414
370 Ga0157376_10000341 3300014969 Bacteria 31058
371 Ga0157376_10115471 3300014969 Bacteria 2370
372 Ga0157376_10154924 3300014969 Bacteria 2070
373 Ga0157376_10213854 3300014969 Bacteria 1782
374 Ga0157376_10419471 3300014969 Bacteria 1298
375 Ga0182006_1000322 3300015261 Bacteria 41718
376 Ga0182006_1000622 3300015261 Bacteria 25427
377 Ga0182007_10000001 3300015262 Bacteria 1127301
378 Ga0182005_1000097 3300015265 Bacteria 66720
379 Ga0183373_1006 3300015682 Bacteria 328276
380 Ga0163161_10001724 3300017792 Bacteria 16022
381 Ga0163161_10002308 3300017792 Bacteria 13670
382 Ga0163161_10059225 3300017792 Bacteria 2784
383 Ga0163161_10060984 3300017792 Bacteria 2746
384 Ga0163161_10072665 3300017792 Bacteria 2519
385 Ga0163161_10267700 3300017792 Bacteria 1336
386 Ga0213876_10001574 3300021384 Bacteria 14029
387 Ga0209436_100324 3300025208 Bacteria 21828
388 Ga0209436_114708 3300025208 Bacteria 1237
389 Ga0209258_100302 3300025242 Bacteria 79794
390 Ga0209258_108334 3300025242 Bacteria 1464
391 Ga0207425_1000007 3300025245 Bacteria 777411
392 Ga0209148_1000131 3300025254 Bacteria 174079
393 Ga0209129_1000006 3300025258 Bacteria 777761
394 Ga0209673_1000203 3300025273 Bacteria 119623
395 Ga0209130_1001297 3300025284 Bacteria 17208
396 Ga0209676_1000001 3300025292 Bacteria 1852142
397 Ga0209025_1000025 3300025294 Bacteria 524454
398 Ga0209564_1022859 3300025295 Bacteria 2192
399 Ga0209564_1022867 3300025295 Bacteria 2192
400 Ga0209758_1000016 3300025297 Bacteria 778557
401 Ga0209050_1000016 3300025298 Bacteria 729149
402 Ga0209050_1000888 3300025298 Bacteria 39848
403 Ga0209050_1037458 3300025298 Bacteria 1398
404 Ga0207426_1000024 3300025302 Bacteria 534075
405 Ga0207426_1000806 3300025302 Bacteria 33910
406 Ga0207426_1017306 3300025302 Bacteria 2565
407 Ga0209257_1000070 3300025304 Bacteria 336454
408 Ga0209257_1002474 3300025304 Bacteria 18274
409 Ga0207697_10028263 3300025315 Unclassified 2294
410 Ga0207697_10051444 3300025315 Bacteria 1702
411 Ga0207682_10107132 3300025893 Bacteria 1227
412 Ga0207710_10000673 3300025900 Bacteria 19242
413 Ga0207710_10102145 3300025900 Bacteria 1353
414 Ga0207688_10002217 3300025901 Bacteria 10462
415 Ga0207680_10036735 3300025903 Bacteria 2823
416 Ga0207680_10043288 3300025903 Bacteria 2640
417 Ga0207680_10190488 3300025903 Bacteria 1392
418 Ga0207647_10000210 3300025904 Bacteria 47384
419 Ga0207647_10006574 3300025904 Bacteria 8445
420 Ga0207647_10044652 3300025904 Bacteria 2767
421 Ga0207685_10012593 3300025905 Bacteria 2586
422 Ga0207645_10002084 3300025907 Bacteria 16005
423 Ga0207645_10012266 3300025907 Bacteria 5821
424 Ga0207645_10077695 3300025907 Bacteria 2127
425 Ga0207645_10142380 3300025907 Bacteria 1563
426 Ga0207645_10155718 3300025907 Bacteria 1493
427 Ga0207643_10106547 3300025908 Bacteria 1648
428 Ga0207643_10179534 3300025908 Unclassified 1280
429 Ga0207654_10017862 3300025911 Bacteria 3716
430 Ga0207654_10062096 3300025911 Bacteria 2188
431 Ga0207707_10096103 3300025912 Unclassified 2589
432 Ga0207707_10285942 3300025912 Unclassified 1427
433 Ga0207695_10000087 3300025913 Bacteria 276412
434 Ga0207695_10000685 3300025913 Bacteria 66448
435 Ga0207695_10000917 3300025913 Bacteria 52754
436 Ga0207695_10001873 3300025913 Bacteria 32931
437 Ga0207695_10028845 3300025913 Bacteria 6143
438 Ga0207695_10038240 3300025913 Bacteria 5169
439 Ga0207695_10118885 3300025913 Bacteria 2613
440 Ga0207671_10000637 3300025914 Bacteria 45954
441 Ga0207671_10004496 3300025914 Bacteria 13275
442 Ga0207671_10011235 3300025914 Bacteria 7305
443 Ga0207671_10051595 3300025914 Bacteria 3048
444 Ga0207671_10053268 3300025914 Bacteria 2998
445 Ga0207660_10021719 3300025917 Bacteria 4319
446 Ga0207662_10064031 3300025918 Bacteria 2211
447 Ga0207657_10004066 3300025919 Bacteria 15521
448 Ga0207657_10105987 3300025919 Bacteria 2326
449 Ga0207649_10000567 3300025920 Bacteria 25427
450 Ga0207649_10007810 3300025920 Bacteria 5820
451 Ga0207649_10021250 3300025920 Bacteria 3733
452 Ga0207652_10000771 3300025921 Bacteria 30684
453 Ga0207652_10007027 3300025921 Bacteria 9072
454 Ga0207681_10010977 3300025923 Bacteria 5563
455 Ga0207681_10034340 3300025923 Bacteria 3334
456 Ga0207681_10034444 3300025923 Bacteria 3330
457 Ga0207681_10119055 3300025923 Bacteria 1934
458 Ga0207681_10282478 3300025923 Bacteria 1307
459 Ga0207694_10004594 3300025924 Bacteria 10748
460 Ga0207694_10016687 3300025924 Bacteria 5550
461 Ga0207650_10001513 3300025925 Bacteria 16609
462 Ga0207650_10061492 3300025925 Bacteria 2804
463 Ga0207650_10232685 3300025925 Bacteria 1487
464 Ga0207650_10273390 3300025925 Bacteria 1374
465 Ga0207659_10032388 3300025926 Bacteria 3587
466 Ga0207659_10049585 3300025926 Bacteria 2979
467 Ga0207659_10065881 3300025926 Bacteria 2627
468 Ga0207687_10123453 3300025927 Bacteria 1940
469 Ga0207644_10131582 3300025931 Unclassified 1916
470 Ga0207644_10157076 3300025931 Bacteria 1765
471 Ga0207644_10384966 3300025931 Bacteria 1144
472 Ga0207690_10003267 3300025932 Bacteria 9722
473 Ga0207690_10010426 3300025932 Bacteria 5522
474 Ga0207690_10087329 3300025932 Bacteria 2194
475 Ga0207690_10276472 3300025932 Bacteria 1306
476 Ga0207706_10003474 3300025933 Bacteria 15037
477 Ga0207706_10010648 3300025933 Bacteria 8399
478 Ga0207706_10012403 3300025933 Bacteria 7765
479 Ga0207706_10017700 3300025933 Bacteria 6420
480 Ga0207706_10052797 3300025933 Bacteria 3588
481 Ga0207670_10039676 3300025936 Bacteria 3085
482 Ga0207670_10042328 3300025936 Bacteria 3001
483 Ga0207669_10023300 3300025937 Bacteria 3305
484 Ga0207669_10024850 3300025937 Bacteria 3227
485 Ga0207704_10006232 3300025938 Bacteria 5547
486 Ga0207704_10009596 3300025938 Bacteria 4677
487 Ga0207704_10112509 3300025938 Bacteria 1844
488 Ga0207704_10194021 3300025938 Unclassified 1480
489 Ga0207691_10063280 3300025940 Bacteria 3355
490 Ga0207689_10000843 3300025942 Bacteria 29516
491 Ga0207689_10007268 3300025942 Bacteria 9723
492 Ga0207689_10008486 3300025942 Bacteria 8952
493 Ga0207689_10031074 3300025942 Bacteria 4448
494 Ga0207689_10043750 3300025942 Bacteria 3701
495 Ga0207689_10058060 3300025942 Bacteria 3183
496 Ga0207689_10065028 3300025942 Bacteria 3000
497 Ga0207689_10201162 3300025942 Bacteria 1644
498 Ga0207661_10000411 3300025944 Bacteria 27626
499 Ga0207661_10007500 3300025944 Bacteria 7759
500 Ga0207661_10045221 3300025944 Bacteria 3484
501 Ga0207679_10000297 3300025945 Bacteria 37427
502 Ga0207679_10000800 3300025945 Bacteria 20460
503 Ga0207679_10069473 3300025945 Bacteria 2651
504 Ga0207667_10000172 3300025949 Bacteria 95455
505 Ga0207667_10008374 3300025949 Bacteria 12289
506 Ga0207667_10031326 3300025949 Bacteria 5742
507 Ga0207667_10055066 3300025949 Bacteria 4182
508 Ga0207667_10602907 3300025949 Bacteria 1107
509 Ga0207667_10638672 3300025949 Bacteria 1071
510 Ga0207651_10009901 3300025960 Bacteria 5248
511 Ga0207651_10017040 3300025960 Bacteria 4279
512 Ga0207651_10020151 3300025960 Bacteria 4018
513 Ga0207651_10027456 3300025960 Bacteria 3575
514 Ga0207651_10098862 3300025960 Bacteria 2159
515 Ga0207651_10317908 3300025960 Bacteria 1300
516 Ga0207712_10001470 3300025961 Bacteria 16071
517 Ga0207712_10002610 3300025961 Bacteria 11559
518 Ga0207712_10017162 3300025961 Bacteria 4697
519 Ga0207712_10315442 3300025961 Unclassified 1288
520 Ga0207668_10130649 3300025972 Bacteria 1917
521 Ga0207668_10330547 3300025972 Unclassified 1268
522 Ga0207640_10035190 3300025981 Bacteria 3132
523 Ga0207640_10197708 3300025981 Bacteria 1521
524 Ga0207640_10201479 3300025981 Unclassified 1509
525 Ga0207658_10192703 3300025986 Unclassified 1696
526 Ga0207677_10000816 3300026023 Bacteria 17807
527 Ga0207677_10039609 3300026023 Bacteria 3101
528 Ga0207677_10103563 3300026023 Unclassified 2101
529 Ga0207677_10174711 3300026023 Archaea 1684
530 Ga0207703_10027443 3300026035 Bacteria 4485
531 Ga0207703_10222294 3300026035 Bacteria 1689
532 Ga0207703_10335913 3300026035 Bacteria 1387
533 Ga0207639_10001395 3300026041 Bacteria 16309
534 Ga0207639_10002886 3300026041 Bacteria 11551
535 Ga0207639_10055557 3300026041 Bacteria 3031
536 Ga0207639_10074264 3300026041 Unclassified 2669
537 Ga0207678_10033889 3300026067 Unclassified 4448
538 Ga0207708_10020703 3300026075 Bacteria 4961
539 Ga0207708_10231220 3300026075 Bacteria 1484
540 Ga0207702_10085938 3300026078 Unclassified 2742
541 Ga0207702_10145534 3300026078 Bacteria 2150
542 Ga0207702_10189987 3300026078 Bacteria 1897
543 Ga0207641_10128901 3300026088 Bacteria 2269
544 Ga0207648_10000384 3300026089 Bacteria 48937
545 Ga0207648_10010983 3300026089 Bacteria 8553
546 Ga0207648_10026353 3300026089 Bacteria 5167
547 Ga0207648_10057208 3300026089 Bacteria 3402
548 Ga0207648_10057945 3300026089 Bacteria 3379
549 Ga0207648_10350676 3300026089 Unclassified 1330
550 Ga0207676_10009634 3300026095 Bacteria 6874
551 Ga0207676_10012634 3300026095 Bacteria 6058
552 Ga0207676_10054242 3300026095 Bacteria 3141
553 Ga0207676_10084359 3300026095 Bacteria 2590
554 Ga0207676_10336798 3300026095 Unclassified 1390
555 Ga0207674_10004626 3300026116 Bacteria 16516
556 Ga0207674_10012404 3300026116 Bacteria 9527
557 Ga0207674_10025239 3300026116 Bacteria 6342
558 Ga0207674_10090545 3300026116 Bacteria 3050
559 Ga0207674_10128342 3300026116 Bacteria 2500
560 Ga0207674_10208408 3300026116 Bacteria 1904
561 Ga0207674_10249965 3300026116 Bacteria 1720
562 Ga0207674_10325876 3300026116 Bacteria 1486
563 Ga0207674_10460949 3300026116 Bacteria 1228
564 Ga0207675_100009007 3300026118 Bacteria 9365
565 Ga0207675_100012296 3300026118 Bacteria 7996
566 Ga0207675_100055186 3300026118 Bacteria 3706
567 Ga0207675_100139269 3300026118 Bacteria 2304
568 Ga0207683_10004211 3300026121 Bacteria 12434
569 Ga0207683_10007595 3300026121 Bacteria 9286
570 Ga0207698_10018321 3300026142 Bacteria 4769
571 Ga0207698_10032497 3300026142 Bacteria 3781
572 Ga0207698_10037614 3300026142 Bacteria 3566
573 Ga0207698_10080910 3300026142 Bacteria 2619
574 Ga0207698_10087442 3300026142 Bacteria 2538
575 Ga0207698_10302729 3300026142 Bacteria 1489
576 Ga0207428_10047103 3300027907 Bacteria 3463
577 Ga0268266_10000048 3300028379 Bacteria 310336
578 Ga0268265_10009060 3300028380 Bacteria 6731
579 Ga0268265_10073620 3300028380 Unclassified 2669
580 Ga0268265_10102517 3300028380 Bacteria 2315
581 Ga0268265_10292943 3300028380 Bacteria 1462
582 Ga0268264_10001761 3300028381 Bacteria 19835
583 Ga0268264_10006470 3300028381 Bacteria 9862
584 Ga0268264_10006760 3300028381 Bacteria 9638
585 Ga0268264_10010034 3300028381 Bacteria 7841
586 Ga0268264_10028275 3300028381 Bacteria 4585
587 Ga0268264_10037291 3300028381 Bacteria 4007
588 Ga0268264_10086516 3300028381 Bacteria 2693
589 Ga0268264_10353553 3300028381 Bacteria 1399
590 Ga0307517_10099816 3300028786 Bacteria 2298
591 Ga0307515_10000001 3300028794 Bacteria 4259510
592 Ga0307515_10104701 3300028794 Bacteria 3377
593 Ga0265338_10000651 3300028800 Bacteria 59980
594 Ga0265324_10016585 3300029957 Unclassified 2686
595 Ga0307511_10000002 3300030521 Bacteria 199923
