F483395
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 849 | 368 | 825 | 319 |
Family's Representative Sequence
| Representative Sequence | 3300014326|Ga0157380_10000018|Ga0157380_1000001885 |
| Length | 321 |
| Sequence | LKSSKEIIDLARQTFDIEAEAIAGLKPFINDDFVESVKLIYSAKGRVIVTGIGKSAIIANKIVATFNSTGTPAVFLHAADAIHGDLGMIQQNDVIICISKSGNTSEIKVLVPLLKNGGNKLIAIVGNMDSYLAGSADLVLNTTIEKEACPNNLAPTTSTTAQLAMGDALAVCLLDYRGFTSGDFARFHPGGALGKRLYLRVGDLYKHNAQPGVNENAGIEEIIMEISSKRLGATAVINDHKLAGIITDGDLRRMMQQHKPLDKVKAKDIMTVNPKTADPEMMAVDALRMMKEFNITQLVVTDKMKYLGFVHLHDLLREGII |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 2585427687 | Pedobacter borealis DSM 19626 | Isolate | Rhizosphere |
| 4 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 5 | 2738541302 | Pedobacter sp. CF074 | Isolate | Unclassified |
| 6 | 2739367651 | Pedobacter sp. OK291 | Isolate | Unclassified |
| 7 | 2739367656 | Pedobacter sp. CF523 | Isolate | Unclassified |
| 8 | 2739367663 | Pedobacter sp. YR510 | Isolate | Unclassified |
| 9 | 2818991437 | Pedobacter terrae 518 | Isolate | Unclassified |
| 10 | 2818991442 | Chitinophaga pinensis 1204 | Isolate | Unclassified |
| 11 | 2818991460 | Chitinophaga polysaccharea 1209 | Isolate | Unclassified |
| 12 | 2821136567 | Chitinophaga sancti 1232 | Isolate | Unclassified |
| 13 | 2842722452 | Pedobacter sp. R-72249 | Isolate | Unclassified |
| 14 | 2842909656 | Pedobacter sp. R-72393 | Isolate | Unclassified |
| 15 | 2849281842 | Pedobacter sp. AK013 | Isolate | Rhizosphere |
| 16 | 2857627736 | Pedobacter sp. R-74587 | Isolate | Unclassified |
| 17 | 2884634485 | Algoriphagus kandeliae XY-J91 | Isolate | Unclassified |
| 18 | 2884791551 | Chitinophaga oryzae 1310 | Isolate | Unclassified |
| 19 | 2896085136 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 20 | 2904445276 | Pedobacter terrae 1734 | Isolate | Rhizosphere |
| 21 | 2904467357 | Chitinophaga sancti 3198 | Isolate | Unclassified |
| 22 | 2929177148 | Chitinophaga sp. R-72269 Hybrid assembly | Isolate | Unclassified |
| 23 | 2929239360 | Chitinophaga sp. R-73072 Hybrid assembly | Isolate | Unclassified |
| 24 | 2945977869 | Chitinophaga sp. W2I13 | Isolate | Rhizosphere |
| 25 | 2945997725 | Pedobacter sp. W3I1 | Isolate | Rhizosphere |
| 26 | 2946013367 | Chitinophaga sp. W3I9 | Isolate | Rhizosphere |
| 27 | 2954016120 | Flavobacterium sp. W4I14 | Isolate | Rhizosphere |
| 28 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 29 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 30 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 31 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 32 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 33 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 34 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 35 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 36 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 37 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 38 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 39 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 40 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 41 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 42 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 43 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 44 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 45 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 46 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 47 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 48 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 49 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 50 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 51 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 54 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 57 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 59 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 61 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 63 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 72 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 79 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 80 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 81 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 83 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 84 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 85 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 87 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 89 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 91 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 92 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 93 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 94 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 95 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 96 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 97 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 98 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 99 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 100 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 101 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 102 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 103 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 104 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 105 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 107 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 108 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 109 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 110 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 111 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 112 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 139 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 140 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 141 | 3300015682 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 | Metagenome | Rhizosphere |
| 142 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 144 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 147 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 149 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 150 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 154 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 211 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 215 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 216 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 217 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 218 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 219 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 220 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 221 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 222 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 223 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 224 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 225 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 226 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 227 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 228 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 229 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 230 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 231 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 232 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 233 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 234 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 235 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 236 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 237 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 238 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 239 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 240 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 241 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 242 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 243 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 244 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 245 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 246 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 247 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 248 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 249 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 250 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 251 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 252 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 253 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 254 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 255 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 256 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 257 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 258 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 259 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 260 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 261 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 262 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 263 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 264 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 265 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 266 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 267 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 268 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 269 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 270 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 295 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 296 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 297 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 298 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 299 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 300 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 305 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 311 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 316 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 317 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 318 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 319 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 320 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 321 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 322 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 323 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 324 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 325 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 326 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 330 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 331 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 335 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 336 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 337 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 338 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 339 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 340 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 341 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 343 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 344 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 345 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 346 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 347 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 348 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 349 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 350 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 351 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 352 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 353 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 354 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 355 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 356 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 357 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 358 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 359 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 360 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 361 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 362 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 363 | 3300053726 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere | Metagenome | Endosphere |
| 364 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 365 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 366 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 367 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 368 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.06 |
| Metatranscriptomes | 0 |
| Isolates | 2.94 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.24 |
| Nodule | 0 |
| Rhizoplane | 0.71 |
| Rhizosphere | 84.81 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.24 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS1b_contig_4233568 | 2162886011 | Unclassified | 1547 |
| 2 | MRS1b_contig_448359 | 2162886011 | Bacteria | 1369 |
| 3 | MBSR1b_contig_1406278 | 2162886012 | Bacteria | 2197 |
| 4 | MBSR1b_contig_7589204 | 2162886012 | Bacteria | 2472 |
| 5 | JGI24744J21845_10003674 | 3300002077 | Bacteria | 3161 |
| 6 | JGI24751J29686_10000540 | 3300002459 | Bacteria | 10612 |
| 7 | JGI25152J39213_1000647 | 3300002773 | Bacteria | 18444 |
| 8 | JGI25150J39212_1000009 | 3300002774 | Bacteria | 249509 |
| 9 | JGI25151J46595_10000017 | 3300003187 | Bacteria | 249509 |
| 10 | JGI25153J46596_10000023 | 3300003215 | Bacteria | 249509 |
| 11 | JGI25153J46596_10023575 | 3300003215 | Bacteria | 2239 |
| 12 | rootH1_10004252 | 3300003316 | Bacteria | 8332 |
| 13 | rootH1_10013495 | 3300003316 | Bacteria | 2356 |
| 14 | rootH1_10013813 | 3300003316 | Bacteria | 11218 |
| 15 | rootH1_10013813 | 3300003323 | Bacteria | 1368 |
| 16 | rootH2_10019275 | 3300003320 | Bacteria | 26987 |
| 17 | rootH2_10039673 | 3300003320 | Bacteria | 11437 |
| 18 | rootH2_10075767 | 3300003320 | Bacteria | 1678 |
| 19 | rootH2_10135544 | 3300003320 | Bacteria | 6928 |
| 20 | rootH2_10166600 | 3300003320 | Bacteria | 4060 |
| 21 | rootH2_10213033 | 3300003320 | Bacteria | 2091 |
| 22 | rootH2_10232790 | 3300003320 | Bacteria | 1248 |
| 23 | rootL2_10000984 | 3300003322 | Bacteria | 19559 |
| 24 | rootL2_10001672 | 3300003322 | Bacteria | 4737 |
| 25 | rootL2_10023331 | 3300003322 | Bacteria | 2597 |
| 26 | rootL2_10041649 | 3300003322 | Bacteria | 1912 |
| 27 | rootL2_10062550 | 3300003322 | Bacteria | 3641 |
| 28 | rootL2_10082800 | 3300003322 | Bacteria | 3650 |
| 29 | rootH1_10003699 | 3300003323 | Bacteria | 25103 |
| 30 | rootH1_10011437 | 3300003323 | Bacteria | 74019 |
| 31 | rootH1_10044529 | 3300003323 | Bacteria | 12446 |
| 32 | rootH1_10064744 | 3300003323 | Bacteria | 6408 |
| 33 | rootH1_10175021 | 3300003323 | Bacteria | 3205 |
| 34 | rootH1_10311342 | 3300003323 | Bacteria | 1623 |
| 35 | JGI25160J50197_1001239 | 3300003354 | Bacteria | 12966 |
| 36 | Ga0055535_1003210 | 3300003761 | Bacteria | 4823 |
| 37 | Ga0055542_1004148 | 3300003762 | Bacteria | 3639 |
| 38 | Ga0055536_1000011 | 3300003781 | Bacteria | 275969 |
| 39 | Ga0055528_1001011 | 3300003790 | Bacteria | 18675 |
| 40 | Ga0055530_10000880 | 3300003791 | Bacteria | 24686 |
| 41 | Ga0055530_10002755 | 3300003791 | Bacteria | 10873 |
| 42 | Ga0055531_10000054 | 3300003794 | Bacteria | 123684 |
| 43 | Ga0055543_1014584 | 3300004625 | Bacteria | 1529 |
| 44 | Ga0065165_1000027 | 3300005262 | Bacteria | 228507 |
| 45 | Ga0065714_10004769 | 3300005288 | Bacteria | 5412 |