596 Ga0265327_10000024 3300031251 Bacteria 382499
597 Ga0265327_10000611 3300031251 Bacteria 59062
598 Ga0265327_10023609 3300031251 Bacteria 3639
599 Ga0307513_10104373 3300031456 Unclassified 2848
600 Ga0307513_10178269 3300031456 Bacteria 1992
601 Ga0307513_10279393 3300031456 Unclassified 1448
602 Ga0307408_100035930 3300031548 Bacteria 3480
603 Ga0307408_100047911 3300031548 Bacteria 3063
604 Ga0307516_10000159 3300031730 Bacteria 84553
605 Ga0307405_10000010 3300031731 Bacteria 250978
606 Ga0307405_10011620 3300031731 Bacteria 4626
607 Ga0307413_10084608 3300031824 Bacteria 2045
608 Ga0307413_10415306 3300031824 Bacteria 1058
609 Ga0307410_10038701 3300031852 Bacteria 3126
610 Ga0307410_10047385 3300031852 Bacteria 2872
611 Ga0307406_10042856 3300031901 Bacteria 2828
612 Ga0307407_10000042 3300031903 Bacteria 65025
613 Ga0307407_10016140 3300031903 Bacteria 3711
614 Ga0307412_10007998 3300031911 Bacteria 6029
615 Ga0307412_10047391 3300031911 Bacteria 2823
616 Ga0307416_100000019 3300032002 Bacteria 199706
617 Ga0307416_100000227 3300032002 Bacteria 29912
618 Ga0307414_10000306 3300032004 Bacteria 28470
619 Ga0307414_10002825 3300032004 Bacteria 9156
620 Ga0307414_10032781 3300032004 Bacteria 3425
621 Ga0307414_10082052 3300032004 Bacteria 2363
622 Ga0307414_10122685 3300032004 Bacteria 2001
623 Ga0307411_10012364 3300032005 Bacteria 4656
624 Ga0307411_10373447 3300032005 Bacteria 1170
625 Ga0307415_100001349 3300032126 Bacteria 11675
626 Ga0373923_0089517 3300035111 Bacteria 1344
627 Ga0373957_0061332 3300035120 Bacteria 1457
628 Ga0373943_0010590 3300035170 Bacteria 4136
629 Ga0373955_0025009 3300035172 Bacteria 3061
630 Ga0373924_0107162 3300035410 Bacteria 1205
631 Ga0373935_0056690 3300035692 Unclassified 2499
632 Ga0373933_0036103 3300035724 Bacteria 2891
633 Ga0373947_0166463 3300035725 Bacteria 1428
634 Ga0373937_0023277 3300036401 Bacteria 5576
635 Ga0395899_0176928 3300037312 Bacteria 1500
636 Ga0395900_0156079 3300037418 Bacteria 2331
637 Ga0395900_0287650 3300037418 Bacteria 1633
638 Ga0395898_0010318 3300037466 Bacteria 9772
639 Ga0395898_0059676 3300037466 Bacteria 3710
640 Ga0395898_0126493 3300037466 Bacteria 2448
641 Ga0395905_0021187 3300037471 Bacteria 6152
642 Ga0395905_0163871 3300037471 Bacteria 2089
643 Ga0395901_0063597 3300038443 Bacteria 3840
644 Ga0395901_0192630 3300038443 Bacteria 2138
645 Ga0395901_0595718 3300038443 Bacteria 1115
646 Ga0395901_0605526 3300038443 Bacteria 1104
647 Ga0436365_1249677 3300039437 Bacteria 17339
648 Ga0439436_0002706 3300041404 Bacteria 5349
649 Ga0439461_0012376 3300041410 Bacteria 1596
650 Ga0451793_1329962 3300041452 Bacteria 1090
651 Ga0451804_1149675 3300041463 Bacteria 1178
652 Ga0451843_0703108 3300041509 Unclassified 988
653 Ga0439449_0002729 3300042007 Bacteria 6868
654 Ga0439449_0024418 3300042007 Bacteria 2260
655 Ga0439457_002111 3300042014 Bacteria 5781
656 Ga0439462_0004635 3300042015 Bacteria 3362
657 Ga0439462_0008387 3300042015 Bacteria 2604
658 Ga0450923_000505 3300042125 Bacteria 4323
659 Ga0451577_0006113 3300042876 Bacteria 12094
660 Ga0451577_0123920 3300042876 Bacteria 2316
661 Ga0451577_0345943 3300042876 Unclassified 1349
662 Ga0466969_0000127 3300044656 Bacteria 41196
663 Ga0466969_0061212 3300044656 Unclassified 1829
664 Ga0466972_0000080 3300044658 Bacteria 89226
665 Ga0453683_0259989 3300044673 Bacteria 1107
666 Ga0466965_0102220 3300044683 Bacteria 1466
667 Ga0466966_0000120 3300044684 Bacteria 49271
668 Ga0466961_0064528 3300044693 Bacteria 2327
669 Ga0466964_0041728 3300044706 Bacteria 1857
670 Ga0453684_0108162 3300044712 Bacteria 3384
671 Ga0453684_0147752 3300044712 Bacteria 2797
672 Ga0466970_0136481 3300044765 Bacteria 1349
673 Ga0466957_0000380 3300044842 Bacteria 21740
674 Ga0466957_0010728 3300044842 Bacteria 5269
675 Ga0466957_0022142 3300044842 Bacteria 3747
676 Ga0466957_0105888 3300044842 Bacteria 1778
677 Ga0466959_0000014 3300045049 Bacteria 150962
678 Ga0466959_0024738 3300045049 Bacteria 4448
679 Ga0451576_0544710 3300045051 Bacteria 1219
680 Ga0495627_044497 3300046453 Bacteria 1355
681 Ga0495592_0129451 3300046454 Bacteria 1767
682 Ga0495638_0000040 3300046460 Bacteria 241883
683 Ga0495638_0220178 3300046460 Unclassified 1061
684 Ga0495653_0064121 3300046463 Bacteria 2769
685 Ga0495650_0031064 3300046471 Bacteria 2409
686 Ga0495580_0341116 3300046472 Bacteria 1016
687 Ga0495664_0202465 3300046477 Bacteria 1203
688 Ga0495606_0005804 3300046507 Bacteria 11654
689 Ga0495610_0000035 3300046512 Bacteria 189683
690 Ga0495610_0015914 3300046512 Bacteria 4350
691 Ga0495628_0027888 3300046516 Bacteria 4591
692 Ga0495630_0063686 3300046517 Bacteria 2770
693 Ga0495587_0066048 3300046536 Bacteria 2111
694 Ga0495621_0036727 3300046539 Bacteria 1702
695 Ga0495633_0000125 3300046558 Bacteria 104459
696 Ga0495633_0133656 3300046558 Bacteria 1148
697 Ga0495668_0002554 3300046616 Bacteria 14799
698 Ga0495634_0009802 3300046642 Bacteria 7051
699 Ga0495611_0000354 3300046648 Bacteria 29975
700 Ga0495611_0102676 3300046648 Bacteria 1329
701 Ga0495635_0104075 3300046663 Bacteria 1940
702 Ga0495658_0046740 3300046683 Bacteria 2435
703 Ga0495636_0000060 3300047318 Bacteria 47278
704 Ga0495672_0010446 3300047320 Bacteria 6613
705 Ga0495672_0021009 3300047320 Unclassified 4265
706 Ga0495672_0028859 3300047320 Bacteria 3503
707 Ga0495680_0273032 3300047322 Bacteria 1193
708 Ga0495687_000261 3300047443 Bacteria 71090
709 Ga0495686_0000005 3300047472 Bacteria 827143
710 Ga0495686_0007643 3300047472 Bacteria 8070
711 Ga0495686_0056486 3300047472 Bacteria 2452
712 Ga0496106_0348409 3300048909 Unclassified 1190
713 Ga0496110_0055506 3300048913 Bacteria 3486
714 Ga0496111_0098458 3300048914 Bacteria 2147
715 Ga0496114_0094838 3300048917 Bacteria 2539
716 Ga0496121_0000081 3300048924 Bacteria 229506
717 Ga0496126_0042525 3300048929 Bacteria 4196
718 Ga0501031_0143800 3300049568 Bacteria 1558
719 Ga0501032_0004132 3300049569 Bacteria 11001
720 Ga0501032_0086164 3300049569 Bacteria 2088
721 Ga0501032_0148383 3300049569 Bacteria 1543
722 Ga0501033_0017643 3300049570 Bacteria 5391
723 Ga0501033_0113556 3300049570 Bacteria 1970
724 Ga0501034_0007421 3300049571 Bacteria 11669
725 Ga0501034_0213240 3300049571 Bacteria 1885
726 Ga0501034_0241907 3300049571 Bacteria 1750
727 Ga0501036_0034595 3300049572 Bacteria 4274
728 Ga0501036_0124345 3300049572 Bacteria 2178
729 Ga0501037_0031925 3300049573 Bacteria 3888
730 Ga0501037_0033161 3300049573 Bacteria 3814
731 Ga0501038_0017313 3300049574 Bacteria 6515
732 Ga0501038_0030627 3300049574 Bacteria 4758
733 Ga0501038_0104439 3300049574 Bacteria 2355
734 Ga0501038_0161412 3300049574 Bacteria 1821
735 Ga0501043_0003893 3300049579 Bacteria 12252
736 Ga0501043_0030664 3300049579 Bacteria 4227
737 Ga0501043_0068367 3300049579 Unclassified 2789
738 Ga0501046_0089336 3300049580 Bacteria 2372
739 Ga0501046_0220574 3300049580 Bacteria 1404
740 Ga0501047_0013596 3300049581 Bacteria 7720
741 Ga0501047_0082793 3300049581 Bacteria 3084
742 Ga0501047_0169887 3300049581 Bacteria 2050
743 Ga0501047_0348637 3300049581 Bacteria 1317
744 Ga0501048_0006258 3300049582 Bacteria 9053
745 Ga0501067_0036099 3300049583 Bacteria 2745
746 Ga0501070_0078985 3300049586 Bacteria 2723
747 Ga0501070_0082958 3300049586 Bacteria 2653
748 Ga0501073_0006651 3300049589 Bacteria 8610
749 Ga0501074_0002599 3300049590 Bacteria 12616
750 Ga0501202_004033 3300049652 Bacteria 2552
751 Ga0501207_003749 3300049654 Bacteria 2038
752 Ga0501216_011083 3300049660 Bacteria 1460
753 Ga0501217_000586 3300049661 Bacteria 6138
754 Ga0501217_004764 3300049661 Bacteria 2803
755 Ga0501222_001557 3300049662 Bacteria 3197
756 Ga0501240_000977 3300049673 Bacteria 2632
757 Ga0501243_007387 3300049675 Bacteria 1679
758 Ga0501257_026722 3300049686 Bacteria 1379
759 Ga0501219_000133 3300049703 Bacteria 13105
760 Ga0501221_002892 3300049704 Bacteria 2829
761 Ga0501225_0000505 3300049705 Bacteria 12150
762 Ga0501225_0012912 3300049705 Bacteria 2342
763 Ga0501225_0030894 3300049705 Bacteria 1474
764 Ga0501079_0049322 3300049741 Bacteria 3249
765 Ga0501080_0030856 3300049742 Bacteria 4994
766 Ga0501083_0015427 3300049744 Bacteria 5350
767 Ga0501083_0205002 3300049744 Unclassified 1286
768 Ga0501241_003764 3300049758 Bacteria 2858
769 Ga0501264_000116 3300049761 Bacteria 12192
770 Ga0501035_0002433 3300049822 Bacteria 18202
771 Ga0501035_0007289 3300049822 Bacteria 10349
772 Ga0501035_0261765 3300049822 Bacteria 1466
773 Ga0501044_0013650 3300049823 Bacteria 8779
774 Ga0501044_0016689 3300049823 Bacteria 7884
775 Ga0501044_0021227 3300049823 Bacteria 6932
776 Ga0501044_0158829 3300049823 Bacteria 2239
777 Ga0501044_0447847 3300049823 Bacteria 1198
778 Ga0501044_0538019 3300049823 Bacteria 1066
779 Ga0501045_0135871 3300049824 Bacteria 1828
780 Ga0501284_00007 3300050005 Bacteria 147956
781 nmdc:mga0k408_54752_c1 3300050493 Bacteria 2312
782 nmdc:mga05p37_827_c1 3300050507 Bacteria 34726
783 nmdc:mga09592_5573_c1 3300050508 Bacteria 10252
784 nmdc:mga0qj67_115904_c1 3300050509 Bacteria 2165
785 nmdc:mga0qj67_154999_c1 3300050509 Bacteria 1859
786 nmdc:mga06r32_338867_c1 3300050510 Bacteria 1488
787 nmdc:mga08y16_110978_c1 3300050511 Bacteria 2855
788 nmdc:mga08y16_143375_c1 3300050511 Bacteria 2483
789 nmdc:mga08y16_198399_c1 3300050511 Bacteria 2080
790 nmdc:mga08y16_33793_c1 3300050511 Bacteria 5371
791 nmdc:mga08y16_57703_c1 3300050511 Bacteria 4056
792 Ga0495619_0207720 3300053085 Bacteria 1356
793 Ga0500578_0000836 3300053086 Bacteria 35575
794 Ga0500644_0000026 3300053088 Bacteria 93328
795 Ga0500644_0002655 3300053088 Bacteria 4465
796 Ga0500646_0013350 3300053090 Bacteria 2125
797 Ga0500583_0000001 3300053092 Bacteria 241642
798 Ga0500583_0002299 3300053092 Bacteria 5712
799 Ga0500651_0079068 3300053093 Bacteria 2039
800 Ga0500641_0004524 3300053096 Bacteria 4915
801 Ga0500556_0003125 3300053104 Bacteria 4944
802 Ga0500569_000047 3300053109 Bacteria 22066
803 Ga0500607_046686 3300053121 Bacteria 2321
804 Ga0500642_0001746 3300053130 Bacteria 6263
805 Ga0500658_0003491 3300053134 Bacteria 5931
806 Ga0500559_0002568 3300053136 Bacteria 9306
807 Ga0500568_0000142 3300053139 Bacteria 64049
808 Ga0500568_0003595 3300053139 Bacteria 8563
809 Ga0500573_0093276 3300053140 Bacteria 1699
810 Ga0500577_0006329 3300053142 Bacteria 3257
811 Ga0500588_0008757 3300053146 Bacteria 2378
812 Ga0500616_0002235 3300053153 Bacteria 16549
813 Ga0500616_0008249 3300053153 Bacteria 6493
814 Ga0500616_0015110 3300053153 Bacteria 4423
815 Ga0500622_0000692 3300053156 Bacteria 29667
816 Ga0500622_0005506 3300053156 Bacteria 7585
817 Ga0500633_0000782 3300053160 Bacteria 5422
818 Ga0500636_0005348 3300053177 Bacteria 7320
819 Ga0500637_0027758 3300053178 Bacteria 3127
820 Ga0500584_105703 3300053726 Bacteria 1149
821 Ga0500611_000003 3300053727 Bacteria 333431
822 Ga0500645_056904 3300053730 Bacteria 1134
823 Ga0501084_0041717 3300054114 Bacteria 3839
824 Ga0500661_005321 3300055283 Bacteria 2407
825 Ga0466962_0063789 3300061719 Unclassified 1759