| 46 | Ga0065714_10073672 | 3300005288 | Bacteria | 3137 |
| 47 | Ga0065704_10101212 | 3300005289 | Unclassified | 2240 |
| 48 | Ga0065712_10072246 | 3300005290 | Bacteria | 4834 |
| 49 | Ga0065712_10080579 | 3300005290 | Bacteria | 3089 |
| 50 | Ga0065712_10084814 | 3300005290 | Bacteria | 2739 |
| 51 | Ga0065712_10109904 | 3300005290 | Bacteria | 1844 |
| 52 | Ga0065715_10113921 | 3300005293 | Bacteria | 2470 |
| 53 | Ga0070658_10051009 | 3300005327 | Bacteria | 3353 |
| 54 | Ga0070658_10121863 | 3300005327 | Bacteria | 2167 |
| 55 | Ga0070683_100000327 | 3300005329 | Bacteria | 32861 |
| 56 | Ga0070683_100015832 | 3300005329 | Bacteria | 6632 |
| 57 | Ga0070683_100047014 | 3300005329 | Bacteria | 3987 |
| 58 | Ga0070683_100069592 | 3300005329 | Bacteria | 3281 |
| 59 | Ga0070683_100160628 | 3300005329 | Bacteria | 2132 |
| 60 | Ga0070683_100192250 | 3300005329 | Bacteria | 1938 |
| 61 | Ga0070683_100208963 | 3300005329 | Bacteria | 1854 |
| 62 | Ga0070690_100006021 | 3300005330 | Bacteria | 6857 |
| 63 | Ga0070670_100002147 | 3300005331 | Bacteria | 16194 |
| 64 | Ga0070670_100026886 | 3300005331 | Bacteria | 4949 |
| 65 | Ga0070670_100088497 | 3300005331 | Bacteria | 2662 |
| 66 | Ga0070670_100193003 | 3300005331 | Bacteria | 1769 |
| 67 | Ga0070677_10105904 | 3300005333 | Bacteria | 1248 |
| 68 | Ga0068869_100004838 | 3300005334 | Bacteria | 8409 |
| 69 | Ga0068869_100007443 | 3300005334 | Bacteria | 6998 |
| 70 | Ga0068869_100009710 | 3300005334 | Bacteria | 6249 |
| 71 | Ga0068869_100033079 | 3300005334 | Bacteria | 3649 |
| 72 | Ga0068869_100135103 | 3300005334 | Bacteria | 1899 |
| 73 | Ga0070666_10010282 | 3300005335 | Bacteria | 5848 |
| 74 | Ga0070666_10015901 | 3300005335 | Bacteria | 4806 |
| 75 | Ga0070666_10057022 | 3300005335 | Bacteria | 2639 |
| 76 | Ga0070680_100030529 | 3300005336 | Bacteria | 4329 |
| 77 | Ga0070680_100039686 | 3300005336 | Bacteria | 3809 |
| 78 | Ga0070682_100036209 | 3300005337 | Unclassified | 3016 |
| 79 | Ga0068868_100001123 | 3300005338 | Bacteria | 18309 |
| 80 | Ga0068868_100009009 | 3300005338 | Bacteria | 7164 |
| 81 | Ga0068868_100155187 | 3300005338 | Bacteria | 1888 |
| 82 | Ga0068868_100237886 | 3300005338 | Archaea | 1529 |
| 83 | Ga0070660_100000435 | 3300005339 | Bacteria | 27665 |
| 84 | Ga0070660_100243923 | 3300005339 | Bacteria | 1464 |
| 85 | Ga0070689_100013812 | 3300005340 | Bacteria | 5850 |
| 86 | Ga0070689_100014333 | 3300005340 | Bacteria | 5756 |
| 87 | Ga0070689_100014980 | 3300005340 | Bacteria | 5645 |
| 88 | Ga0070691_10087870 | 3300005341 | Bacteria | 1529 |
| 89 | Ga0070661_100003284 | 3300005344 | Bacteria | 11166 |
| 90 | Ga0070661_100011988 | 3300005344 | Bacteria | 6056 |
| 91 | Ga0070661_100120125 | 3300005344 | Unclassified | 1968 |
| 92 | Ga0070668_100165525 | 3300005347 | Bacteria | 1797 |
| 93 | Ga0070669_100006429 | 3300005353 | Bacteria | 8458 |
| 94 | Ga0070669_100014257 | 3300005353 | Bacteria | 5656 |
| 95 | Ga0070669_100024594 | 3300005353 | Bacteria | 4320 |
| 96 | Ga0070669_100038623 | 3300005353 | Bacteria | 3466 |
| 97 | Ga0070675_100055992 | 3300005354 | Bacteria | 3248 |
| 98 | Ga0070675_100117262 | 3300005354 | Bacteria | 2259 |
| 99 | Ga0070671_100053038 | 3300005355 | Bacteria | 3371 |
| 100 | Ga0070671_100144493 | 3300005355 | Bacteria | 2008 |
| 101 | Ga0070671_100268721 | 3300005355 | Bacteria | 1449 |
| 102 | Ga0070674_100020838 | 3300005356 | Bacteria | 4198 |
| 103 | Ga0070673_100040106 | 3300005364 | Bacteria | 3590 |
| 104 | Ga0070673_100042302 | 3300005364 | Bacteria | 3512 |
| 105 | Ga0070673_100118290 | 3300005364 | Bacteria | 2206 |
| 106 | Ga0070673_100149021 | 3300005364 | Unclassified | 1980 |
| 107 | Ga0070673_100293831 | 3300005364 | Bacteria | 1429 |
| 108 | Ga0070688_100084798 | 3300005365 | Bacteria | 2058 |
| 109 | Ga0070659_100008871 | 3300005366 | Bacteria | 7367 |
| 110 | Ga0070659_100009567 | 3300005366 | Bacteria | 7122 |
| 111 | Ga0070659_100019255 | 3300005366 | Bacteria | 5168 |
| 112 | Ga0070667_100018912 | 3300005367 | Bacteria | 5712 |
| 113 | Ga0070667_100050896 | 3300005367 | Bacteria | 3491 |
| 114 | Ga0070667_100222256 | 3300005367 | Bacteria | 1681 |
| 115 | Ga0070700_100035240 | 3300005441 | Bacteria | 3027 |
| 116 | Ga0070663_100209846 | 3300005455 | Bacteria | 1524 |
| 117 | Ga0070663_100428230 | 3300005455 | Bacteria | 1087 |
| 118 | Ga0070678_100011344 | 3300005456 | Bacteria | 5491 |
| 119 | Ga0070678_100119505 | 3300005456 | Bacteria | 2076 |
| 120 | Ga0070662_100000209 | 3300005457 | Bacteria | 34168 |
| 121 | Ga0070662_100046050 | 3300005457 | Bacteria | 3133 |
| 122 | Ga0070681_10012536 | 3300005458 | Bacteria | 8413 |
| 123 | Ga0070681_10051031 | 3300005458 | Bacteria | 4126 |
| 124 | Ga0070681_10102633 | 3300005458 | Bacteria | 2805 |
| 125 | Ga0068867_100003103 | 3300005459 | Bacteria | 11709 |
| 126 | Ga0068867_100039779 | 3300005459 | Bacteria | 3430 |
| 127 | Ga0068867_100257655 | 3300005459 | Unclassified | 1421 |
| 128 | Ga0068867_100274327 | 3300005459 | Bacteria | 1380 |
| 129 | Ga0070685_10004060 | 3300005466 | Bacteria | 7394 |
| 130 | Ga0070685_10123337 | 3300005466 | Bacteria | 1611 |
| 131 | Ga0070685_10262349 | 3300005466 | Unclassified | 1149 |
| 132 | Ga0070698_100000282 | 3300005471 | Bacteria | 51827 |
| 133 | Ga0070698_100002541 | 3300005471 | Bacteria | 20094 |
| 134 | Ga0070698_100006847 | 3300005471 | Bacteria | 12348 |
| 135 | Ga0070679_100094063 | 3300005530 | Bacteria | 2984 |
| 136 | Ga0070684_100000290 | 3300005535 | Bacteria | 34902 |
| 137 | Ga0070684_100001419 | 3300005535 | Bacteria | 17242 |
| 138 | Ga0070684_100080123 | 3300005535 | Bacteria | 2888 |
| 139 | Ga0070684_100094748 | 3300005535 | Bacteria | 2659 |
| 140 | Ga0068853_100009821 | 3300005539 | Bacteria | 7723 |
| 141 | Ga0068853_100010194 | 3300005539 | Bacteria | 7596 |
| 142 | Ga0068853_100029290 | 3300005539 | Bacteria | 4639 |
| 143 | Ga0068853_100041203 | 3300005539 | Bacteria | 3943 |
| 144 | Ga0068853_100087689 | 3300005539 | Bacteria | 2731 |
| 145 | Ga0068853_100417602 | 3300005539 | Bacteria | 1258 |
| 146 | Ga0070672_100008190 | 3300005543 | Bacteria | 7143 |
| 147 | Ga0070672_100079570 | 3300005543 | Bacteria | 2624 |
| 148 | Ga0070672_100147053 | 3300005543 | Bacteria | 1947 |
| 149 | Ga0070686_100042729 | 3300005544 | Bacteria | 2841 |
| 150 | Ga0070686_100072943 | 3300005544 | Bacteria | 2252 |
| 151 | Ga0070665_100000014 | 3300005548 | Bacteria | 484881 |
| 152 | Ga0070665_100229319 | 3300005548 | Bacteria | 1857 |
| 153 | Ga0068855_100000081 | 3300005563 | Bacteria | 115707 |
| 154 | Ga0068855_100013609 | 3300005563 | Bacteria | 9810 |
| 155 | Ga0068855_100023253 | 3300005563 | Bacteria | 7424 |
| 156 | Ga0068855_100024021 | 3300005563 | Bacteria | 7298 |
| 157 | Ga0068855_100059131 | 3300005563 | Bacteria | 4486 |
| 158 | Ga0068855_100062546 | 3300005563 | Unclassified | 4345 |
| 159 | Ga0068855_100198910 | 3300005563 | Bacteria | 2257 |
| 160 | Ga0068855_100680977 | 3300005563 | Bacteria | 1102 |
| 161 | Ga0070664_100000509 | 3300005564 | Bacteria | 29514 |
| 162 | Ga0070664_100005422 | 3300005564 | Bacteria | 10239 |
| 163 | Ga0070664_100008601 | 3300005564 | Bacteria | 8259 |
| 164 | Ga0070664_100391241 | 3300005564 | Unclassified | 1270 |
| 165 | Ga0068857_100000579 | 3300005577 | Bacteria | 26747 |
| 166 | Ga0068857_100002654 | 3300005577 | Bacteria | 14675 |
| 167 | Ga0068857_100008029 | 3300005577 | Bacteria | 9102 |
| 168 | Ga0068857_100073334 | 3300005577 | Bacteria | 3050 |
| 169 | Ga0068857_100160766 | 3300005577 | Bacteria | 2038 |
| 170 | Ga0068857_100164503 | 3300005577 | Bacteria | 2014 |
| 171 | Ga0068854_100032309 | 3300005578 | Bacteria | 3641 |
| 172 | Ga0068854_100046669 | 3300005578 | Bacteria | 3085 |
| 173 | Ga0068854_100071526 | 3300005578 | Bacteria | 2538 |
| 174 | Ga0068854_100093732 | 3300005578 | Bacteria | 2239 |
| 175 | Ga0068856_100024646 | 3300005614 | Bacteria | 5857 |
| 176 | Ga0068856_100054252 | 3300005614 | Bacteria | 3953 |
| 177 | Ga0068856_100067961 | 3300005614 | Bacteria | 3522 |
| 178 | Ga0068856_100077785 | 3300005614 | Bacteria | 3288 |
| 179 | Ga0068852_100014577 | 3300005616 | Bacteria | 6057 |
| 180 | Ga0068852_100035186 | 3300005616 | Bacteria | 4175 |
| 181 | Ga0068852_100075342 | 3300005616 | Bacteria | 2976 |
| 182 | Ga0068852_100090210 | 3300005616 | Bacteria | 2741 |
| 183 | Ga0068852_100197709 | 3300005616 | Bacteria | 1901 |
| 184 | Ga0068852_100366226 | 3300005616 | Bacteria | 1411 |
| 185 | Ga0068852_100368481 | 3300005616 | Unclassified | 1407 |
| 186 | Ga0068859_100000289 | 3300005617 | Bacteria | 49979 |
| 187 | Ga0068859_100017809 | 3300005617 | Bacteria | 7141 |
| 188 | Ga0068859_100086698 | 3300005617 | Bacteria | 3178 |
| 189 | Ga0068864_100002659 | 3300005618 | Bacteria | 14761 |
| 190 | Ga0068864_100004779 | 3300005618 | Bacteria | 11103 |
| 191 | Ga0068864_100043128 | 3300005618 | Bacteria | 3862 |
| 192 | Ga0068864_100088090 | 3300005618 | Bacteria | 2734 |
| 193 | Ga0068864_100127278 | 3300005618 | Bacteria | 2284 |
| 194 | Ga0068864_100257686 | 3300005618 | Bacteria | 1622 |
| 195 | Ga0068864_100303098 | 3300005618 | Unclassified | 1496 |
| 196 | Ga0068864_100644796 | 3300005618 | Unclassified | 1031 |
| 197 | Ga0068866_10014018 | 3300005718 | Bacteria | 3530 |
| 198 | Ga0068866_10031820 | 3300005718 | Unclassified | 2545 |
| 199 | Ga0068861_100001502 | 3300005719 | Bacteria | 14807 |
| 200 | Ga0068861_100020793 | 3300005719 | Bacteria | 4707 |
| 201 | Ga0068861_100049553 | 3300005719 | Bacteria | 3181 |
| 202 | Ga0068861_100164123 | 3300005719 | Bacteria | 1835 |
| 203 | Ga0068861_100462228 | 3300005719 | Bacteria | 1139 |
| 204 | Ga0068851_10008435 | 3300005834 | Bacteria | 4762 |
| 205 | Ga0068870_10002263 | 3300005840 | Bacteria | 7992 |
| 206 | Ga0068870_10095513 | 3300005840 | Bacteria | 1670 |
| 207 | Ga0068863_100026959 | 3300005841 | Bacteria | 5479 |
| 208 | Ga0068863_100405149 | 3300005841 | Bacteria | 1334 |
| 209 | Ga0068863_100481938 | 3300005841 | Bacteria | 1220 |
| 210 | Ga0068858_100104708 | 3300005842 | Bacteria | 2640 |
| 211 | Ga0068858_100119796 | 3300005842 | Bacteria | 2460 |
| 212 | Ga0068858_100527839 | 3300005842 | Bacteria | 1142 |
| 213 | Ga0068860_100008699 | 3300005843 | Bacteria | 10113 |
| 214 | Ga0068860_100054588 | 3300005843 | Bacteria | 3798 |
| 215 | Ga0068860_100343310 | 3300005843 | Unclassified | 1468 |
| 216 | Ga0068862_100011939 | 3300005844 | Bacteria | 7176 |
| 217 | Ga0068862_100027366 | 3300005844 | Bacteria | 4799 |
| 218 | Ga0068862_100058506 | 3300005844 | Bacteria | 3306 |
| 219 | Ga0068862_100132285 | 3300005844 | Bacteria | 2207 |
| 220 | Ga0068862_100306494 | 3300005844 | Bacteria | 1462 |
| 221 | Ga0075366_10096980 | 3300006195 | Bacteria | 1768 |
| 222 | Ga0097621_100000036 | 3300006237 | Bacteria | 67999 |
| 223 | Ga0097621_100070027 | 3300006237 | Bacteria | 2896 |
| 224 | Ga0097621_100215805 | 3300006237 | Bacteria | 1670 |
| 225 | Ga0097621_100225479 | 3300006237 | Unclassified | 1634 |
| 226 | Ga0068871_100005055 | 3300006358 | Bacteria | 9209 |
| 227 | Ga0068871_100033550 | 3300006358 | Bacteria | 4066 |
| 228 | Ga0068871_100326025 | 3300006358 | Unclassified | 1353 |
| 229 | Ga0068871_100343538 | 3300006358 | Unclassified | 1318 |
| 230 | Ga0075428_100006607 | 3300006844 | Bacteria | 12900 |
| 231 | Ga0075428_100093975 | 3300006844 | Bacteria | 3269 |
| 232 | Ga0075428_100152663 | 3300006844 | Bacteria | 2509 |
| 233 | Ga0075428_100294134 | 3300006844 | Bacteria | 1746 |
| 234 | Ga0075430_100104237 | 3300006846 | Bacteria | 2368 |
| 235 | Ga0075430_100175362 | 3300006846 | Bacteria | 1783 |
| 236 | Ga0075431_100055523 | 3300006847 | Bacteria | 4085 |
| 237 | Ga0075431_100110345 | 3300006847 | Bacteria | 2839 |
| 238 | Ga0075431_100127855 | 3300006847 | Bacteria | 2622 |
| 239 | Ga0075431_100147598 | 3300006847 | Unclassified | 2423 |
| 240 | Ga0075429_100000136 | 3300006880 | Bacteria | 44169 |
| 241 | Ga0075429_100001725 | 3300006880 | Bacteria | 18078 |
| 242 | Ga0068865_100095874 | 3300006881 | Bacteria | 2162 |
| 243 | Ga0097620_100000289 | 3300006931 | Bacteria | 49979 |
| 244 | Ga0097620_100017809 | 3300006931 | Bacteria | 7141 |
| 245 | Ga0097620_100086694 | 3300006931 | Bacteria | 3178 |
| 246 | Ga0097620_100446771 | 3300006931 | Bacteria | 1389 |
| 247 | Ga0105240_10000106 | 3300009093 | Bacteria | 171825 |
| 248 | Ga0105240_10000606 | 3300009093 | Bacteria | 66467 |
| 249 | Ga0105240_10002298 | 3300009093 | Bacteria | 30947 |
| 250 | Ga0105240_10003660 | 3300009093 | Bacteria | 23789 |
| 251 | Ga0105240_10006503 | 3300009093 | Bacteria | 17166 |
| 252 | Ga0105240_10062121 | 3300009093 | Bacteria | 4652 |
| 253 | Ga0105240_10067774 | 3300009093 | Bacteria | 4423 |
| 254 | Ga0105240_10085981 | 3300009093 | Bacteria | 3852 |
| 255 | Ga0105240_10363012 | 3300009093 | Bacteria | 1640 |
| 256 | Ga0111539_10000601 | 3300009094 | Bacteria | 46564 |
| 257 | Ga0111539_10033061 | 3300009094 | Bacteria | 6280 |
| 258 | Ga0111539_10077796 | 3300009094 | Bacteria | 3904 |
| 259 | Ga0111539_10157727 | 3300009094 | Bacteria | 2655 |
| 260 | Ga0111539_10571069 | 3300009094 | Unclassified | 1317 |
| 261 | Ga0111539_10632485 | 3300009094 | Bacteria | 1246 |
| 262 | Ga0105247_10001391 | 3300009101 | Bacteria | 17555 |
| 263 | Ga0114129_10004956 | 3300009147 | Bacteria | 18775 |
| 264 | Ga0114129_10007484 | 3300009147 | Bacteria | 15553 |
| 265 | Ga0114129_10039792 | 3300009147 | Bacteria | 6631 |
| 266 | Ga0114129_10138808 | 3300009147 | Bacteria | 3334 |
| 267 | Ga0105243_10120919 | 3300009148 | Bacteria | 2207 |
| 268 | Ga0105241_10004142 | 3300009174 | Bacteria | 10702 |
| 269 | Ga0105241_10033823 | 3300009174 | Bacteria | 3839 |
| 270 | Ga0105241_10034973 | 3300009174 | Bacteria | 3778 |
| 271 | Ga0105241_10169024 | 3300009174 | Bacteria | 1804 |
| 272 | Ga0105242_10078638 | 3300009176 | Bacteria | 2753 |
| 273 | Ga0105242_10084012 | 3300009176 | Bacteria | 2667 |
| 274 | Ga0105237_10003013 | 3300009545 | Bacteria | 20323 |
| 275 | Ga0105237_10014210 | 3300009545 | Bacteria | 8336 |
| 276 | Ga0105237_10016066 | 3300009545 | Bacteria | 7784 |
| 277 | Ga0105237_10036411 | 3300009545 | Bacteria | 4980 |
| 278 | Ga0105237_10137911 | 3300009545 | Bacteria | 2434 |
| 279 | Ga0105237_10186331 | 3300009545 | Bacteria | 2075 |
| 280 | Ga0105238_10002205 | 3300009551 | Bacteria | 19643 |
| 281 | Ga0105238_10080747 | 3300009551 | Bacteria | 3241 |
| 282 | Ga0105249_10000635 | 3300009553 | Bacteria | 32011 |
| 283 | Ga0105249_10001404 | 3300009553 | Bacteria | 21086 |
| 284 | Ga0105249_10044696 | 3300009553 | Bacteria | 4027 |
| 285 | Ga0105249_10054284 | 3300009553 | Unclassified | 3664 |
| 286 | Ga0105249_10144835 | 3300009553 | Bacteria | 2281 |
| 287 | Ga0105249_10175047 | 3300009553 | Bacteria | 2084 |
| 288 | Ga0105249_10455591 | 3300009553 | Bacteria | 1318 |
| 289 | Ga0105239_10000404 | 3300010375 | Bacteria | 63332 |
| 290 | Ga0105239_10006097 | 3300010375 | Bacteria | 14036 |
| 291 | Ga0105239_10006227 | 3300010375 | Bacteria | 13883 |
| 292 | Ga0105239_10015063 | 3300010375 | Bacteria | 8572 |
| 293 | Ga0105239_10205164 | 3300010375 | Bacteria | 2209 |
| 294 | Ga0105239_10347541 | 3300010375 | Bacteria | 1674 |
| 295 | Ga0105246_10024851 | 3300011119 | Bacteria | 3899 |
| 296 | Ga0105246_10039983 | 3300011119 | Bacteria | 3162 |
| 297 | Ga0157373_10002753 | 3300013100 | Bacteria | 13315 |
| 298 | Ga0157373_10026532 | 3300013100 | Bacteria | 4183 |
| 299 | Ga0157371_10000009 | 3300013102 | Bacteria | 392895 |
| 300 | Ga0157371_10000518 | 3300013102 | Bacteria | 46197 |
| 301 | Ga0157371_10002698 | 3300013102 | Bacteria | 16766 |
| 302 | Ga0157371_10004536 | 3300013102 | Bacteria | 12096 |
| 303 | Ga0157371_10012494 | 3300013102 | Bacteria | 6489 |