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005354 Ga0070675_100117262 Ga0070675_1001172621 287
2 3300005618 Ga0068864_100088090 Ga0068864_1000880903 287
3 3300005289 Ga0065704_10101212 Ga0065704_101012121 289
4 3300005441 Ga0070700_100035240 Ga0070700_1000352402 289
5 3300026075 Ga0207708_10020703 Ga0207708_100207034 289
6 3300013100 Ga0157373_10002753 Ga0157373_1000275310 292
7 3300013102 Ga0157371_10002698 Ga0157371_1000269812 292
8 3300013307 Ga0157372_10026460 Ga0157372_100264605 292
9 3300037466 Ga0395898_0126493 Ga0395898_0126493_1158_2120 292
10 3300037471 Ga0395905_0021187 Ga0395905_0021187_2879_3841 292
11 3300037471 Ga0395905_0163871 Ga0395905_0163871_914_1876 292
12 3300038443 Ga0395901_0063597 Ga0395901_0063597_1361_2323 292
13 3300005458 Ga0070681_10012536 Ga0070681_100125362 293
14 3300005563 Ga0068855_100062546 Ga0068855_1000625462 293
15 3300013105 Ga0157369_10075403 Ga0157369_100754033 293
16 3300025912 Ga0207707_10096103 Ga0207707_100961033 293
17 3300025921 Ga0207652_10000771 Ga0207652_1000077123 293
18 3300026067 Ga0207678_10033889 Ga0207678_100338893 293
19 3300037418 Ga0395900_0287650 Ga0395900_0287650_407_1369 293
20 3300037466 Ga0395898_0010318 Ga0395898_0010318_4323_5285 293
21 3300038443 Ga0395901_0605526 Ga0395901_0605526_112_1074 293
22 3300006237 Ga0097621_100215805 Ga0097621_1002158051 294
23 3300009176 Ga0105242_10084012 Ga0105242_100840122 294
24 3300011119 Ga0105246_10039983 Ga0105246_100399832 294
25 3300013297 Ga0157378_10150092 Ga0157378_101500922 294
26 3300053726 Ga0500584_105703 Ga0500584_105703_250_1137 294
27 3300005841 Ga0068863_100481938 Ga0068863_1004819382 295
28 3300041509 Ga0451843_0703108 Ga0451843_0703108_37_942 295
29 3300053730 Ga0500645_056904 Ga0500645_056904_140_1036 295
30 3300005329 Ga0070683_100069592 Ga0070683_1000695922 296
31 3300005335 Ga0070666_10010282 Ga0070666_100102823 296
32 3300005340 Ga0070689_100013812 Ga0070689_1000138127 296
33 3300005355 Ga0070671_100053038 Ga0070671_1000530381 296
34 3300005535 Ga0070684_100080123 Ga0070684_1000801231 296
35 3300025893 Ga0207682_10107132 Ga0207682_101071321 297
36 3300005338 Ga0068868_100155187 Ga0068868_1001551872 298
37 3300005455 Ga0070663_100428230 Ga0070663_1004282301 298
38 3300005466 Ga0070685_10004060 Ga0070685_100040602 298
39 3300025914 Ga0207671_10011235 Ga0207671_100112353 298
40 3300026089 Ga0207648_10350676 Ga0207648_103506762 299
41 3300038443 Ga0395901_0192630 Ga0395901_0192630_1122_2084 299
42 3300003781 Ga0055536_1000011 Ga0055536_1000011169 300
43 3300005548 Ga0070665_100000014 Ga0070665_10000001428 300
44 3300025292 Ga0209676_1000001 Ga0209676_1000001784 300
45 3300025298 Ga0209050_1000016 Ga0209050_1000016449 300
46 3300025927 Ga0207687_10123453 Ga0207687_101234532 301
47 3300031548 Ga0307408_100035930 Ga0307408_1000359302 301
48 3300031901 Ga0307406_10042856 Ga0307406_100428562 301
49 3300031911 Ga0307412_10047391 Ga0307412_100473912 301
50 3300032005 Ga0307411_10012364 Ga0307411_100123642 301
51 3300053178 Ga0500637_0027758 Ga0500637_0027758_167_1135 302
52 3300005293 Ga0065715_10113921 Ga0065715_101139213 303
53 3300009094 Ga0111539_10077796 Ga0111539_100777962 304
54 3300027907 Ga0207428_10047103 Ga0207428_100471034 304
55 3300049569 Ga0501032_0148383 Ga0501032_0148383_536_1465 304
56 3300050511 nmdc:mga08y16_198399_c1 nmdc:mga08y16_198399_c1_411_1400 304
57 iso_pu_bacteria 2884634485 2884637094 304
58 3300005338 Ga0068868_100237886 Ga0068868_1002378861 305
59 3300005341 Ga0070691_10087870 Ga0070691_100878701 305
60 3300005367 Ga0070667_100018912 Ga0070667_1000189126 305
61 3300005367 Ga0070667_100050896 Ga0070667_1000508963 305
62 3300005578 Ga0068854_100046669 Ga0068854_1000466693 305
63 3300005616 Ga0068852_100035186 Ga0068852_1000351862 305
64 3300009553 Ga0105249_10175047 Ga0105249_101750471 305
65 3300013296 Ga0157374_10028707 Ga0157374_100287072 305
66 3300013306 Ga0163162_10010645 Ga0163162_100106452 305
67 3300025931 Ga0207644_10157076 Ga0207644_101570762 305
68 3300025932 Ga0207690_10276472 Ga0207690_102764722 305
69 3300025933 Ga0207706_10052797 Ga0207706_100527972 305
70 3300025936 Ga0207670_10042328 Ga0207670_100423283 305
71 3300025944 Ga0207661_10045221 Ga0207661_100452212 305
72 3300025949 Ga0207667_10602907 Ga0207667_106029071 305
73 3300026142 Ga0207698_10037614 Ga0207698_100376141 305
74 3300026142 Ga0207698_10087442 Ga0207698_100874423 305
75 3300031824 Ga0307413_10415306 Ga0307413_104153061 305
76 3300049686 Ga0501257_026722 Ga0501257_026722_67_984 305
77 3300005329 Ga0070683_100047014 Ga0070683_1000470145 306
78 3300005330 Ga0070690_100006021 Ga0070690_1000060212 306
79 3300005334 Ga0068869_100004838 Ga0068869_10000483810 306
80 3300005334 Ga0068869_100007443 Ga0068869_1000074435 306
81 3300005338 Ga0068868_100001123 Ga0068868_1000011232 306
82 3300005340 Ga0070689_100014980 Ga0070689_1000149805 306
83 3300005344 Ga0070661_100011988 Ga0070661_1000119883 306
84 3300005354 Ga0070675_100055992 Ga0070675_1000559922 306
85 3300005355 Ga0070671_100268721 Ga0070671_1002687212 306
86 3300005364 Ga0070673_100040106 Ga0070673_1000401062 306
87 3300005364 Ga0070673_100042302 Ga0070673_1000423022 306
88 3300005364 Ga0070673_100293831 Ga0070673_1002938312 306
89 3300005366 Ga0070659_100009567 Ga0070659_1000095677 306
90 3300005535 Ga0070684_100094748 Ga0070684_1000947482 306
91 3300005539 Ga0068853_100417602 Ga0068853_1004176021 306
92 3300005544 Ga0070686_100042729 Ga0070686_1000427292 306
93 3300005564 Ga0070664_100005422 Ga0070664_10000542213 306
94 3300005564 Ga0070664_100391241 Ga0070664_1003912411 306
95 3300005577 Ga0068857_100008029 Ga0068857_1000080292 306
96 3300005618 Ga0068864_100004779 Ga0068864_1000047798 306
97 3300005719 Ga0068861_100020793 Ga0068861_1000207934 306
98 3300005719 Ga0068861_100164123 Ga0068861_1001641232 306
99 3300006358 Ga0068871_100326025 Ga0068871_1003260252 306
100 3300009553 Ga0105249_10144835 Ga0105249_101448352 306
101 3300010375 Ga0105239_10205164 Ga0105239_102051642 306
102 3300013296 Ga0157374_10000587 Ga0157374_100005873 306
103 3300013296 Ga0157374_10000745 Ga0157374_100007459 306
104 3300013297 Ga0157378_10035720 Ga0157378_100357202 306
105 3300013306 Ga0163162_10002271 Ga0163162_100022712 306
106 3300013306 Ga0163162_10068630 Ga0163162_100686303 306
107 3300013307 Ga0157372_10197822 Ga0157372_101978222 306
108 3300013308 Ga0157375_10000067 Ga0157375_1000006743 306
109 3300013308 Ga0157375_10011638 Ga0157375_100116382 306
110 3300014325 Ga0163163_10172155 Ga0163163_101721553 306
111 3300014968 Ga0157379_10008380 Ga0157379_100083804 306
112 3300014968 Ga0157379_10059561 Ga0157379_100595612 306
113 3300025903 Ga0207680_10190488 Ga0207680_101904882 306
114 3300025904 Ga0207647_10000210 Ga0207647_1000021045 306
115 3300025907 Ga0207645_10012266 Ga0207645_100122664 306
116 3300025907 Ga0207645_10077695 Ga0207645_100776952 306
117 3300025920 Ga0207649_10007810 Ga0207649_100078107 306
118 3300025926 Ga0207659_10049585 Ga0207659_100495852 306
119 3300025931 Ga0207644_10384966 Ga0207644_103849662 306
120 3300025932 Ga0207690_10087329 Ga0207690_100873292 306
121 3300025933 Ga0207706_10003474 Ga0207706_1000347413 306
122 3300025933 Ga0207706_10010648 Ga0207706_100106482 306
123 3300025933 Ga0207706_10012403 Ga0207706_100124037 306
124 3300025940 Ga0207691_10063280 Ga0207691_100632802 306
125 3300025942 Ga0207689_10000843 Ga0207689_1000084315 306
126 3300025942 Ga0207689_10031074 Ga0207689_100310744 306
127 3300025944 Ga0207661_10007500 Ga0207661_100075005 306
128 3300025945 Ga0207679_10000800 Ga0207679_1000080016 306
129 3300025945 Ga0207679_10069473 Ga0207679_100694733 306
130 3300025960 Ga0207651_10017040 Ga0207651_100170402 306
131 3300025960 Ga0207651_10027456 Ga0207651_100274562 306
132 3300025981 Ga0207640_10201479 Ga0207640_102014791 306
133 3300026023 Ga0207677_10000816 Ga0207677_1000081613 306
134 3300026023 Ga0207677_10039609 Ga0207677_100396092 306
135 3300026023 Ga0207677_10103563 Ga0207677_101035632 306
136 3300026089 Ga0207648_10026353 Ga0207648_100263532 306
137 3300026095 Ga0207676_10009634 Ga0207676_100096342 306
138 3300026116 Ga0207674_10025239 Ga0207674_100252396 306
139 3300026116 Ga0207674_10325876 Ga0207674_103258762 306
140 3300026118 Ga0207675_100055186 Ga0207675_1000551862 306
141 3300035111 Ga0373923_0089517 Ga0373923_0089517_166_1086 306
142 3300035120 Ga0373957_0061332 Ga0373957_0061332_40_960 306
143 3300035170 Ga0373943_0010590 Ga0373943_0010590_1407_2327 306
144 3300035172 Ga0373955_0025009 Ga0373955_0025009_43_963 306
145 3300035410 Ga0373924_0107162 Ga0373924_0107162_38_958 306
146 3300035692 Ga0373935_0056690 Ga0373935_0056690_460_1380 306
147 3300035724 Ga0373933_0036103 Ga0373933_0036103_1610_2530 306
148 3300035725 Ga0373947_0166463 Ga0373947_0166463_35_955 306
149 3300036401 Ga0373937_0023277 Ga0373937_0023277_157_1077 306
150 3300038443 Ga0395901_0595718 Ga0395901_0595718_148_1068 306
151 3300046454 Ga0495592_0129451 Ga0495592_0129451_677_1597 306
152 3300046463 Ga0495653_0064121 Ga0495653_0064121_1247_2167 306
153 3300046477 Ga0495664_0202465 Ga0495664_0202465_108_1028 306
154 3300046516 Ga0495628_0027888 Ga0495628_0027888_819_1739 306
155 3300046517 Ga0495630_0063686 Ga0495630_0063686_94_1014 306
156 3300046536 Ga0495587_0066048 Ga0495587_0066048_464_1384 306
157 3300046642 Ga0495634_0009802 Ga0495634_0009802_5663_6583 306
158 3300046663 Ga0495635_0104075 Ga0495635_0104075_392_1312 306
159 3300046683 Ga0495658_0046740 Ga0495658_0046740_182_1102 306
160 3300047322 Ga0495680_0273032 Ga0495680_0273032_164_1084 306
161 3300048914 Ga0496111_0098458 Ga0496111_0098458_275_1195 306
162 3300048917 Ga0496114_0094838 Ga0496114_0094838_243_1163 306
163 3300049652 Ga0501202_004033 Ga0501202_004033_1159_2079 306
164 3300053085 Ga0495619_0207720 Ga0495619_0207720_182_1102 306
165 3300003320 rootH2_10166600 rootH2_101666002 307
166 3300005842 Ga0068858_100527839 Ga0068858_1005278391 307
167 3300014325 Ga0163163_10040694 Ga0163163_100406944 307
168 3300014968 Ga0157379_10028680 Ga0157379_100286802 307
169 3300026035 Ga0207703_10027443 Ga0207703_100274433 307
170 3300032004 Ga0307414_10000306 Ga0307414_1000030612 307