| 304 | Ga0157371_10036915 | 3300013102 | Bacteria | 3500 |
| 305 | Ga0157371_10203478 | 3300013102 | Bacteria | 1420 |
| 306 | Ga0157370_10000408 | 3300013104 | Bacteria | 54355 |
| 307 | Ga0157370_10016291 | 3300013104 | Bacteria | 7532 |
| 308 | Ga0157370_10018111 | 3300013104 | Bacteria | 7090 |
| 309 | Ga0157370_10055556 | 3300013104 | Bacteria | 3771 |
| 310 | Ga0157370_10061782 | 3300013104 | Bacteria | 3555 |
| 311 | Ga0157370_10070626 | 3300013104 | Bacteria | 3296 |
| 312 | Ga0157370_10087246 | 3300013104 | Bacteria | 2931 |
| 313 | Ga0157370_10434281 | 3300013104 | Bacteria | 1207 |
| 314 | Ga0157369_10000006 | 3300013105 | Bacteria | 412230 |
| 315 | Ga0157369_10075403 | 3300013105 | Bacteria | 3617 |
| 316 | Ga0157369_10182337 | 3300013105 | Unclassified | 2209 |
| 317 | Ga0157369_10252579 | 3300013105 | Bacteria | 1840 |
| 318 | Ga0157374_10000027 | 3300013296 | Bacteria | 233444 |
| 319 | Ga0157374_10000587 | 3300013296 | Bacteria | 32144 |
| 320 | Ga0157374_10000745 | 3300013296 | Bacteria | 28347 |
| 321 | Ga0157374_10028707 | 3300013296 | Bacteria | 5028 |
| 322 | Ga0157374_10062246 | 3300013296 | Bacteria | 3497 |
| 323 | Ga0157374_10125984 | 3300013296 | Bacteria | 2476 |
| 324 | Ga0157374_10184131 | 3300013296 | Bacteria | 2041 |
| 325 | Ga0157378_10015554 | 3300013297 | Bacteria | 6664 |
| 326 | Ga0157378_10035720 | 3300013297 | Bacteria | 4397 |
| 327 | Ga0157378_10150092 | 3300013297 | Bacteria | 2171 |
| 328 | Ga0157378_10330464 | 3300013297 | Unclassified | 1483 |
| 329 | Ga0163162_10000177 | 3300013306 | Bacteria | 58576 |
| 330 | Ga0163162_10002271 | 3300013306 | Bacteria | 18040 |
| 331 | Ga0163162_10002571 | 3300013306 | Bacteria | 17169 |
| 332 | Ga0163162_10002830 | 3300013306 | Bacteria | 16503 |
| 333 | Ga0163162_10010645 | 3300013306 | Bacteria | 8945 |
| 334 | Ga0163162_10023096 | 3300013306 | Bacteria | 6135 |
| 335 | Ga0163162_10068630 | 3300013306 | Bacteria | 3597 |
| 336 | Ga0163162_10077356 | 3300013306 | Bacteria | 3390 |
| 337 | Ga0163162_10138178 | 3300013306 | Bacteria | 2548 |
| 338 | Ga0163162_10172929 | 3300013306 | Bacteria | 2285 |
| 339 | Ga0163162_10201986 | 3300013306 | Bacteria | 2116 |
| 340 | Ga0163162_10434663 | 3300013306 | Archaea | 1445 |
| 341 | Ga0157372_10002627 | 3300013307 | Bacteria | 19456 |
| 342 | Ga0157372_10018986 | 3300013307 | Bacteria | 7399 |
| 343 | Ga0157372_10022449 | 3300013307 | Bacteria | 6830 |
| 344 | Ga0157372_10026460 | 3300013307 | Bacteria | 6312 |
| 345 | Ga0157372_10029218 | 3300013307 | Bacteria | 6018 |
| 346 | Ga0157372_10052938 | 3300013307 | Bacteria | 4522 |
| 347 | Ga0157372_10078140 | 3300013307 | Bacteria | 3739 |
| 348 | Ga0157372_10080014 | 3300013307 | Bacteria | 3697 |
| 349 | Ga0157372_10117112 | 3300013307 | Bacteria | 3055 |
| 350 | Ga0157372_10190194 | 3300013307 | Bacteria | 2377 |
| 351 | Ga0157372_10197822 | 3300013307 | Bacteria | 2328 |
| 352 | Ga0157375_10000067 | 3300013308 | Bacteria | 110313 |
| 353 | Ga0157375_10011638 | 3300013308 | Bacteria | 7774 |
| 354 | Ga0157375_10085934 | 3300013308 | Bacteria | 3196 |
| 355 | Ga0163163_10000432 | 3300014325 | Bacteria | 38603 |
| 356 | Ga0163163_10014374 | 3300014325 | Bacteria | 7277 |
| 357 | Ga0163163_10040694 | 3300014325 | Bacteria | 4540 |
| 358 | Ga0163163_10107022 | 3300014325 | Bacteria | 2823 |
| 359 | Ga0163163_10128193 | 3300014325 | Bacteria | 2576 |
| 360 | Ga0163163_10172155 | 3300014325 | Bacteria | 2212 |
| 361 | Ga0157380_10000018 | 3300014326 | Bacteria | 116537 |
| 362 | Ga0157380_10028507 | 3300014326 | Bacteria | 4257 |
| 363 | Ga0157380_10050708 | 3300014326 | Bacteria | 3279 |
| 364 | Ga0157380_10069798 | 3300014326 | Bacteria | 2837 |
| 365 | Ga0157380_10102592 | 3300014326 | Bacteria | 2385 |
| 366 | Ga0157380_10370164 | 3300014326 | Bacteria | 1348 |
| 367 | Ga0157379_10008380 | 3300014968 | Bacteria | 8984 |
| 368 | Ga0157379_10028680 | 3300014968 | Bacteria | 4950 |
| 369 | Ga0157379_10059561 | 3300014968 | Bacteria | 3414 |
| 370 | Ga0157376_10000341 | 3300014969 | Bacteria | 31058 |
| 371 | Ga0157376_10115471 | 3300014969 | Bacteria | 2370 |
| 372 | Ga0157376_10154924 | 3300014969 | Bacteria | 2070 |
| 373 | Ga0157376_10213854 | 3300014969 | Bacteria | 1782 |
| 374 | Ga0157376_10419471 | 3300014969 | Bacteria | 1298 |
| 375 | Ga0182006_1000322 | 3300015261 | Bacteria | 41718 |
| 376 | Ga0182006_1000622 | 3300015261 | Bacteria | 25427 |
| 377 | Ga0182007_10000001 | 3300015262 | Bacteria | 1127301 |
| 378 | Ga0182005_1000097 | 3300015265 | Bacteria | 66720 |
| 379 | Ga0183373_1006 | 3300015682 | Bacteria | 328276 |
| 380 | Ga0163161_10001724 | 3300017792 | Bacteria | 16022 |
| 381 | Ga0163161_10002308 | 3300017792 | Bacteria | 13670 |
| 382 | Ga0163161_10059225 | 3300017792 | Bacteria | 2784 |
| 383 | Ga0163161_10060984 | 3300017792 | Bacteria | 2746 |
| 384 | Ga0163161_10072665 | 3300017792 | Bacteria | 2519 |
| 385 | Ga0163161_10267700 | 3300017792 | Bacteria | 1336 |
| 386 | Ga0213876_10001574 | 3300021384 | Bacteria | 14029 |
| 387 | Ga0209436_100324 | 3300025208 | Bacteria | 21828 |
| 388 | Ga0209436_114708 | 3300025208 | Bacteria | 1237 |
| 389 | Ga0209258_100302 | 3300025242 | Bacteria | 79794 |
| 390 | Ga0209258_108334 | 3300025242 | Bacteria | 1464 |
| 391 | Ga0207425_1000007 | 3300025245 | Bacteria | 777411 |
| 392 | Ga0209148_1000131 | 3300025254 | Bacteria | 174079 |
| 393 | Ga0209129_1000006 | 3300025258 | Bacteria | 777761 |
| 394 | Ga0209673_1000203 | 3300025273 | Bacteria | 119623 |
| 395 | Ga0209130_1001297 | 3300025284 | Bacteria | 17208 |
| 396 | Ga0209676_1000001 | 3300025292 | Bacteria | 1852142 |
| 397 | Ga0209025_1000025 | 3300025294 | Bacteria | 524454 |
| 398 | Ga0209564_1022859 | 3300025295 | Bacteria | 2192 |
| 399 | Ga0209564_1022867 | 3300025295 | Bacteria | 2192 |
| 400 | Ga0209758_1000016 | 3300025297 | Bacteria | 778557 |
| 401 | Ga0209050_1000016 | 3300025298 | Bacteria | 729149 |
| 402 | Ga0209050_1000888 | 3300025298 | Bacteria | 39848 |
| 403 | Ga0209050_1037458 | 3300025298 | Bacteria | 1398 |
| 404 | Ga0207426_1000024 | 3300025302 | Bacteria | 534075 |
| 405 | Ga0207426_1000806 | 3300025302 | Bacteria | 33910 |
| 406 | Ga0207426_1017306 | 3300025302 | Bacteria | 2565 |
| 407 | Ga0209257_1000070 | 3300025304 | Bacteria | 336454 |
| 408 | Ga0209257_1002474 | 3300025304 | Bacteria | 18274 |
| 409 | Ga0207697_10028263 | 3300025315 | Unclassified | 2294 |
| 410 | Ga0207697_10051444 | 3300025315 | Bacteria | 1702 |
| 411 | Ga0207682_10107132 | 3300025893 | Bacteria | 1227 |
| 412 | Ga0207710_10000673 | 3300025900 | Bacteria | 19242 |
| 413 | Ga0207710_10102145 | 3300025900 | Bacteria | 1353 |
| 414 | Ga0207688_10002217 | 3300025901 | Bacteria | 10462 |
| 415 | Ga0207680_10036735 | 3300025903 | Bacteria | 2823 |
| 416 | Ga0207680_10043288 | 3300025903 | Bacteria | 2640 |
| 417 | Ga0207680_10190488 | 3300025903 | Bacteria | 1392 |
| 418 | Ga0207647_10000210 | 3300025904 | Bacteria | 47384 |
| 419 | Ga0207647_10006574 | 3300025904 | Bacteria | 8445 |
| 420 | Ga0207647_10044652 | 3300025904 | Bacteria | 2767 |
| 421 | Ga0207685_10012593 | 3300025905 | Bacteria | 2586 |
| 422 | Ga0207645_10002084 | 3300025907 | Bacteria | 16005 |
| 423 | Ga0207645_10012266 | 3300025907 | Bacteria | 5821 |
| 424 | Ga0207645_10077695 | 3300025907 | Bacteria | 2127 |
| 425 | Ga0207645_10142380 | 3300025907 | Bacteria | 1563 |
| 426 | Ga0207645_10155718 | 3300025907 | Bacteria | 1493 |
| 427 | Ga0207643_10106547 | 3300025908 | Bacteria | 1648 |
| 428 | Ga0207643_10179534 | 3300025908 | Unclassified | 1280 |
| 429 | Ga0207654_10017862 | 3300025911 | Bacteria | 3716 |
| 430 | Ga0207654_10062096 | 3300025911 | Bacteria | 2188 |
| 431 | Ga0207707_10096103 | 3300025912 | Unclassified | 2589 |
| 432 | Ga0207707_10285942 | 3300025912 | Unclassified | 1427 |
| 433 | Ga0207695_10000087 | 3300025913 | Bacteria | 276412 |
| 434 | Ga0207695_10000685 | 3300025913 | Bacteria | 66448 |
| 435 | Ga0207695_10000917 | 3300025913 | Bacteria | 52754 |
| 436 | Ga0207695_10001873 | 3300025913 | Bacteria | 32931 |
| 437 | Ga0207695_10028845 | 3300025913 | Bacteria | 6143 |
| 438 | Ga0207695_10038240 | 3300025913 | Bacteria | 5169 |
| 439 | Ga0207695_10118885 | 3300025913 | Bacteria | 2613 |
| 440 | Ga0207671_10000637 | 3300025914 | Bacteria | 45954 |
| 441 | Ga0207671_10004496 | 3300025914 | Bacteria | 13275 |
| 442 | Ga0207671_10011235 | 3300025914 | Bacteria | 7305 |
| 443 | Ga0207671_10051595 | 3300025914 | Bacteria | 3048 |
| 444 | Ga0207671_10053268 | 3300025914 | Bacteria | 2998 |
| 445 | Ga0207660_10021719 | 3300025917 | Bacteria | 4319 |
| 446 | Ga0207662_10064031 | 3300025918 | Bacteria | 2211 |
| 447 | Ga0207657_10004066 | 3300025919 | Bacteria | 15521 |
| 448 | Ga0207657_10105987 | 3300025919 | Bacteria | 2326 |
| 449 | Ga0207649_10000567 | 3300025920 | Bacteria | 25427 |
| 450 | Ga0207649_10007810 | 3300025920 | Bacteria | 5820 |
| 451 | Ga0207649_10021250 | 3300025920 | Bacteria | 3733 |
| 452 | Ga0207652_10000771 | 3300025921 | Bacteria | 30684 |
| 453 | Ga0207652_10007027 | 3300025921 | Bacteria | 9072 |
| 454 | Ga0207681_10010977 | 3300025923 | Bacteria | 5563 |
| 455 | Ga0207681_10034340 | 3300025923 | Bacteria | 3334 |
| 456 | Ga0207681_10034444 | 3300025923 | Bacteria | 3330 |
| 457 | Ga0207681_10119055 | 3300025923 | Bacteria | 1934 |
| 458 | Ga0207681_10282478 | 3300025923 | Bacteria | 1307 |
| 459 | Ga0207694_10004594 | 3300025924 | Bacteria | 10748 |
| 460 | Ga0207694_10016687 | 3300025924 | Bacteria | 5550 |
| 461 | Ga0207650_10001513 | 3300025925 | Bacteria | 16609 |
| 462 | Ga0207650_10061492 | 3300025925 | Bacteria | 2804 |
| 463 | Ga0207650_10232685 | 3300025925 | Bacteria | 1487 |
| 464 | Ga0207650_10273390 | 3300025925 | Bacteria | 1374 |
| 465 | Ga0207659_10032388 | 3300025926 | Bacteria | 3587 |
| 466 | Ga0207659_10049585 | 3300025926 | Bacteria | 2979 |
| 467 | Ga0207659_10065881 | 3300025926 | Bacteria | 2627 |
| 468 | Ga0207687_10123453 | 3300025927 | Bacteria | 1940 |
| 469 | Ga0207644_10131582 | 3300025931 | Unclassified | 1916 |
| 470 | Ga0207644_10157076 | 3300025931 | Bacteria | 1765 |
| 471 | Ga0207644_10384966 | 3300025931 | Bacteria | 1144 |
| 472 | Ga0207690_10003267 | 3300025932 | Bacteria | 9722 |
| 473 | Ga0207690_10010426 | 3300025932 | Bacteria | 5522 |
| 474 | Ga0207690_10087329 | 3300025932 | Bacteria | 2194 |
| 475 | Ga0207690_10276472 | 3300025932 | Bacteria | 1306 |
| 476 | Ga0207706_10003474 | 3300025933 | Bacteria | 15037 |
| 477 | Ga0207706_10010648 | 3300025933 | Bacteria | 8399 |
| 478 | Ga0207706_10012403 | 3300025933 | Bacteria | 7765 |
| 479 | Ga0207706_10017700 | 3300025933 | Bacteria | 6420 |
| 480 | Ga0207706_10052797 | 3300025933 | Bacteria | 3588 |
| 481 | Ga0207670_10039676 | 3300025936 | Bacteria | 3085 |
| 482 | Ga0207670_10042328 | 3300025936 | Bacteria | 3001 |
| 483 | Ga0207669_10023300 | 3300025937 | Bacteria | 3305 |
| 484 | Ga0207669_10024850 | 3300025937 | Bacteria | 3227 |
| 485 | Ga0207704_10006232 | 3300025938 | Bacteria | 5547 |
| 486 | Ga0207704_10009596 | 3300025938 | Bacteria | 4677 |
| 487 | Ga0207704_10112509 | 3300025938 | Bacteria | 1844 |
| 488 | Ga0207704_10194021 | 3300025938 | Unclassified | 1480 |
| 489 | Ga0207691_10063280 | 3300025940 | Bacteria | 3355 |
| 490 | Ga0207689_10000843 | 3300025942 | Bacteria | 29516 |
| 491 | Ga0207689_10007268 | 3300025942 | Bacteria | 9723 |
| 492 | Ga0207689_10008486 | 3300025942 | Bacteria | 8952 |
| 493 | Ga0207689_10031074 | 3300025942 | Bacteria | 4448 |
| 494 | Ga0207689_10043750 | 3300025942 | Bacteria | 3701 |
| 495 | Ga0207689_10058060 | 3300025942 | Bacteria | 3183 |
| 496 | Ga0207689_10065028 | 3300025942 | Bacteria | 3000 |
| 497 | Ga0207689_10201162 | 3300025942 | Bacteria | 1644 |
| 498 | Ga0207661_10000411 | 3300025944 | Bacteria | 27626 |
| 499 | Ga0207661_10007500 | 3300025944 | Bacteria | 7759 |
| 500 | Ga0207661_10045221 | 3300025944 | Bacteria | 3484 |
| 501 | Ga0207679_10000297 | 3300025945 | Bacteria | 37427 |
| 502 | Ga0207679_10000800 | 3300025945 | Bacteria | 20460 |
| 503 | Ga0207679_10069473 | 3300025945 | Bacteria | 2651 |
| 504 | Ga0207667_10000172 | 3300025949 | Bacteria | 95455 |
| 505 | Ga0207667_10008374 | 3300025949 | Bacteria | 12289 |
| 506 | Ga0207667_10031326 | 3300025949 | Bacteria | 5742 |
| 507 | Ga0207667_10055066 | 3300025949 | Bacteria | 4182 |
| 508 | Ga0207667_10602907 | 3300025949 | Bacteria | 1107 |
| 509 | Ga0207667_10638672 | 3300025949 | Bacteria | 1071 |
| 510 | Ga0207651_10009901 | 3300025960 | Bacteria | 5248 |
| 511 | Ga0207651_10017040 | 3300025960 | Bacteria | 4279 |
| 512 | Ga0207651_10020151 | 3300025960 | Bacteria | 4018 |
| 513 | Ga0207651_10027456 | 3300025960 | Bacteria | 3575 |
| 514 | Ga0207651_10098862 | 3300025960 | Bacteria | 2159 |
| 515 | Ga0207651_10317908 | 3300025960 | Bacteria | 1300 |
| 516 | Ga0207712_10001470 | 3300025961 | Bacteria | 16071 |
| 517 | Ga0207712_10002610 | 3300025961 | Bacteria | 11559 |
| 518 | Ga0207712_10017162 | 3300025961 | Bacteria | 4697 |
| 519 | Ga0207712_10315442 | 3300025961 | Unclassified | 1288 |
| 520 | Ga0207668_10130649 | 3300025972 | Bacteria | 1917 |
| 521 | Ga0207668_10330547 | 3300025972 | Unclassified | 1268 |
| 522 | Ga0207640_10035190 | 3300025981 | Bacteria | 3132 |
| 523 | Ga0207640_10197708 | 3300025981 | Bacteria | 1521 |
| 524 | Ga0207640_10201479 | 3300025981 | Unclassified | 1509 |
| 525 | Ga0207658_10192703 | 3300025986 | Unclassified | 1696 |
| 526 | Ga0207677_10000816 | 3300026023 | Bacteria | 17807 |
| 527 | Ga0207677_10039609 | 3300026023 | Bacteria | 3101 |
| 528 | Ga0207677_10103563 | 3300026023 | Unclassified | 2101 |
| 529 | Ga0207677_10174711 | 3300026023 | Archaea | 1684 |
| 530 | Ga0207703_10027443 | 3300026035 | Bacteria | 4485 |
| 531 | Ga0207703_10222294 | 3300026035 | Bacteria | 1689 |
| 532 | Ga0207703_10335913 | 3300026035 | Bacteria | 1387 |
| 533 | Ga0207639_10001395 | 3300026041 | Bacteria | 16309 |
| 534 | Ga0207639_10002886 | 3300026041 | Bacteria | 11551 |
| 535 | Ga0207639_10055557 | 3300026041 | Bacteria | 3031 |
| 536 | Ga0207639_10074264 | 3300026041 | Unclassified | 2669 |
| 537 | Ga0207678_10033889 | 3300026067 | Unclassified | 4448 |
| 538 | Ga0207708_10020703 | 3300026075 | Bacteria | 4961 |
| 539 | Ga0207708_10231220 | 3300026075 | Bacteria | 1484 |
| 540 | Ga0207702_10085938 | 3300026078 | Unclassified | 2742 |
| 541 | Ga0207702_10145534 | 3300026078 | Bacteria | 2150 |
| 542 | Ga0207702_10189987 | 3300026078 | Bacteria | 1897 |
| 543 | Ga0207641_10128901 | 3300026088 | Bacteria | 2269 |
| 544 | Ga0207648_10000384 | 3300026089 | Bacteria | 48937 |
| 545 | Ga0207648_10010983 | 3300026089 | Bacteria | 8553 |
| 546 | Ga0207648_10026353 | 3300026089 | Bacteria | 5167 |
| 547 | Ga0207648_10057208 | 3300026089 | Bacteria | 3402 |
| 548 | Ga0207648_10057945 | 3300026089 | Bacteria | 3379 |
| 549 | Ga0207648_10350676 | 3300026089 | Unclassified | 1330 |
| 550 | Ga0207676_10009634 | 3300026095 | Bacteria | 6874 |
| 551 | Ga0207676_10012634 | 3300026095 | Bacteria | 6058 |
| 552 | Ga0207676_10054242 | 3300026095 | Bacteria | 3141 |
| 553 | Ga0207676_10084359 | 3300026095 | Bacteria | 2590 |
| 554 | Ga0207676_10336798 | 3300026095 | Unclassified | 1390 |
| 555 | Ga0207674_10004626 | 3300026116 | Bacteria | 16516 |
| 556 | Ga0207674_10012404 | 3300026116 | Bacteria | 9527 |
| 557 | Ga0207674_10025239 | 3300026116 | Bacteria | 6342 |
| 558 | Ga0207674_10090545 | 3300026116 | Bacteria | 3050 |
| 559 | Ga0207674_10128342 | 3300026116 | Bacteria | 2500 |
| 560 | Ga0207674_10208408 | 3300026116 | Bacteria | 1904 |
| 561 | Ga0207674_10249965 | 3300026116 | Bacteria | 1720 |
| 562 | Ga0207674_10325876 | 3300026116 | Bacteria | 1486 |
| 563 | Ga0207674_10460949 | 3300026116 | Bacteria | 1228 |