171 3300048913 Ga0496110_0055506 Ga0496110_0055506_1157_2119 307
172 3300031456 Ga0307513_10178269 Ga0307513_101782692 309
173 3300005616 Ga0068852_100366226 Ga0068852_1003662261 311
174 3300003215 JGI25153J46596_10023575 JGI25153J46596_100235753 314
175 3300003316 rootH1_10013495 rootH1_100134952 314
176 3300003320 rootH2_10039673 rootH2_100396732 314
177 3300003320 rootH2_10075767 rootH2_100757671 314
178 3300003320 rootH2_10135544 rootH2_101355444 314
179 3300003320 rootH2_10213033 rootH2_102130332 314
180 3300003322 rootL2_10023331 rootL2_100233311 314
181 3300003322 rootL2_10082800 rootL2_100828002 314
182 3300003323 rootH1_10044529 rootH1_100445294 314
183 3300003354 JGI25160J50197_1001239 JGI25160J50197_10012397 314
184 3300003761 Ga0055535_1003210 Ga0055535_10032103 314
185 3300003762 Ga0055542_1004148 Ga0055542_10041482 314
186 3300003790 Ga0055528_1001011 Ga0055528_10010113 314
187 3300003791 Ga0055530_10000880 Ga0055530_1000088017 314
188 3300003794 Ga0055531_10000054 Ga0055531_1000005479 314
189 3300004625 Ga0055543_1014584 Ga0055543_10145841 314
190 3300005262 Ga0065165_1000027 Ga0065165_1000027125 314
191 3300005290 Ga0065712_10072246 Ga0065712_100722464 314
192 3300005327 Ga0070658_10121863 Ga0070658_101218632 314
193 3300005329 Ga0070683_100015832 Ga0070683_1000158327 314
194 3300005329 Ga0070683_100160628 Ga0070683_1001606282 314
195 3300005329 Ga0070683_100208963 Ga0070683_1002089631 314
196 3300005331 Ga0070670_100088497 Ga0070670_1000884972 314
197 3300005331 Ga0070670_100193003 Ga0070670_1001930032 314
198 3300005333 Ga0070677_10105904 Ga0070677_101059041 314
199 3300005335 Ga0070666_10057022 Ga0070666_100570222 314
200 3300005336 Ga0070680_100030529 Ga0070680_1000305292 314
201 3300005336 Ga0070680_100039686 Ga0070680_1000396863 314
202 3300005339 Ga0070660_100000435 Ga0070660_10000043513 314
203 3300005339 Ga0070660_100243923 Ga0070660_1002439231 314
204 3300005356 Ga0070674_100020838 Ga0070674_1000208382 314
205 3300005366 Ga0070659_100008871 Ga0070659_1000088714 314
206 3300005455 Ga0070663_100209846 Ga0070663_1002098462 314
207 3300005458 Ga0070681_10051031 Ga0070681_100510312 314
208 3300005458 Ga0070681_10102633 Ga0070681_101026332 314
209 3300005530 Ga0070679_100094063 Ga0070679_1000940632 314
210 3300005535 Ga0070684_100001419 Ga0070684_1000014192 314
211 3300005539 Ga0068853_100010194 Ga0068853_1000101949 314
212 3300005539 Ga0068853_100041203 Ga0068853_1000412032 314
213 3300005539 Ga0068853_100087689 Ga0068853_1000876892 314
214 3300005543 Ga0070672_100079570 Ga0070672_1000795703 314
215 3300005548 Ga0070665_100229319 Ga0070665_1002293193 314
216 3300005563 Ga0068855_100000081 Ga0068855_10000008154 314
217 3300005563 Ga0068855_100013609 Ga0068855_1000136094 314
218 3300005563 Ga0068855_100023253 Ga0068855_1000232532 314
219 3300005563 Ga0068855_100024021 Ga0068855_1000240214 314
220 3300005563 Ga0068855_100198910 Ga0068855_1001989101 314
221 3300005563 Ga0068855_100680977 Ga0068855_1006809771 314
222 3300005577 Ga0068857_100002654 Ga0068857_1000026547 314
223 3300005578 Ga0068854_100071526 Ga0068854_1000715262 314
224 3300005614 Ga0068856_100054252 Ga0068856_1000542524 314
225 3300005614 Ga0068856_100077785 Ga0068856_1000777852 314
226 3300005616 Ga0068852_100075342 Ga0068852_1000753423 314
227 3300005616 Ga0068852_100090210 Ga0068852_1000902101 314
228 3300005616 Ga0068852_100197709 Ga0068852_1001977092 314
229 3300005617 Ga0068859_100017809 Ga0068859_1000178094 314
230 3300005840 Ga0068870_10095513 Ga0068870_100955132 314
231 3300005843 Ga0068860_100008699 Ga0068860_1000086995 314
232 3300005844 Ga0068862_100011939 Ga0068862_1000119394 314
233 3300006847 Ga0075431_100147598 Ga0075431_1001475982 314
234 3300006880 Ga0075429_100001725 Ga0075429_10000172514 314
235 3300006931 Ga0097620_100017809 Ga0097620_1000178094 314
236 3300009093 Ga0105240_10000106 Ga0105240_100001068 314
237 3300009093 Ga0105240_10000606 Ga0105240_1000060642 314
238 3300009093 Ga0105240_10002298 Ga0105240_1000229822 314
239 3300009093 Ga0105240_10003660 Ga0105240_100036603 314
240 3300009093 Ga0105240_10006503 Ga0105240_100065036 314
241 3300009093 Ga0105240_10062121 Ga0105240_100621214 314
242 3300009093 Ga0105240_10067774 Ga0105240_100677741 314
243 3300009093 Ga0105240_10363012 Ga0105240_103630122 314
244 3300009094 Ga0111539_10033061 Ga0111539_100330614 314
245 3300009094 Ga0111539_10571069 Ga0111539_105710691 314
246 3300009147 Ga0114129_10007484 Ga0114129_1000748411 314
247 3300009174 Ga0105241_10004142 Ga0105241_100041427 314
248 3300009174 Ga0105241_10169024 Ga0105241_101690242 314
249 3300009545 Ga0105237_10003013 Ga0105237_1000301313 314
250 3300009545 Ga0105237_10014210 Ga0105237_100142107 314
251 3300009545 Ga0105237_10036411 Ga0105237_100364112 314
252 3300009545 Ga0105237_10186331 Ga0105237_101863312 314
253 3300009551 Ga0105238_10002205 Ga0105238_1000220514 314
254 3300009551 Ga0105238_10080747 Ga0105238_100807472 314
255 3300009553 Ga0105249_10455591 Ga0105249_104555911 314
256 3300010375 Ga0105239_10000404 Ga0105239_1000040447 314
257 3300010375 Ga0105239_10006097 Ga0105239_1000609710 314
258 3300010375 Ga0105239_10006227 Ga0105239_1000622710 314
259 3300010375 Ga0105239_10015063 Ga0105239_100150632 314
260 3300010375 Ga0105239_10347541 Ga0105239_103475412 314
261 3300013102 Ga0157371_10000518 Ga0157371_1000051814 314
262 3300013102 Ga0157371_10004536 Ga0157371_100045361 314
263 3300013102 Ga0157371_10012494 Ga0157371_100124943 314
264 3300013102 Ga0157371_10036915 Ga0157371_100369153 314
265 3300013102 Ga0157371_10203478 Ga0157371_102034781 314
266 3300013104 Ga0157370_10000408 Ga0157370_1000040825 314
267 3300013104 Ga0157370_10018111 Ga0157370_100181114 314
268 3300013104 Ga0157370_10055556 Ga0157370_100555562 314
269 3300013104 Ga0157370_10070626 Ga0157370_100706262 314
270 3300013104 Ga0157370_10087246 Ga0157370_100872463 314
271 3300013105 Ga0157369_10182337 Ga0157369_101823372 314
272 3300013105 Ga0157369_10252579 Ga0157369_102525791 314
273 3300013296 Ga0157374_10000027 Ga0157374_1000002728 314
274 3300013297 Ga0157378_10330464 Ga0157378_103304642 314
275 3300013306 Ga0163162_10002571 Ga0163162_100025717 314
276 3300013306 Ga0163162_10201986 Ga0163162_102019862 314
277 3300013306 Ga0163162_10434663 Ga0163162_104346632 314
278 3300013307 Ga0157372_10002627 Ga0157372_1000262714 314
279 3300013307 Ga0157372_10018986 Ga0157372_100189866 314
280 3300013307 Ga0157372_10029218 Ga0157372_100292183 314
281 3300013307 Ga0157372_10052938 Ga0157372_100529383 314
282 3300013307 Ga0157372_10078140 Ga0157372_100781402 314
283 3300013307 Ga0157372_10190194 Ga0157372_101901943 314
284 3300014325 Ga0163163_10128193 Ga0163163_101281933 314
285 3300014326 Ga0157380_10000018 Ga0157380_1000001885 314
286 3300014326 Ga0157380_10028507 Ga0157380_100285072 314
287 3300014326 Ga0157380_10069798 Ga0157380_100697983 314
288 3300014969 Ga0157376_10000341 Ga0157376_1000034114 314
289 3300015265 Ga0182005_1000097 Ga0182005_100009739 314
290 3300025208 Ga0209436_100324 Ga0209436_10032418 314
291 3300025208 Ga0209436_114708 Ga0209436_1147081 314
292 3300025242 Ga0209258_100302 Ga0209258_10030262 314
293 3300025254 Ga0209148_1000131 Ga0209148_100013119 314
294 3300025273 Ga0209673_1000203 Ga0209673_100020317 314
295 3300025284 Ga0209130_1001297 Ga0209130_100129715 314
296 3300025295 Ga0209564_1022859 Ga0209564_10228591 314
297 3300025295 Ga0209564_1022867 Ga0209564_10228671 314
298 3300025298 Ga0209050_1000888 Ga0209050_100088815 314
299 3300025302 Ga0207426_1000024 Ga0207426_100002413 314
300 3300025302 Ga0207426_1000806 Ga0207426_100080626 314
301 3300025302 Ga0207426_1017306 Ga0207426_10173062 314
302 3300025304 Ga0209257_1000070 Ga0209257_100007029 314
303 3300025304 Ga0209257_1002474 Ga0209257_10024749 314
304 3300025903 Ga0207680_10043288 Ga0207680_100432882 314
305 3300025904 Ga0207647_10006574 Ga0207647_100065747 314
306 3300025904 Ga0207647_10044652 Ga0207647_100446522 314
307 3300025911 Ga0207654_10017862 Ga0207654_100178624 314
308 3300025912 Ga0207707_10285942 Ga0207707_102859422 314
309 3300025913 Ga0207695_10000087 Ga0207695_10000087198 314
310 3300025913 Ga0207695_10000685 Ga0207695_1000068542 314
311 3300025913 Ga0207695_10000917 Ga0207695_1000091718 314
312 3300025913 Ga0207695_10001873 Ga0207695_1000187323 314
313 3300025913 Ga0207695_10028845 Ga0207695_100288453 314
314 3300025913 Ga0207695_10038240 Ga0207695_100382402 314
315 3300025913 Ga0207695_10118885 Ga0207695_101188853 314
316 3300025914 Ga0207671_10000637 Ga0207671_1000063734 314
317 3300025914 Ga0207671_10004496 Ga0207671_1000449610 314
318 3300025914 Ga0207671_10051595 Ga0207671_100515951 314
319 3300025917 Ga0207660_10021719 Ga0207660_100217193 314
320 3300025919 Ga0207657_10004066 Ga0207657_100040662 314
321 3300025921 Ga0207652_10007027 Ga0207652_100070273 314
322 3300025923 Ga0207681_10119055 Ga0207681_101190552 314
323 3300025924 Ga0207694_10004594 Ga0207694_1000459410 314
324 3300025924 Ga0207694_10016687 Ga0207694_100166875 314
325 3300025925 Ga0207650_10232685 Ga0207650_102326852 314
326 3300025926 Ga0207659_10065881 Ga0207659_100658813 314
327 3300025932 Ga0207690_10010426 Ga0207690_100104265 314
328 3300025937 Ga0207669_10023300 Ga0207669_100233002 314
329 3300025937 Ga0207669_10024850 Ga0207669_100248502 314
330 3300025949 Ga0207667_10000172 Ga0207667_1000017226 314
331 3300025949 Ga0207667_10008374 Ga0207667_100083747 314
332 3300025949 Ga0207667_10031326 Ga0207667_100313263 314
333 3300025949 Ga0207667_10055066 Ga0207667_100550661 314
334 3300025949 Ga0207667_10638672 Ga0207667_106386721 314
335 3300025986 Ga0207658_10192703 Ga0207658_101927032 314
336 3300026023 Ga0207677_10174711 Ga0207677_101747111 314
337 3300026041 Ga0207639_10055557 Ga0207639_100555571 314
338 3300026041 Ga0207639_10074264 Ga0207639_100742642 314
339 3300026078 Ga0207702_10085938 Ga0207702_100859382 314
340 3300026078 Ga0207702_10189987 Ga0207702_101899872 314
341 3300026116 Ga0207674_10004626 Ga0207674_100046265 314
342 3300026142 Ga0207698_10018321 Ga0207698_100183212 314
343 3300026142 Ga0207698_10080910 Ga0207698_100809102 314
344 3300026142 Ga0207698_10302729 Ga0207698_103027291 314