| 564 | Ga0207675_100009007 | 3300026118 | Bacteria | 9365 |
| 565 | Ga0207675_100012296 | 3300026118 | Bacteria | 7996 |
| 566 | Ga0207675_100055186 | 3300026118 | Bacteria | 3706 |
| 567 | Ga0207675_100139269 | 3300026118 | Bacteria | 2304 |
| 568 | Ga0207683_10004211 | 3300026121 | Bacteria | 12434 |
| 569 | Ga0207683_10007595 | 3300026121 | Bacteria | 9286 |
| 570 | Ga0207698_10018321 | 3300026142 | Bacteria | 4769 |
| 571 | Ga0207698_10032497 | 3300026142 | Bacteria | 3781 |
| 572 | Ga0207698_10037614 | 3300026142 | Bacteria | 3566 |
| 573 | Ga0207698_10080910 | 3300026142 | Bacteria | 2619 |
| 574 | Ga0207698_10087442 | 3300026142 | Bacteria | 2538 |
| 575 | Ga0207698_10302729 | 3300026142 | Bacteria | 1489 |
| 576 | Ga0207428_10047103 | 3300027907 | Bacteria | 3463 |
| 577 | Ga0268266_10000048 | 3300028379 | Bacteria | 310336 |
| 578 | Ga0268265_10009060 | 3300028380 | Bacteria | 6731 |
| 579 | Ga0268265_10073620 | 3300028380 | Unclassified | 2669 |
| 580 | Ga0268265_10102517 | 3300028380 | Bacteria | 2315 |
| 581 | Ga0268265_10292943 | 3300028380 | Bacteria | 1462 |
| 582 | Ga0268264_10001761 | 3300028381 | Bacteria | 19835 |
| 583 | Ga0268264_10006470 | 3300028381 | Bacteria | 9862 |
| 584 | Ga0268264_10006760 | 3300028381 | Bacteria | 9638 |
| 585 | Ga0268264_10010034 | 3300028381 | Bacteria | 7841 |
| 586 | Ga0268264_10028275 | 3300028381 | Bacteria | 4585 |
| 587 | Ga0268264_10037291 | 3300028381 | Bacteria | 4007 |
| 588 | Ga0268264_10086516 | 3300028381 | Bacteria | 2693 |
| 589 | Ga0268264_10353553 | 3300028381 | Bacteria | 1399 |
| 590 | Ga0307517_10099816 | 3300028786 | Bacteria | 2298 |
| 591 | Ga0307515_10000001 | 3300028794 | Bacteria | 4259510 |
| 592 | Ga0307515_10104701 | 3300028794 | Bacteria | 3377 |
| 593 | Ga0265338_10000651 | 3300028800 | Bacteria | 59980 |
| 594 | Ga0265324_10016585 | 3300029957 | Unclassified | 2686 |
| 595 | Ga0307511_10000002 | 3300030521 | Bacteria | 199923 |
| 596 | Ga0265327_10000024 | 3300031251 | Bacteria | 382499 |
| 597 | Ga0265327_10000611 | 3300031251 | Bacteria | 59062 |
| 598 | Ga0265327_10023609 | 3300031251 | Bacteria | 3639 |
| 599 | Ga0307513_10104373 | 3300031456 | Unclassified | 2848 |
| 600 | Ga0307513_10178269 | 3300031456 | Bacteria | 1992 |
| 601 | Ga0307513_10279393 | 3300031456 | Unclassified | 1448 |
| 602 | Ga0307408_100035930 | 3300031548 | Bacteria | 3480 |
| 603 | Ga0307408_100047911 | 3300031548 | Bacteria | 3063 |
| 604 | Ga0307516_10000159 | 3300031730 | Bacteria | 84553 |
| 605 | Ga0307405_10000010 | 3300031731 | Bacteria | 250978 |
| 606 | Ga0307405_10011620 | 3300031731 | Bacteria | 4626 |
| 607 | Ga0307413_10084608 | 3300031824 | Bacteria | 2045 |
| 608 | Ga0307413_10415306 | 3300031824 | Bacteria | 1058 |
| 609 | Ga0307410_10038701 | 3300031852 | Bacteria | 3126 |
| 610 | Ga0307410_10047385 | 3300031852 | Bacteria | 2872 |
| 611 | Ga0307406_10042856 | 3300031901 | Bacteria | 2828 |
| 612 | Ga0307407_10000042 | 3300031903 | Bacteria | 65025 |
| 613 | Ga0307407_10016140 | 3300031903 | Bacteria | 3711 |
| 614 | Ga0307412_10007998 | 3300031911 | Bacteria | 6029 |
| 615 | Ga0307412_10047391 | 3300031911 | Bacteria | 2823 |
| 616 | Ga0307416_100000019 | 3300032002 | Bacteria | 199706 |
| 617 | Ga0307416_100000227 | 3300032002 | Bacteria | 29912 |
| 618 | Ga0307414_10000306 | 3300032004 | Bacteria | 28470 |
| 619 | Ga0307414_10002825 | 3300032004 | Bacteria | 9156 |
| 620 | Ga0307414_10032781 | 3300032004 | Bacteria | 3425 |
| 621 | Ga0307414_10082052 | 3300032004 | Bacteria | 2363 |
| 622 | Ga0307414_10122685 | 3300032004 | Bacteria | 2001 |
| 623 | Ga0307411_10012364 | 3300032005 | Bacteria | 4656 |
| 624 | Ga0307411_10373447 | 3300032005 | Bacteria | 1170 |
| 625 | Ga0307415_100001349 | 3300032126 | Bacteria | 11675 |
| 626 | Ga0373923_0089517 | 3300035111 | Bacteria | 1344 |
| 627 | Ga0373957_0061332 | 3300035120 | Bacteria | 1457 |
| 628 | Ga0373943_0010590 | 3300035170 | Bacteria | 4136 |
| 629 | Ga0373955_0025009 | 3300035172 | Bacteria | 3061 |
| 630 | Ga0373924_0107162 | 3300035410 | Bacteria | 1205 |
| 631 | Ga0373935_0056690 | 3300035692 | Unclassified | 2499 |
| 632 | Ga0373933_0036103 | 3300035724 | Bacteria | 2891 |
| 633 | Ga0373947_0166463 | 3300035725 | Bacteria | 1428 |
| 634 | Ga0373937_0023277 | 3300036401 | Bacteria | 5576 |
| 635 | Ga0395899_0176928 | 3300037312 | Bacteria | 1500 |
| 636 | Ga0395900_0156079 | 3300037418 | Bacteria | 2331 |
| 637 | Ga0395900_0287650 | 3300037418 | Bacteria | 1633 |
| 638 | Ga0395898_0010318 | 3300037466 | Bacteria | 9772 |
| 639 | Ga0395898_0059676 | 3300037466 | Bacteria | 3710 |
| 640 | Ga0395898_0126493 | 3300037466 | Bacteria | 2448 |
| 641 | Ga0395905_0021187 | 3300037471 | Bacteria | 6152 |
| 642 | Ga0395905_0163871 | 3300037471 | Bacteria | 2089 |
| 643 | Ga0395901_0063597 | 3300038443 | Bacteria | 3840 |
| 644 | Ga0395901_0192630 | 3300038443 | Bacteria | 2138 |
| 645 | Ga0395901_0595718 | 3300038443 | Bacteria | 1115 |
| 646 | Ga0395901_0605526 | 3300038443 | Bacteria | 1104 |
| 647 | Ga0436365_1249677 | 3300039437 | Bacteria | 17339 |
| 648 | Ga0439436_0002706 | 3300041404 | Bacteria | 5349 |
| 649 | Ga0439461_0012376 | 3300041410 | Bacteria | 1596 |
| 650 | Ga0451793_1329962 | 3300041452 | Bacteria | 1090 |
| 651 | Ga0451804_1149675 | 3300041463 | Bacteria | 1178 |
| 652 | Ga0451843_0703108 | 3300041509 | Unclassified | 988 |
| 653 | Ga0439449_0002729 | 3300042007 | Bacteria | 6868 |
| 654 | Ga0439449_0024418 | 3300042007 | Bacteria | 2260 |
| 655 | Ga0439457_002111 | 3300042014 | Bacteria | 5781 |
| 656 | Ga0439462_0004635 | 3300042015 | Bacteria | 3362 |
| 657 | Ga0439462_0008387 | 3300042015 | Bacteria | 2604 |
| 658 | Ga0450923_000505 | 3300042125 | Bacteria | 4323 |
| 659 | Ga0451577_0006113 | 3300042876 | Bacteria | 12094 |
| 660 | Ga0451577_0123920 | 3300042876 | Bacteria | 2316 |
| 661 | Ga0451577_0345943 | 3300042876 | Unclassified | 1349 |
| 662 | Ga0466969_0000127 | 3300044656 | Bacteria | 41196 |
| 663 | Ga0466969_0061212 | 3300044656 | Unclassified | 1829 |
| 664 | Ga0466972_0000080 | 3300044658 | Bacteria | 89226 |
| 665 | Ga0453683_0259989 | 3300044673 | Bacteria | 1107 |
| 666 | Ga0466965_0102220 | 3300044683 | Bacteria | 1466 |
| 667 | Ga0466966_0000120 | 3300044684 | Bacteria | 49271 |
| 668 | Ga0466961_0064528 | 3300044693 | Bacteria | 2327 |
| 669 | Ga0466964_0041728 | 3300044706 | Bacteria | 1857 |
| 670 | Ga0453684_0108162 | 3300044712 | Bacteria | 3384 |
| 671 | Ga0453684_0147752 | 3300044712 | Bacteria | 2797 |
| 672 | Ga0466970_0136481 | 3300044765 | Bacteria | 1349 |
| 673 | Ga0466957_0000380 | 3300044842 | Bacteria | 21740 |
| 674 | Ga0466957_0010728 | 3300044842 | Bacteria | 5269 |
| 675 | Ga0466957_0022142 | 3300044842 | Bacteria | 3747 |
| 676 | Ga0466957_0105888 | 3300044842 | Bacteria | 1778 |
| 677 | Ga0466959_0000014 | 3300045049 | Bacteria | 150962 |
| 678 | Ga0466959_0024738 | 3300045049 | Bacteria | 4448 |
| 679 | Ga0451576_0544710 | 3300045051 | Bacteria | 1219 |
| 680 | Ga0495627_044497 | 3300046453 | Bacteria | 1355 |
| 681 | Ga0495592_0129451 | 3300046454 | Bacteria | 1767 |
| 682 | Ga0495638_0000040 | 3300046460 | Bacteria | 241883 |
| 683 | Ga0495638_0220178 | 3300046460 | Unclassified | 1061 |
| 684 | Ga0495653_0064121 | 3300046463 | Bacteria | 2769 |
| 685 | Ga0495650_0031064 | 3300046471 | Bacteria | 2409 |
| 686 | Ga0495580_0341116 | 3300046472 | Bacteria | 1016 |
| 687 | Ga0495664_0202465 | 3300046477 | Bacteria | 1203 |
| 688 | Ga0495606_0005804 | 3300046507 | Bacteria | 11654 |
| 689 | Ga0495610_0000035 | 3300046512 | Bacteria | 189683 |
| 690 | Ga0495610_0015914 | 3300046512 | Bacteria | 4350 |
| 691 | Ga0495628_0027888 | 3300046516 | Bacteria | 4591 |
| 692 | Ga0495630_0063686 | 3300046517 | Bacteria | 2770 |
| 693 | Ga0495587_0066048 | 3300046536 | Bacteria | 2111 |
| 694 | Ga0495621_0036727 | 3300046539 | Bacteria | 1702 |
| 695 | Ga0495633_0000125 | 3300046558 | Bacteria | 104459 |
| 696 | Ga0495633_0133656 | 3300046558 | Bacteria | 1148 |
| 697 | Ga0495668_0002554 | 3300046616 | Bacteria | 14799 |
| 698 | Ga0495634_0009802 | 3300046642 | Bacteria | 7051 |
| 699 | Ga0495611_0000354 | 3300046648 | Bacteria | 29975 |
| 700 | Ga0495611_0102676 | 3300046648 | Bacteria | 1329 |
| 701 | Ga0495635_0104075 | 3300046663 | Bacteria | 1940 |
| 702 | Ga0495658_0046740 | 3300046683 | Bacteria | 2435 |
| 703 | Ga0495636_0000060 | 3300047318 | Bacteria | 47278 |
| 704 | Ga0495672_0010446 | 3300047320 | Bacteria | 6613 |
| 705 | Ga0495672_0021009 | 3300047320 | Unclassified | 4265 |
| 706 | Ga0495672_0028859 | 3300047320 | Bacteria | 3503 |
| 707 | Ga0495680_0273032 | 3300047322 | Bacteria | 1193 |
| 708 | Ga0495687_000261 | 3300047443 | Bacteria | 71090 |
| 709 | Ga0495686_0000005 | 3300047472 | Bacteria | 827143 |
| 710 | Ga0495686_0007643 | 3300047472 | Bacteria | 8070 |
| 711 | Ga0495686_0056486 | 3300047472 | Bacteria | 2452 |
| 712 | Ga0496106_0348409 | 3300048909 | Unclassified | 1190 |
| 713 | Ga0496110_0055506 | 3300048913 | Bacteria | 3486 |
| 714 | Ga0496111_0098458 | 3300048914 | Bacteria | 2147 |
| 715 | Ga0496114_0094838 | 3300048917 | Bacteria | 2539 |
| 716 | Ga0496121_0000081 | 3300048924 | Bacteria | 229506 |
| 717 | Ga0496126_0042525 | 3300048929 | Bacteria | 4196 |
| 718 | Ga0501031_0143800 | 3300049568 | Bacteria | 1558 |
| 719 | Ga0501032_0004132 | 3300049569 | Bacteria | 11001 |
| 720 | Ga0501032_0086164 | 3300049569 | Bacteria | 2088 |
| 721 | Ga0501032_0148383 | 3300049569 | Bacteria | 1543 |
| 722 | Ga0501033_0017643 | 3300049570 | Bacteria | 5391 |
| 723 | Ga0501033_0113556 | 3300049570 | Bacteria | 1970 |
| 724 | Ga0501034_0007421 | 3300049571 | Bacteria | 11669 |
| 725 | Ga0501034_0213240 | 3300049571 | Bacteria | 1885 |
| 726 | Ga0501034_0241907 | 3300049571 | Bacteria | 1750 |
| 727 | Ga0501036_0034595 | 3300049572 | Bacteria | 4274 |
| 728 | Ga0501036_0124345 | 3300049572 | Bacteria | 2178 |
| 729 | Ga0501037_0031925 | 3300049573 | Bacteria | 3888 |
| 730 | Ga0501037_0033161 | 3300049573 | Bacteria | 3814 |
| 731 | Ga0501038_0017313 | 3300049574 | Bacteria | 6515 |
| 732 | Ga0501038_0030627 | 3300049574 | Bacteria | 4758 |
| 733 | Ga0501038_0104439 | 3300049574 | Bacteria | 2355 |
| 734 | Ga0501038_0161412 | 3300049574 | Bacteria | 1821 |
| 735 | Ga0501043_0003893 | 3300049579 | Bacteria | 12252 |
| 736 | Ga0501043_0030664 | 3300049579 | Bacteria | 4227 |
| 737 | Ga0501043_0068367 | 3300049579 | Unclassified | 2789 |
| 738 | Ga0501046_0089336 | 3300049580 | Bacteria | 2372 |
| 739 | Ga0501046_0220574 | 3300049580 | Bacteria | 1404 |
| 740 | Ga0501047_0013596 | 3300049581 | Bacteria | 7720 |
| 741 | Ga0501047_0082793 | 3300049581 | Bacteria | 3084 |
| 742 | Ga0501047_0169887 | 3300049581 | Bacteria | 2050 |
| 743 | Ga0501047_0348637 | 3300049581 | Bacteria | 1317 |
| 744 | Ga0501048_0006258 | 3300049582 | Bacteria | 9053 |
| 745 | Ga0501067_0036099 | 3300049583 | Bacteria | 2745 |
| 746 | Ga0501070_0078985 | 3300049586 | Bacteria | 2723 |
| 747 | Ga0501070_0082958 | 3300049586 | Bacteria | 2653 |
| 748 | Ga0501073_0006651 | 3300049589 | Bacteria | 8610 |
| 749 | Ga0501074_0002599 | 3300049590 | Bacteria | 12616 |
| 750 | Ga0501202_004033 | 3300049652 | Bacteria | 2552 |
| 751 | Ga0501207_003749 | 3300049654 | Bacteria | 2038 |
| 752 | Ga0501216_011083 | 3300049660 | Bacteria | 1460 |
| 753 | Ga0501217_000586 | 3300049661 | Bacteria | 6138 |
| 754 | Ga0501217_004764 | 3300049661 | Bacteria | 2803 |
| 755 | Ga0501222_001557 | 3300049662 | Bacteria | 3197 |
| 756 | Ga0501240_000977 | 3300049673 | Bacteria | 2632 |
| 757 | Ga0501243_007387 | 3300049675 | Bacteria | 1679 |
| 758 | Ga0501257_026722 | 3300049686 | Bacteria | 1379 |
| 759 | Ga0501219_000133 | 3300049703 | Bacteria | 13105 |
| 760 | Ga0501221_002892 | 3300049704 | Bacteria | 2829 |
| 761 | Ga0501225_0000505 | 3300049705 | Bacteria | 12150 |
| 762 | Ga0501225_0012912 | 3300049705 | Bacteria | 2342 |
| 763 | Ga0501225_0030894 | 3300049705 | Bacteria | 1474 |
| 764 | Ga0501079_0049322 | 3300049741 | Bacteria | 3249 |
| 765 | Ga0501080_0030856 | 3300049742 | Bacteria | 4994 |
| 766 | Ga0501083_0015427 | 3300049744 | Bacteria | 5350 |
| 767 | Ga0501083_0205002 | 3300049744 | Unclassified | 1286 |
| 768 | Ga0501241_003764 | 3300049758 | Bacteria | 2858 |
| 769 | Ga0501264_000116 | 3300049761 | Bacteria | 12192 |
| 770 | Ga0501035_0002433 | 3300049822 | Bacteria | 18202 |
| 771 | Ga0501035_0007289 | 3300049822 | Bacteria | 10349 |
| 772 | Ga0501035_0261765 | 3300049822 | Bacteria | 1466 |
| 773 | Ga0501044_0013650 | 3300049823 | Bacteria | 8779 |
| 774 | Ga0501044_0016689 | 3300049823 | Bacteria | 7884 |
| 775 | Ga0501044_0021227 | 3300049823 | Bacteria | 6932 |
| 776 | Ga0501044_0158829 | 3300049823 | Bacteria | 2239 |
| 777 | Ga0501044_0447847 | 3300049823 | Bacteria | 1198 |
| 778 | Ga0501044_0538019 | 3300049823 | Bacteria | 1066 |
| 779 | Ga0501045_0135871 | 3300049824 | Bacteria | 1828 |
| 780 | Ga0501284_00007 | 3300050005 | Bacteria | 147956 |
| 781 | nmdc:mga0k408_54752_c1 | 3300050493 | Bacteria | 2312 |
| 782 | nmdc:mga05p37_827_c1 | 3300050507 | Bacteria | 34726 |
| 783 | nmdc:mga09592_5573_c1 | 3300050508 | Bacteria | 10252 |
| 784 | nmdc:mga0qj67_115904_c1 | 3300050509 | Bacteria | 2165 |
| 785 | nmdc:mga0qj67_154999_c1 | 3300050509 | Bacteria | 1859 |
| 786 | nmdc:mga06r32_338867_c1 | 3300050510 | Bacteria | 1488 |
| 787 | nmdc:mga08y16_110978_c1 | 3300050511 | Bacteria | 2855 |
| 788 | nmdc:mga08y16_143375_c1 | 3300050511 | Bacteria | 2483 |
| 789 | nmdc:mga08y16_198399_c1 | 3300050511 | Bacteria | 2080 |
| 790 | nmdc:mga08y16_33793_c1 | 3300050511 | Bacteria | 5371 |
| 791 | nmdc:mga08y16_57703_c1 | 3300050511 | Bacteria | 4056 |
| 792 | Ga0495619_0207720 | 3300053085 | Bacteria | 1356 |
| 793 | Ga0500578_0000836 | 3300053086 | Bacteria | 35575 |
| 794 | Ga0500644_0000026 | 3300053088 | Bacteria | 93328 |
| 795 | Ga0500644_0002655 | 3300053088 | Bacteria | 4465 |
| 796 | Ga0500646_0013350 | 3300053090 | Bacteria | 2125 |
| 797 | Ga0500583_0000001 | 3300053092 | Bacteria | 241642 |
| 798 | Ga0500583_0002299 | 3300053092 | Bacteria | 5712 |
| 799 | Ga0500651_0079068 | 3300053093 | Bacteria | 2039 |
| 800 | Ga0500641_0004524 | 3300053096 | Bacteria | 4915 |
| 801 | Ga0500556_0003125 | 3300053104 | Bacteria | 4944 |
| 802 | Ga0500569_000047 | 3300053109 | Bacteria | 22066 |
| 803 | Ga0500607_046686 | 3300053121 | Bacteria | 2321 |
| 804 | Ga0500642_0001746 | 3300053130 | Bacteria | 6263 |
| 805 | Ga0500658_0003491 | 3300053134 | Bacteria | 5931 |
| 806 | Ga0500559_0002568 | 3300053136 | Bacteria | 9306 |
| 807 | Ga0500568_0000142 | 3300053139 | Bacteria | 64049 |
| 808 | Ga0500568_0003595 | 3300053139 | Bacteria | 8563 |
| 809 | Ga0500573_0093276 | 3300053140 | Bacteria | 1699 |
| 810 | Ga0500577_0006329 | 3300053142 | Bacteria | 3257 |
| 811 | Ga0500588_0008757 | 3300053146 | Bacteria | 2378 |
| 812 | Ga0500616_0002235 | 3300053153 | Bacteria | 16549 |
| 813 | Ga0500616_0008249 | 3300053153 | Bacteria | 6493 |
| 814 | Ga0500616_0015110 | 3300053153 | Bacteria | 4423 |
| 815 | Ga0500622_0000692 | 3300053156 | Bacteria | 29667 |
| 816 | Ga0500622_0005506 | 3300053156 | Bacteria | 7585 |
| 817 | Ga0500633_0000782 | 3300053160 | Bacteria | 5422 |
| 818 | Ga0500636_0005348 | 3300053177 | Bacteria | 7320 |
| 819 | Ga0500637_0027758 | 3300053178 | Bacteria | 3127 |
| 820 | Ga0500584_105703 | 3300053726 | Bacteria | 1149 |
| 821 | Ga0500611_000003 | 3300053727 | Bacteria | 333431 |
| 822 | Ga0500645_056904 | 3300053730 | Bacteria | 1134 |
| 823 | Ga0501084_0041717 | 3300054114 | Bacteria | 3839 |
| 824 | Ga0500661_005321 | 3300055283 | Bacteria | 2407 |