345 3300028379 Ga0268266_10000048 Ga0268266_10000048106 314
346 3300028380 Ga0268265_10009060 Ga0268265_100090603 314
347 3300028381 Ga0268264_10001761 Ga0268264_1000176111 314
348 3300028381 Ga0268264_10006470 Ga0268264_100064709 314
349 3300028381 Ga0268264_10010034 Ga0268264_100100344 314
350 3300028786 Ga0307517_10099816 Ga0307517_100998162 314
351 3300029957 Ga0265324_10016585 Ga0265324_100165852 314
352 3300030521 Ga0307511_10000002 Ga0307511_1000000222 314
353 3300031251 Ga0265327_10023609 Ga0265327_100236094 314
354 3300031730 Ga0307516_10000159 Ga0307516_1000015968 314
355 3300042007 Ga0439449_0002729 Ga0439449_0002729_2397_3380 314
356 3300042015 Ga0439462_0008387 Ga0439462_0008387_772_1755 314
357 3300044656 Ga0466969_0061212 Ga0466969_0061212_641_1603 314
358 3300044683 Ga0466965_0102220 Ga0466965_0102220_316_1290 314
359 3300044693 Ga0466961_0064528 Ga0466961_0064528_278_1240 314
360 3300044765 Ga0466970_0136481 Ga0466970_0136481_194_1156 314
361 3300044842 Ga0466957_0022142 Ga0466957_0022142_2491_3465 314
362 3300044842 Ga0466957_0105888 Ga0466957_0105888_308_1276 314
363 3300045049 Ga0466959_0024738 Ga0466959_0024738_2428_3390 314
364 3300046460 Ga0495638_0220178 Ga0495638_0220178_19_987 314
365 3300046472 Ga0495580_0341116 Ga0495580_0341116_19_984 314
366 3300046507 Ga0495606_0005804 Ga0495606_0005804_1134_2102 314
367 3300046558 Ga0495633_0000125 Ga0495633_0000125_64755_65729 314
368 3300046616 Ga0495668_0002554 Ga0495668_0002554_1842_2822 314
369 3300046648 Ga0495611_0000354 Ga0495611_0000354_16627_17595 314
370 3300046648 Ga0495611_0102676 Ga0495611_0102676_235_1203 314
371 3300047318 Ga0495636_0000060 Ga0495636_0000060_23069_24037 314
372 3300047320 Ga0495672_0028859 Ga0495672_0028859_2120_3085 314
373 3300047443 Ga0495687_000261 Ga0495687_000261_31474_32442 314
374 3300047472 Ga0495686_0000005 Ga0495686_0000005_672238_673206 314
375 3300048924 Ga0496121_0000081 Ga0496121_0000081_65955_66929 314
376 3300048929 Ga0496126_0042525 Ga0496126_0042525_1610_2584 314
377 3300049569 Ga0501032_0004132 Ga0501032_0004132_7062_8036 314
378 3300049569 Ga0501032_0086164 Ga0501032_0086164_386_1348 314
379 3300049570 Ga0501033_0017643 Ga0501033_0017643_3641_4603 314
380 3300049570 Ga0501033_0113556 Ga0501033_0113556_277_1251 314
381 3300049571 Ga0501034_0007421 Ga0501034_0007421_7819_8793 314
382 3300049574 Ga0501038_0104439 Ga0501038_0104439_1032_1994 314
383 3300049574 Ga0501038_0161412 Ga0501038_0161412_298_1272 314
384 3300049579 Ga0501043_0030664 Ga0501043_0030664_324_1298 314
385 3300049579 Ga0501043_0068367 Ga0501043_0068367_196_1170 314
386 3300049580 Ga0501046_0220574 Ga0501046_0220574_94_1068 314
387 3300049581 Ga0501047_0013596 Ga0501047_0013596_3930_4904 314
388 3300049581 Ga0501047_0169887 Ga0501047_0169887_1022_1990 314
389 3300049654 Ga0501207_003749 Ga0501207_003749_388_1407 314
390 3300049660 Ga0501216_011083 Ga0501216_011083_207_1172 314
391 3300049661 Ga0501217_000586 Ga0501217_000586_477_1496 314
392 3300049662 Ga0501222_001557 Ga0501222_001557_222_1241 314
393 3300049673 Ga0501240_000977 Ga0501240_000977_25_1044 314
394 3300049703 Ga0501219_000133 Ga0501219_000133_6302_7276 314
395 3300049704 Ga0501221_002892 Ga0501221_002892_485_1504 314
396 3300049705 Ga0501225_0012912 Ga0501225_0012912_589_1554 314
397 3300049705 Ga0501225_0030894 Ga0501225_0030894_481_1455 314
398 3300049758 Ga0501241_003764 Ga0501241_003764_66_1040 314
399 3300049822 Ga0501035_0007289 Ga0501035_0007289_3392_4366 314
400 3300049822 Ga0501035_0261765 Ga0501035_0261765_127_1089 314
401 3300049823 Ga0501044_0158829 Ga0501044_0158829_211_1173 314
402 3300050005 Ga0501284_00007 Ga0501284_00007_115746_116720 314
403 3300050511 nmdc:mga08y16_110978_c1 nmdc:mga08y16_110978_c1_1070_2044 314
404 3300050511 nmdc:mga08y16_143375_c1 nmdc:mga08y16_143375_c1_1231_2196 314
405 3300053088 Ga0500644_0000026 Ga0500644_0000026_60664_61638 314
406 3300053090 Ga0500646_0013350 Ga0500646_0013350_344_1318 314
407 3300053092 Ga0500583_0002299 Ga0500583_0002299_1461_2435 314
408 3300053109 Ga0500569_000047 Ga0500569_000047_9672_10646 314
409 3300053121 Ga0500607_046686 Ga0500607_046686_29_1003 314
410 3300053130 Ga0500642_0001746 Ga0500642_0001746_244_1212 314
411 3300053134 Ga0500658_0003491 Ga0500658_0003491_4435_5409 314
412 3300053136 Ga0500559_0002568 Ga0500559_0002568_4539_5513 314
413 3300053139 Ga0500568_0003595 Ga0500568_0003595_5743_6711 314
414 3300053142 Ga0500577_0006329 Ga0500577_0006329_2052_3026 314
415 3300053146 Ga0500588_0008757 Ga0500588_0008757_312_1292 314
416 3300053153 Ga0500616_0002235 Ga0500616_0002235_9619_10593 314
417 3300053156 Ga0500622_0000692 Ga0500622_0000692_27472_28446 314
418 3300053156 Ga0500622_0005506 Ga0500622_0005506_2147_3115 314
419 3300053160 Ga0500633_0000782 Ga0500633_0000782_1058_2032 314
420 3300053177 Ga0500636_0005348 Ga0500636_0005348_135_1109 314
421 3300055283 Ga0500661_005321 Ga0500661_005321_458_1432 314
422 3300061719 Ga0466962_0063789 Ga0466962_0063789_519_1481 314
423 iso_pu_bacteria 2818991442 2819574922 314
424 iso_pu_bacteria 2818991460 2819676870 314
425 iso_pu_bacteria 2821136567 2821141023 314
426 iso_pu_bacteria 2884791551 2884796724 314
427 iso_pu_bacteria 2896085136 2896086639 314
428 iso_pu_bacteria 2904467357 2904471523 314
429 iso_pu_bacteria 2929177148 2929177758 314
430 iso_pu_bacteria 2929239360 2929240122 314
431 iso_pu_bacteria 2945977869 2945980105 314
432 iso_pu_bacteria 2946013367 2946014033 314
433 2162886011 MRS1b_contig_4233568 MRS1b_0388.00003100 315
434 2162886011 MRS1b_contig_448359 MRS1b_0602.00001840 315
435 2162886012 MBSR1b_contig_1406278 MBSR1b_0239.00007060 315
436 2162886012 MBSR1b_contig_7589204 MBSR1b_0095.00007450 315
437 3300002077 JGI24744J21845_10003674 JGI24744J21845_100036743 315
438 3300002459 JGI24751J29686_10000540 JGI24751J29686_100005409 315
439 3300002773 JGI25152J39213_1000647 JGI25152J39213_100064711 315
440 3300002774 JGI25150J39212_1000009 JGI25150J39212_1000009228 315
441 3300003187 JGI25151J46595_10000017 JGI25151J46595_10000017228 315
442 3300003215 JGI25153J46596_10000023 JGI25153J46596_1000002311 315
443 3300003316 rootH1_10004252 rootH1_100042523 315
444 3300003316 rootH1_10013813 rootH1_100138137 315
445 3300003320 rootH2_10019275 rootH2_1001927518 315
446 3300003320 rootH2_10232790 rootH2_102327901 315
447 3300003322 rootL2_10000984 rootL2_1000098410 315
448 3300003322 rootL2_10001672 rootL2_100016723 315
449 3300003322 rootL2_10041649 rootL2_100416492 315
450 3300003322 rootL2_10062550 rootL2_100625502 315
451 3300003323 rootH1_10003699 rootH1_100036998 315
452 3300003323 rootH1_10011437 rootH1_1001143720 315
453 3300003323 rootH1_10064744 rootH1_100647442 315
454 3300003323 rootH1_10175021 rootH1_101750214 315
455 3300003323 rootH1_10311342 rootH1_103113422 315
456 3300003791 Ga0055530_10002755 Ga0055530_100027557 315
457 3300005288 Ga0065714_10004769 Ga0065714_100047693 315
458 3300005288 Ga0065714_10073672 Ga0065714_100736723 315
459 3300005290 Ga0065712_10080579 Ga0065712_100805791 315
460 3300005290 Ga0065712_10084814 Ga0065712_100848141 315
461 3300005290 Ga0065712_10109904 Ga0065712_101099042 315
462 3300005327 Ga0070658_10051009 Ga0070658_100510093 315
463 3300005329 Ga0070683_100000327 Ga0070683_1000003277 315
464 3300005329 Ga0070683_100192250 Ga0070683_1001922502 315
465 3300005331 Ga0070670_100002147 Ga0070670_1000021474 315
466 3300005331 Ga0070670_100026886 Ga0070670_1000268863 315
467 3300005334 Ga0068869_100009710 Ga0068869_1000097104 315
468 3300005334 Ga0068869_100033079 Ga0068869_1000330792 315
469 3300005334 Ga0068869_100135103 Ga0068869_1001351033 315
470 3300005335 Ga0070666_10015901 Ga0070666_100159015 315
471 3300005337 Ga0070682_100036209 Ga0070682_1000362093 315
472 3300005338 Ga0068868_100009009 Ga0068868_1000090096 315
473 3300005340 Ga0070689_100014333 Ga0070689_1000143332 315
474 3300005344 Ga0070661_100003284 Ga0070661_1000032843 315
475 3300005344 Ga0070661_100120125 Ga0070661_1001201252 315
476 3300005347 Ga0070668_100165525 Ga0070668_1001655251 315
477 3300005353 Ga0070669_100006429 Ga0070669_1000064297 315
478 3300005353 Ga0070669_100014257 Ga0070669_1000142577 315
479 3300005353 Ga0070669_100024594 Ga0070669_1000245942 315
480 3300005353 Ga0070669_100038623 Ga0070669_1000386231 315
481 3300005355 Ga0070671_100144493 Ga0070671_1001444932 315
482 3300005364 Ga0070673_100118290 Ga0070673_1001182901 315
483 3300005364 Ga0070673_100149021 Ga0070673_1001490212 315
484 3300005365 Ga0070688_100084798 Ga0070688_1000847982 315
485 3300005366 Ga0070659_100019255 Ga0070659_1000192551 315
486 3300005367 Ga0070667_100222256 Ga0070667_1002222562 315
487 3300005456 Ga0070678_100011344 Ga0070678_1000113443 315
488 3300005456 Ga0070678_100119505 Ga0070678_1001195052 315
489 3300005457 Ga0070662_100000209 Ga0070662_10000020934 315
490 3300005457 Ga0070662_100046050 Ga0070662_1000460503 315
491 3300005459 Ga0068867_100003103 Ga0068867_10000310324 315
492 3300005459 Ga0068867_100039779 Ga0068867_1000397793 315
493 3300005459 Ga0068867_100257655 Ga0068867_1002576552 315
494 3300005459 Ga0068867_100274327 Ga0068867_1002743271 315
495 3300005466 Ga0070685_10123337 Ga0070685_101233371 315
496 3300005466 Ga0070685_10262349 Ga0070685_102623491 315
497 3300005471 Ga0070698_100000282 Ga0070698_10000028224 315
498 3300005471 Ga0070698_100002541 Ga0070698_1000025414 315
499 3300005471 Ga0070698_100006847 Ga0070698_1000068476 315
500 3300005535 Ga0070684_100000290 Ga0070684_10000029026 315
501 3300005539 Ga0068853_100009821 Ga0068853_1000098213 315
502 3300005539 Ga0068853_100029290 Ga0068853_1000292903 315
503 3300005543 Ga0070672_100008190 Ga0070672_1000081907 315
504 3300005543 Ga0070672_100147053 Ga0070672_1001470531 315
505 3300005544 Ga0070686_100072943 Ga0070686_1000729432 315
506 3300005563 Ga0068855_100059131 Ga0068855_1000591313 315
507 3300005564 Ga0070664_100000509 Ga0070664_10000050927 315
508 3300005564 Ga0070664_100008601 Ga0070664_1000086013 315
509 3300005577 Ga0068857_100000579 Ga0068857_1000005791 315
510 3300005577 Ga0068857_100073334 Ga0068857_1000733342 315
511 3300005577 Ga0068857_100160766 Ga0068857_1001607662 315