| 825 | Ga0466962_0063789 | 3300061719 | Unclassified | 1759 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005354 | Ga0070675_100117262 | Ga0070675_1001172621 | 287 |
| 2 | 3300005618 | Ga0068864_100088090 | Ga0068864_1000880903 | 287 |
| 3 | 3300005289 | Ga0065704_10101212 | Ga0065704_101012121 | 289 |
| 4 | 3300005441 | Ga0070700_100035240 | Ga0070700_1000352402 | 289 |
| 5 | 3300026075 | Ga0207708_10020703 | Ga0207708_100207034 | 289 |
| 6 | 3300013100 | Ga0157373_10002753 | Ga0157373_1000275310 | 292 |
| 7 | 3300013102 | Ga0157371_10002698 | Ga0157371_1000269812 | 292 |
| 8 | 3300013307 | Ga0157372_10026460 | Ga0157372_100264605 | 292 |
| 9 | 3300037466 | Ga0395898_0126493 | Ga0395898_0126493_1158_2120 | 292 |
| 10 | 3300037471 | Ga0395905_0021187 | Ga0395905_0021187_2879_3841 | 292 |
| 11 | 3300037471 | Ga0395905_0163871 | Ga0395905_0163871_914_1876 | 292 |
| 12 | 3300038443 | Ga0395901_0063597 | Ga0395901_0063597_1361_2323 | 292 |
| 13 | 3300005458 | Ga0070681_10012536 | Ga0070681_100125362 | 293 |
| 14 | 3300005563 | Ga0068855_100062546 | Ga0068855_1000625462 | 293 |
| 15 | 3300013105 | Ga0157369_10075403 | Ga0157369_100754033 | 293 |
| 16 | 3300025912 | Ga0207707_10096103 | Ga0207707_100961033 | 293 |
| 17 | 3300025921 | Ga0207652_10000771 | Ga0207652_1000077123 | 293 |
| 18 | 3300026067 | Ga0207678_10033889 | Ga0207678_100338893 | 293 |
| 19 | 3300037418 | Ga0395900_0287650 | Ga0395900_0287650_407_1369 | 293 |
| 20 | 3300037466 | Ga0395898_0010318 | Ga0395898_0010318_4323_5285 | 293 |
| 21 | 3300038443 | Ga0395901_0605526 | Ga0395901_0605526_112_1074 | 293 |
| 22 | 3300006237 | Ga0097621_100215805 | Ga0097621_1002158051 | 294 |
| 23 | 3300009176 | Ga0105242_10084012 | Ga0105242_100840122 | 294 |
| 24 | 3300011119 | Ga0105246_10039983 | Ga0105246_100399832 | 294 |
| 25 | 3300013297 | Ga0157378_10150092 | Ga0157378_101500922 | 294 |
| 26 | 3300053726 | Ga0500584_105703 | Ga0500584_105703_250_1137 | 294 |
| 27 | 3300005841 | Ga0068863_100481938 | Ga0068863_1004819382 | 295 |
| 28 | 3300041509 | Ga0451843_0703108 | Ga0451843_0703108_37_942 | 295 |
| 29 | 3300053730 | Ga0500645_056904 | Ga0500645_056904_140_1036 | 295 |
| 30 | 3300005329 | Ga0070683_100069592 | Ga0070683_1000695922 | 296 |
| 31 | 3300005335 | Ga0070666_10010282 | Ga0070666_100102823 | 296 |
| 32 | 3300005340 | Ga0070689_100013812 | Ga0070689_1000138127 | 296 |
| 33 | 3300005355 | Ga0070671_100053038 | Ga0070671_1000530381 | 296 |
| 34 | 3300005535 | Ga0070684_100080123 | Ga0070684_1000801231 | 296 |
| 35 | 3300025893 | Ga0207682_10107132 | Ga0207682_101071321 | 297 |
| 36 | 3300005338 | Ga0068868_100155187 | Ga0068868_1001551872 | 298 |
| 37 | 3300005455 | Ga0070663_100428230 | Ga0070663_1004282301 | 298 |
| 38 | 3300005466 | Ga0070685_10004060 | Ga0070685_100040602 | 298 |
| 39 | 3300025914 | Ga0207671_10011235 | Ga0207671_100112353 | 298 |
| 40 | 3300026089 | Ga0207648_10350676 | Ga0207648_103506762 | 299 |
| 41 | 3300038443 | Ga0395901_0192630 | Ga0395901_0192630_1122_2084 | 299 |
| 42 | 3300003781 | Ga0055536_1000011 | Ga0055536_1000011169 | 300 |
| 43 | 3300005548 | Ga0070665_100000014 | Ga0070665_10000001428 | 300 |
| 44 | 3300025292 | Ga0209676_1000001 | Ga0209676_1000001784 | 300 |
| 45 | 3300025298 | Ga0209050_1000016 | Ga0209050_1000016449 | 300 |
| 46 | 3300025927 | Ga0207687_10123453 | Ga0207687_101234532 | 301 |
| 47 | 3300031548 | Ga0307408_100035930 | Ga0307408_1000359302 | 301 |
| 48 | 3300031901 | Ga0307406_10042856 | Ga0307406_100428562 | 301 |
| 49 | 3300031911 | Ga0307412_10047391 | Ga0307412_100473912 | 301 |
| 50 | 3300032005 | Ga0307411_10012364 | Ga0307411_100123642 | 301 |
| 51 | 3300053178 | Ga0500637_0027758 | Ga0500637_0027758_167_1135 | 302 |
| 52 | 3300005293 | Ga0065715_10113921 | Ga0065715_101139213 | 303 |
| 53 | 3300009094 | Ga0111539_10077796 | Ga0111539_100777962 | 304 |
| 54 | 3300027907 | Ga0207428_10047103 | Ga0207428_100471034 | 304 |
| 55 | 3300049569 | Ga0501032_0148383 | Ga0501032_0148383_536_1465 | 304 |
| 56 | 3300050511 | nmdc:mga08y16_198399_c1 | nmdc:mga08y16_198399_c1_411_1400 | 304 |
| 57 | iso_pu_bacteria | 2884634485 | 2884637094 | 304 |
| 58 | 3300005338 | Ga0068868_100237886 | Ga0068868_1002378861 | 305 |
| 59 | 3300005341 | Ga0070691_10087870 | Ga0070691_100878701 | 305 |
| 60 | 3300005367 | Ga0070667_100018912 | Ga0070667_1000189126 | 305 |
| 61 | 3300005367 | Ga0070667_100050896 | Ga0070667_1000508963 | 305 |
| 62 | 3300005578 | Ga0068854_100046669 | Ga0068854_1000466693 | 305 |
| 63 | 3300005616 | Ga0068852_100035186 | Ga0068852_1000351862 | 305 |
| 64 | 3300009553 | Ga0105249_10175047 | Ga0105249_101750471 | 305 |
| 65 | 3300013296 | Ga0157374_10028707 | Ga0157374_100287072 | 305 |
| 66 | 3300013306 | Ga0163162_10010645 | Ga0163162_100106452 | 305 |
| 67 | 3300025931 | Ga0207644_10157076 | Ga0207644_101570762 | 305 |
| 68 | 3300025932 | Ga0207690_10276472 | Ga0207690_102764722 | 305 |
| 69 | 3300025933 | Ga0207706_10052797 | Ga0207706_100527972 | 305 |
| 70 | 3300025936 | Ga0207670_10042328 | Ga0207670_100423283 | 305 |
| 71 | 3300025944 | Ga0207661_10045221 | Ga0207661_100452212 | 305 |
| 72 | 3300025949 | Ga0207667_10602907 | Ga0207667_106029071 | 305 |
| 73 | 3300026142 | Ga0207698_10037614 | Ga0207698_100376141 | 305 |
| 74 | 3300026142 | Ga0207698_10087442 | Ga0207698_100874423 | 305 |
| 75 | 3300031824 | Ga0307413_10415306 | Ga0307413_104153061 | 305 |
| 76 | 3300049686 | Ga0501257_026722 | Ga0501257_026722_67_984 | 305 |
| 77 | 3300005329 | Ga0070683_100047014 | Ga0070683_1000470145 | 306 |
| 78 | 3300005330 | Ga0070690_100006021 | Ga0070690_1000060212 | 306 |
| 79 | 3300005334 | Ga0068869_100004838 | Ga0068869_10000483810 | 306 |
| 80 | 3300005334 | Ga0068869_100007443 | Ga0068869_1000074435 | 306 |
| 81 | 3300005338 | Ga0068868_100001123 | Ga0068868_1000011232 | 306 |
| 82 | 3300005340 | Ga0070689_100014980 | Ga0070689_1000149805 | 306 |
| 83 | 3300005344 | Ga0070661_100011988 | Ga0070661_1000119883 | 306 |
| 84 | 3300005354 | Ga0070675_100055992 | Ga0070675_1000559922 | 306 |
| 85 | 3300005355 | Ga0070671_100268721 | Ga0070671_1002687212 | 306 |
| 86 | 3300005364 | Ga0070673_100040106 | Ga0070673_1000401062 | 306 |
| 87 | 3300005364 | Ga0070673_100042302 | Ga0070673_1000423022 | 306 |
| 88 | 3300005364 | Ga0070673_100293831 | Ga0070673_1002938312 | 306 |
| 89 | 3300005366 | Ga0070659_100009567 | Ga0070659_1000095677 | 306 |
| 90 | 3300005535 | Ga0070684_100094748 | Ga0070684_1000947482 | 306 |
| 91 | 3300005539 | Ga0068853_100417602 | Ga0068853_1004176021 | 306 |
| 92 | 3300005544 | Ga0070686_100042729 | Ga0070686_1000427292 | 306 |
| 93 | 3300005564 | Ga0070664_100005422 | Ga0070664_10000542213 | 306 |
| 94 | 3300005564 | Ga0070664_100391241 | Ga0070664_1003912411 | 306 |
| 95 | 3300005577 | Ga0068857_100008029 | Ga0068857_1000080292 | 306 |
| 96 | 3300005618 | Ga0068864_100004779 | Ga0068864_1000047798 | 306 |
| 97 | 3300005719 | Ga0068861_100020793 | Ga0068861_1000207934 | 306 |
| 98 | 3300005719 | Ga0068861_100164123 | Ga0068861_1001641232 | 306 |
| 99 | 3300006358 | Ga0068871_100326025 | Ga0068871_1003260252 | 306 |
| 100 | 3300009553 | Ga0105249_10144835 | Ga0105249_101448352 | 306 |
| 101 | 3300010375 | Ga0105239_10205164 | Ga0105239_102051642 | 306 |
| 102 | 3300013296 | Ga0157374_10000587 | Ga0157374_100005873 | 306 |
| 103 | 3300013296 | Ga0157374_10000745 | Ga0157374_100007459 | 306 |
| 104 | 3300013297 | Ga0157378_10035720 | Ga0157378_100357202 | 306 |
| 105 | 3300013306 | Ga0163162_10002271 | Ga0163162_100022712 | 306 |
| 106 | 3300013306 | Ga0163162_10068630 | Ga0163162_100686303 | 306 |
| 107 | 3300013307 | Ga0157372_10197822 | Ga0157372_101978222 | 306 |
| 108 | 3300013308 | Ga0157375_10000067 | Ga0157375_1000006743 | 306 |
| 109 | 3300013308 | Ga0157375_10011638 | Ga0157375_100116382 | 306 |
| 110 | 3300014325 | Ga0163163_10172155 | Ga0163163_101721553 | 306 |
| 111 | 3300014968 | Ga0157379_10008380 | Ga0157379_100083804 | 306 |
| 112 | 3300014968 | Ga0157379_10059561 | Ga0157379_100595612 | 306 |
| 113 | 3300025903 | Ga0207680_10190488 | Ga0207680_101904882 | 306 |
| 114 | 3300025904 | Ga0207647_10000210 | Ga0207647_1000021045 | 306 |
| 115 | 3300025907 | Ga0207645_10012266 | Ga0207645_100122664 | 306 |
| 116 | 3300025907 | Ga0207645_10077695 | Ga0207645_100776952 | 306 |
| 117 | 3300025920 | Ga0207649_10007810 | Ga0207649_100078107 | 306 |
| 118 | 3300025926 | Ga0207659_10049585 | Ga0207659_100495852 | 306 |
| 119 | 3300025931 | Ga0207644_10384966 | Ga0207644_103849662 | 306 |
| 120 | 3300025932 | Ga0207690_10087329 | Ga0207690_100873292 | 306 |
| 121 | 3300025933 | Ga0207706_10003474 | Ga0207706_1000347413 | 306 |
| 122 | 3300025933 | Ga0207706_10010648 | Ga0207706_100106482 | 306 |
| 123 | 3300025933 | Ga0207706_10012403 | Ga0207706_100124037 | 306 |
| 124 | 3300025940 | Ga0207691_10063280 | Ga0207691_100632802 | 306 |
| 125 | 3300025942 | Ga0207689_10000843 | Ga0207689_1000084315 | 306 |
| 126 | 3300025942 | Ga0207689_10031074 | Ga0207689_100310744 | 306 |
| 127 | 3300025944 | Ga0207661_10007500 | Ga0207661_100075005 | 306 |
| 128 | 3300025945 | Ga0207679_10000800 | Ga0207679_1000080016 | 306 |
| 129 | 3300025945 | Ga0207679_10069473 | Ga0207679_100694733 | 306 |
| 130 | 3300025960 | Ga0207651_10017040 | Ga0207651_100170402 | 306 |
| 131 | 3300025960 | Ga0207651_10027456 | Ga0207651_100274562 | 306 |
| 132 | 3300025981 | Ga0207640_10201479 | Ga0207640_102014791 | 306 |
| 133 | 3300026023 | Ga0207677_10000816 | Ga0207677_1000081613 | 306 |
| 134 | 3300026023 | Ga0207677_10039609 | Ga0207677_100396092 | 306 |
| 135 | 3300026023 | Ga0207677_10103563 | Ga0207677_101035632 | 306 |
| 136 | 3300026089 | Ga0207648_10026353 | Ga0207648_100263532 | 306 |
| 137 | 3300026095 | Ga0207676_10009634 | Ga0207676_100096342 | 306 |
| 138 | 3300026116 | Ga0207674_10025239 | Ga0207674_100252396 | 306 |
| 139 | 3300026116 | Ga0207674_10325876 | Ga0207674_103258762 | 306 |
| 140 | 3300026118 | Ga0207675_100055186 | Ga0207675_1000551862 | 306 |
| 141 | 3300035111 | Ga0373923_0089517 | Ga0373923_0089517_166_1086 | 306 |
| 142 | 3300035120 | Ga0373957_0061332 | Ga0373957_0061332_40_960 | 306 |
| 143 | 3300035170 | Ga0373943_0010590 | Ga0373943_0010590_1407_2327 | 306 |
| 144 | 3300035172 | Ga0373955_0025009 | Ga0373955_0025009_43_963 | 306 |
| 145 | 3300035410 | Ga0373924_0107162 | Ga0373924_0107162_38_958 | 306 |
| 146 | 3300035692 | Ga0373935_0056690 | Ga0373935_0056690_460_1380 | 306 |
| 147 | 3300035724 | Ga0373933_0036103 | Ga0373933_0036103_1610_2530 | 306 |
| 148 | 3300035725 | Ga0373947_0166463 | Ga0373947_0166463_35_955 | 306 |
| 149 | 3300036401 | Ga0373937_0023277 | Ga0373937_0023277_157_1077 | 306 |
| 150 | 3300038443 | Ga0395901_0595718 | Ga0395901_0595718_148_1068 | 306 |
| 151 | 3300046454 | Ga0495592_0129451 | Ga0495592_0129451_677_1597 | 306 |
| 152 | 3300046463 | Ga0495653_0064121 | Ga0495653_0064121_1247_2167 | 306 |
| 153 | 3300046477 | Ga0495664_0202465 | Ga0495664_0202465_108_1028 | 306 |
| 154 | 3300046516 | Ga0495628_0027888 | Ga0495628_0027888_819_1739 | 306 |
| 155 | 3300046517 | Ga0495630_0063686 | Ga0495630_0063686_94_1014 | 306 |
| 156 | 3300046536 | Ga0495587_0066048 | Ga0495587_0066048_464_1384 | 306 |
| 157 | 3300046642 | Ga0495634_0009802 | Ga0495634_0009802_5663_6583 | 306 |
| 158 | 3300046663 | Ga0495635_0104075 | Ga0495635_0104075_392_1312 | 306 |
| 159 | 3300046683 | Ga0495658_0046740 | Ga0495658_0046740_182_1102 | 306 |
| 160 | 3300047322 | Ga0495680_0273032 | Ga0495680_0273032_164_1084 | 306 |
| 161 | 3300048914 | Ga0496111_0098458 | Ga0496111_0098458_275_1195 | 306 |
| 162 | 3300048917 | Ga0496114_0094838 | Ga0496114_0094838_243_1163 | 306 |
| 163 | 3300049652 | Ga0501202_004033 | Ga0501202_004033_1159_2079 | 306 |
| 164 | 3300053085 | Ga0495619_0207720 | Ga0495619_0207720_182_1102 | 306 |
| 165 | 3300003320 | rootH2_10166600 | rootH2_101666002 | 307 |
| 166 | 3300005842 | Ga0068858_100527839 | Ga0068858_1005278391 | 307 |
| 167 | 3300014325 | Ga0163163_10040694 | Ga0163163_100406944 | 307 |
| 168 | 3300014968 | Ga0157379_10028680 | Ga0157379_100286802 | 307 |
| 169 | 3300026035 | Ga0207703_10027443 | Ga0207703_100274433 | 307 |
| 170 | 3300032004 | Ga0307414_10000306 | Ga0307414_1000030612 | 307 |
| 171 | 3300048913 | Ga0496110_0055506 | Ga0496110_0055506_1157_2119 | 307 |
| 172 | 3300031456 | Ga0307513_10178269 | Ga0307513_101782692 | 309 |
| 173 | 3300005616 | Ga0068852_100366226 | Ga0068852_1003662261 | 311 |
| 174 | 3300003215 | JGI25153J46596_10023575 | JGI25153J46596_100235753 | 314 |
| 175 | 3300003316 | rootH1_10013495 | rootH1_100134952 | 314 |
| 176 | 3300003320 | rootH2_10039673 | rootH2_100396732 | 314 |
| 177 | 3300003320 | rootH2_10075767 | rootH2_100757671 | 314 |
| 178 | 3300003320 | rootH2_10135544 | rootH2_101355444 | 314 |
| 179 | 3300003320 | rootH2_10213033 | rootH2_102130332 | 314 |
| 180 | 3300003322 | rootL2_10023331 | rootL2_100233311 | 314 |
| 181 | 3300003322 | rootL2_10082800 | rootL2_100828002 | 314 |
| 182 | 3300003323 | rootH1_10044529 | rootH1_100445294 | 314 |
| 183 | 3300003354 | JGI25160J50197_1001239 | JGI25160J50197_10012397 | 314 |
| 184 | 3300003761 | Ga0055535_1003210 | Ga0055535_10032103 | 314 |
| 185 | 3300003762 | Ga0055542_1004148 | Ga0055542_10041482 | 314 |
| 186 | 3300003790 | Ga0055528_1001011 | Ga0055528_10010113 | 314 |
| 187 | 3300003791 | Ga0055530_10000880 | Ga0055530_1000088017 | 314 |
| 188 | 3300003794 | Ga0055531_10000054 | Ga0055531_1000005479 | 314 |
| 189 | 3300004625 | Ga0055543_1014584 | Ga0055543_10145841 | 314 |
| 190 | 3300005262 | Ga0065165_1000027 | Ga0065165_1000027125 | 314 |
| 191 | 3300005290 | Ga0065712_10072246 | Ga0065712_100722464 | 314 |
| 192 | 3300005327 | Ga0070658_10121863 | Ga0070658_101218632 | 314 |
| 193 | 3300005329 | Ga0070683_100015832 | Ga0070683_1000158327 | 314 |
| 194 | 3300005329 | Ga0070683_100160628 | Ga0070683_1001606282 | 314 |
| 195 | 3300005329 | Ga0070683_100208963 | Ga0070683_1002089631 | 314 |
| 196 | 3300005331 | Ga0070670_100088497 | Ga0070670_1000884972 | 314 |
| 197 | 3300005331 | Ga0070670_100193003 | Ga0070670_1001930032 | 314 |
| 198 | 3300005333 | Ga0070677_10105904 | Ga0070677_101059041 | 314 |
| 199 | 3300005335 | Ga0070666_10057022 | Ga0070666_100570222 | 314 |
| 200 | 3300005336 | Ga0070680_100030529 | Ga0070680_1000305292 | 314 |
| 201 | 3300005336 | Ga0070680_100039686 | Ga0070680_1000396863 | 314 |
| 202 | 3300005339 | Ga0070660_100000435 | Ga0070660_10000043513 | 314 |
| 203 | 3300005339 | Ga0070660_100243923 | Ga0070660_1002439231 | 314 |
| 204 | 3300005356 | Ga0070674_100020838 | Ga0070674_1000208382 | 314 |
| 205 | 3300005366 | Ga0070659_100008871 | Ga0070659_1000088714 | 314 |
| 206 | 3300005455 | Ga0070663_100209846 | Ga0070663_1002098462 | 314 |
| 207 | 3300005458 | Ga0070681_10051031 | Ga0070681_100510312 | 314 |
| 208 | 3300005458 | Ga0070681_10102633 | Ga0070681_101026332 | 314 |
| 209 | 3300005530 | Ga0070679_100094063 | Ga0070679_1000940632 | 314 |
| 210 | 3300005535 | Ga0070684_100001419 | Ga0070684_1000014192 | 314 |
| 211 | 3300005539 | Ga0068853_100010194 | Ga0068853_1000101949 | 314 |
| 212 | 3300005539 | Ga0068853_100041203 | Ga0068853_1000412032 | 314 |
| 213 | 3300005539 | Ga0068853_100087689 | Ga0068853_1000876892 | 314 |
| 214 | 3300005543 | Ga0070672_100079570 | Ga0070672_1000795703 | 314 |
| 215 | 3300005548 | Ga0070665_100229319 | Ga0070665_1002293193 | 314 |
| 216 | 3300005563 | Ga0068855_100000081 | Ga0068855_10000008154 | 314 |
| 217 | 3300005563 | Ga0068855_100013609 | Ga0068855_1000136094 | 314 |
| 218 | 3300005563 | Ga0068855_100023253 | Ga0068855_1000232532 | 314 |
| 219 | 3300005563 | Ga0068855_100024021 | Ga0068855_1000240214 | 314 |
| 220 | 3300005563 | Ga0068855_100198910 | Ga0068855_1001989101 | 314 |
| 221 | 3300005563 | Ga0068855_100680977 | Ga0068855_1006809771 | 314 |