512 3300005577 Ga0068857_100164503 Ga0068857_1001645032 315
513 3300005578 Ga0068854_100032309 Ga0068854_1000323092 315
514 3300005578 Ga0068854_100093732 Ga0068854_1000937321 315
515 3300005614 Ga0068856_100024646 Ga0068856_1000246462 315
516 3300005614 Ga0068856_100067961 Ga0068856_1000679612 315
517 3300005616 Ga0068852_100014577 Ga0068852_1000145776 315
518 3300005616 Ga0068852_100368481 Ga0068852_1003684812 315
519 3300005617 Ga0068859_100000289 Ga0068859_10000028930 315
520 3300005617 Ga0068859_100086698 Ga0068859_1000866983 315
521 3300005618 Ga0068864_100002659 Ga0068864_10000265910 315
522 3300005618 Ga0068864_100043128 Ga0068864_1000431284 315
523 3300005618 Ga0068864_100127278 Ga0068864_1001272782 315
524 3300005618 Ga0068864_100257686 Ga0068864_1002576861 315
525 3300005618 Ga0068864_100303098 Ga0068864_1003030981 315
526 3300005618 Ga0068864_100644796 Ga0068864_1006447961 315
527 3300005718 Ga0068866_10014018 Ga0068866_100140182 315
528 3300005718 Ga0068866_10031820 Ga0068866_100318202 315
529 3300005719 Ga0068861_100001502 Ga0068861_10000150216 315
530 3300005719 Ga0068861_100049553 Ga0068861_1000495532 315
531 3300005719 Ga0068861_100462228 Ga0068861_1004622282 315
532 3300005834 Ga0068851_10008435 Ga0068851_100084352 315
533 3300005840 Ga0068870_10002263 Ga0068870_100022632 315
534 3300005841 Ga0068863_100026959 Ga0068863_1000269596 315
535 3300005841 Ga0068863_100405149 Ga0068863_1004051492 315
536 3300005842 Ga0068858_100104708 Ga0068858_1001047083 315
537 3300005842 Ga0068858_100119796 Ga0068858_1001197961 315
538 3300005843 Ga0068860_100054588 Ga0068860_1000545882 315
539 3300005843 Ga0068860_100343310 Ga0068860_1003433101 315
540 3300005844 Ga0068862_100027366 Ga0068862_1000273664 315
541 3300005844 Ga0068862_100058506 Ga0068862_1000585062 315
542 3300005844 Ga0068862_100132285 Ga0068862_1001322851 315
543 3300005844 Ga0068862_100306494 Ga0068862_1003064943 315
544 3300006195 Ga0075366_10096980 Ga0075366_100969802 315
545 3300006237 Ga0097621_100000036 Ga0097621_10000003629 315
546 3300006237 Ga0097621_100070027 Ga0097621_1000700272 315
547 3300006237 Ga0097621_100225479 Ga0097621_1002254792 315
548 3300006358 Ga0068871_100005055 Ga0068871_1000050557 315
549 3300006358 Ga0068871_100033550 Ga0068871_1000335502 315
550 3300006358 Ga0068871_100343538 Ga0068871_1003435381 315
551 3300006844 Ga0075428_100006607 Ga0075428_1000066072 315
552 3300006844 Ga0075428_100093975 Ga0075428_1000939753 315
553 3300006844 Ga0075428_100152663 Ga0075428_1001526631 315
554 3300006844 Ga0075428_100294134 Ga0075428_1002941341 315
555 3300006846 Ga0075430_100104237 Ga0075430_1001042372 315
556 3300006846 Ga0075430_100175362 Ga0075430_1001753622 315
557 3300006847 Ga0075431_100055523 Ga0075431_1000555234 315
558 3300006847 Ga0075431_100110345 Ga0075431_1001103452 315
559 3300006847 Ga0075431_100127855 Ga0075431_1001278552 315
560 3300006880 Ga0075429_100000136 Ga0075429_10000013622 315
561 3300006881 Ga0068865_100095874 Ga0068865_1000958742 315
562 3300006931 Ga0097620_100000289 Ga0097620_10000028921 315
563 3300006931 Ga0097620_100086694 Ga0097620_1000866943 315
564 3300006931 Ga0097620_100446771 Ga0097620_1004467712 315
565 3300009093 Ga0105240_10085981 Ga0105240_100859815 315
566 3300009094 Ga0111539_10000601 Ga0111539_1000060113 315
567 3300009094 Ga0111539_10157727 Ga0111539_101577271 315
568 3300009094 Ga0111539_10632485 Ga0111539_106324851 315
569 3300009101 Ga0105247_10001391 Ga0105247_1000139112 315
570 3300009147 Ga0114129_10004956 Ga0114129_100049566 315
571 3300009147 Ga0114129_10039792 Ga0114129_100397922 315
572 3300009147 Ga0114129_10138808 Ga0114129_101388083 315
573 3300009148 Ga0105243_10120919 Ga0105243_101209192 315
574 3300009174 Ga0105241_10033823 Ga0105241_100338232 315
575 3300009174 Ga0105241_10034973 Ga0105241_100349732 315
576 3300009176 Ga0105242_10078638 Ga0105242_100786382 315
577 3300009545 Ga0105237_10016066 Ga0105237_100160664 315
578 3300009545 Ga0105237_10137911 Ga0105237_101379112 315
579 3300009553 Ga0105249_10000635 Ga0105249_1000063510 315
580 3300009553 Ga0105249_10001404 Ga0105249_100014043 315
581 3300009553 Ga0105249_10044696 Ga0105249_100446961 315
582 3300009553 Ga0105249_10054284 Ga0105249_100542842 315
583 3300011119 Ga0105246_10024851 Ga0105246_100248512 315
584 3300013100 Ga0157373_10026532 Ga0157373_100265322 315
585 3300013102 Ga0157371_10000009 Ga0157371_10000009329 315
586 3300013104 Ga0157370_10016291 Ga0157370_100162913 315
587 3300013104 Ga0157370_10061782 Ga0157370_100617822 315
588 3300013104 Ga0157370_10434281 Ga0157370_104342812 315
589 3300013105 Ga0157369_10000006 Ga0157369_10000006355 315
590 3300013296 Ga0157374_10062246 Ga0157374_100622463 315
591 3300013296 Ga0157374_10125984 Ga0157374_101259842 315
592 3300013296 Ga0157374_10184131 Ga0157374_101841312 315
593 3300013297 Ga0157378_10015554 Ga0157378_100155547 315
594 3300013306 Ga0163162_10000177 Ga0163162_1000017741 315
595 3300013306 Ga0163162_10002830 Ga0163162_100028305 315
596 3300013306 Ga0163162_10023096 Ga0163162_100230967 315
597 3300013306 Ga0163162_10077356 Ga0163162_100773562 315
598 3300013306 Ga0163162_10138178 Ga0163162_101381782 315
599 3300013306 Ga0163162_10172929 Ga0163162_101729292 315
600 3300013307 Ga0157372_10022449 Ga0157372_100224496 315
601 3300013307 Ga0157372_10080014 Ga0157372_100800142 315
602 3300013307 Ga0157372_10117112 Ga0157372_101171122 315
603 3300013308 Ga0157375_10085934 Ga0157375_100859342 315
604 3300014325 Ga0163163_10000432 Ga0163163_1000043223 315
605 3300014325 Ga0163163_10014374 Ga0163163_100143742 315
606 3300014325 Ga0163163_10107022 Ga0163163_101070222 315
607 3300014326 Ga0157380_10050708 Ga0157380_100507082 315
608 3300014326 Ga0157380_10102592 Ga0157380_101025922 315
609 3300014326 Ga0157380_10370164 Ga0157380_103701641 315
610 3300014969 Ga0157376_10115471 Ga0157376_101154711 315
611 3300014969 Ga0157376_10154924 Ga0157376_101549241 315
612 3300014969 Ga0157376_10213854 Ga0157376_102138542 315
613 3300014969 Ga0157376_10419471 Ga0157376_104194712 315
614 3300015261 Ga0182006_1000322 Ga0182006_10003224 315
615 3300015261 Ga0182006_1000622 Ga0182006_100062225 315
616 3300015262 Ga0182007_10000001 Ga0182007_10000001304 315
617 3300015682 Ga0183373_1006 Ga0183373_1006196 315
618 3300017792 Ga0163161_10001724 Ga0163161_1000172413 315
619 3300017792 Ga0163161_10002308 Ga0163161_1000230812 315
620 3300017792 Ga0163161_10059225 Ga0163161_100592252 315
621 3300017792 Ga0163161_10060984 Ga0163161_100609841 315
622 3300017792 Ga0163161_10072665 Ga0163161_100726651 315
623 3300017792 Ga0163161_10267700 Ga0163161_102677001 315
624 3300021384 Ga0213876_10001574 Ga0213876_100015749 315
625 3300025242 Ga0209258_108334 Ga0209258_1083342 315
626 3300025245 Ga0207425_1000007 Ga0207425_1000007328 315
627 3300025258 Ga0209129_1000006 Ga0209129_1000006328 315
628 3300025294 Ga0209025_1000025 Ga0209025_1000025158 315
629 3300025297 Ga0209758_1000016 Ga0209758_1000016328 315
630 3300025298 Ga0209050_1037458 Ga0209050_10374582 315
631 3300025315 Ga0207697_10028263 Ga0207697_100282632 315
632 3300025315 Ga0207697_10051444 Ga0207697_100514442 315
633 3300025900 Ga0207710_10000673 Ga0207710_100006735 315
634 3300025900 Ga0207710_10102145 Ga0207710_101021451 315
635 3300025901 Ga0207688_10002217 Ga0207688_100022174 315
636 3300025903 Ga0207680_10036735 Ga0207680_100367353 315
637 3300025905 Ga0207685_10012593 Ga0207685_100125931 315
638 3300025907 Ga0207645_10002084 Ga0207645_100020845 315
639 3300025907 Ga0207645_10142380 Ga0207645_101423802 315
640 3300025907 Ga0207645_10155718 Ga0207645_101557182 315
641 3300025908 Ga0207643_10106547 Ga0207643_101065472 315
642 3300025908 Ga0207643_10179534 Ga0207643_101795341 315
643 3300025911 Ga0207654_10062096 Ga0207654_100620962 315
644 3300025914 Ga0207671_10053268 Ga0207671_100532683 315
645 3300025918 Ga0207662_10064031 Ga0207662_100640311 315
646 3300025919 Ga0207657_10105987 Ga0207657_101059872 315
647 3300025920 Ga0207649_10000567 Ga0207649_1000056722 315
648 3300025920 Ga0207649_10021250 Ga0207649_100212501 315
649 3300025923 Ga0207681_10010977 Ga0207681_100109773 315
650 3300025923 Ga0207681_10034340 Ga0207681_100343401 315
651 3300025923 Ga0207681_10034444 Ga0207681_100344442 315
652 3300025923 Ga0207681_10282478 Ga0207681_102824782 315
653 3300025925 Ga0207650_10001513 Ga0207650_1000151314 315
654 3300025925 Ga0207650_10061492 Ga0207650_100614922 315
655 3300025925 Ga0207650_10273390 Ga0207650_102733902 315
656 3300025926 Ga0207659_10032388 Ga0207659_100323882 315
657 3300025931 Ga0207644_10131582 Ga0207644_101315822 315
658 3300025932 Ga0207690_10003267 Ga0207690_100032672 315
659 3300025933 Ga0207706_10017700 Ga0207706_100177004 315
660 3300025936 Ga0207670_10039676 Ga0207670_100396761 315
661 3300025938 Ga0207704_10006232 Ga0207704_100062322 315
662 3300025938 Ga0207704_10009596 Ga0207704_100095962 315
663 3300025938 Ga0207704_10112509 Ga0207704_101125092 315
664 3300025938 Ga0207704_10194021 Ga0207704_101940212 315
665 3300025942 Ga0207689_10007268 Ga0207689_100072683 315
666 3300025942 Ga0207689_10008486 Ga0207689_100084864 315
667 3300025942 Ga0207689_10043750 Ga0207689_100437501 315
668 3300025942 Ga0207689_10058060 Ga0207689_100580603 315
669 3300025942 Ga0207689_10065028 Ga0207689_100650282 315
670 3300025942 Ga0207689_10201162 Ga0207689_102011621 315
671 3300025944 Ga0207661_10000411 Ga0207661_100004116 315
672 3300025945 Ga0207679_10000297 Ga0207679_1000029712 315
673 3300025960 Ga0207651_10009901 Ga0207651_100099016 315
674 3300025960 Ga0207651_10020151 Ga0207651_100201515 315
675 3300025960 Ga0207651_10098862 Ga0207651_100988622 315
676 3300025960 Ga0207651_10317908 Ga0207651_103179082 315
677 3300025961 Ga0207712_10001470 Ga0207712_100014705 315
678 3300025961 Ga0207712_10002610 Ga0207712_100026103 315
679 3300025961 Ga0207712_10017162 Ga0207712_100171623 315
680 3300025961 Ga0207712_10315442 Ga0207712_103154421 315
681 3300025972 Ga0207668_10130649 Ga0207668_101306492 315
682 3300025972 Ga0207668_10330547 Ga0207668_103305472 315
683 3300025981 Ga0207640_10035190 Ga0207640_100351903 315
684 3300025981 Ga0207640_10197708 Ga0207640_101977082 315