| 222 | 3300005577 | Ga0068857_100002654 | Ga0068857_1000026547 | 314 |
| 223 | 3300005578 | Ga0068854_100071526 | Ga0068854_1000715262 | 314 |
| 224 | 3300005614 | Ga0068856_100054252 | Ga0068856_1000542524 | 314 |
| 225 | 3300005614 | Ga0068856_100077785 | Ga0068856_1000777852 | 314 |
| 226 | 3300005616 | Ga0068852_100075342 | Ga0068852_1000753423 | 314 |
| 227 | 3300005616 | Ga0068852_100090210 | Ga0068852_1000902101 | 314 |
| 228 | 3300005616 | Ga0068852_100197709 | Ga0068852_1001977092 | 314 |
| 229 | 3300005617 | Ga0068859_100017809 | Ga0068859_1000178094 | 314 |
| 230 | 3300005840 | Ga0068870_10095513 | Ga0068870_100955132 | 314 |
| 231 | 3300005843 | Ga0068860_100008699 | Ga0068860_1000086995 | 314 |
| 232 | 3300005844 | Ga0068862_100011939 | Ga0068862_1000119394 | 314 |
| 233 | 3300006847 | Ga0075431_100147598 | Ga0075431_1001475982 | 314 |
| 234 | 3300006880 | Ga0075429_100001725 | Ga0075429_10000172514 | 314 |
| 235 | 3300006931 | Ga0097620_100017809 | Ga0097620_1000178094 | 314 |
| 236 | 3300009093 | Ga0105240_10000106 | Ga0105240_100001068 | 314 |
| 237 | 3300009093 | Ga0105240_10000606 | Ga0105240_1000060642 | 314 |
| 238 | 3300009093 | Ga0105240_10002298 | Ga0105240_1000229822 | 314 |
| 239 | 3300009093 | Ga0105240_10003660 | Ga0105240_100036603 | 314 |
| 240 | 3300009093 | Ga0105240_10006503 | Ga0105240_100065036 | 314 |
| 241 | 3300009093 | Ga0105240_10062121 | Ga0105240_100621214 | 314 |
| 242 | 3300009093 | Ga0105240_10067774 | Ga0105240_100677741 | 314 |
| 243 | 3300009093 | Ga0105240_10363012 | Ga0105240_103630122 | 314 |
| 244 | 3300009094 | Ga0111539_10033061 | Ga0111539_100330614 | 314 |
| 245 | 3300009094 | Ga0111539_10571069 | Ga0111539_105710691 | 314 |
| 246 | 3300009147 | Ga0114129_10007484 | Ga0114129_1000748411 | 314 |
| 247 | 3300009174 | Ga0105241_10004142 | Ga0105241_100041427 | 314 |
| 248 | 3300009174 | Ga0105241_10169024 | Ga0105241_101690242 | 314 |
| 249 | 3300009545 | Ga0105237_10003013 | Ga0105237_1000301313 | 314 |
| 250 | 3300009545 | Ga0105237_10014210 | Ga0105237_100142107 | 314 |
| 251 | 3300009545 | Ga0105237_10036411 | Ga0105237_100364112 | 314 |
| 252 | 3300009545 | Ga0105237_10186331 | Ga0105237_101863312 | 314 |
| 253 | 3300009551 | Ga0105238_10002205 | Ga0105238_1000220514 | 314 |
| 254 | 3300009551 | Ga0105238_10080747 | Ga0105238_100807472 | 314 |
| 255 | 3300009553 | Ga0105249_10455591 | Ga0105249_104555911 | 314 |
| 256 | 3300010375 | Ga0105239_10000404 | Ga0105239_1000040447 | 314 |
| 257 | 3300010375 | Ga0105239_10006097 | Ga0105239_1000609710 | 314 |
| 258 | 3300010375 | Ga0105239_10006227 | Ga0105239_1000622710 | 314 |
| 259 | 3300010375 | Ga0105239_10015063 | Ga0105239_100150632 | 314 |
| 260 | 3300010375 | Ga0105239_10347541 | Ga0105239_103475412 | 314 |
| 261 | 3300013102 | Ga0157371_10000518 | Ga0157371_1000051814 | 314 |
| 262 | 3300013102 | Ga0157371_10004536 | Ga0157371_100045361 | 314 |
| 263 | 3300013102 | Ga0157371_10012494 | Ga0157371_100124943 | 314 |
| 264 | 3300013102 | Ga0157371_10036915 | Ga0157371_100369153 | 314 |
| 265 | 3300013102 | Ga0157371_10203478 | Ga0157371_102034781 | 314 |
| 266 | 3300013104 | Ga0157370_10000408 | Ga0157370_1000040825 | 314 |
| 267 | 3300013104 | Ga0157370_10018111 | Ga0157370_100181114 | 314 |
| 268 | 3300013104 | Ga0157370_10055556 | Ga0157370_100555562 | 314 |
| 269 | 3300013104 | Ga0157370_10070626 | Ga0157370_100706262 | 314 |
| 270 | 3300013104 | Ga0157370_10087246 | Ga0157370_100872463 | 314 |
| 271 | 3300013105 | Ga0157369_10182337 | Ga0157369_101823372 | 314 |
| 272 | 3300013105 | Ga0157369_10252579 | Ga0157369_102525791 | 314 |
| 273 | 3300013296 | Ga0157374_10000027 | Ga0157374_1000002728 | 314 |
| 274 | 3300013297 | Ga0157378_10330464 | Ga0157378_103304642 | 314 |
| 275 | 3300013306 | Ga0163162_10002571 | Ga0163162_100025717 | 314 |
| 276 | 3300013306 | Ga0163162_10201986 | Ga0163162_102019862 | 314 |
| 277 | 3300013306 | Ga0163162_10434663 | Ga0163162_104346632 | 314 |
| 278 | 3300013307 | Ga0157372_10002627 | Ga0157372_1000262714 | 314 |
| 279 | 3300013307 | Ga0157372_10018986 | Ga0157372_100189866 | 314 |
| 280 | 3300013307 | Ga0157372_10029218 | Ga0157372_100292183 | 314 |
| 281 | 3300013307 | Ga0157372_10052938 | Ga0157372_100529383 | 314 |
| 282 | 3300013307 | Ga0157372_10078140 | Ga0157372_100781402 | 314 |
| 283 | 3300013307 | Ga0157372_10190194 | Ga0157372_101901943 | 314 |
| 284 | 3300014325 | Ga0163163_10128193 | Ga0163163_101281933 | 314 |
| 285 | 3300014326 | Ga0157380_10000018 | Ga0157380_1000001885 | 314 |
| 286 | 3300014326 | Ga0157380_10028507 | Ga0157380_100285072 | 314 |
| 287 | 3300014326 | Ga0157380_10069798 | Ga0157380_100697983 | 314 |
| 288 | 3300014969 | Ga0157376_10000341 | Ga0157376_1000034114 | 314 |
| 289 | 3300015265 | Ga0182005_1000097 | Ga0182005_100009739 | 314 |
| 290 | 3300025208 | Ga0209436_100324 | Ga0209436_10032418 | 314 |
| 291 | 3300025208 | Ga0209436_114708 | Ga0209436_1147081 | 314 |
| 292 | 3300025242 | Ga0209258_100302 | Ga0209258_10030262 | 314 |
| 293 | 3300025254 | Ga0209148_1000131 | Ga0209148_100013119 | 314 |
| 294 | 3300025273 | Ga0209673_1000203 | Ga0209673_100020317 | 314 |
| 295 | 3300025284 | Ga0209130_1001297 | Ga0209130_100129715 | 314 |
| 296 | 3300025295 | Ga0209564_1022859 | Ga0209564_10228591 | 314 |
| 297 | 3300025295 | Ga0209564_1022867 | Ga0209564_10228671 | 314 |
| 298 | 3300025298 | Ga0209050_1000888 | Ga0209050_100088815 | 314 |
| 299 | 3300025302 | Ga0207426_1000024 | Ga0207426_100002413 | 314 |
| 300 | 3300025302 | Ga0207426_1000806 | Ga0207426_100080626 | 314 |
| 301 | 3300025302 | Ga0207426_1017306 | Ga0207426_10173062 | 314 |
| 302 | 3300025304 | Ga0209257_1000070 | Ga0209257_100007029 | 314 |
| 303 | 3300025304 | Ga0209257_1002474 | Ga0209257_10024749 | 314 |
| 304 | 3300025903 | Ga0207680_10043288 | Ga0207680_100432882 | 314 |
| 305 | 3300025904 | Ga0207647_10006574 | Ga0207647_100065747 | 314 |
| 306 | 3300025904 | Ga0207647_10044652 | Ga0207647_100446522 | 314 |
| 307 | 3300025911 | Ga0207654_10017862 | Ga0207654_100178624 | 314 |
| 308 | 3300025912 | Ga0207707_10285942 | Ga0207707_102859422 | 314 |
| 309 | 3300025913 | Ga0207695_10000087 | Ga0207695_10000087198 | 314 |
| 310 | 3300025913 | Ga0207695_10000685 | Ga0207695_1000068542 | 314 |
| 311 | 3300025913 | Ga0207695_10000917 | Ga0207695_1000091718 | 314 |
| 312 | 3300025913 | Ga0207695_10001873 | Ga0207695_1000187323 | 314 |
| 313 | 3300025913 | Ga0207695_10028845 | Ga0207695_100288453 | 314 |
| 314 | 3300025913 | Ga0207695_10038240 | Ga0207695_100382402 | 314 |
| 315 | 3300025913 | Ga0207695_10118885 | Ga0207695_101188853 | 314 |
| 316 | 3300025914 | Ga0207671_10000637 | Ga0207671_1000063734 | 314 |
| 317 | 3300025914 | Ga0207671_10004496 | Ga0207671_1000449610 | 314 |
| 318 | 3300025914 | Ga0207671_10051595 | Ga0207671_100515951 | 314 |
| 319 | 3300025917 | Ga0207660_10021719 | Ga0207660_100217193 | 314 |
| 320 | 3300025919 | Ga0207657_10004066 | Ga0207657_100040662 | 314 |
| 321 | 3300025921 | Ga0207652_10007027 | Ga0207652_100070273 | 314 |
| 322 | 3300025923 | Ga0207681_10119055 | Ga0207681_101190552 | 314 |
| 323 | 3300025924 | Ga0207694_10004594 | Ga0207694_1000459410 | 314 |
| 324 | 3300025924 | Ga0207694_10016687 | Ga0207694_100166875 | 314 |
| 325 | 3300025925 | Ga0207650_10232685 | Ga0207650_102326852 | 314 |
| 326 | 3300025926 | Ga0207659_10065881 | Ga0207659_100658813 | 314 |
| 327 | 3300025932 | Ga0207690_10010426 | Ga0207690_100104265 | 314 |
| 328 | 3300025937 | Ga0207669_10023300 | Ga0207669_100233002 | 314 |
| 329 | 3300025937 | Ga0207669_10024850 | Ga0207669_100248502 | 314 |
| 330 | 3300025949 | Ga0207667_10000172 | Ga0207667_1000017226 | 314 |
| 331 | 3300025949 | Ga0207667_10008374 | Ga0207667_100083747 | 314 |
| 332 | 3300025949 | Ga0207667_10031326 | Ga0207667_100313263 | 314 |
| 333 | 3300025949 | Ga0207667_10055066 | Ga0207667_100550661 | 314 |
| 334 | 3300025949 | Ga0207667_10638672 | Ga0207667_106386721 | 314 |
| 335 | 3300025986 | Ga0207658_10192703 | Ga0207658_101927032 | 314 |
| 336 | 3300026023 | Ga0207677_10174711 | Ga0207677_101747111 | 314 |
| 337 | 3300026041 | Ga0207639_10055557 | Ga0207639_100555571 | 314 |
| 338 | 3300026041 | Ga0207639_10074264 | Ga0207639_100742642 | 314 |
| 339 | 3300026078 | Ga0207702_10085938 | Ga0207702_100859382 | 314 |
| 340 | 3300026078 | Ga0207702_10189987 | Ga0207702_101899872 | 314 |
| 341 | 3300026116 | Ga0207674_10004626 | Ga0207674_100046265 | 314 |
| 342 | 3300026142 | Ga0207698_10018321 | Ga0207698_100183212 | 314 |
| 343 | 3300026142 | Ga0207698_10080910 | Ga0207698_100809102 | 314 |
| 344 | 3300026142 | Ga0207698_10302729 | Ga0207698_103027291 | 314 |
| 345 | 3300028379 | Ga0268266_10000048 | Ga0268266_10000048106 | 314 |
| 346 | 3300028380 | Ga0268265_10009060 | Ga0268265_100090603 | 314 |
| 347 | 3300028381 | Ga0268264_10001761 | Ga0268264_1000176111 | 314 |
| 348 | 3300028381 | Ga0268264_10006470 | Ga0268264_100064709 | 314 |
| 349 | 3300028381 | Ga0268264_10010034 | Ga0268264_100100344 | 314 |
| 350 | 3300028786 | Ga0307517_10099816 | Ga0307517_100998162 | 314 |
| 351 | 3300029957 | Ga0265324_10016585 | Ga0265324_100165852 | 314 |
| 352 | 3300030521 | Ga0307511_10000002 | Ga0307511_1000000222 | 314 |
| 353 | 3300031251 | Ga0265327_10023609 | Ga0265327_100236094 | 314 |
| 354 | 3300031730 | Ga0307516_10000159 | Ga0307516_1000015968 | 314 |
| 355 | 3300042007 | Ga0439449_0002729 | Ga0439449_0002729_2397_3380 | 314 |
| 356 | 3300042015 | Ga0439462_0008387 | Ga0439462_0008387_772_1755 | 314 |
| 357 | 3300044656 | Ga0466969_0061212 | Ga0466969_0061212_641_1603 | 314 |
| 358 | 3300044683 | Ga0466965_0102220 | Ga0466965_0102220_316_1290 | 314 |
| 359 | 3300044693 | Ga0466961_0064528 | Ga0466961_0064528_278_1240 | 314 |
| 360 | 3300044765 | Ga0466970_0136481 | Ga0466970_0136481_194_1156 | 314 |
| 361 | 3300044842 | Ga0466957_0022142 | Ga0466957_0022142_2491_3465 | 314 |
| 362 | 3300044842 | Ga0466957_0105888 | Ga0466957_0105888_308_1276 | 314 |
| 363 | 3300045049 | Ga0466959_0024738 | Ga0466959_0024738_2428_3390 | 314 |
| 364 | 3300046460 | Ga0495638_0220178 | Ga0495638_0220178_19_987 | 314 |
| 365 | 3300046472 | Ga0495580_0341116 | Ga0495580_0341116_19_984 | 314 |
| 366 | 3300046507 | Ga0495606_0005804 | Ga0495606_0005804_1134_2102 | 314 |
| 367 | 3300046558 | Ga0495633_0000125 | Ga0495633_0000125_64755_65729 | 314 |
| 368 | 3300046616 | Ga0495668_0002554 | Ga0495668_0002554_1842_2822 | 314 |
| 369 | 3300046648 | Ga0495611_0000354 | Ga0495611_0000354_16627_17595 | 314 |
| 370 | 3300046648 | Ga0495611_0102676 | Ga0495611_0102676_235_1203 | 314 |
| 371 | 3300047318 | Ga0495636_0000060 | Ga0495636_0000060_23069_24037 | 314 |
| 372 | 3300047320 | Ga0495672_0028859 | Ga0495672_0028859_2120_3085 | 314 |
| 373 | 3300047443 | Ga0495687_000261 | Ga0495687_000261_31474_32442 | 314 |
| 374 | 3300047472 | Ga0495686_0000005 | Ga0495686_0000005_672238_673206 | 314 |
| 375 | 3300048924 | Ga0496121_0000081 | Ga0496121_0000081_65955_66929 | 314 |
| 376 | 3300048929 | Ga0496126_0042525 | Ga0496126_0042525_1610_2584 | 314 |
| 377 | 3300049569 | Ga0501032_0004132 | Ga0501032_0004132_7062_8036 | 314 |
| 378 | 3300049569 | Ga0501032_0086164 | Ga0501032_0086164_386_1348 | 314 |
| 379 | 3300049570 | Ga0501033_0017643 | Ga0501033_0017643_3641_4603 | 314 |
| 380 | 3300049570 | Ga0501033_0113556 | Ga0501033_0113556_277_1251 | 314 |
| 381 | 3300049571 | Ga0501034_0007421 | Ga0501034_0007421_7819_8793 | 314 |
| 382 | 3300049574 | Ga0501038_0104439 | Ga0501038_0104439_1032_1994 | 314 |
| 383 | 3300049574 | Ga0501038_0161412 | Ga0501038_0161412_298_1272 | 314 |
| 384 | 3300049579 | Ga0501043_0030664 | Ga0501043_0030664_324_1298 | 314 |
| 385 | 3300049579 | Ga0501043_0068367 | Ga0501043_0068367_196_1170 | 314 |
| 386 | 3300049580 | Ga0501046_0220574 | Ga0501046_0220574_94_1068 | 314 |
| 387 | 3300049581 | Ga0501047_0013596 | Ga0501047_0013596_3930_4904 | 314 |
| 388 | 3300049581 | Ga0501047_0169887 | Ga0501047_0169887_1022_1990 | 314 |
| 389 | 3300049654 | Ga0501207_003749 | Ga0501207_003749_388_1407 | 314 |
| 390 | 3300049660 | Ga0501216_011083 | Ga0501216_011083_207_1172 | 314 |
| 391 | 3300049661 | Ga0501217_000586 | Ga0501217_000586_477_1496 | 314 |
| 392 | 3300049662 | Ga0501222_001557 | Ga0501222_001557_222_1241 | 314 |
| 393 | 3300049673 | Ga0501240_000977 | Ga0501240_000977_25_1044 | 314 |
| 394 | 3300049703 | Ga0501219_000133 | Ga0501219_000133_6302_7276 | 314 |
| 395 | 3300049704 | Ga0501221_002892 | Ga0501221_002892_485_1504 | 314 |
| 396 | 3300049705 | Ga0501225_0012912 | Ga0501225_0012912_589_1554 | 314 |
| 397 | 3300049705 | Ga0501225_0030894 | Ga0501225_0030894_481_1455 | 314 |
| 398 | 3300049758 | Ga0501241_003764 | Ga0501241_003764_66_1040 | 314 |
| 399 | 3300049822 | Ga0501035_0007289 | Ga0501035_0007289_3392_4366 | 314 |
| 400 | 3300049822 | Ga0501035_0261765 | Ga0501035_0261765_127_1089 | 314 |
| 401 | 3300049823 | Ga0501044_0158829 | Ga0501044_0158829_211_1173 | 314 |
| 402 | 3300050005 | Ga0501284_00007 | Ga0501284_00007_115746_116720 | 314 |
| 403 | 3300050511 | nmdc:mga08y16_110978_c1 | nmdc:mga08y16_110978_c1_1070_2044 | 314 |
| 404 | 3300050511 | nmdc:mga08y16_143375_c1 | nmdc:mga08y16_143375_c1_1231_2196 | 314 |
| 405 | 3300053088 | Ga0500644_0000026 | Ga0500644_0000026_60664_61638 | 314 |
| 406 | 3300053090 | Ga0500646_0013350 | Ga0500646_0013350_344_1318 | 314 |
| 407 | 3300053092 | Ga0500583_0002299 | Ga0500583_0002299_1461_2435 | 314 |
| 408 | 3300053109 | Ga0500569_000047 | Ga0500569_000047_9672_10646 | 314 |
| 409 | 3300053121 | Ga0500607_046686 | Ga0500607_046686_29_1003 | 314 |
| 410 | 3300053130 | Ga0500642_0001746 | Ga0500642_0001746_244_1212 | 314 |
| 411 | 3300053134 | Ga0500658_0003491 | Ga0500658_0003491_4435_5409 | 314 |
| 412 | 3300053136 | Ga0500559_0002568 | Ga0500559_0002568_4539_5513 | 314 |
| 413 | 3300053139 | Ga0500568_0003595 | Ga0500568_0003595_5743_6711 | 314 |
| 414 | 3300053142 | Ga0500577_0006329 | Ga0500577_0006329_2052_3026 | 314 |
| 415 | 3300053146 | Ga0500588_0008757 | Ga0500588_0008757_312_1292 | 314 |
| 416 | 3300053153 | Ga0500616_0002235 | Ga0500616_0002235_9619_10593 | 314 |
| 417 | 3300053156 | Ga0500622_0000692 | Ga0500622_0000692_27472_28446 | 314 |
| 418 | 3300053156 | Ga0500622_0005506 | Ga0500622_0005506_2147_3115 | 314 |
| 419 | 3300053160 | Ga0500633_0000782 | Ga0500633_0000782_1058_2032 | 314 |
| 420 | 3300053177 | Ga0500636_0005348 | Ga0500636_0005348_135_1109 | 314 |
| 421 | 3300055283 | Ga0500661_005321 | Ga0500661_005321_458_1432 | 314 |
| 422 | 3300061719 | Ga0466962_0063789 | Ga0466962_0063789_519_1481 | 314 |
| 423 | iso_pu_bacteria | 2818991442 | 2819574922 | 314 |
| 424 | iso_pu_bacteria | 2818991460 | 2819676870 | 314 |
| 425 | iso_pu_bacteria | 2821136567 | 2821141023 | 314 |
| 426 | iso_pu_bacteria | 2884791551 | 2884796724 | 314 |
| 427 | iso_pu_bacteria | 2896085136 | 2896086639 | 314 |
| 428 | iso_pu_bacteria | 2904467357 | 2904471523 | 314 |
| 429 | iso_pu_bacteria | 2929177148 | 2929177758 | 314 |
| 430 | iso_pu_bacteria | 2929239360 | 2929240122 | 314 |
| 431 | iso_pu_bacteria | 2945977869 | 2945980105 | 314 |
| 432 | iso_pu_bacteria | 2946013367 | 2946014033 | 314 |
| 433 | 2162886011 | MRS1b_contig_4233568 | MRS1b_0388.00003100 | 315 |
| 434 | 2162886011 | MRS1b_contig_448359 | MRS1b_0602.00001840 | 315 |
| 435 | 2162886012 | MBSR1b_contig_1406278 | MBSR1b_0239.00007060 | 315 |
| 436 | 2162886012 | MBSR1b_contig_7589204 | MBSR1b_0095.00007450 | 315 |
| 437 | 3300002077 | JGI24744J21845_10003674 | JGI24744J21845_100036743 | 315 |
| 438 | 3300002459 | JGI24751J29686_10000540 | JGI24751J29686_100005409 | 315 |
| 439 | 3300002773 | JGI25152J39213_1000647 | JGI25152J39213_100064711 | 315 |
| 440 | 3300002774 | JGI25150J39212_1000009 | JGI25150J39212_1000009228 | 315 |