685 3300026035 Ga0207703_10222294 Ga0207703_102222941 315
686 3300026035 Ga0207703_10335913 Ga0207703_103359132 315
687 3300026041 Ga0207639_10001395 Ga0207639_100013954 315
688 3300026041 Ga0207639_10002886 Ga0207639_100028868 315
689 3300026075 Ga0207708_10231220 Ga0207708_102312201 315
690 3300026078 Ga0207702_10145534 Ga0207702_101455342 315
691 3300026088 Ga0207641_10128901 Ga0207641_101289011 315
692 3300026089 Ga0207648_10000384 Ga0207648_1000038413 315
693 3300026089 Ga0207648_10010983 Ga0207648_100109836 315
694 3300026089 Ga0207648_10057208 Ga0207648_100572082 315
695 3300026089 Ga0207648_10057945 Ga0207648_100579453 315
696 3300026095 Ga0207676_10012634 Ga0207676_100126342 315
697 3300026095 Ga0207676_10054242 Ga0207676_100542421 315
698 3300026095 Ga0207676_10084359 Ga0207676_100843592 315
699 3300026095 Ga0207676_10336798 Ga0207676_103367982 315
700 3300026116 Ga0207674_10012404 Ga0207674_1001240410 315
701 3300026116 Ga0207674_10090545 Ga0207674_100905452 315
702 3300026116 Ga0207674_10128342 Ga0207674_101283421 315
703 3300026116 Ga0207674_10208408 Ga0207674_102084082 315
704 3300026116 Ga0207674_10249965 Ga0207674_102499651 315
705 3300026116 Ga0207674_10460949 Ga0207674_104609492 315
706 3300026118 Ga0207675_100009007 Ga0207675_1000090075 315
707 3300026118 Ga0207675_100012296 Ga0207675_1000122966 315
708 3300026118 Ga0207675_100139269 Ga0207675_1001392692 315
709 3300026121 Ga0207683_10004211 Ga0207683_100042113 315
710 3300026121 Ga0207683_10007595 Ga0207683_100075957 315
711 3300026142 Ga0207698_10032497 Ga0207698_100324971 315
712 3300028380 Ga0268265_10073620 Ga0268265_100736203 315
713 3300028380 Ga0268265_10102517 Ga0268265_101025173 315
714 3300028380 Ga0268265_10292943 Ga0268265_102929432 315
715 3300028381 Ga0268264_10006760 Ga0268264_100067603 315
716 3300028381 Ga0268264_10028275 Ga0268264_100282753 315
717 3300028381 Ga0268264_10037291 Ga0268264_100372912 315
718 3300028381 Ga0268264_10086516 Ga0268264_100865163 315
719 3300028381 Ga0268264_10353553 Ga0268264_103535531 315
720 3300028794 Ga0307515_10000001 Ga0307515_100000012846 315
721 3300028794 Ga0307515_10104701 Ga0307515_101047014 315
722 3300028800 Ga0265338_10000651 Ga0265338_1000065133 315
723 3300031251 Ga0265327_10000024 Ga0265327_1000002493 315
724 3300031251 Ga0265327_10000611 Ga0265327_1000061141 315
725 3300031456 Ga0307513_10104373 Ga0307513_101043733 315
726 3300031456 Ga0307513_10279393 Ga0307513_102793932 315
727 3300031548 Ga0307408_100047911 Ga0307408_1000479112 315
728 3300031731 Ga0307405_10000010 Ga0307405_1000001044 315
729 3300031731 Ga0307405_10011620 Ga0307405_100116202 315
730 3300031824 Ga0307413_10084608 Ga0307413_100846082 315
731 3300031852 Ga0307410_10038701 Ga0307410_100387011 315
732 3300031852 Ga0307410_10047385 Ga0307410_100473852 315
733 3300031903 Ga0307407_10000042 Ga0307407_1000004240 315
734 3300031903 Ga0307407_10016140 Ga0307407_100161402 315
735 3300031911 Ga0307412_10007998 Ga0307412_100079984 315
736 3300032002 Ga0307416_100000019 Ga0307416_10000001911 315
737 3300032002 Ga0307416_100000227 Ga0307416_1000002277 315
738 3300032004 Ga0307414_10002825 Ga0307414_100028255 315
739 3300032004 Ga0307414_10032781 Ga0307414_100327812 315
740 3300032004 Ga0307414_10082052 Ga0307414_100820522 315
741 3300032004 Ga0307414_10122685 Ga0307414_101226852 315
742 3300032005 Ga0307411_10373447 Ga0307411_103734471 315
743 3300032126 Ga0307415_100001349 Ga0307415_10000134913 315
744 3300037312 Ga0395899_0176928 Ga0395899_0176928_78_1079 315
745 3300037418 Ga0395900_0156079 Ga0395900_0156079_389_1357 315
746 3300037466 Ga0395898_0059676 Ga0395898_0059676_1170_2171 315
747 3300039437 Ga0436365_1249677 Ga0436365_1249677_4655_5617 315
748 3300041404 Ga0439436_0002706 Ga0439436_0002706_2894_3871 315
749 3300041410 Ga0439461_0012376 Ga0439461_0012376_207_1187 315
750 3300041452 Ga0451793_1329962 Ga0451793_1329962_37_1002 315
751 3300041463 Ga0451804_1149675 Ga0451804_1149675_173_1135 315
752 3300042007 Ga0439449_0024418 Ga0439449_0024418_1081_2058 315
753 3300042014 Ga0439457_002111 Ga0439457_002111_1003_1980 315
754 3300042015 Ga0439462_0004635 Ga0439462_0004635_750_1727 315
755 3300042125 Ga0450923_000505 Ga0450923_000505_907_1965 315
756 3300042876 Ga0451577_0006113 Ga0451577_0006113_746_1711 315
757 3300042876 Ga0451577_0123920 Ga0451577_0123920_269_1234 315
758 3300042876 Ga0451577_0345943 Ga0451577_0345943_347_1309 315
759 3300044656 Ga0466969_0000127 Ga0466969_0000127_17554_18531 315
760 3300044658 Ga0466972_0000080 Ga0466972_0000080_84309_85286 315
761 3300044673 Ga0453683_0259989 Ga0453683_0259989_42_1004 315
762 3300044684 Ga0466966_0000120 Ga0466966_0000120_21314_22291 315
763 3300044706 Ga0466964_0041728 Ga0466964_0041728_123_1100 315
764 3300044712 Ga0453684_0108162 Ga0453684_0108162_2262_3236 315
765 3300044712 Ga0453684_0147752 Ga0453684_0147752_1142_2107 315
766 3300044842 Ga0466957_0000380 Ga0466957_0000380_2220_3197 315
767 3300044842 Ga0466957_0010728 Ga0466957_0010728_4074_5051 315
768 3300045049 Ga0466959_0000014 Ga0466959_0000014_100700_101677 315
769 3300045051 Ga0451576_0544710 Ga0451576_0544710_235_1197 315
770 3300046453 Ga0495627_044497 Ga0495627_044497_100_1068 315
771 3300046460 Ga0495638_0000040 Ga0495638_0000040_156836_157804 315
772 3300046471 Ga0495650_0031064 Ga0495650_0031064_1238_2200 315
773 3300046512 Ga0495610_0000035 Ga0495610_0000035_108_1076 315
774 3300046512 Ga0495610_0015914 Ga0495610_0015914_3275_4243 315
775 3300046539 Ga0495621_0036727 Ga0495621_0036727_415_1404 315
776 3300046558 Ga0495633_0133656 Ga0495633_0133656_144_1112 315
777 3300047320 Ga0495672_0010446 Ga0495672_0010446_3339_4301 315
778 3300047320 Ga0495672_0021009 Ga0495672_0021009_595_1557 315
779 3300047472 Ga0495686_0007643 Ga0495686_0007643_5683_6645 315
780 3300047472 Ga0495686_0056486 Ga0495686_0056486_1425_2387 315
781 3300048909 Ga0496106_0348409 Ga0496106_0348409_176_1138 315
782 3300049568 Ga0501031_0143800 Ga0501031_0143800_537_1499 315
783 3300049571 Ga0501034_0213240 Ga0501034_0213240_292_1254 315
784 3300049571 Ga0501034_0241907 Ga0501034_0241907_537_1499 315
785 3300049572 Ga0501036_0034595 Ga0501036_0034595_1739_2701 315
786 3300049572 Ga0501036_0124345 Ga0501036_0124345_800_1762 315
787 3300049573 Ga0501037_0031925 Ga0501037_0031925_899_1861 315
788 3300049573 Ga0501037_0033161 Ga0501037_0033161_1091_2053 315
789 3300049574 Ga0501038_0017313 Ga0501038_0017313_4571_5533 315
790 3300049574 Ga0501038_0030627 Ga0501038_0030627_3151_4113 315
791 3300049579 Ga0501043_0003893 Ga0501043_0003893_3165_4127 315
792 3300049580 Ga0501046_0089336 Ga0501046_0089336_11_973 315
793 3300049581 Ga0501047_0082793 Ga0501047_0082793_1602_2579 315
794 3300049581 Ga0501047_0348637 Ga0501047_0348637_194_1171 315
795 3300049582 Ga0501048_0006258 Ga0501048_0006258_5161_6123 315
796 3300049583 Ga0501067_0036099 Ga0501067_0036099_1388_2350 315
797 3300049586 Ga0501070_0078985 Ga0501070_0078985_1672_2634 315
798 3300049586 Ga0501070_0082958 Ga0501070_0082958_1111_2073 315
799 3300049589 Ga0501073_0006651 Ga0501073_0006651_562_1524 315
800 3300049590 Ga0501074_0002599 Ga0501074_0002599_562_1524 315
801 3300049661 Ga0501217_004764 Ga0501217_004764_1584_2585 315
802 3300049675 Ga0501243_007387 Ga0501243_007387_407_1408 315
803 3300049705 Ga0501225_0000505 Ga0501225_0000505_3319_4296 315
804 3300049741 Ga0501079_0049322 Ga0501079_0049322_1784_2746 315
805 3300049742 Ga0501080_0030856 Ga0501080_0030856_562_1524 315
806 3300049744 Ga0501083_0015427 Ga0501083_0015427_2449_3411 315
807 3300049744 Ga0501083_0205002 Ga0501083_0205002_204_1166 315
808 3300049761 Ga0501264_000116 Ga0501264_000116_738_1739 315
809 3300049822 Ga0501035_0002433 Ga0501035_0002433_1786_2748 315
810 3300049823 Ga0501044_0013650 Ga0501044_0013650_7415_8392 315
811 3300049823 Ga0501044_0016689 Ga0501044_0016689_379_1341 315
812 3300049823 Ga0501044_0021227 Ga0501044_0021227_4443_5405 315
813 3300049823 Ga0501044_0447847 Ga0501044_0447847_100_1062 315
814 3300049823 Ga0501044_0538019 Ga0501044_0538019_72_1034 315
815 3300049824 Ga0501045_0135871 Ga0501045_0135871_214_1176 315
816 3300050493 nmdc:mga0k408_54752_c1 nmdc:mga0k408_54752_c1_1072_2034 315
817 3300050507 nmdc:mga05p37_827_c1 nmdc:mga05p37_827_c1_17003_17980 315
818 3300050508 nmdc:mga09592_5573_c1 nmdc:mga09592_5573_c1_2132_3094 315
819 3300050509 nmdc:mga0qj67_115904_c1 nmdc:mga0qj67_115904_c1_882_1895 315
820 3300050509 nmdc:mga0qj67_154999_c1 nmdc:mga0qj67_154999_c1_283_1245 315
821 3300050510 nmdc:mga06r32_338867_c1 nmdc:mga06r32_338867_c1_94_1107 315
822 3300050511 nmdc:mga08y16_33793_c1 nmdc:mga08y16_33793_c1_226_1239 315
823 3300050511 nmdc:mga08y16_57703_c1 nmdc:mga08y16_57703_c1_2980_3948 315
824 3300053086 Ga0500578_0000836 Ga0500578_0000836_28395_29372 315
825 3300053088 Ga0500644_0002655 Ga0500644_0002655_1992_2969 315
826 3300053092 Ga0500583_0000001 Ga0500583_0000001_91617_92594 315
827 3300053093 Ga0500651_0079068 Ga0500651_0079068_967_1935 315
828 3300053096 Ga0500641_0004524 Ga0500641_0004524_3212_4174 315
829 3300053104 Ga0500556_0003125 Ga0500556_0003125_615_1583 315
830 3300053139 Ga0500568_0000142 Ga0500568_0000142_19953_20915 315
831 3300053140 Ga0500573_0093276 Ga0500573_0093276_170_1147 315
832 3300053153 Ga0500616_0008249 Ga0500616_0008249_537_1502 315
833 3300053153 Ga0500616_0015110 Ga0500616_0015110_1858_2835 315
834 3300053727 Ga0500611_000003 Ga0500611_000003_110291_111253 315
835 3300054114 Ga0501084_0041717 Ga0501084_0041717_1070_2032 315
836 iso_pu_bacteria 2585427687 2586207416 315
837 iso_pu_bacteria 2738541278 2738725417 315
838 iso_pu_bacteria 2738541302 2738854007 315
839 iso_pu_bacteria 2739367651 2739588608 315
840 iso_pu_bacteria 2739367656 2739615898 315
841 iso_pu_bacteria 2739367663 2739644989 315
842 iso_pu_bacteria 2818991437 2819548142 315
843 iso_pu_bacteria 2842722452 2842723744 315
844 iso_pu_bacteria 2842909656 2842910250 315
845 iso_pu_bacteria 2849281842 2849284295 315
846 iso_pu_bacteria 2857627736 2857628930 315
847 iso_pu_bacteria 2904445276 2904445698 315
848 iso_pu_bacteria 2945997725 2946000604 315
849 iso_pu_bacteria 2954016120 2954017486 315

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01380

SIS

SIS domain

39

172

0.98

PF00571

CBS

CBS domain

266

320

0.95

PF00571

CBS

CBS domain

201

257

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2xhz-assembly1.cif.gz_B probing the active site of the sugar isomerase domain from e. coli arabinose-5-phosphate isomerase via x-ray crystallography 0.9778 2 170
5uqi-assembly1.cif.gz_A e. coli cft073 c3406 in complex with a5p 0.9532 6 182
3fxa-assembly1.cif.gz_D crystal structure of a putative sugar-phosphate isomerase (lmof2365_0531) from listeria monocytogenes str. 4b f2365 at 1.60 a resolution 0.9527 2 182
3etn-assembly1.cif.gz_C crystal structure of putative phosphosugar isomerase involved in capsule formation (yp_209877.1) from bacteroides fragilis nctc 9343 at 1.70 a resolution 0.95 8 181
2xhz-assembly1.cif.gz_B probing the active site of the sugar isomerase domain from e. coli arabinose-5-phosphate isomerase via x-ray crystallography 0.9448 2 170
ID Description Score Start End Superfamily
af_P45395_11_201_3.40.50.10490 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 0.9774 2 189 3.40.50.10490
af_P45395_11_201_3.40.50.10490 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 0.9574 2 189 3.40.50.10490
5vhuA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 0.9538 6 182 3.40.50.10490
af_I1N9R7_21_211_3.40.50.10490 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 0.9476 7 187 3.40.50.10490
3kpbA00 Alpha Beta;Roll;CBS-domain;CBS-domain 0.9379 193 311 3.10.580.10
ID Description Score Start End GO Terms
AF-A0A4V2AMI0-F1-model_v4 SIS domain-containing protein 0.9993 10 156 GO:0097367
GO:1901135
AF-A0A7X7FZ27-F1-model_v4 SIS domain-containing protein 0.9879 2 182 GO:0097367
GO:1901135
AF-A0A4V2AMI0-F1-model_v4 SIS domain-containing protein 0.9859 10 156 GO:0097367
GO:1901135
AF-A0A7G3ELT6-F1-model_v4 deleted 0.9828 2 182
AF-A0A5C9ADZ1-F1-model_v4 KpsF/GutQ family sugar-phosphate isomerase 0.9811 2 184 GO:0005975
GO:0016853
GO:0097367
GO:1901135

Feature Viewer

pLDDT pTM Quality
91.68 0.7 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map