| 441 | 3300003187 | JGI25151J46595_10000017 | JGI25151J46595_10000017228 | 315 |
| 442 | 3300003215 | JGI25153J46596_10000023 | JGI25153J46596_1000002311 | 315 |
| 443 | 3300003316 | rootH1_10004252 | rootH1_100042523 | 315 |
| 444 | 3300003316 | rootH1_10013813 | rootH1_100138137 | 315 |
| 445 | 3300003320 | rootH2_10019275 | rootH2_1001927518 | 315 |
| 446 | 3300003320 | rootH2_10232790 | rootH2_102327901 | 315 |
| 447 | 3300003322 | rootL2_10000984 | rootL2_1000098410 | 315 |
| 448 | 3300003322 | rootL2_10001672 | rootL2_100016723 | 315 |
| 449 | 3300003322 | rootL2_10041649 | rootL2_100416492 | 315 |
| 450 | 3300003322 | rootL2_10062550 | rootL2_100625502 | 315 |
| 451 | 3300003323 | rootH1_10003699 | rootH1_100036998 | 315 |
| 452 | 3300003323 | rootH1_10011437 | rootH1_1001143720 | 315 |
| 453 | 3300003323 | rootH1_10064744 | rootH1_100647442 | 315 |
| 454 | 3300003323 | rootH1_10175021 | rootH1_101750214 | 315 |
| 455 | 3300003323 | rootH1_10311342 | rootH1_103113422 | 315 |
| 456 | 3300003791 | Ga0055530_10002755 | Ga0055530_100027557 | 315 |
| 457 | 3300005288 | Ga0065714_10004769 | Ga0065714_100047693 | 315 |
| 458 | 3300005288 | Ga0065714_10073672 | Ga0065714_100736723 | 315 |
| 459 | 3300005290 | Ga0065712_10080579 | Ga0065712_100805791 | 315 |
| 460 | 3300005290 | Ga0065712_10084814 | Ga0065712_100848141 | 315 |
| 461 | 3300005290 | Ga0065712_10109904 | Ga0065712_101099042 | 315 |
| 462 | 3300005327 | Ga0070658_10051009 | Ga0070658_100510093 | 315 |
| 463 | 3300005329 | Ga0070683_100000327 | Ga0070683_1000003277 | 315 |
| 464 | 3300005329 | Ga0070683_100192250 | Ga0070683_1001922502 | 315 |
| 465 | 3300005331 | Ga0070670_100002147 | Ga0070670_1000021474 | 315 |
| 466 | 3300005331 | Ga0070670_100026886 | Ga0070670_1000268863 | 315 |
| 467 | 3300005334 | Ga0068869_100009710 | Ga0068869_1000097104 | 315 |
| 468 | 3300005334 | Ga0068869_100033079 | Ga0068869_1000330792 | 315 |
| 469 | 3300005334 | Ga0068869_100135103 | Ga0068869_1001351033 | 315 |
| 470 | 3300005335 | Ga0070666_10015901 | Ga0070666_100159015 | 315 |
| 471 | 3300005337 | Ga0070682_100036209 | Ga0070682_1000362093 | 315 |
| 472 | 3300005338 | Ga0068868_100009009 | Ga0068868_1000090096 | 315 |
| 473 | 3300005340 | Ga0070689_100014333 | Ga0070689_1000143332 | 315 |
| 474 | 3300005344 | Ga0070661_100003284 | Ga0070661_1000032843 | 315 |
| 475 | 3300005344 | Ga0070661_100120125 | Ga0070661_1001201252 | 315 |
| 476 | 3300005347 | Ga0070668_100165525 | Ga0070668_1001655251 | 315 |
| 477 | 3300005353 | Ga0070669_100006429 | Ga0070669_1000064297 | 315 |
| 478 | 3300005353 | Ga0070669_100014257 | Ga0070669_1000142577 | 315 |
| 479 | 3300005353 | Ga0070669_100024594 | Ga0070669_1000245942 | 315 |
| 480 | 3300005353 | Ga0070669_100038623 | Ga0070669_1000386231 | 315 |
| 481 | 3300005355 | Ga0070671_100144493 | Ga0070671_1001444932 | 315 |
| 482 | 3300005364 | Ga0070673_100118290 | Ga0070673_1001182901 | 315 |
| 483 | 3300005364 | Ga0070673_100149021 | Ga0070673_1001490212 | 315 |
| 484 | 3300005365 | Ga0070688_100084798 | Ga0070688_1000847982 | 315 |
| 485 | 3300005366 | Ga0070659_100019255 | Ga0070659_1000192551 | 315 |
| 486 | 3300005367 | Ga0070667_100222256 | Ga0070667_1002222562 | 315 |
| 487 | 3300005456 | Ga0070678_100011344 | Ga0070678_1000113443 | 315 |
| 488 | 3300005456 | Ga0070678_100119505 | Ga0070678_1001195052 | 315 |
| 489 | 3300005457 | Ga0070662_100000209 | Ga0070662_10000020934 | 315 |
| 490 | 3300005457 | Ga0070662_100046050 | Ga0070662_1000460503 | 315 |
| 491 | 3300005459 | Ga0068867_100003103 | Ga0068867_10000310324 | 315 |
| 492 | 3300005459 | Ga0068867_100039779 | Ga0068867_1000397793 | 315 |
| 493 | 3300005459 | Ga0068867_100257655 | Ga0068867_1002576552 | 315 |
| 494 | 3300005459 | Ga0068867_100274327 | Ga0068867_1002743271 | 315 |
| 495 | 3300005466 | Ga0070685_10123337 | Ga0070685_101233371 | 315 |
| 496 | 3300005466 | Ga0070685_10262349 | Ga0070685_102623491 | 315 |
| 497 | 3300005471 | Ga0070698_100000282 | Ga0070698_10000028224 | 315 |
| 498 | 3300005471 | Ga0070698_100002541 | Ga0070698_1000025414 | 315 |
| 499 | 3300005471 | Ga0070698_100006847 | Ga0070698_1000068476 | 315 |
| 500 | 3300005535 | Ga0070684_100000290 | Ga0070684_10000029026 | 315 |
| 501 | 3300005539 | Ga0068853_100009821 | Ga0068853_1000098213 | 315 |
| 502 | 3300005539 | Ga0068853_100029290 | Ga0068853_1000292903 | 315 |
| 503 | 3300005543 | Ga0070672_100008190 | Ga0070672_1000081907 | 315 |
| 504 | 3300005543 | Ga0070672_100147053 | Ga0070672_1001470531 | 315 |
| 505 | 3300005544 | Ga0070686_100072943 | Ga0070686_1000729432 | 315 |
| 506 | 3300005563 | Ga0068855_100059131 | Ga0068855_1000591313 | 315 |
| 507 | 3300005564 | Ga0070664_100000509 | Ga0070664_10000050927 | 315 |
| 508 | 3300005564 | Ga0070664_100008601 | Ga0070664_1000086013 | 315 |
| 509 | 3300005577 | Ga0068857_100000579 | Ga0068857_1000005791 | 315 |
| 510 | 3300005577 | Ga0068857_100073334 | Ga0068857_1000733342 | 315 |
| 511 | 3300005577 | Ga0068857_100160766 | Ga0068857_1001607662 | 315 |
| 512 | 3300005577 | Ga0068857_100164503 | Ga0068857_1001645032 | 315 |
| 513 | 3300005578 | Ga0068854_100032309 | Ga0068854_1000323092 | 315 |
| 514 | 3300005578 | Ga0068854_100093732 | Ga0068854_1000937321 | 315 |
| 515 | 3300005614 | Ga0068856_100024646 | Ga0068856_1000246462 | 315 |
| 516 | 3300005614 | Ga0068856_100067961 | Ga0068856_1000679612 | 315 |
| 517 | 3300005616 | Ga0068852_100014577 | Ga0068852_1000145776 | 315 |
| 518 | 3300005616 | Ga0068852_100368481 | Ga0068852_1003684812 | 315 |
| 519 | 3300005617 | Ga0068859_100000289 | Ga0068859_10000028930 | 315 |
| 520 | 3300005617 | Ga0068859_100086698 | Ga0068859_1000866983 | 315 |
| 521 | 3300005618 | Ga0068864_100002659 | Ga0068864_10000265910 | 315 |
| 522 | 3300005618 | Ga0068864_100043128 | Ga0068864_1000431284 | 315 |
| 523 | 3300005618 | Ga0068864_100127278 | Ga0068864_1001272782 | 315 |
| 524 | 3300005618 | Ga0068864_100257686 | Ga0068864_1002576861 | 315 |
| 525 | 3300005618 | Ga0068864_100303098 | Ga0068864_1003030981 | 315 |
| 526 | 3300005618 | Ga0068864_100644796 | Ga0068864_1006447961 | 315 |
| 527 | 3300005718 | Ga0068866_10014018 | Ga0068866_100140182 | 315 |
| 528 | 3300005718 | Ga0068866_10031820 | Ga0068866_100318202 | 315 |
| 529 | 3300005719 | Ga0068861_100001502 | Ga0068861_10000150216 | 315 |
| 530 | 3300005719 | Ga0068861_100049553 | Ga0068861_1000495532 | 315 |
| 531 | 3300005719 | Ga0068861_100462228 | Ga0068861_1004622282 | 315 |
| 532 | 3300005834 | Ga0068851_10008435 | Ga0068851_100084352 | 315 |
| 533 | 3300005840 | Ga0068870_10002263 | Ga0068870_100022632 | 315 |
| 534 | 3300005841 | Ga0068863_100026959 | Ga0068863_1000269596 | 315 |
| 535 | 3300005841 | Ga0068863_100405149 | Ga0068863_1004051492 | 315 |
| 536 | 3300005842 | Ga0068858_100104708 | Ga0068858_1001047083 | 315 |
| 537 | 3300005842 | Ga0068858_100119796 | Ga0068858_1001197961 | 315 |
| 538 | 3300005843 | Ga0068860_100054588 | Ga0068860_1000545882 | 315 |
| 539 | 3300005843 | Ga0068860_100343310 | Ga0068860_1003433101 | 315 |
| 540 | 3300005844 | Ga0068862_100027366 | Ga0068862_1000273664 | 315 |
| 541 | 3300005844 | Ga0068862_100058506 | Ga0068862_1000585062 | 315 |
| 542 | 3300005844 | Ga0068862_100132285 | Ga0068862_1001322851 | 315 |
| 543 | 3300005844 | Ga0068862_100306494 | Ga0068862_1003064943 | 315 |
| 544 | 3300006195 | Ga0075366_10096980 | Ga0075366_100969802 | 315 |
| 545 | 3300006237 | Ga0097621_100000036 | Ga0097621_10000003629 | 315 |
| 546 | 3300006237 | Ga0097621_100070027 | Ga0097621_1000700272 | 315 |
| 547 | 3300006237 | Ga0097621_100225479 | Ga0097621_1002254792 | 315 |
| 548 | 3300006358 | Ga0068871_100005055 | Ga0068871_1000050557 | 315 |
| 549 | 3300006358 | Ga0068871_100033550 | Ga0068871_1000335502 | 315 |
| 550 | 3300006358 | Ga0068871_100343538 | Ga0068871_1003435381 | 315 |
| 551 | 3300006844 | Ga0075428_100006607 | Ga0075428_1000066072 | 315 |
| 552 | 3300006844 | Ga0075428_100093975 | Ga0075428_1000939753 | 315 |
| 553 | 3300006844 | Ga0075428_100152663 | Ga0075428_1001526631 | 315 |
| 554 | 3300006844 | Ga0075428_100294134 | Ga0075428_1002941341 | 315 |
| 555 | 3300006846 | Ga0075430_100104237 | Ga0075430_1001042372 | 315 |
| 556 | 3300006846 | Ga0075430_100175362 | Ga0075430_1001753622 | 315 |
| 557 | 3300006847 | Ga0075431_100055523 | Ga0075431_1000555234 | 315 |
| 558 | 3300006847 | Ga0075431_100110345 | Ga0075431_1001103452 | 315 |
| 559 | 3300006847 | Ga0075431_100127855 | Ga0075431_1001278552 | 315 |
| 560 | 3300006880 | Ga0075429_100000136 | Ga0075429_10000013622 | 315 |
| 561 | 3300006881 | Ga0068865_100095874 | Ga0068865_1000958742 | 315 |
| 562 | 3300006931 | Ga0097620_100000289 | Ga0097620_10000028921 | 315 |
| 563 | 3300006931 | Ga0097620_100086694 | Ga0097620_1000866943 | 315 |
| 564 | 3300006931 | Ga0097620_100446771 | Ga0097620_1004467712 | 315 |
| 565 | 3300009093 | Ga0105240_10085981 | Ga0105240_100859815 | 315 |
| 566 | 3300009094 | Ga0111539_10000601 | Ga0111539_1000060113 | 315 |
| 567 | 3300009094 | Ga0111539_10157727 | Ga0111539_101577271 | 315 |
| 568 | 3300009094 | Ga0111539_10632485 | Ga0111539_106324851 | 315 |
| 569 | 3300009101 | Ga0105247_10001391 | Ga0105247_1000139112 | 315 |
| 570 | 3300009147 | Ga0114129_10004956 | Ga0114129_100049566 | 315 |
| 571 | 3300009147 | Ga0114129_10039792 | Ga0114129_100397922 | 315 |
| 572 | 3300009147 | Ga0114129_10138808 | Ga0114129_101388083 | 315 |
| 573 | 3300009148 | Ga0105243_10120919 | Ga0105243_101209192 | 315 |
| 574 | 3300009174 | Ga0105241_10033823 | Ga0105241_100338232 | 315 |
| 575 | 3300009174 | Ga0105241_10034973 | Ga0105241_100349732 | 315 |
| 576 | 3300009176 | Ga0105242_10078638 | Ga0105242_100786382 | 315 |
| 577 | 3300009545 | Ga0105237_10016066 | Ga0105237_100160664 | 315 |
| 578 | 3300009545 | Ga0105237_10137911 | Ga0105237_101379112 | 315 |
| 579 | 3300009553 | Ga0105249_10000635 | Ga0105249_1000063510 | 315 |
| 580 | 3300009553 | Ga0105249_10001404 | Ga0105249_100014043 | 315 |
| 581 | 3300009553 | Ga0105249_10044696 | Ga0105249_100446961 | 315 |
| 582 | 3300009553 | Ga0105249_10054284 | Ga0105249_100542842 | 315 |
| 583 | 3300011119 | Ga0105246_10024851 | Ga0105246_100248512 | 315 |
| 584 | 3300013100 | Ga0157373_10026532 | Ga0157373_100265322 | 315 |
| 585 | 3300013102 | Ga0157371_10000009 | Ga0157371_10000009329 | 315 |
| 586 | 3300013104 | Ga0157370_10016291 | Ga0157370_100162913 | 315 |
| 587 | 3300013104 | Ga0157370_10061782 | Ga0157370_100617822 | 315 |
| 588 | 3300013104 | Ga0157370_10434281 | Ga0157370_104342812 | 315 |
| 589 | 3300013105 | Ga0157369_10000006 | Ga0157369_10000006355 | 315 |
| 590 | 3300013296 | Ga0157374_10062246 | Ga0157374_100622463 | 315 |
| 591 | 3300013296 | Ga0157374_10125984 | Ga0157374_101259842 | 315 |
| 592 | 3300013296 | Ga0157374_10184131 | Ga0157374_101841312 | 315 |
| 593 | 3300013297 | Ga0157378_10015554 | Ga0157378_100155547 | 315 |
| 594 | 3300013306 | Ga0163162_10000177 | Ga0163162_1000017741 | 315 |
| 595 | 3300013306 | Ga0163162_10002830 | Ga0163162_100028305 | 315 |
| 596 | 3300013306 | Ga0163162_10023096 | Ga0163162_100230967 | 315 |
| 597 | 3300013306 | Ga0163162_10077356 | Ga0163162_100773562 | 315 |
| 598 | 3300013306 | Ga0163162_10138178 | Ga0163162_101381782 | 315 |
| 599 | 3300013306 | Ga0163162_10172929 | Ga0163162_101729292 | 315 |
| 600 | 3300013307 | Ga0157372_10022449 | Ga0157372_100224496 | 315 |
| 601 | 3300013307 | Ga0157372_10080014 | Ga0157372_100800142 | 315 |
| 602 | 3300013307 | Ga0157372_10117112 | Ga0157372_101171122 | 315 |
| 603 | 3300013308 | Ga0157375_10085934 | Ga0157375_100859342 | 315 |
| 604 | 3300014325 | Ga0163163_10000432 | Ga0163163_1000043223 | 315 |
| 605 | 3300014325 | Ga0163163_10014374 | Ga0163163_100143742 | 315 |
| 606 | 3300014325 | Ga0163163_10107022 | Ga0163163_101070222 | 315 |
| 607 | 3300014326 | Ga0157380_10050708 | Ga0157380_100507082 | 315 |
| 608 | 3300014326 | Ga0157380_10102592 | Ga0157380_101025922 | 315 |
| 609 | 3300014326 | Ga0157380_10370164 | Ga0157380_103701641 | 315 |
| 610 | 3300014969 | Ga0157376_10115471 | Ga0157376_101154711 | 315 |
| 611 | 3300014969 | Ga0157376_10154924 | Ga0157376_101549241 | 315 |
| 612 | 3300014969 | Ga0157376_10213854 | Ga0157376_102138542 | 315 |
| 613 | 3300014969 | Ga0157376_10419471 | Ga0157376_104194712 | 315 |
| 614 | 3300015261 | Ga0182006_1000322 | Ga0182006_10003224 | 315 |
| 615 | 3300015261 | Ga0182006_1000622 | Ga0182006_100062225 | 315 |
| 616 | 3300015262 | Ga0182007_10000001 | Ga0182007_10000001304 | 315 |
| 617 | 3300015682 | Ga0183373_1006 | Ga0183373_1006196 | 315 |
| 618 | 3300017792 | Ga0163161_10001724 | Ga0163161_1000172413 | 315 |
| 619 | 3300017792 | Ga0163161_10002308 | Ga0163161_1000230812 | 315 |
| 620 | 3300017792 | Ga0163161_10059225 | Ga0163161_100592252 | 315 |
| 621 | 3300017792 | Ga0163161_10060984 | Ga0163161_100609841 | 315 |
| 622 | 3300017792 | Ga0163161_10072665 | Ga0163161_100726651 | 315 |
| 623 | 3300017792 | Ga0163161_10267700 | Ga0163161_102677001 | 315 |
| 624 | 3300021384 | Ga0213876_10001574 | Ga0213876_100015749 | 315 |
| 625 | 3300025242 | Ga0209258_108334 | Ga0209258_1083342 | 315 |
| 626 | 3300025245 | Ga0207425_1000007 | Ga0207425_1000007328 | 315 |
| 627 | 3300025258 | Ga0209129_1000006 | Ga0209129_1000006328 | 315 |
| 628 | 3300025294 | Ga0209025_1000025 | Ga0209025_1000025158 | 315 |
| 629 | 3300025297 | Ga0209758_1000016 | Ga0209758_1000016328 | 315 |
| 630 | 3300025298 | Ga0209050_1037458 | Ga0209050_10374582 | 315 |
| 631 | 3300025315 | Ga0207697_10028263 | Ga0207697_100282632 | 315 |
| 632 | 3300025315 | Ga0207697_10051444 | Ga0207697_100514442 | 315 |
| 633 | 3300025900 | Ga0207710_10000673 | Ga0207710_100006735 | 315 |
| 634 | 3300025900 | Ga0207710_10102145 | Ga0207710_101021451 | 315 |
| 635 | 3300025901 | Ga0207688_10002217 | Ga0207688_100022174 | 315 |
| 636 | 3300025903 | Ga0207680_10036735 | Ga0207680_100367353 | 315 |
| 637 | 3300025905 | Ga0207685_10012593 | Ga0207685_100125931 | 315 |
| 638 | 3300025907 | Ga0207645_10002084 | Ga0207645_100020845 | 315 |
| 639 | 3300025907 | Ga0207645_10142380 | Ga0207645_101423802 | 315 |
| 640 | 3300025907 | Ga0207645_10155718 | Ga0207645_101557182 | 315 |
| 641 | 3300025908 | Ga0207643_10106547 | Ga0207643_101065472 | 315 |
| 642 | 3300025908 | Ga0207643_10179534 | Ga0207643_101795341 | 315 |
| 643 | 3300025911 | Ga0207654_10062096 | Ga0207654_100620962 | 315 |
| 644 | 3300025914 | Ga0207671_10053268 | Ga0207671_100532683 | 315 |
| 645 | 3300025918 | Ga0207662_10064031 | Ga0207662_100640311 | 315 |
| 646 | 3300025919 | Ga0207657_10105987 | Ga0207657_101059872 | 315 |
| 647 | 3300025920 | Ga0207649_10000567 | Ga0207649_1000056722 | 315 |
| 648 | 3300025920 | Ga0207649_10021250 | Ga0207649_100212501 | 315 |
| 649 | 3300025923 | Ga0207681_10010977 | Ga0207681_100109773 | 315 |
| 650 | 3300025923 | Ga0207681_10034340 | Ga0207681_100343401 | 315 |
| 651 | 3300025923 | Ga0207681_10034444 | Ga0207681_100344442 | 315 |
| 652 | 3300025923 | Ga0207681_10282478 | Ga0207681_102824782 | 315 |
| 653 | 3300025925 | Ga0207650_10001513 | Ga0207650_1000151314 | 315 |
| 654 | 3300025925 | Ga0207650_10061492 | Ga0207650_100614922 | 315 |
| 655 | 3300025925 | Ga0207650_10273390 | Ga0207650_102733902 | 315 |
| 656 | 3300025926 | Ga0207659_10032388 | Ga0207659_100323882 | 315 |
| 657 | 3300025931 | Ga0207644_10131582 | Ga0207644_101315822 | 315 |
| 658 | 3300025932 | Ga0207690_10003267 | Ga0207690_100032672 | 315 |
| 659 | 3300025933 | Ga0207706_10017700 | Ga0207706_100177004 | 315 |
| 660 | 3300025936 | Ga0207670_10039676 | Ga0207670_100396761 | 315 |
| 661 | 3300025938 | Ga0207704_10006232 | Ga0207704_100062322 | 315 |
| 662 | 3300025938 | Ga0207704_10009596 | Ga0207704_100095962 | 315 |
| 663 | 3300025938 | Ga0207704_10112509 | Ga0207704_101125092 | 315 |
| 664 | 3300025938 | Ga0207704_10194021 | Ga0207704_101940212 | 315 |
| 665 | 3300025942 | Ga0207689_10007268 | Ga0207689_100072683 | 315 |
| 666 | 3300025942 | Ga0207689_10008486 | Ga0207689_100084864 | 315 |
| 667 | 3300025942 | Ga0207689_10043750 | Ga0207689_100437501 | 315 |
| 668 | 3300025942 | Ga0207689_10058060 | Ga0207689_100580603 | 315 |
| 669 | 3300025942 | Ga0207689_10065028 | Ga0207689_100650282 | 315 |
| 670 | 3300025942 | Ga0207689_10201162 | Ga0207689_102011621 | 315 |
| 671 | 3300025944 | Ga0207661_10000411 | Ga0207661_100004116 | 315 |
| 672 | 3300025945 | Ga0207679_10000297 | Ga0207679_1000029712 | 315 |
| 673 | 3300025960 | Ga0207651_10009901 | Ga0207651_100099016 | 315 |
| 674 | 3300025960 | Ga0207651_10020151 | Ga0207651_100201515 | 315 |
| 675 | 3300025960 | Ga0207651_10098862 | Ga0207651_100988622 | 315 |
| 676 | 3300025960 | Ga0207651_10317908 | Ga0207651_103179082 | 315 |
| 677 | 3300025961 | Ga0207712_10001470 | Ga0207712_100014705 | 315 |
| 678 | 3300025961 | Ga0207712_10002610 | Ga0207712_100026103 | 315 |
| 679 | 3300025961 | Ga0207712_10017162 | Ga0207712_100171623 | 315 |
| 680 | 3300025961 | Ga0207712_10315442 | Ga0207712_103154421 | 315 |
| 681 | 3300025972 | Ga0207668_10130649 | Ga0207668_101306492 | 315 |
| 682 | 3300025972 | Ga0207668_10330547 | Ga0207668_103305472 | 315 |
| 683 | 3300025981 | Ga0207640_10035190 | Ga0207640_100351903 | 315 |
| 684 | 3300025981 | Ga0207640_10197708 | Ga0207640_101977082 | 315 |
| 685 | 3300026035 | Ga0207703_10222294 | Ga0207703_102222941 | 315 |
| 686 | 3300026035 | Ga0207703_10335913 | Ga0207703_103359132 | 315 |
| 687 | 3300026041 | Ga0207639_10001395 | Ga0207639_100013954 | 315 |
| 688 | 3300026041 | Ga0207639_10002886 | Ga0207639_100028868 | 315 |
| 689 | 3300026075 | Ga0207708_10231220 | Ga0207708_102312201 | 315 |
| 690 | 3300026078 | Ga0207702_10145534 | Ga0207702_101455342 | 315 |
| 691 | 3300026088 | Ga0207641_10128901 | Ga0207641_101289011 | 315 |
| 692 | 3300026089 | Ga0207648_10000384 | Ga0207648_1000038413 | 315 |
| 693 | 3300026089 | Ga0207648_10010983 | Ga0207648_100109836 | 315 |
| 694 | 3300026089 | Ga0207648_10057208 | Ga0207648_100572082 | 315 |
| 695 | 3300026089 | Ga0207648_10057945 | Ga0207648_100579453 | 315 |
| 696 | 3300026095 | Ga0207676_10012634 | Ga0207676_100126342 | 315 |
| 697 | 3300026095 | Ga0207676_10054242 | Ga0207676_100542421 | 315 |
| 698 | 3300026095 | Ga0207676_10084359 | Ga0207676_100843592 | 315 |
| 699 | 3300026095 | Ga0207676_10336798 | Ga0207676_103367982 | 315 |
| 700 | 3300026116 | Ga0207674_10012404 | Ga0207674_1001240410 | 315 |
| 701 | 3300026116 | Ga0207674_10090545 | Ga0207674_100905452 | 315 |
| 702 | 3300026116 | Ga0207674_10128342 | Ga0207674_101283421 | 315 |
| 703 | 3300026116 | Ga0207674_10208408 | Ga0207674_102084082 | 315 |
| 704 | 3300026116 | Ga0207674_10249965 | Ga0207674_102499651 | 315 |
| 705 | 3300026116 | Ga0207674_10460949 | Ga0207674_104609492 | 315 |
| 706 | 3300026118 | Ga0207675_100009007 | Ga0207675_1000090075 | 315 |
| 707 | 3300026118 | Ga0207675_100012296 | Ga0207675_1000122966 | 315 |
| 708 | 3300026118 | Ga0207675_100139269 | Ga0207675_1001392692 | 315 |
| 709 | 3300026121 | Ga0207683_10004211 | Ga0207683_100042113 | 315 |
| 710 | 3300026121 | Ga0207683_10007595 | Ga0207683_100075957 | 315 |
| 711 | 3300026142 | Ga0207698_10032497 | Ga0207698_100324971 | 315 |
| 712 | 3300028380 | Ga0268265_10073620 | Ga0268265_100736203 | 315 |
| 713 | 3300028380 | Ga0268265_10102517 | Ga0268265_101025173 | 315 |
| 714 | 3300028380 | Ga0268265_10292943 | Ga0268265_102929432 | 315 |
| 715 | 3300028381 | Ga0268264_10006760 | Ga0268264_100067603 | 315 |
| 716 | 3300028381 | Ga0268264_10028275 | Ga0268264_100282753 | 315 |
| 717 | 3300028381 | Ga0268264_10037291 | Ga0268264_100372912 | 315 |
| 718 | 3300028381 | Ga0268264_10086516 | Ga0268264_100865163 | 315 |
| 719 | 3300028381 | Ga0268264_10353553 | Ga0268264_103535531 | 315 |
| 720 | 3300028794 | Ga0307515_10000001 | Ga0307515_100000012846 | 315 |
| 721 | 3300028794 | Ga0307515_10104701 | Ga0307515_101047014 | 315 |
| 722 | 3300028800 | Ga0265338_10000651 | Ga0265338_1000065133 | 315 |
| 723 | 3300031251 | Ga0265327_10000024 | Ga0265327_1000002493 | 315 |
| 724 | 3300031251 | Ga0265327_10000611 | Ga0265327_1000061141 | 315 |
| 725 | 3300031456 | Ga0307513_10104373 | Ga0307513_101043733 | 315 |
| 726 | 3300031456 | Ga0307513_10279393 | Ga0307513_102793932 | 315 |
| 727 | 3300031548 | Ga0307408_100047911 | Ga0307408_1000479112 | 315 |
| 728 | 3300031731 | Ga0307405_10000010 | Ga0307405_1000001044 | 315 |
| 729 | 3300031731 | Ga0307405_10011620 | Ga0307405_100116202 | 315 |
| 730 | 3300031824 | Ga0307413_10084608 | Ga0307413_100846082 | 315 |
| 731 | 3300031852 | Ga0307410_10038701 | Ga0307410_100387011 | 315 |
| 732 | 3300031852 | Ga0307410_10047385 | Ga0307410_100473852 | 315 |
| 733 | 3300031903 | Ga0307407_10000042 | Ga0307407_1000004240 | 315 |
| 734 | 3300031903 | Ga0307407_10016140 | Ga0307407_100161402 | 315 |
| 735 | 3300031911 | Ga0307412_10007998 | Ga0307412_100079984 | 315 |
| 736 | 3300032002 | Ga0307416_100000019 | Ga0307416_10000001911 | 315 |
| 737 | 3300032002 | Ga0307416_100000227 | Ga0307416_1000002277 | 315 |
| 738 | 3300032004 | Ga0307414_10002825 | Ga0307414_100028255 | 315 |
| 739 | 3300032004 | Ga0307414_10032781 | Ga0307414_100327812 | 315 |
| 740 | 3300032004 | Ga0307414_10082052 | Ga0307414_100820522 | 315 |
| 741 | 3300032004 | Ga0307414_10122685 | Ga0307414_101226852 | 315 |
| 742 | 3300032005 | Ga0307411_10373447 | Ga0307411_103734471 | 315 |
| 743 | 3300032126 | Ga0307415_100001349 | Ga0307415_10000134913 | 315 |
| 744 | 3300037312 | Ga0395899_0176928 | Ga0395899_0176928_78_1079 | 315 |
| 745 | 3300037418 | Ga0395900_0156079 | Ga0395900_0156079_389_1357 | 315 |
| 746 | 3300037466 | Ga0395898_0059676 | Ga0395898_0059676_1170_2171 | 315 |
| 747 | 3300039437 | Ga0436365_1249677 | Ga0436365_1249677_4655_5617 | 315 |
| 748 | 3300041404 | Ga0439436_0002706 | Ga0439436_0002706_2894_3871 | 315 |
| 749 | 3300041410 | Ga0439461_0012376 | Ga0439461_0012376_207_1187 | 315 |
| 750 | 3300041452 | Ga0451793_1329962 | Ga0451793_1329962_37_1002 | 315 |
| 751 | 3300041463 | Ga0451804_1149675 | Ga0451804_1149675_173_1135 | 315 |
| 752 | 3300042007 | Ga0439449_0024418 | Ga0439449_0024418_1081_2058 | 315 |
| 753 | 3300042014 | Ga0439457_002111 | Ga0439457_002111_1003_1980 | 315 |
| 754 | 3300042015 | Ga0439462_0004635 | Ga0439462_0004635_750_1727 | 315 |
| 755 | 3300042125 | Ga0450923_000505 | Ga0450923_000505_907_1965 | 315 |
| 756 | 3300042876 | Ga0451577_0006113 | Ga0451577_0006113_746_1711 | 315 |
| 757 | 3300042876 | Ga0451577_0123920 | Ga0451577_0123920_269_1234 | 315 |
| 758 | 3300042876 | Ga0451577_0345943 | Ga0451577_0345943_347_1309 | 315 |
| 759 | 3300044656 | Ga0466969_0000127 | Ga0466969_0000127_17554_18531 | 315 |
| 760 | 3300044658 | Ga0466972_0000080 | Ga0466972_0000080_84309_85286 | 315 |
| 761 | 3300044673 | Ga0453683_0259989 | Ga0453683_0259989_42_1004 | 315 |
| 762 | 3300044684 | Ga0466966_0000120 | Ga0466966_0000120_21314_22291 | 315 |
| 763 | 3300044706 | Ga0466964_0041728 | Ga0466964_0041728_123_1100 | 315 |
| 764 | 3300044712 | Ga0453684_0108162 | Ga0453684_0108162_2262_3236 | 315 |
| 765 | 3300044712 | Ga0453684_0147752 | Ga0453684_0147752_1142_2107 | 315 |
| 766 | 3300044842 | Ga0466957_0000380 | Ga0466957_0000380_2220_3197 | 315 |
| 767 | 3300044842 | Ga0466957_0010728 | Ga0466957_0010728_4074_5051 | 315 |
| 768 | 3300045049 | Ga0466959_0000014 | Ga0466959_0000014_100700_101677 | 315 |
| 769 | 3300045051 | Ga0451576_0544710 | Ga0451576_0544710_235_1197 | 315 |
| 770 | 3300046453 | Ga0495627_044497 | Ga0495627_044497_100_1068 | 315 |
| 771 | 3300046460 | Ga0495638_0000040 | Ga0495638_0000040_156836_157804 | 315 |
| 772 | 3300046471 | Ga0495650_0031064 | Ga0495650_0031064_1238_2200 | 315 |
| 773 | 3300046512 | Ga0495610_0000035 | Ga0495610_0000035_108_1076 | 315 |
| 774 | 3300046512 | Ga0495610_0015914 | Ga0495610_0015914_3275_4243 | 315 |
| 775 | 3300046539 | Ga0495621_0036727 | Ga0495621_0036727_415_1404 | 315 |
| 776 | 3300046558 | Ga0495633_0133656 | Ga0495633_0133656_144_1112 | 315 |
| 777 | 3300047320 | Ga0495672_0010446 | Ga0495672_0010446_3339_4301 | 315 |
| 778 | 3300047320 | Ga0495672_0021009 | Ga0495672_0021009_595_1557 | 315 |
| 779 | 3300047472 | Ga0495686_0007643 | Ga0495686_0007643_5683_6645 | 315 |
| 780 | 3300047472 | Ga0495686_0056486 | Ga0495686_0056486_1425_2387 | 315 |
| 781 | 3300048909 | Ga0496106_0348409 | Ga0496106_0348409_176_1138 | 315 |
| 782 | 3300049568 | Ga0501031_0143800 | Ga0501031_0143800_537_1499 | 315 |
| 783 | 3300049571 | Ga0501034_0213240 | Ga0501034_0213240_292_1254 | 315 |
| 784 | 3300049571 | Ga0501034_0241907 | Ga0501034_0241907_537_1499 | 315 |
| 785 | 3300049572 | Ga0501036_0034595 | Ga0501036_0034595_1739_2701 | 315 |
| 786 | 3300049572 | Ga0501036_0124345 | Ga0501036_0124345_800_1762 | 315 |
| 787 | 3300049573 | Ga0501037_0031925 | Ga0501037_0031925_899_1861 | 315 |
| 788 | 3300049573 | Ga0501037_0033161 | Ga0501037_0033161_1091_2053 | 315 |
| 789 | 3300049574 | Ga0501038_0017313 | Ga0501038_0017313_4571_5533 | 315 |
| 790 | 3300049574 | Ga0501038_0030627 | Ga0501038_0030627_3151_4113 | 315 |
| 791 | 3300049579 | Ga0501043_0003893 | Ga0501043_0003893_3165_4127 | 315 |
| 792 | 3300049580 | Ga0501046_0089336 | Ga0501046_0089336_11_973 | 315 |
| 793 | 3300049581 | Ga0501047_0082793 | Ga0501047_0082793_1602_2579 | 315 |
| 794 | 3300049581 | Ga0501047_0348637 | Ga0501047_0348637_194_1171 | 315 |
| 795 | 3300049582 | Ga0501048_0006258 | Ga0501048_0006258_5161_6123 | 315 |
| 796 | 3300049583 | Ga0501067_0036099 | Ga0501067_0036099_1388_2350 | 315 |
| 797 | 3300049586 | Ga0501070_0078985 | Ga0501070_0078985_1672_2634 | 315 |
| 798 | 3300049586 | Ga0501070_0082958 | Ga0501070_0082958_1111_2073 | 315 |
| 799 | 3300049589 | Ga0501073_0006651 | Ga0501073_0006651_562_1524 | 315 |
| 800 | 3300049590 | Ga0501074_0002599 | Ga0501074_0002599_562_1524 | 315 |
| 801 | 3300049661 | Ga0501217_004764 | Ga0501217_004764_1584_2585 | 315 |
| 802 | 3300049675 | Ga0501243_007387 | Ga0501243_007387_407_1408 | 315 |
| 803 | 3300049705 | Ga0501225_0000505 | Ga0501225_0000505_3319_4296 | 315 |
| 804 | 3300049741 | Ga0501079_0049322 | Ga0501079_0049322_1784_2746 | 315 |
| 805 | 3300049742 | Ga0501080_0030856 | Ga0501080_0030856_562_1524 | 315 |
| 806 | 3300049744 | Ga0501083_0015427 | Ga0501083_0015427_2449_3411 | 315 |
| 807 | 3300049744 | Ga0501083_0205002 | Ga0501083_0205002_204_1166 | 315 |
| 808 | 3300049761 | Ga0501264_000116 | Ga0501264_000116_738_1739 | 315 |
| 809 | 3300049822 | Ga0501035_0002433 | Ga0501035_0002433_1786_2748 | 315 |
| 810 | 3300049823 | Ga0501044_0013650 | Ga0501044_0013650_7415_8392 | 315 |
| 811 | 3300049823 | Ga0501044_0016689 | Ga0501044_0016689_379_1341 | 315 |
| 812 | 3300049823 | Ga0501044_0021227 | Ga0501044_0021227_4443_5405 | 315 |
| 813 | 3300049823 | Ga0501044_0447847 | Ga0501044_0447847_100_1062 | 315 |
| 814 | 3300049823 | Ga0501044_0538019 | Ga0501044_0538019_72_1034 | 315 |
| 815 | 3300049824 | Ga0501045_0135871 | Ga0501045_0135871_214_1176 | 315 |
| 816 | 3300050493 | nmdc:mga0k408_54752_c1 | nmdc:mga0k408_54752_c1_1072_2034 | 315 |
| 817 | 3300050507 | nmdc:mga05p37_827_c1 | nmdc:mga05p37_827_c1_17003_17980 | 315 |
| 818 | 3300050508 | nmdc:mga09592_5573_c1 | nmdc:mga09592_5573_c1_2132_3094 | 315 |
| 819 | 3300050509 | nmdc:mga0qj67_115904_c1 | nmdc:mga0qj67_115904_c1_882_1895 | 315 |
| 820 | 3300050509 | nmdc:mga0qj67_154999_c1 | nmdc:mga0qj67_154999_c1_283_1245 | 315 |
| 821 | 3300050510 | nmdc:mga06r32_338867_c1 | nmdc:mga06r32_338867_c1_94_1107 | 315 |
| 822 | 3300050511 | nmdc:mga08y16_33793_c1 | nmdc:mga08y16_33793_c1_226_1239 | 315 |
| 823 | 3300050511 | nmdc:mga08y16_57703_c1 | nmdc:mga08y16_57703_c1_2980_3948 | 315 |
| 824 | 3300053086 | Ga0500578_0000836 | Ga0500578_0000836_28395_29372 | 315 |
| 825 | 3300053088 | Ga0500644_0002655 | Ga0500644_0002655_1992_2969 | 315 |
| 826 | 3300053092 | Ga0500583_0000001 | Ga0500583_0000001_91617_92594 | 315 |
| 827 | 3300053093 | Ga0500651_0079068 | Ga0500651_0079068_967_1935 | 315 |
| 828 | 3300053096 | Ga0500641_0004524 | Ga0500641_0004524_3212_4174 | 315 |
| 829 | 3300053104 | Ga0500556_0003125 | Ga0500556_0003125_615_1583 | 315 |
| 830 | 3300053139 | Ga0500568_0000142 | Ga0500568_0000142_19953_20915 | 315 |
| 831 | 3300053140 | Ga0500573_0093276 | Ga0500573_0093276_170_1147 | 315 |
| 832 | 3300053153 | Ga0500616_0008249 | Ga0500616_0008249_537_1502 | 315 |
| 833 | 3300053153 | Ga0500616_0015110 | Ga0500616_0015110_1858_2835 | 315 |
| 834 | 3300053727 | Ga0500611_000003 | Ga0500611_000003_110291_111253 | 315 |
| 835 | 3300054114 | Ga0501084_0041717 | Ga0501084_0041717_1070_2032 | 315 |
| 836 | iso_pu_bacteria | 2585427687 | 2586207416 | 315 |
| 837 | iso_pu_bacteria | 2738541278 | 2738725417 | 315 |
| 838 | iso_pu_bacteria | 2738541302 | 2738854007 | 315 |
| 839 | iso_pu_bacteria | 2739367651 | 2739588608 | 315 |
| 840 | iso_pu_bacteria | 2739367656 | 2739615898 | 315 |
| 841 | iso_pu_bacteria | 2739367663 | 2739644989 | 315 |
| 842 | iso_pu_bacteria | 2818991437 | 2819548142 | 315 |
| 843 | iso_pu_bacteria | 2842722452 | 2842723744 | 315 |
| 844 | iso_pu_bacteria | 2842909656 | 2842910250 | 315 |
| 845 | iso_pu_bacteria | 2849281842 | 2849284295 | 315 |
| 846 | iso_pu_bacteria | 2857627736 | 2857628930 | 315 |
| 847 | iso_pu_bacteria | 2904445276 | 2904445698 | 315 |
| 848 | iso_pu_bacteria | 2945997725 | 2946000604 | 315 |
| 849 | iso_pu_bacteria | 2954016120 | 2954017486 | 315 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2xhz-assembly1.cif.gz_B | probing the active site of the sugar isomerase domain from e. coli arabinose-5-phosphate isomerase via x-ray crystallography | 0.9778 | 2 | 170 |
| 5uqi-assembly1.cif.gz_A | e. coli cft073 c3406 in complex with a5p | 0.9532 | 6 | 182 |
| 3fxa-assembly1.cif.gz_D | crystal structure of a putative sugar-phosphate isomerase (lmof2365_0531) from listeria monocytogenes str. 4b f2365 at 1.60 a resolution | 0.9527 | 2 | 182 |
| 3etn-assembly1.cif.gz_C | crystal structure of putative phosphosugar isomerase involved in capsule formation (yp_209877.1) from bacteroides fragilis nctc 9343 at 1.70 a resolution | 0.95 | 8 | 181 |
| 2xhz-assembly1.cif.gz_B | probing the active site of the sugar isomerase domain from e. coli arabinose-5-phosphate isomerase via x-ray crystallography | 0.9448 | 2 | 170 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P45395_11_201_3.40.50.10490 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 | 0.9774 | 2 | 189 | 3.40.50.10490 |
| af_P45395_11_201_3.40.50.10490 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 | 0.9574 | 2 | 189 | 3.40.50.10490 |
| 5vhuA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 | 0.9538 | 6 | 182 | 3.40.50.10490 |
| af_I1N9R7_21_211_3.40.50.10490 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 | 0.9476 | 7 | 187 | 3.40.50.10490 |
| 3kpbA00 | Alpha Beta;Roll;CBS-domain;CBS-domain | 0.9379 | 193 | 311 | 3.10.580.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4V2AMI0-F1-model_v4 | SIS domain-containing protein | 0.9993 | 10 | 156 |
GO:0097367
GO:1901135 |
| AF-A0A7X7FZ27-F1-model_v4 | SIS domain-containing protein | 0.9879 | 2 | 182 |
GO:0097367
GO:1901135 |
| AF-A0A4V2AMI0-F1-model_v4 | SIS domain-containing protein | 0.9859 | 10 | 156 |
GO:0097367
GO:1901135 |
| AF-A0A7G3ELT6-F1-model_v4 | deleted | 0.9828 | 2 | 182 |
|
| AF-A0A5C9ADZ1-F1-model_v4 | KpsF/GutQ family sugar-phosphate isomerase | 0.9811 | 2 | 184 |
GO:0005975
GO:0016853 GO:0097367 GO:1901135 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar