F483386
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 849 | 308 | 849 | 438 |
Family's Representative Sequence
| Representative Sequence | 3300005328|Ga0070676_10001315|Ga0070676_100013153 |
| Length | 471 |
| Sequence | MVAEVKAKCHVPHGRRAIAATYNAGRQGIRISMKNSHQFYRARRAAVMKSMREHSGGGLALVPTAPEVPRNRDSFFPFRFDSYFYYLSGFPEPEAVVALVAGPEGDKHVLFCREKNAEREIWDGFRYGPDAAKEIFGFDEAHPISALPEKLPELASDRPALYTPLGLFDDWDKQVTQLLNDVRNRARAGVSAPDEIVDVRGSLDAMRLIKDDHELKLMREAASISSAAHRRAMNVTRPGWYEYQTEAELLHEFLRCGAQAVAYPSIVASGPNACVLHYRENDRQMADGDLLLIDAGCEFRGYASDITRTFPVNGKFTGPQKDIYELVLASQAACLDVVKPGTDFHAYHKAAERVLAQGYIDLKLCQGTLDEVLENGSFKQFYMHRAGHWLGMDVHDAGLYQVKGASQTLVPGMVLTVEPGTYIRPADNVPEHFWNIGVRIEDDVLVTTGGHENLTAAAPKSIADVEAACKR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 42 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 50 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 58 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 60 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 61 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 62 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 64 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 65 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 66 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 67 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 68 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 69 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 70 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 71 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 72 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 73 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 74 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 75 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 78 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 80 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 81 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 82 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 83 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 84 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 85 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 86 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 88 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 114 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 181 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 182 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 183 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 184 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 185 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 186 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 187 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 188 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 189 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 190 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 191 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 192 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 193 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 194 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 195 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 196 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 197 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 198 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 199 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 200 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 201 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 202 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 203 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 204 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 205 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 206 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 207 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 208 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 209 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 210 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 211 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 212 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 213 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 214 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 215 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 216 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 217 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 218 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 219 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 220 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 221 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 222 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 223 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 224 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 225 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 259 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 260 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 261 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 262 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 263 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 264 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 265 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 266 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 267 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 268 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 269 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 270 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 271 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 272 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 273 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 296 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 297 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 298 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 299 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 303 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.88 |
| Metatranscriptomes | 0.12 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.24 |
| Nodule | 0 |
| Rhizoplane | 3.42 |
| Rhizosphere | 96.23 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.12 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootL2_10002570 | 3300003322 | Bacteria | 12236 |
| 2 | Ga0070658_10002818 | 3300005327 | Bacteria | 14445 |
| 3 | Ga0070658_10065015 | 3300005327 | Bacteria | 2976 |
| 4 | Ga0070658_10091341 | 3300005327 | Bacteria | 2509 |
| 5 | Ga0070676_10000750 | 3300005328 | Bacteria | 15951 |
| 6 | Ga0070676_10001315 | 3300005328 | Bacteria | 12480 |
| 7 | Ga0070676_10004249 | 3300005328 | Bacteria | 7530 |
| 8 | Ga0070676_10070082 | 3300005328 | Bacteria | 2102 |
| 9 | Ga0070683_100022323 | 3300005329 | Bacteria | 5655 |
| 10 | Ga0070683_100028571 | 3300005329 | Bacteria | 5041 |
| 11 | Ga0070690_100001695 | 3300005330 | Bacteria | 11617 |
| 12 | Ga0070690_100097400 | 3300005330 | Bacteria | 1945 |
| 13 | Ga0070670_100001918 | 3300005331 | Bacteria | 17024 |
| 14 | Ga0070670_100025763 | 3300005331 | Bacteria | 5061 |
| 15 | Ga0070670_100027040 | 3300005331 | Bacteria | 4935 |
| 16 | Ga0070670_100028538 | 3300005331 | Bacteria | 4803 |
| 17 | Ga0070670_100036152 | 3300005331 | Bacteria | 4251 |
| 18 | Ga0070670_100036272 | 3300005331 | Bacteria | 4243 |
| 19 | Ga0070670_100036353 | 3300005331 | Bacteria | 4238 |
| 20 | Ga0070670_100071650 | 3300005331 | Bacteria | 2976 |
| 21 | Ga0070677_10000546 | 3300005333 | Bacteria | 12863 |
| 22 | Ga0068869_100000754 | 3300005334 | Bacteria | 18380 |
| 23 | Ga0068869_100003777 | 3300005334 | Bacteria | 9328 |
| 24 | Ga0068869_100016570 | 3300005334 | Bacteria | 4969 |
| 25 | Ga0068869_100022640 | 3300005334 | Bacteria | 4333 |
| 26 | Ga0068869_100143419 | 3300005334 | Bacteria | 1846 |
| 27 | Ga0070666_10001272 | 3300005335 | Bacteria | 15252 |
| 28 | Ga0070666_10002654 | 3300005335 | Bacteria | 10784 |
| 29 | Ga0070666_10061782 | 3300005335 | Bacteria | 2537 |
| 30 | Ga0070666_10067613 | 3300005335 | Bacteria | 2426 |
| 31 | Ga0070680_100130793 | 3300005336 | Bacteria | 2100 |
| 32 | Ga0070680_100171981 | 3300005336 | Bacteria | 1823 |
| 33 | Ga0070682_100022514 | 3300005337 | Bacteria | 3734 |
| 34 | Ga0070682_100029031 | 3300005337 | Bacteria | 3329 |
| 35 | Ga0068868_100000331 | 3300005338 | Bacteria | 31871 |
| 36 | Ga0068868_100020762 | 3300005338 | Bacteria | 4941 |
| 37 | Ga0068868_100022802 | 3300005338 | Bacteria | 4731 |
| 38 | Ga0068868_100024330 | 3300005338 | Bacteria | 4595 |
| 39 | Ga0068868_100028029 | 3300005338 | Bacteria | 4301 |
| 40 | Ga0068868_100081181 | 3300005338 | Bacteria | 2599 |
| 41 | Ga0068868_100136692 | 3300005338 | Bacteria | 2009 |
| 42 | Ga0070660_100006726 | 3300005339 | Bacteria | 7975 |
| 43 | Ga0070660_100059575 | 3300005339 | Bacteria | 2961 |
| 44 | Ga0070660_100081270 | 3300005339 | Bacteria | 2544 |
| 45 | Ga0070660_100115409 | 3300005339 | Bacteria | 2140 |
| 46 | Ga0070689_100013932 | 3300005340 | Bacteria | 5832 |
| 47 | Ga0070689_100068077 | 3300005340 | Bacteria | 2776 |
| 48 | Ga0070687_100009630 | 3300005343 | Bacteria | 4146 |
| 49 | Ga0070687_100021560 | 3300005343 | Bacteria | 3031 |
| 50 | Ga0070687_100080791 | 3300005343 | Bacteria | 1773 |
| 51 | Ga0070661_100001661 | 3300005344 | Bacteria | 15409 |
| 52 | Ga0070661_100005429 | 3300005344 | Bacteria | 8789 |
| 53 | Ga0070661_100008702 | 3300005344 | Bacteria | 7023 |
| 54 | Ga0070661_100010495 | 3300005344 | Bacteria | 6444 |
| 55 | Ga0070661_100025284 | 3300005344 | Bacteria | 4266 |
| 56 | Ga0070661_100087282 | 3300005344 | Bacteria | 2307 |
| 57 | Ga0070692_10047732 | 3300005345 | Bacteria | 2217 |
| 58 | Ga0070692_10090227 | 3300005345 | Bacteria | 1665 |
| 59 | Ga0070668_100001693 | 3300005347 | Bacteria | 15990 |
| 60 | Ga0070668_100018925 | 3300005347 | Bacteria | 5174 |
| 61 | Ga0070668_100027410 | 3300005347 | Bacteria | 4326 |
| 62 | Ga0070668_100030741 | 3300005347 | Bacteria | 4085 |
| 63 | Ga0070668_100037212 | 3300005347 | Bacteria | 3715 |
| 64 | Ga0070668_100158638 | 3300005347 | Bacteria | 1834 |
| 65 | Ga0070669_100004986 | 3300005353 | Bacteria | 9592 |
| 66 | Ga0070669_100075859 | 3300005353 | Bacteria | 2494 |
| 67 | Ga0070669_100109037 | 3300005353 | Bacteria | 2099 |
| 68 | Ga0070669_100111157 | 3300005353 | Bacteria | 2079 |
| 69 | Ga0070675_100001740 | 3300005354 | Bacteria | 16069 |
| 70 | Ga0070675_100002186 | 3300005354 | Bacteria | 14494 |
| 71 | Ga0070675_100003389 | 3300005354 | Bacteria | 12077 |
| 72 | Ga0070675_100018910 | 3300005354 | Bacteria | 5487 |
| 73 | Ga0070675_100023704 | 3300005354 | Bacteria | 4910 |
| 74 | Ga0070675_100033543 | 3300005354 | Bacteria | 4163 |
| 75 | Ga0070675_100165825 | 3300005354 | Bacteria | 1902 |
| 76 | Ga0070675_100261446 | 3300005354 | Bacteria | 1517 |
| 77 | Ga0070671_100000599 | 3300005355 | Bacteria | 25802 |
| 78 | Ga0070671_100004955 | 3300005355 | Bacteria | 10598 |
| 79 | Ga0070671_100006548 | 3300005355 | Bacteria | 9310 |
| 80 | Ga0070671_100013316 | 3300005355 | Bacteria | 6629 |
| 81 | Ga0070671_100026054 | 3300005355 | Bacteria | 4803 |
| 82 | Ga0070671_100042738 | 3300005355 | Bacteria | 3767 |
| 83 | Ga0070671_100061778 | 3300005355 | Bacteria | 3120 |
| 84 | Ga0070671_100137220 | 3300005355 | Bacteria | 2062 |
| 85 | Ga0070674_100000298 | 3300005356 | Bacteria | 24378 |
| 86 | Ga0070674_100018018 | 3300005356 | Bacteria | 4455 |
| 87 | Ga0070674_100020622 | 3300005356 | Bacteria | 4216 |
| 88 | Ga0070674_100026335 | 3300005356 | Bacteria | 3797 |
| 89 | Ga0070674_100038752 | 3300005356 | Bacteria | 3214 |
| 90 | Ga0070673_100000267 | 3300005364 | Bacteria | 26687 |
| 91 | Ga0070673_100008988 | 3300005364 | Bacteria | 6684 |
| 92 | Ga0070673_100018356 | 3300005364 | Bacteria | 4994 |
| 93 | Ga0070673_100052411 | 3300005364 | Bacteria | 3201 |
| 94 | Ga0070673_100089880 | 3300005364 | Bacteria | 2508 |
| 95 | Ga0070673_100129222 | 3300005364 | Bacteria | 2117 |
| 96 | Ga0070673_100217709 | 3300005364 | Bacteria | 1651 |
| 97 | Ga0070688_100015042 | 3300005365 | Bacteria | 4393 |
| 98 | Ga0070688_100024961 | 3300005365 | Bacteria | 3533 |
| 99 | Ga0070688_100037786 | 3300005365 | Bacteria | 2944 |
| 100 | Ga0070688_100065905 | 3300005365 | Bacteria | 2303 |
| 101 | Ga0070659_100009388 | 3300005366 | Bacteria | 7185 |
| 102 | Ga0070659_100065208 | 3300005366 | Bacteria | 2884 |
| 103 | Ga0070659_100072790 | 3300005366 | Bacteria | 2735 |
| 104 | Ga0070667_100007230 | 3300005367 | Bacteria | 9223 |
| 105 | Ga0070667_100010293 | 3300005367 | Bacteria | 7727 |
| 106 | Ga0070667_100031905 | 3300005367 | Bacteria | 4392 |
| 107 | Ga0070667_100075791 | 3300005367 | Bacteria | 2872 |
| 108 | Ga0070667_100137359 | 3300005367 | Bacteria | 2138 |
| 109 | Ga0070709_10002723 | 3300005434 | Bacteria | 9551 |
| 110 | Ga0070709_10079172 | 3300005434 | Bacteria | 2140 |
| 111 | Ga0070714_100000181 | 3300005435 | Bacteria | 50158 |
| 112 | Ga0070713_100008842 | 3300005436 | Bacteria | 7170 |
| 113 | Ga0070713_100020637 | 3300005436 | Bacteria | 5054 |
| 114 | Ga0070713_100031689 | 3300005436 | Bacteria | 4214 |
| 115 | Ga0070710_10024716 | 3300005437 | Bacteria | 3173 |
| 116 | Ga0070701_10000879 | 3300005438 | Bacteria | 10809 |
| 117 | Ga0070711_100045623 | 3300005439 | Bacteria | 2983 |
| 118 | Ga0070711_100049911 | 3300005439 | Bacteria | 2867 |
| 119 | Ga0070705_100010619 | 3300005440 | Bacteria | 4616 |
| 120 | Ga0070705_100023482 | 3300005440 | Bacteria | 3312 |
| 121 | Ga0070700_100000172 | 3300005441 | Bacteria | 36746 |
| 122 | Ga0070700_100014588 | 3300005441 | Bacteria | 4438 |
| 123 | Ga0070700_100101104 | 3300005441 | Bacteria | 1900 |
| 124 | Ga0070694_100029412 | 3300005444 | Bacteria | 3585 |
| 125 | Ga0070708_100002049 | 3300005445 | Bacteria | 15531 |
| 126 | Ga0070708_100017991 | 3300005445 | Bacteria | 5909 |
| 127 | Ga0070663_100013073 | 3300005455 | Bacteria | 5275 |
| 128 | Ga0070663_100016349 | 3300005455 | Bacteria | 4816 |
| 129 | Ga0070678_100000237 | 3300005456 | Bacteria | 25212 |
| 130 | Ga0070678_100000798 | 3300005456 | Bacteria | 15850 |
| 131 | Ga0070678_100003408 | 3300005456 | Bacteria | 8865 |
| 132 | Ga0070678_100004668 | 3300005456 | Bacteria | 7796 |
| 133 | Ga0070678_100026396 | 3300005456 | Bacteria | 3926 |
| 134 | Ga0070678_100098283 | 3300005456 | Bacteria | 2263 |
| 135 | Ga0070662_100000408 | 3300005457 | Bacteria | 25491 |
| 136 | Ga0070662_100024047 | 3300005457 | Bacteria | 4193 |
| 137 | Ga0070662_100063254 | 3300005457 | Bacteria | 2706 |
| 138 | Ga0070681_10008661 | 3300005458 | Bacteria | 9978 |
| 139 | Ga0070681_10048491 | 3300005458 | Bacteria | 4244 |
| 140 | Ga0068867_100005477 | 3300005459 | Bacteria | 8982 |
| 141 | Ga0068867_100007370 | 3300005459 | Bacteria | 7782 |
| 142 | Ga0068867_100023773 | 3300005459 | Bacteria | 4389 |
| 143 | Ga0068867_100029903 | 3300005459 | Bacteria | 3927 |
| 144 | Ga0068867_100092481 | 3300005459 | Bacteria | 2297 |
| 145 | Ga0068867_100105628 | 3300005459 | Bacteria | 2156 |
| 146 | Ga0070706_100043759 | 3300005467 | Bacteria | 4136 |
| 147 | Ga0070707_100024556 | 3300005468 | Bacteria | 5709 |
| 148 | Ga0070698_100156980 | 3300005471 | Bacteria | 2221 |
| 149 | Ga0070699_100006309 | 3300005518 | Bacteria | 10342 |
| 150 | Ga0070699_100013133 | 3300005518 | Bacteria | 7140 |
| 151 | Ga0070679_100016424 | 3300005530 | Bacteria | 7138 |
| 152 | Ga0070679_100071283 | 3300005530 | Bacteria | 3466 |
| 153 | Ga0070684_100030046 | 3300005535 | Bacteria | 4613 |
| 154 | Ga0070697_100128907 | 3300005536 | Bacteria | 2120 |
| 155 | Ga0068853_100003197 | 3300005539 | Bacteria | 12512 |
| 156 | Ga0068853_100008754 | 3300005539 | Bacteria | 8141 |
| 157 | Ga0068853_100017674 | 3300005539 | Bacteria | 5885 |
| 158 | Ga0068853_100030893 | 3300005539 | Bacteria | 4527 |
| 159 | Ga0068853_100333599 | 3300005539 | Bacteria | 1408 |
| 160 | Ga0070672_100000300 | 3300005543 | Bacteria | 28072 |
| 161 | Ga0070672_100001410 | 3300005543 | Bacteria | 14847 |
| 162 | Ga0070672_100003340 | 3300005543 | Bacteria | 10399 |
| 163 | Ga0070672_100009746 | 3300005543 | Bacteria | 6633 |
| 164 | Ga0070672_100061679 | 3300005543 | Bacteria | 2957 |
| 165 | Ga0070672_100154487 | 3300005543 | Bacteria | 1900 |
| 166 | Ga0070686_100000603 | 3300005544 | Bacteria | 21221 |
| 167 | Ga0070686_100008401 | 3300005544 | Bacteria | 5779 |
| 168 | Ga0070686_100026482 | 3300005544 | Bacteria | 3500 |
| 169 | Ga0070695_100024345 | 3300005545 | Bacteria | 3728 |
| 170 | Ga0070696_100012935 | 3300005546 | Bacteria | 5605 |
| 171 | Ga0070696_100018153 | 3300005546 | Bacteria | 4752 |
| 172 | Ga0070696_100037807 | 3300005546 | Bacteria | 3329 |
| 173 | Ga0070693_100006079 | 3300005547 | Bacteria | 5848 |
| 174 | Ga0070665_100001882 | 3300005548 | Bacteria | 23780 |
| 175 | Ga0070665_100007215 | 3300005548 | Bacteria | 11295 |
| 176 | Ga0070665_100020892 | 3300005548 | Bacteria | 6579 |
| 177 | Ga0070665_100029715 | 3300005548 | Bacteria | 5499 |
| 178 | Ga0070665_100051903 | 3300005548 | Bacteria | 4112 |
| 179 | Ga0070704_100004254 | 3300005549 | Bacteria | 8273 |
| 180 | Ga0068855_100000446 | 3300005563 | Bacteria | 51081 |
| 181 | Ga0068855_100012930 | 3300005563 | Bacteria | 10071 |
| 182 | Ga0068855_100033254 | 3300005563 | Bacteria | 6156 |
| 183 | Ga0068855_100060258 | 3300005563 | Bacteria | 4439 |
| 184 | Ga0068855_100062422 | 3300005563 | Bacteria | 4350 |
| 185 | Ga0068855_100066882 | 3300005563 | Bacteria | 4189 |
| 186 | Ga0068855_100148008 | 3300005563 | Bacteria | 2672 |
| 187 | Ga0070664_100001654 | 3300005564 | Bacteria | 17817 |
| 188 | Ga0070664_100007848 | 3300005564 | Bacteria | 8620 |
| 189 | Ga0070664_100016574 | 3300005564 | Bacteria | 6043 |
| 190 | Ga0070664_100028590 | 3300005564 | Bacteria | 4639 |
| 191 | Ga0070664_100028764 | 3300005564 | Bacteria | 4627 |
| 192 | Ga0070664_100147225 | 3300005564 | Bacteria | 2077 |
| 193 | Ga0070664_100225025 | 3300005564 | Bacteria | 1679 |
| 194 | Ga0068857_100004996 | 3300005577 | Bacteria | 11268 |
| 195 | Ga0068857_100010303 | 3300005577 | Bacteria | 8120 |
| 196 | Ga0068854_100014448 | 3300005578 | Bacteria | 5206 |
| 197 | Ga0068854_100050570 | 3300005578 | Bacteria | 2974 |
| 198 | Ga0068856_100000418 | 3300005614 | Bacteria | 46813 |
| 199 | Ga0068856_100002692 | 3300005614 | Bacteria | 18215 |
| 200 | Ga0068856_100043154 | 3300005614 | Bacteria | 4437 |
| 201 | Ga0068856_100099304 | 3300005614 | Bacteria | 2902 |
| 202 | Ga0068856_100108587 | 3300005614 | Bacteria | 2771 |
| 203 | Ga0068856_100138573 | 3300005614 | Bacteria | 2439 |
| 204 | Ga0070702_100000059 | 3300005615 | Bacteria | 31794 |
| 205 | Ga0070702_100016722 | 3300005615 | Bacteria | 3770 |
| 206 | Ga0070702_100025182 | 3300005615 | Bacteria | 3185 |
| 207 | Ga0068852_100003068 | 3300005616 | Bacteria | 11625 |
| 208 | Ga0068852_100011110 | 3300005616 | Bacteria | 6762 |
| 209 | Ga0068859_100009665 | 3300005617 | Bacteria | 9737 |
| 210 | Ga0068859_100013680 | 3300005617 | Bacteria | 8133 |
| 211 | Ga0068859_100095565 | 3300005617 | Bacteria | 3024 |
| 212 | Ga0068859_100227830 | 3300005617 | Bacteria | 1952 |
| 213 | Ga0068864_100001133 | 3300005618 | Bacteria | 22296 |
| 214 | Ga0068864_100001473 | 3300005618 | Bacteria | 19425 |
| 215 | Ga0068864_100006741 | 3300005618 | Bacteria | 9406 |
| 216 | Ga0068864_100006751 | 3300005618 | Bacteria | 9401 |
| 217 | Ga0068864_100021353 | 3300005618 | Bacteria | 5424 |
| 218 | Ga0068864_100079912 | 3300005618 | Bacteria | 2864 |
| 219 | Ga0068864_100088765 | 3300005618 | Bacteria | 2723 |
| 220 | Ga0068866_10002710 | 3300005718 | Bacteria | 7308 |
| 221 | Ga0068866_10028293 | 3300005718 | Bacteria | 2669 |
| 222 | Ga0068861_100000637 | 3300005719 | Bacteria | 20800 |
| 223 | Ga0068861_100009329 | 3300005719 | Bacteria | 6773 |
| 224 | Ga0068861_100013882 | 3300005719 | Bacteria | 5645 |
| 225 | Ga0068861_100103362 | 3300005719 | Bacteria | 2270 |
| 226 | Ga0068851_10000220 | 3300005834 | Bacteria | 27525 |
| 227 | Ga0068851_10004519 | 3300005834 | Bacteria | 6276 |
| 228 | Ga0068851_10029005 | 3300005834 | Bacteria | 2737 |
| 229 | Ga0068851_10056785 | 3300005834 | Bacteria | 1997 |
| 230 | Ga0068870_10002168 | 3300005840 | Bacteria | 8129 |
| 231 | Ga0068870_10002355 | 3300005840 | Bacteria | 7862 |
| 232 | Ga0068870_10006416 | 3300005840 | Bacteria | 5184 |
| 233 | Ga0068863_100000926 | 3300005841 | Bacteria | 29444 |
| 234 | Ga0068863_100002580 | 3300005841 | Bacteria | 17962 |
| 235 | Ga0068863_100011123 | 3300005841 | Bacteria | 8725 |
| 236 | Ga0068863_100015831 | 3300005841 | Bacteria | 7235 |
| 237 | Ga0068863_100038818 | 3300005841 | Bacteria | 4530 |
| 238 | Ga0068863_100208846 | 3300005841 | Bacteria | 1880 |
| 239 | Ga0068858_100001249 | 3300005842 | Bacteria | 26288 |
| 240 | Ga0068858_100003386 | 3300005842 | Bacteria | 15868 |
| 241 | Ga0068858_100011276 | 3300005842 | Bacteria | 8446 |
| 242 | Ga0068858_100013794 | 3300005842 | Bacteria | 7628 |
| 243 | Ga0068858_100015673 | 3300005842 | Bacteria | 7130 |
| 244 | Ga0068858_100027866 | 3300005842 | Bacteria | 5249 |
| 245 | Ga0068858_100027946 | 3300005842 | Bacteria | 5241 |
| 246 | Ga0068858_100123481 | 3300005842 | Bacteria | 2423 |
| 247 | Ga0068858_100145844 | 3300005842 | Bacteria | 2223 |
| 248 | Ga0068860_100001199 | 3300005843 | Bacteria | 28279 |
| 249 | Ga0068860_100004796 | 3300005843 | Bacteria | 13774 |
| 250 | Ga0068860_100009785 | 3300005843 | Bacteria | 9517 |
| 251 | Ga0068860_100030080 | 3300005843 | Bacteria | 5223 |
| 252 | Ga0068860_100048280 | 3300005843 | Bacteria | 4057 |
| 253 | Ga0068860_100091463 | 3300005843 | Bacteria | 2899 |
| 254 | Ga0068860_100104794 | 3300005843 | Bacteria | 2700 |
| 255 | Ga0068860_100166833 | 3300005843 | Bacteria | 2126 |
| 256 | Ga0068860_100263635 | 3300005843 | Bacteria | 1680 |
| 257 | Ga0068862_100003428 | 3300005844 | Bacteria | 13646 |
| 258 | Ga0068862_100007062 | 3300005844 | Bacteria | 9325 |
| 259 | Ga0068862_100012664 | 3300005844 | Bacteria | 6980 |
| 260 | Ga0068862_100025506 | 3300005844 | Bacteria | 4963 |
| 261 | Ga0068862_100052797 | 3300005844 | Bacteria | 3479 |
| 262 | Ga0068862_100133146 | 3300005844 | Bacteria | 2201 |
| 263 | Ga0068862_100256340 | 3300005844 | Bacteria | 1595 |
| 264 | Ga0081539_10008389 | 3300005985 | Bacteria | 9015 |
| 265 | Ga0070716_100001986 | 3300006173 | Bacteria | 9318 |
| 266 | Ga0070716_100014590 | 3300006173 | Bacteria | 4027 |
| 267 | Ga0070712_100000349 | 3300006175 | Bacteria | 26136 |
| 268 | Ga0075366_10000310 | 3300006195 | Bacteria | 22074 |
| 269 | Ga0097621_100001144 | 3300006237 | Bacteria | 18429 |
| 270 | Ga0097621_100012504 | 3300006237 | Bacteria | 6296 |
| 271 | Ga0097621_100019011 | 3300006237 | Bacteria | 5265 |
| 272 | Ga0097621_100019887 | 3300006237 | Bacteria | 5164 |
| 273 | Ga0097621_100106286 | 3300006237 | Bacteria | 2367 |
| 274 | Ga0068871_100001061 | 3300006358 | Bacteria | 18428 |
| 275 | Ga0068871_100010412 | 3300006358 | Bacteria | 6785 |
| 276 | Ga0068871_100010933 | 3300006358 | Bacteria | 6648 |
| 277 | Ga0068871_100020334 | 3300006358 | Bacteria | 5084 |
| 278 | Ga0068871_100060833 | 3300006358 | Bacteria | 3082 |
| 279 | Ga0068871_100075336 | 3300006358 | Bacteria | 2785 |
| 280 | Ga0068871_100077274 | 3300006358 | Bacteria | 2751 |
| 281 | Ga0075430_100009206 | 3300006846 | Bacteria | 8346 |
| 282 | Ga0075431_100000324 | 3300006847 | Bacteria | 37752 |
| 283 | Ga0075434_100175498 | 3300006871 | Bacteria | 2163 |
| 284 | Ga0075429_100040723 | 3300006880 | Bacteria | 4045 |
| 285 | Ga0068865_100000303 | 3300006881 | Bacteria | 27172 |
| 286 | Ga0068865_100016281 | 3300006881 | Bacteria | 4755 |
| 287 | Ga0068865_100040902 | 3300006881 | Bacteria | 3152 |
| 288 | Ga0068865_100043549 | 3300006881 | Bacteria | 3068 |
| 289 | Ga0075436_100003228 | 3300006914 | Bacteria | 11183 |
| 290 | Ga0097620_100009664 | 3300006931 | Bacteria | 9737 |
| 291 | Ga0097620_100013680 | 3300006931 | Bacteria | 8133 |
| 292 | Ga0097620_100095571 | 3300006931 | Bacteria | 3024 |
| 293 | Ga0097620_100227815 | 3300006931 | Bacteria | 1952 |
| 294 | Ga0099794_10009164 | 3300007265 | Bacteria | 4144 |
| 295 | Ga0105240_10016077 | 3300009093 | Bacteria | 10139 |
| 296 | Ga0105240_10019253 | 3300009093 | Bacteria | 9123 |
| 297 | Ga0105240_10020409 | 3300009093 | Bacteria | 8839 |
| 298 | Ga0105240_10028424 | 3300009093 | Bacteria | 7305 |
| 299 | Ga0105240_10118753 | 3300009093 | Bacteria | 3186 |
| 300 | Ga0105245_10000063 | 3300009098 | Bacteria | 113377 |
| 301 | Ga0105245_10023418 | 3300009098 | Bacteria | 5421 |
| 302 | Ga0105243_10000358 | 3300009148 | Bacteria | 48817 |
| 303 | Ga0105243_10036829 | 3300009148 | Bacteria | 3800 |
| 304 | Ga0105241_10005388 | 3300009174 | Bacteria | 9459 |
| 305 | Ga0105241_10059368 | 3300009174 | Bacteria | 2941 |
| 306 | Ga0105241_10154834 | 3300009174 | Bacteria | 1878 |
| 307 | Ga0105242_10001369 | 3300009176 | Bacteria | 19239 |
| 308 | Ga0105242_10184139 | 3300009176 | Bacteria | 1844 |
| 309 | Ga0105248_10002137 | 3300009177 | Bacteria | 21876 |
| 310 | Ga0105248_10002406 | 3300009177 | Bacteria | 20779 |
| 311 | Ga0105248_10002576 | 3300009177 | Bacteria | 20139 |
| 312 | Ga0105248_10087383 | 3300009177 | Bacteria | 3509 |
| 313 | Ga0105248_10111641 | 3300009177 | Bacteria | 3083 |
| 314 | Ga0105248_10199327 | 3300009177 | Bacteria | 2255 |
| 315 | Ga0105237_10050564 | 3300009545 | Bacteria | 4176 |
| 316 | Ga0105237_10095561 | 3300009545 | Bacteria | 2961 |
| 317 | Ga0105238_10001151 | 3300009551 | Bacteria | 26718 |
| 318 | Ga0105238_10016621 | 3300009551 | Bacteria | 7452 |
| 319 | Ga0105238_10286457 | 3300009551 | Bacteria | 1629 |
| 320 | Ga0105249_10034951 | 3300009553 | Bacteria | 4556 |
| 321 | Ga0105249_10081638 | 3300009553 | Bacteria | 3006 |
| 322 | Ga0105249_10104951 | 3300009553 | Bacteria | 2663 |
| 323 | Ga0105249_10122279 | 3300009553 | Bacteria | 2475 |
| 324 | Ga0105249_10131918 | 3300009553 | Bacteria | 2386 |
| 325 | Ga0105246_10036410 | 3300011119 | Bacteria | 3296 |
| 326 | Ga0105246_10047683 | 3300011119 | Bacteria | 2927 |
| 327 | Ga0157373_10002367 | 3300013100 | Bacteria | 14315 |
| 328 | Ga0157373_10007388 | 3300013100 | Bacteria | 8176 |
| 329 | Ga0157373_10027061 | 3300013100 | Bacteria | 4138 |
| 330 | Ga0157373_10103618 | 3300013100 | Bacteria | 2001 |
| 331 | Ga0157371_10000303 | 3300013102 | Bacteria | 64643 |
| 332 | Ga0157371_10026330 | 3300013102 | Bacteria | 4229 |
| 333 | Ga0157370_10005226 | 3300013104 | Bacteria | 14617 |
| 334 | Ga0157370_10009339 | 3300013104 | Bacteria | 10495 |
| 335 | Ga0157370_10017164 | 3300013104 | Bacteria | 7307 |
| 336 | Ga0157370_10026960 | 3300013104 | Bacteria | 5667 |
| 337 | Ga0157370_10029442 | 3300013104 | Bacteria | 5388 |
| 338 | Ga0157370_10064548 | 3300013104 | Bacteria | 3467 |
| 339 | Ga0157370_10121566 | 3300013104 | Bacteria | 2438 |
| 340 | Ga0157369_10004421 | 3300013105 | Bacteria | 16592 |
| 341 | Ga0157369_10008265 | 3300013105 | Bacteria | 11932 |
| 342 | Ga0157369_10070675 | 3300013105 | Bacteria | 3749 |
| 343 | Ga0157369_10096169 | 3300013105 | Bacteria | 3160 |
| 344 | Ga0157369_10137920 | 3300013105 | Bacteria | 2582 |
| 345 | Ga0157374_10001563 | 3300013296 | Bacteria | 19265 |
| 346 | Ga0157374_10006165 | 3300013296 | Bacteria | 10161 |
| 347 | Ga0157374_10017795 | 3300013296 | Bacteria | 6260 |
| 348 | Ga0157374_10285258 | 3300013296 | Bacteria | 1631 |
| 349 | Ga0157378_10000193 | 3300013297 | Bacteria | 58970 |
| 350 | Ga0157378_10017022 | 3300013297 | Bacteria | 6372 |
| 351 | Ga0157378_10026204 | 3300013297 | Bacteria | 5139 |
| 352 | Ga0157378_10034161 | 3300013297 | Bacteria | 4498 |
| 353 | Ga0157378_10154106 | 3300013297 | Bacteria | 2143 |
| 354 | Ga0163162_10005453 | 3300013306 | Bacteria | 12288 |
| 355 | Ga0163162_10027395 | 3300013306 | Bacteria | 5635 |
| 356 | Ga0163162_10027992 | 3300013306 | Bacteria | 5575 |
| 357 | Ga0163162_10084689 | 3300013306 | Bacteria | 3246 |
| 358 | Ga0163162_10192072 | 3300013306 | Bacteria | 2170 |
| 359 | Ga0157372_10000697 | 3300013307 | Bacteria | 36905 |
| 360 | Ga0157372_10007476 | 3300013307 | Bacteria | 11619 |
| 361 | Ga0157372_10013266 | 3300013307 | Bacteria | 8795 |
| 362 | Ga0157372_10046020 | 3300013307 | Bacteria | 4842 |
| 363 | Ga0157372_10074469 | 3300013307 | Bacteria | 3828 |
| 364 | Ga0157372_10086192 | 3300013307 | Bacteria | 3563 |
| 365 | Ga0157372_10235506 | 3300013307 | Bacteria | 2123 |
| 366 | Ga0157375_10001643 | 3300013308 | Bacteria | 19224 |
| 367 | Ga0157375_10003068 | 3300013308 | Bacteria | 14496 |
| 368 | Ga0157375_10045571 | 3300013308 | Bacteria | 4269 |
| 369 | Ga0157375_10067589 | 3300013308 | Bacteria | 3572 |
| 370 | Ga0157375_10249925 | 3300013308 | Bacteria | 1934 |
| 371 | Ga0163163_10005701 | 3300014325 | Bacteria | 10798 |
| 372 | Ga0163163_10010919 | 3300014325 | Bacteria | 8203 |
| 373 | Ga0163163_10031133 | 3300014325 | Bacteria | 5147 |
| 374 | Ga0163163_10139510 | 3300014325 | Bacteria | 2466 |
| 375 | Ga0157380_10000537 | 3300014326 | Bacteria | 23313 |
| 376 | Ga0157380_10062492 | 3300014326 | Bacteria | 2983 |
| 377 | Ga0157380_10114274 | 3300014326 | Bacteria | 2275 |
| 378 | Ga0157380_10116030 | 3300014326 | Bacteria | 2259 |
| 379 | Ga0157377_10015363 | 3300014745 | Bacteria | 3915 |
| 380 | Ga0157377_10028035 | 3300014745 | Bacteria | 3028 |
| 381 | Ga0157379_10002346 | 3300014968 | Bacteria | 15798 |
| 382 | Ga0157379_10007068 | 3300014968 | Bacteria | 9702 |
| 383 | Ga0157379_10011575 | 3300014968 | Bacteria | 7702 |
| 384 | Ga0157379_10044720 | 3300014968 | Bacteria | 3953 |
| 385 | Ga0157379_10147406 | 3300014968 | Bacteria | 2122 |
| 386 | Ga0157379_10159207 | 3300014968 | Bacteria | 2038 |
| 387 | Ga0157379_10179313 | 3300014968 | Bacteria | 1914 |
| 388 | Ga0157376_10009076 | 3300014969 | Bacteria | 7203 |
| 389 | Ga0157376_10013612 | 3300014969 | Bacteria | 6076 |
| 390 | Ga0157376_10028202 | 3300014969 | Bacteria | 4460 |
| 391 | Ga0157376_10077975 | 3300014969 | Bacteria | 2835 |
| 392 | Ga0163161_10012835 | 3300017792 | Bacteria | 5820 |
| 393 | Ga0163161_10019362 | 3300017792 | Bacteria | 4775 |
| 394 | Ga0163161_10048737 | 3300017792 | Bacteria | 3060 |
| 395 | Ga0206353_10212916 | 3300020082 | Bacteria | 4903 |
| 396 | Ga0207673_1006063 | 3300025290 | Bacteria | 1489 |
| 397 | Ga0207697_10000773 | 3300025315 | Bacteria | 18139 |
| 398 | Ga0207697_10002747 | 3300025315 | Bacteria | 8976 |
| 399 | Ga0207697_10031146 | 3300025315 | Bacteria | 2182 |
| 400 | Ga0207697_10062282 | 3300025315 | Bacteria | 1553 |
| 401 | Ga0207656_10006828 | 3300025321 | Bacteria | 4128 |
| 402 | Ga0207656_10026039 | 3300025321 | Bacteria | 2380 |
| 403 | Ga0207682_10000450 | 3300025893 | Bacteria | 18905 |
| 404 | Ga0207682_10004174 | 3300025893 | Bacteria | 6109 |
| 405 | Ga0207642_10001671 | 3300025899 | Bacteria | 6851 |
| 406 | Ga0207642_10026484 | 3300025899 | Bacteria | 2361 |
| 407 | Ga0207642_10031977 | 3300025899 | Bacteria | 2211 |
| 408 | Ga0207688_10000624 | 3300025901 | Bacteria | 17405 |
| 409 | Ga0207688_10006888 | 3300025901 | Bacteria | 6184 |
| 410 | Ga0207688_10013405 | 3300025901 | Bacteria | 4454 |
| 411 | Ga0207680_10010559 | 3300025903 | Bacteria | 4624 |
| 412 | Ga0207680_10012191 | 3300025903 | Bacteria | 4372 |
| 413 | Ga0207680_10048809 | 3300025903 | Bacteria | 2516 |
| 414 | Ga0207645_10000241 | 3300025907 | Bacteria | 45331 |
| 415 | Ga0207645_10000607 | 3300025907 | Bacteria | 29680 |
| 416 | Ga0207645_10004261 | 3300025907 | Bacteria | 10618 |
| 417 | Ga0207645_10004739 | 3300025907 | Bacteria | 10010 |
| 418 | Ga0207645_10019084 | 3300025907 | Bacteria | 4502 |
| 419 | Ga0207645_10064542 | 3300025907 | Bacteria | 2340 |
| 420 | Ga0207645_10136745 | 3300025907 | Bacteria | 1596 |
| 421 | Ga0207643_10001508 | 3300025908 | Bacteria | 13311 |
| 422 | Ga0207643_10001509 | 3300025908 | Bacteria | 13308 |
| 423 | Ga0207643_10002271 | 3300025908 | Bacteria | 10467 |
| 424 | Ga0207643_10005613 | 3300025908 | Bacteria | 6705 |
| 425 | Ga0207643_10012665 | 3300025908 | Bacteria | 4556 |
| 426 | Ga0207705_10028758 | 3300025909 | Bacteria | 3961 |
| 427 | Ga0207705_10204508 | 3300025909 | Bacteria | 1496 |
| 428 | Ga0207654_10020290 | 3300025911 | Bacteria | 3521 |
| 429 | Ga0207654_10028871 | 3300025911 | Bacteria | 3029 |
| 430 | Ga0207707_10063509 | 3300025912 | Bacteria | 3214 |
| 431 | Ga0207707_10083836 | 3300025912 | Bacteria | 2783 |
| 432 | Ga0207707_10192213 | 3300025912 | Bacteria | 1780 |
| 433 | Ga0207695_10004983 | 3300025913 | Bacteria | 17871 |
| 434 | Ga0207695_10009417 | 3300025913 | Bacteria | 12081 |
| 435 | Ga0207671_10082410 | 3300025914 | Bacteria | 2414 |
| 436 | Ga0207693_10001075 | 3300025915 | Bacteria | 24500 |
| 437 | Ga0207693_10019259 | 3300025915 | Bacteria | 5431 |
| 438 | Ga0207663_10016461 | 3300025916 | Bacteria | 4101 |
| 439 | Ga0207660_10007339 | 3300025917 | Bacteria | 7133 |
| 440 | Ga0207662_10017725 | 3300025918 | Bacteria | 4031 |
| 441 | Ga0207662_10025321 | 3300025918 | Bacteria | 3418 |
| 442 | Ga0207657_10000160 | 3300025919 | Bacteria | 69252 |
| 443 | Ga0207657_10001131 | 3300025919 | Bacteria | 28329 |
| 444 | Ga0207657_10005759 | 3300025919 | Bacteria | 12922 |
| 445 | Ga0207657_10041915 | 3300025919 | Bacteria | 4043 |
| 446 | Ga0207657_10050272 | 3300025919 | Bacteria | 3628 |
| 447 | Ga0207657_10069071 | 3300025919 | Bacteria | 3000 |
| 448 | Ga0207657_10125689 | 3300025919 | Bacteria | 2106 |
| 449 | Ga0207649_10001689 | 3300025920 | Bacteria | 12744 |
| 450 | Ga0207649_10001979 | 3300025920 | Bacteria | 11685 |
| 451 | Ga0207649_10004509 | 3300025920 | Bacteria | 7558 |
| 452 | Ga0207649_10006307 | 3300025920 | Bacteria | 6443 |
| 453 | Ga0207649_10133708 | 3300025920 | Bacteria | 1688 |
| 454 | Ga0207652_10006852 | 3300025921 | Bacteria | 9183 |
| 455 | Ga0207652_10017279 | 3300025921 | Bacteria | 5902 |
| 456 | Ga0207652_10146661 | 3300025921 | Bacteria | 2112 |
| 457 | Ga0207681_10000854 | 3300025923 | Bacteria | 20032 |
| 458 | Ga0207681_10077247 | 3300025923 | Bacteria | 2340 |
| 459 | Ga0207681_10079958 | 3300025923 | Bacteria | 2304 |
| 460 | Ga0207681_10171959 | 3300025923 | Bacteria | 1643 |
| 461 | Ga0207694_10004092 | 3300025924 | Bacteria | 11465 |
| 462 | Ga0207694_10012266 | 3300025924 | Bacteria | 6458 |
| 463 | Ga0207694_10070723 | 3300025924 | Bacteria | 2727 |
| 464 | Ga0207650_10000838 | 3300025925 | Bacteria | 23344 |
| 465 | Ga0207650_10001440 | 3300025925 | Bacteria | 17133 |
| 466 | Ga0207650_10006114 | 3300025925 | Bacteria | 8202 |
| 467 | Ga0207650_10008750 | 3300025925 | Bacteria | 6915 |
| 468 | Ga0207650_10010249 | 3300025925 | Bacteria | 6424 |
| 469 | Ga0207650_10030656 | 3300025925 | Bacteria | 3876 |
| 470 | Ga0207650_10036940 | 3300025925 | Bacteria | 3556 |
| 471 | Ga0207650_10037369 | 3300025925 | Bacteria | 3538 |
| 472 | Ga0207650_10041963 | 3300025925 | Bacteria | 3355 |
| 473 | Ga0207659_10000360 | 3300025926 | Bacteria | 27263 |
| 474 | Ga0207659_10011055 | 3300025926 | Bacteria | 5690 |
| 475 | Ga0207659_10023722 | 3300025926 | Bacteria | 4099 |
| 476 | Ga0207659_10162220 | 3300025926 | Bacteria | 1756 |
| 477 | Ga0207687_10010501 | 3300025927 | Bacteria | 6049 |
| 478 | Ga0207687_10028353 | 3300025927 | Bacteria | 3762 |
| 479 | Ga0207687_10056987 | 3300025927 | Bacteria | 2743 |
| 480 | Ga0207664_10003175 | 3300025929 | Bacteria | 10918 |
| 481 | Ga0207664_10020199 | 3300025929 | Bacteria | 4933 |
| 482 | Ga0207664_10045535 | 3300025929 | Bacteria | 3441 |
| 483 | Ga0207644_10001134 | 3300025931 | Bacteria | 17065 |
| 484 | Ga0207644_10008411 | 3300025931 | Bacteria | 6753 |
| 485 | Ga0207644_10020376 | 3300025931 | Bacteria | 4509 |
| 486 | Ga0207644_10023131 | 3300025931 | Bacteria | 4252 |
| 487 | Ga0207644_10023989 | 3300025931 | Bacteria | 4183 |
| 488 | Ga0207644_10048403 | 3300025931 | Bacteria | 3039 |
| 489 | Ga0207644_10065347 | 3300025931 | Bacteria | 2645 |
| 490 | Ga0207690_10000955 | 3300025932 | Bacteria | 18501 |
| 491 | Ga0207690_10017119 | 3300025932 | Bacteria | 4421 |
| 492 | Ga0207690_10139188 | 3300025932 | Bacteria | 1786 |
| 493 | Ga0207690_10171294 | 3300025932 | Bacteria | 1627 |
| 494 | Ga0207706_10000023 | 3300025933 | Bacteria | 153979 |
| 495 | Ga0207706_10001994 | 3300025933 | Bacteria | 19984 |
| 496 | Ga0207706_10011380 | 3300025933 | Bacteria | 8105 |
| 497 | Ga0207706_10039233 | 3300025933 | Bacteria | 4198 |
| 498 | Ga0207706_10061538 | 3300025933 | Bacteria | 3306 |
| 499 | Ga0207706_10065036 | 3300025933 | Bacteria | 3211 |
| 500 | Ga0207706_10109603 | 3300025933 | Bacteria | 2430 |
| 501 | Ga0207686_10001851 | 3300025934 | Bacteria | 11747 |
| 502 | Ga0207686_10006650 | 3300025934 | Bacteria | 6234 |
| 503 | Ga0207709_10104762 | 3300025935 | Bacteria | 1878 |
| 504 | Ga0207670_10010067 | 3300025936 | Bacteria | 5427 |
| 505 | Ga0207669_10003410 | 3300025937 | Bacteria | 6875 |
| 506 | Ga0207669_10004208 | 3300025937 | Bacteria | 6311 |
| 507 | Ga0207669_10014609 | 3300025937 | Bacteria | 3940 |
| 508 | Ga0207669_10038364 | 3300025937 | Bacteria | 2757 |
| 509 | Ga0207669_10039661 | 3300025937 | Bacteria | 2724 |
| 510 | Ga0207704_10001298 | 3300025938 | Bacteria | 11172 |
| 511 | Ga0207704_10038206 | 3300025938 | Bacteria | 2782 |
| 512 | Ga0207704_10053770 | 3300025938 | Bacteria | 2450 |
| 513 | Ga0207665_10000689 | 3300025939 | Bacteria | 22862 |
| 514 | Ga0207691_10000279 | 3300025940 | Bacteria | 50526 |
| 515 | Ga0207691_10000368 | 3300025940 | Bacteria | 45434 |
| 516 | Ga0207691_10001973 | 3300025940 | Bacteria | 20063 |
| 517 | Ga0207691_10005465 | 3300025940 | Bacteria | 12269 |
| 518 | Ga0207691_10006104 | 3300025940 | Bacteria | 11645 |
| 519 | Ga0207691_10028393 | 3300025940 | Bacteria | 5238 |
| 520 | Ga0207691_10035519 | 3300025940 | Bacteria | 4624 |
| 521 | Ga0207691_10062461 | 3300025940 | Bacteria | 3380 |
| 522 | Ga0207691_10254686 | 3300025940 | Bacteria | 1514 |
| 523 | Ga0207711_10007918 | 3300025941 | Bacteria | 8888 |
| 524 | Ga0207711_10011043 | 3300025941 | Bacteria | 7506 |
| 525 | Ga0207711_10056754 | 3300025941 | Bacteria | 3365 |
| 526 | Ga0207711_10153910 | 3300025941 | Bacteria | 2077 |
| 527 | Ga0207689_10000038 | 3300025942 | Bacteria | 94282 |
| 528 | Ga0207689_10000156 | 3300025942 | Bacteria | 59034 |
| 529 | Ga0207689_10000356 | 3300025942 | Bacteria | 42960 |
| 530 | Ga0207689_10008074 | 3300025942 | Bacteria | 9180 |
| 531 | Ga0207689_10079553 | 3300025942 | Bacteria | 2694 |
| 532 | Ga0207689_10086600 | 3300025942 | Bacteria | 2575 |
| 533 | Ga0207661_10156828 | 3300025944 | Bacteria | 1972 |
| 534 | Ga0207661_10201225 | 3300025944 | Bacteria | 1751 |
| 535 | Ga0207679_10000921 | 3300025945 | Bacteria | 18761 |
| 536 | Ga0207679_10022254 | 3300025945 | Bacteria | 4313 |
| 537 | Ga0207679_10088627 | 3300025945 | Bacteria | 2386 |
| 538 | Ga0207679_10189840 | 3300025945 | Bacteria | 1707 |
| 539 | Ga0207679_10285787 | 3300025945 | Bacteria | 1416 |
| 540 | Ga0207667_10000758 | 3300025949 | Bacteria | 41976 |
| 541 | Ga0207667_10001121 | 3300025949 | Bacteria | 33788 |
| 542 | Ga0207667_10017635 | 3300025949 | Bacteria | 8032 |
| 543 | Ga0207667_10019494 | 3300025949 | Bacteria | 7569 |
| 544 | Ga0207667_10106935 | 3300025949 | Bacteria | 2886 |
| 545 | Ga0207667_10282092 | 3300025949 | Bacteria | 1697 |
| 546 | Ga0207651_10002721 | 3300025960 | Bacteria | 8479 |
| 547 | Ga0207651_10004440 | 3300025960 | Bacteria | 7071 |
| 548 | Ga0207651_10007291 | 3300025960 | Bacteria | 5878 |
| 549 | Ga0207651_10030053 | 3300025960 | Bacteria | 3454 |
| 550 | Ga0207651_10053579 | 3300025960 | Bacteria | 2758 |
| 551 | Ga0207651_10093928 | 3300025960 | Bacteria | 2204 |
| 552 | Ga0207668_10001355 | 3300025972 | Bacteria | 14490 |
| 553 | Ga0207668_10026878 | 3300025972 | Bacteria | 3743 |
| 554 | Ga0207668_10029264 | 3300025972 | Bacteria | 3609 |
| 555 | Ga0207668_10056181 | 3300025972 | Bacteria | 2740 |
| 556 | Ga0207668_10113006 | 3300025972 | Bacteria | 2041 |
| 557 | Ga0207640_10005966 | 3300025981 | Bacteria | 6653 |
| 558 | Ga0207640_10033317 | 3300025981 | Bacteria | 3204 |
| 559 | Ga0207640_10056264 | 3300025981 | Bacteria | 2581 |
| 560 | Ga0207640_10114749 | 3300025981 | Bacteria | 1917 |
| 561 | Ga0207640_10195973 | 3300025981 | Bacteria | 1526 |
| 562 | Ga0207658_10017195 | 3300025986 | Bacteria | 4982 |
| 563 | Ga0207658_10017859 | 3300025986 | Bacteria | 4888 |
| 564 | Ga0207658_10020189 | 3300025986 | Bacteria | 4615 |
| 565 | Ga0207658_10040737 | 3300025986 | Bacteria | 3360 |
| 566 | Ga0207658_10089373 | 3300025986 | Bacteria | 2384 |
| 567 | Ga0207658_10107314 | 3300025986 | Bacteria | 2200 |
| 568 | Ga0207658_10172568 | 3300025986 | Bacteria | 1783 |
| 569 | Ga0207677_10000445 | 3300026023 | Bacteria | 28010 |
| 570 | Ga0207677_10000770 | 3300026023 | Bacteria | 18440 |
| 571 | Ga0207677_10025978 | 3300026023 | Bacteria | 3664 |
| 572 | Ga0207677_10029697 | 3300026023 | Bacteria | 3478 |
| 573 | Ga0207677_10075313 | 3300026023 | Bacteria | 2398 |
| 574 | Ga0207703_10000830 | 3300026035 | Bacteria | 30371 |
| 575 | Ga0207703_10004139 | 3300026035 | Bacteria | 11964 |
| 576 | Ga0207703_10010851 | 3300026035 | Bacteria | 7104 |
| 577 | Ga0207703_10017574 | 3300026035 | Bacteria | 5584 |
| 578 | Ga0207703_10021430 | 3300026035 | Bacteria | 5059 |
| 579 | Ga0207703_10028916 | 3300026035 | Bacteria | 4374 |
| 580 | Ga0207703_10035154 | 3300026035 | Bacteria | 3981 |
| 581 | Ga0207703_10038328 | 3300026035 | Bacteria | 3824 |
| 582 | Ga0207703_10130804 | 3300026035 | Bacteria | 2167 |
| 583 | Ga0207639_10003604 | 3300026041 | Bacteria | 10401 |
| 584 | Ga0207639_10005242 | 3300026041 | Bacteria | 8745 |
| 585 | Ga0207639_10016150 | 3300026041 | Bacteria | 5274 |
| 586 | Ga0207639_10029303 | 3300026041 | Bacteria | 4028 |
| 587 | Ga0207678_10006313 | 3300026067 | Bacteria | 10527 |
| 588 | Ga0207678_10007347 | 3300026067 | Bacteria | 9756 |
| 589 | Ga0207678_10011136 | 3300026067 | Bacteria | 7903 |
| 590 | Ga0207678_10025966 | 3300026067 | Bacteria | 5111 |
| 591 | Ga0207678_10092253 | 3300026067 | Bacteria | 2589 |
| 592 | Ga0207708_10002916 | 3300026075 | Bacteria | 12596 |
| 593 | Ga0207708_10003451 | 3300026075 | Bacteria | 11652 |
| 594 | Ga0207708_10017071 | 3300026075 | Bacteria | 5463 |
| 595 | Ga0207708_10025022 | 3300026075 | Bacteria | 4515 |
| 596 | Ga0207708_10080021 | 3300026075 | Bacteria | 2511 |
| 597 | Ga0207708_10193713 | 3300026075 | Bacteria | 1619 |
| 598 | Ga0207702_10003505 | 3300026078 | Bacteria | 14306 |
| 599 | Ga0207702_10017725 | 3300026078 | Bacteria | 5894 |
| 600 | Ga0207702_10043250 | 3300026078 | Bacteria | 3782 |
| 601 | Ga0207702_10093620 | 3300026078 | Bacteria | 2635 |
| 602 | Ga0207641_10000735 | 3300026088 | Bacteria | 35180 |
| 603 | Ga0207641_10008846 | 3300026088 | Bacteria | 8315 |
| 604 | Ga0207641_10014768 | 3300026088 | Bacteria | 6404 |
| 605 | Ga0207641_10158533 | 3300026088 | Bacteria | 2055 |
| 606 | Ga0207641_10189242 | 3300026088 | Bacteria | 1890 |
| 607 | Ga0207648_10000089 | 3300026089 | Bacteria | 86359 |
| 608 | Ga0207648_10000131 | 3300026089 | Bacteria | 73949 |
| 609 | Ga0207648_10006719 | 3300026089 | Bacteria | 11411 |
| 610 | Ga0207648_10007022 | 3300026089 | Bacteria | 11134 |
| 611 | Ga0207648_10008186 | 3300026089 | Bacteria | 10165 |
| 612 | Ga0207648_10009299 | 3300026089 | Bacteria | 9423 |
| 613 | Ga0207648_10012263 | 3300026089 | Bacteria | 8024 |
| 614 | Ga0207648_10040851 | 3300026089 | Bacteria | 4075 |
| 615 | Ga0207648_10043857 | 3300026089 | Bacteria | 3926 |
| 616 | Ga0207648_10070992 | 3300026089 | Bacteria | 3035 |
| 617 | Ga0207676_10003423 | 3300026095 | Bacteria | 11221 |
| 618 | Ga0207676_10004767 | 3300026095 | Bacteria | 9622 |
| 619 | Ga0207676_10012250 | 3300026095 | Bacteria | 6137 |
| 620 | Ga0207676_10028759 | 3300026095 | Bacteria | 4156 |
| 621 | Ga0207676_10094534 | 3300026095 | Bacteria | 2463 |
| 622 | Ga0207676_10113914 | 3300026095 | Bacteria | 2268 |
| 623 | Ga0207674_10000053 | 3300026116 | Bacteria | 114437 |
| 624 | Ga0207674_10000236 | 3300026116 | Bacteria | 68955 |
| 625 | Ga0207674_10003777 | 3300026116 | Bacteria | 18471 |
| 626 | Ga0207674_10015118 | 3300026116 | Bacteria | 8493 |
| 627 | Ga0207674_10048923 | 3300026116 | Bacteria | 4325 |
| 628 | Ga0207675_100000084 | 3300026118 | Bacteria | 74312 |
| 629 | Ga0207675_100001262 | 3300026118 | Bacteria | 25262 |
| 630 | Ga0207675_100003475 | 3300026118 | Bacteria | 15390 |
| 631 | Ga0207675_100019834 | 3300026118 | Bacteria | 6274 |
| 632 | Ga0207675_100029491 | 3300026118 | Bacteria | 5112 |
| 633 | Ga0207675_100050974 | 3300026118 | Bacteria | 3862 |
| 634 | Ga0207675_100065145 | 3300026118 | Bacteria | 3406 |
| 635 | Ga0207675_100114847 | 3300026118 | Bacteria | 2543 |
| 636 | Ga0207683_10000003 | 3300026121 | Bacteria | 191866 |
| 637 | Ga0207683_10000325 | 3300026121 | Bacteria | 43393 |
| 638 | Ga0207683_10003106 | 3300026121 | Bacteria | 14512 |
| 639 | Ga0207683_10011603 | 3300026121 | Bacteria | 7522 |
| 640 | Ga0207683_10014625 | 3300026121 | Bacteria | 6684 |
| 641 | Ga0207683_10016833 | 3300026121 | Bacteria | 6220 |
| 642 | Ga0207683_10047008 | 3300026121 | Bacteria | 3779 |
| 643 | Ga0207683_10098736 | 3300026121 | Bacteria | 2606 |
| 644 | Ga0207683_10140292 | 3300026121 | Bacteria | 2177 |
| 645 | Ga0207698_10001020 | 3300026142 | Bacteria | 16307 |
| 646 | Ga0207698_10001266 | 3300026142 | Bacteria | 14766 |
| 647 | Ga0207698_10032398 | 3300026142 | Bacteria | 3786 |
| 648 | Ga0207698_10064341 | 3300026142 | Bacteria | 2874 |
| 649 | Ga0207698_10086596 | 3300026142 | Bacteria | 2548 |
| 650 | Ga0207698_10217694 | 3300026142 | Bacteria | 1723 |
| 651 | Ga0209983_1006691 | 3300027665 | Bacteria | 2366 |
| 652 | Ga0209971_1003106 | 3300027682 | Bacteria | 3965 |
| 653 | Ga0209998_10004607 | 3300027717 | Bacteria | 2921 |
| 654 | Ga0209974_10000416 | 3300027876 | Bacteria | 14223 |
| 655 | Ga0268266_10001663 | 3300028379 | Bacteria | 25674 |
| 656 | Ga0268266_10015641 | 3300028379 | Bacteria | 6501 |
| 657 | Ga0268266_10141487 | 3300028379 | Bacteria | 2159 |
| 658 | Ga0268265_10021192 | 3300028380 | Bacteria | 4548 |
| 659 | Ga0268265_10033262 | 3300028380 | Bacteria | 3747 |
| 660 | Ga0268265_10064328 | 3300028380 | Bacteria | 2825 |
| 661 | Ga0268265_10098932 | 3300028380 | Bacteria | 2350 |
| 662 | Ga0268265_10106866 | 3300028380 | Bacteria | 2274 |
| 663 | Ga0268264_10003730 | 3300028381 | Bacteria | 13089 |
| 664 | Ga0268264_10008746 | 3300028381 | Bacteria | 8406 |
| 665 | Ga0268264_10014632 | 3300028381 | Bacteria | 6447 |
| 666 | Ga0268264_10033015 | 3300028381 | Bacteria | 4249 |
| 667 | Ga0268264_10098249 | 3300028381 | Bacteria | 2539 |
| 668 | Ga0268264_10099853 | 3300028381 | Bacteria | 2520 |
| 669 | Ga0268264_10267652 | 3300028381 | Bacteria | 1595 |
| 670 | Ga0265330_10005529 | 3300031235 | Bacteria | 6295 |
| 671 | Ga0265332_10000451 | 3300031238 | Bacteria | 28892 |
| 672 | Ga0265325_10010336 | 3300031241 | Bacteria | 5411 |
| 673 | Ga0265329_10000638 | 3300031242 | Bacteria | 17893 |
| 674 | Ga0265331_10000298 | 3300031250 | Bacteria | 54129 |
| 675 | Ga0265327_10007022 | 3300031251 | Bacteria | 8827 |
| 676 | Ga0265316_10015495 | 3300031344 | Bacteria | 6662 |
| 677 | Ga0307408_100035285 | 3300031548 | Bacteria | 3508 |
| 678 | Ga0265314_10002786 | 3300031711 | Bacteria | 17455 |
| 679 | Ga0307405_10027286 | 3300031731 | Bacteria | 3308 |
| 680 | Ga0307413_10000389 | 3300031824 | Bacteria | 14000 |
| 681 | Ga0307413_10013141 | 3300031824 | Bacteria | 4147 |
| 682 | Ga0307413_10063848 | 3300031824 | Bacteria | 2285 |
| 683 | Ga0307410_10018949 | 3300031852 | Bacteria | 4173 |
| 684 | Ga0307410_10039415 | 3300031852 | Bacteria | 3102 |
| 685 | Ga0307406_10005268 | 3300031901 | Bacteria | 7069 |
| 686 | Ga0307407_10031575 | 3300031903 | Bacteria | 2870 |
| 687 | Ga0307412_10093807 | 3300031911 | Bacteria | 2106 |
| 688 | Ga0307409_100117173 | 3300031995 | Bacteria | 2247 |
| 689 | Ga0307416_100005189 | 3300032002 | Bacteria | 7962 |
| 690 | Ga0307416_100016145 | 3300032002 | Bacteria | 5179 |
| 691 | Ga0307414_10007699 | 3300032004 | Bacteria | 6065 |
| 692 | Ga0307411_10013827 | 3300032005 | Bacteria | 4470 |
| 693 | Ga0307411_10051387 | 3300032005 | Bacteria | 2689 |
| 694 | Ga0307415_100030106 | 3300032126 | Bacteria | 3478 |
| 695 | Ga0373926_0032533 | 3300035083 | Bacteria | 1840 |
| 696 | Ga0373934_0026175 | 3300035086 | Bacteria | 2262 |
| 697 | Ga0373944_0007147 | 3300035089 | Bacteria | 2986 |
| 698 | Ga0373953_0021472 | 3300035117 | Bacteria | 2423 |
| 699 | Ga0373953_0056517 | 3300035117 | Bacteria | 1595 |
| 700 | Ga0373954_0002509 | 3300035118 | Bacteria | 7700 |
| 701 | Ga0373954_0016585 | 3300035118 | Bacteria | 3299 |
| 702 | Ga0373954_0057387 | 3300035118 | Bacteria | 1833 |
| 703 | Ga0373956_0006016 | 3300035119 | Bacteria | 4857 |
| 704 | Ga0373956_0007137 | 3300035119 | Bacteria | 4494 |
| 705 | Ga0373956_0024752 | 3300035119 | Bacteria | 2589 |
| 706 | Ga0373955_0071631 | 3300035172 | Bacteria | 1939 |
| 707 | Ga0373955_0093536 | 3300035172 | Bacteria | 1716 |
| 708 | Ga0373924_0000884 | 3300035410 | Bacteria | 9440 |
| 709 | Ga0373924_0022609 | 3300035410 | Bacteria | 2458 |
| 710 | Ga0373924_0037148 | 3300035410 | Bacteria | 1981 |
| 711 | Ga0373931_0016282 | 3300035691 | Bacteria | 3658 |
| 712 | Ga0373935_0034864 | 3300035692 | Bacteria | 3138 |
| 713 | Ga0373927_0073388 | 3300035695 | Bacteria | 2216 |
| 714 | Ga0373933_0001392 | 3300035724 | Bacteria | 14190 |
| 715 | Ga0373933_0013082 | 3300035724 | Bacteria | 4594 |
| 716 | Ga0373933_0029443 | 3300035724 | Bacteria | 3175 |
| 717 | Ga0373933_0100565 | 3300035724 | Bacteria | 1793 |
| 718 | Ga0373937_0027633 | 3300036401 | Bacteria | 5132 |
| 719 | Ga0373937_0033469 | 3300036401 | Bacteria | 4667 |
| 720 | Ga0373937_0084621 | 3300036401 | Bacteria | 2935 |
| 721 | Ga0373937_0100340 | 3300036401 | Bacteria | 2686 |
| 722 | Ga0373937_0259237 | 3300036401 | Bacteria | 1639 |
| 723 | Ga0373925_0007841 | 3300037068 | Bacteria | 7776 |
| 724 | Ga0373925_0018129 | 3300037068 | Bacteria | 5113 |
| 725 | Ga0395900_0350650 | 3300037418 | Bacteria | 1449 |
| 726 | Ga0395898_0258520 | 3300037466 | Bacteria | 1661 |
| 727 | Ga0395905_0031217 | 3300037471 | Bacteria | 5017 |
| 728 | Ga0395901_0435187 | 3300038443 | Bacteria | 1343 |
| 729 | Ga0436361_0133183 | 3300039447 | Bacteria | 45710 |
| 730 | Ga0436361_0366030 | 3300039447 | Bacteria | 29190 |
| 731 | Ga0451807_0007505 | 3300041486 | Bacteria | 1759 |
| 732 | Ga0439448_0027325 | 3300042005 | Bacteria | 1798 |
| 733 | Ga0451577_0172152 | 3300042876 | Bacteria | 1951 |
| 734 | Ga0453684_0083116 | 3300044712 | Bacteria | 3986 |
| 735 | Ga0451576_0100505 | 3300045051 | Bacteria | 3008 |
| 736 | Ga0466967_0095983 | 3300045976 | Bacteria | 2704 |
| 737 | Ga0495592_0000449 | 3300046454 | Bacteria | 30874 |
| 738 | Ga0495592_0126142 | 3300046454 | Bacteria | 1796 |
| 739 | Ga0495603_0059176 | 3300046455 | Bacteria | 2265 |
| 740 | Ga0495641_0032708 | 3300046461 | Bacteria | 2473 |
| 741 | Ga0495651_0005865 | 3300046462 | Bacteria | 9368 |
| 742 | Ga0495580_0145673 | 3300046472 | Bacteria | 1641 |
| 743 | Ga0495582_0030744 | 3300046473 | Bacteria | 2949 |
| 744 | Ga0495639_0026618 | 3300046475 | Bacteria | 2557 |
| 745 | Ga0495662_0040349 | 3300046476 | Bacteria | 2254 |
| 746 | Ga0495662_0067504 | 3300046476 | Bacteria | 1730 |
| 747 | Ga0495594_0044783 | 3300046499 | Bacteria | 2428 |
| 748 | Ga0495618_0095366 | 3300046514 | Bacteria | 1902 |
| 749 | Ga0495628_0001138 | 3300046516 | Bacteria | 24250 |
| 750 | Ga0495628_0066320 | 3300046516 | Bacteria | 2822 |
| 751 | Ga0495630_0054504 | 3300046517 | Bacteria | 2996 |
| 752 | Ga0495630_0103640 | 3300046517 | Bacteria | 2153 |
| 753 | Ga0495652_0000659 | 3300046529 | Bacteria | 40054 |
| 754 | Ga0495586_0050563 | 3300046535 | Bacteria | 2249 |
| 755 | Ga0495598_0001069 | 3300046537 | Bacteria | 5256 |
| 756 | Ga0495645_0000440 | 3300046543 | Bacteria | 28547 |
| 757 | Ga0495645_0010412 | 3300046543 | Bacteria | 6517 |
| 758 | Ga0495667_0020317 | 3300046559 | Bacteria | 4482 |
| 759 | Ga0495667_0030314 | 3300046559 | Bacteria | 3635 |
| 760 | Ga0495667_0120564 | 3300046559 | Bacteria | 1693 |
| 761 | Ga0495634_0084487 | 3300046642 | Bacteria | 2069 |
| 762 | Ga0495635_0020851 | 3300046663 | Bacteria | 4565 |
| 763 | Ga0495659_0032949 | 3300046664 | Bacteria | 1816 |
| 764 | Ga0495657_0156652 | 3300046675 | Bacteria | 1411 |
| 765 | Ga0495599_0004166 | 3300046678 | Bacteria | 8541 |
| 766 | Ga0495599_0076490 | 3300046678 | Bacteria | 2090 |
| 767 | Ga0495623_0039948 | 3300046679 | Bacteria | 2997 |
| 768 | Ga0495647_0001220 | 3300046681 | Bacteria | 7915 |
| 769 | Ga0495658_0028442 | 3300046683 | Bacteria | 3017 |
| 770 | Ga0495613_0147544 | 3300046689 | Bacteria | 1678 |
| 771 | Ga0495624_0037097 | 3300046690 | Bacteria | 3138 |
| 772 | Ga0495600_0013358 | 3300046809 | Bacteria | 5157 |
| 773 | Ga0495581_0005311 | 3300047315 | Bacteria | 7452 |
| 774 | Ga0495674_0038632 | 3300047319 | Bacteria | 4283 |
| 775 | Ga0495680_0030053 | 3300047322 | Bacteria | 4441 |
| 776 | Ga0495675_0021513 | 3300047444 | Bacteria | 4108 |
| 777 | Ga0495593_0036160 | 3300047673 | Bacteria | 2679 |
| 778 | Ga0496100_0169783 | 3300048903 | Bacteria | 1570 |
| 779 | Ga0496101_0011258 | 3300048904 | Bacteria | 5927 |
| 780 | Ga0496101_0078956 | 3300048904 | Bacteria | 2429 |
| 781 | Ga0496102_0020676 | 3300048905 | Bacteria | 5816 |
| 782 | Ga0496103_0016993 | 3300048906 | Bacteria | 4348 |
| 783 | Ga0496103_0048807 | 3300048906 | Bacteria | 2617 |
| 784 | Ga0496104_0013445 | 3300048907 | Bacteria | 7376 |
| 785 | Ga0496105_0110565 | 3300048908 | Bacteria | 2268 |
| 786 | Ga0496106_0133803 | 3300048909 | Bacteria | 1946 |
| 787 | Ga0496106_0172096 | 3300048909 | Bacteria | 1717 |
| 788 | Ga0496107_0021530 | 3300048910 | Bacteria | 4556 |
| 789 | Ga0496107_0117423 | 3300048910 | Bacteria | 1959 |
| 790 | Ga0496108_0032097 | 3300048911 | Bacteria | 4360 |
| 791 | Ga0496108_0045263 | 3300048911 | Bacteria | 3675 |
| 792 | Ga0496108_0092980 | 3300048911 | Bacteria | 2565 |
| 793 | Ga0496108_0164065 | 3300048911 | Bacteria | 1921 |
| 794 | Ga0496108_0200125 | 3300048911 | Bacteria | 1733 |
| 795 | Ga0496109_0013476 | 3300048912 | Bacteria | 7093 |
| 796 | Ga0496109_0022046 | 3300048912 | Bacteria | 5638 |
| 797 | Ga0496111_0181126 | 3300048914 | Bacteria | 1566 |
| 798 | Ga0496112_0003510 | 3300048915 | Bacteria | 12994 |
| 799 | Ga0496112_0009119 | 3300048915 | Bacteria | 8915 |
| 800 | Ga0496112_0074107 | 3300048915 | Bacteria | 3366 |
| 801 | Ga0496113_0108602 | 3300048916 | Bacteria | 2157 |
| 802 | Ga0496114_0009997 | 3300048917 | Bacteria | 7543 |
| 803 | Ga0496114_0028994 | 3300048917 | Bacteria | 4547 |
| 804 | Ga0496114_0133964 | 3300048917 | Bacteria | 2141 |
| 805 | Ga0496115_0034802 | 3300048918 | Bacteria | 3981 |
| 806 | Ga0501033_0061934 | 3300049570 | Bacteria | 2756 |
| 807 | Ga0501036_0056028 | 3300049572 | Bacteria | 3339 |
| 808 | Ga0501037_0032421 | 3300049573 | Bacteria | 3858 |
| 809 | Ga0501039_0006097 | 3300049575 | Bacteria | 9151 |
| 810 | Ga0501040_0026030 | 3300049576 | Bacteria | 3936 |
| 811 | Ga0501041_0004612 | 3300049577 | Bacteria | 7995 |
| 812 | Ga0501042_0009824 | 3300049578 | Bacteria | 6391 |
| 813 | Ga0501043_0018087 | 3300049579 | Bacteria | 5527 |
| 814 | Ga0501046_0125910 | 3300049580 | Bacteria | 1946 |
| 815 | Ga0501047_0004408 | 3300049581 | Bacteria | 13254 |
| 816 | Ga0501048_0013661 | 3300049582 | Bacteria | 6024 |
| 817 | Ga0501070_0023657 | 3300049586 | Bacteria | 5147 |
| 818 | Ga0501072_0003128 | 3300049588 | Bacteria | 12448 |
| 819 | Ga0501073_0068292 | 3300049589 | Bacteria | 2477 |
| 820 | Ga0501076_0001401 | 3300049592 | Bacteria | 16144 |
| 821 | Ga0501076_0022117 | 3300049592 | Bacteria | 4885 |
| 822 | Ga0501077_0038307 | 3300049593 | Bacteria | 3052 |
| 823 | Ga0501079_0011165 | 3300049741 | Bacteria | 6850 |
| 824 | Ga0501079_0099326 | 3300049741 | Bacteria | 2256 |
| 825 | Ga0501080_0004046 | 3300049742 | Bacteria | 12985 |
| 826 | Ga0501080_0005610 | 3300049742 | Bacteria | 11217 |
| 827 | Ga0501080_0312246 | 3300049742 | Bacteria | 1425 |
| 828 | Ga0501081_0001144 | 3300049743 | Bacteria | 16029 |
| 829 | Ga0501083_0027583 | 3300049744 | Bacteria | 3918 |
| 830 | Ga0501083_0110886 | 3300049744 | Bacteria | 1804 |
| 831 | Ga0501044_0071920 | 3300049823 | Bacteria | 3517 |
| 832 | Ga0501045_0116137 | 3300049824 | Bacteria | 1985 |
| 833 | nmdc:mga0k408_165_c1 | 3300050493 | Bacteria | 34703 |
| 834 | nmdc:mga09592_30226_c1 | 3300050508 | Bacteria | 4507 |
| 835 | nmdc:mga0qj67_178219_c1 | 3300050509 | Bacteria | 1726 |
| 836 | nmdc:mga06r32_812_c1 | 3300050510 | Bacteria | 27757 |
| 837 | nmdc:mga08y16_33921_c1 | 3300050511 | Bacteria | 5362 |
| 838 | nmdc:mga0n895_203537_c1 | 3300050512 | Bacteria | 2010 |
| 839 | nmdc:mga08x19_5379_c1 | 3300050514 | Bacteria | 7566 |
| 840 | nmdc:mga0a205_227090_c1 | 3300050515 | Bacteria | 1751 |
| 841 | Ga0495601_0007667 | 3300053077 | Bacteria | 6343 |
| 842 | Ga0495595_0039823 | 3300053084 | Bacteria | 2146 |
| 843 | Ga0495595_0072999 | 3300053084 | Bacteria | 1624 |
| 844 | Ga0495619_0014518 | 3300053085 | Bacteria | 4975 |
| 845 | Ga0495619_0019523 | 3300053085 | Bacteria | 4310 |
| 846 | Ga0501084_0018856 | 3300054114 | Bacteria | 5744 |
| 847 | Ga0501082_0004457 | 3300060353 | Bacteria | 12227 |
| 848 | Ga0530510_0010172 | 3300061734 | Bacteria | 6593 |
| 849 | Ga0530510_0049821 | 3300061734 | Bacteria | 3025 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013297 | Ga0157378_10026204 | Ga0157378_100262045 | 395 |
| 2 | 3300046514 | Ga0495618_0095366 | Ga0495618_0095366_11_1222 | 401 |
| 3 | 3300035117 | Ga0373953_0056517 | Ga0373953_0056517_365_1582 | 403 |
| 4 | 3300005467 | Ga0070706_100043759 | Ga0070706_1000437591 | 412 |
| 5 | 3300005353 | Ga0070669_100111157 | Ga0070669_1001111572 | 415 |
| 6 | 3300005354 | Ga0070675_100023704 | Ga0070675_1000237043 | 415 |
| 7 | 3300031250 | Ga0265331_10000298 | Ga0265331_1000029819 | 415 |
| 8 | 3300031251 | Ga0265327_10007022 | Ga0265327_100070222 | 415 |
| 9 | 3300031711 | Ga0265314_10002786 | Ga0265314_100027869 | 415 |
| 10 | 3300031824 | Ga0307413_10063848 | Ga0307413_100638482 | 415 |
| 11 | 3300037418 | Ga0395900_0350650 | Ga0395900_0350650_43_1308 | 415 |
| 12 | 3300038443 | Ga0395901_0435187 | Ga0395901_0435187_33_1298 | 415 |
| 13 | 3300049823 | Ga0501044_0071920 | Ga0501044_0071920_2204_3475 | 416 |
| 14 | 3300031852 | Ga0307410_10039415 | Ga0307410_100394152 | 418 |
| 15 | 3300031995 | Ga0307409_100117173 | Ga0307409_1001171732 | 418 |
| 16 | 3300028381 | Ga0268264_10098249 | Ga0268264_100982491 | 421 |
| 17 | 3300017792 | Ga0163161_10048737 | Ga0163161_100487371 | 422 |
| 18 | 3300035410 | Ga0373924_0000884 | Ga0373924_0000884_2182_3510 | 422 |
| 19 | 3300005328 | Ga0070676_10000750 | Ga0070676_1000075011 | 423 |
| 20 | 3300005331 | Ga0070670_100036272 | Ga0070670_1000362722 | 423 |
| 21 | 3300005333 | Ga0070677_10000546 | Ga0070677_100005467 | 423 |
| 22 | 3300005334 | Ga0068869_100022640 | Ga0068869_1000226403 | 423 |
| 23 | 3300005335 | Ga0070666_10001272 | Ga0070666_1000127210 | 423 |
| 24 | 3300005338 | Ga0068868_100028029 | Ga0068868_1000280293 | 423 |
| 25 | 3300005347 | Ga0070668_100018925 | Ga0070668_1000189252 | 423 |
| 26 | 3300005347 | Ga0070668_100030741 | Ga0070668_1000307412 | 423 |
| 27 | 3300005354 | Ga0070675_100001740 | Ga0070675_1000017407 | 423 |
| 28 | 3300005355 | Ga0070671_100000599 | Ga0070671_10000059911 | 423 |
| 29 | 3300005356 | Ga0070674_100000298 | Ga0070674_1000002984 | 423 |
| 30 | 3300005364 | Ga0070673_100000267 | Ga0070673_10000026714 | 423 |
| 31 | 3300005367 | Ga0070667_100010293 | Ga0070667_1000102935 | 423 |
| 32 | 3300005456 | Ga0070678_100000237 | Ga0070678_10000023710 | 423 |
| 33 | 3300005459 | Ga0068867_100007370 | Ga0068867_1000073703 | 423 |
| 34 | 3300005539 | Ga0068853_100003197 | Ga0068853_1000031975 | 423 |
| 35 | 3300005543 | Ga0070672_100000300 | Ga0070672_10000030019 | 423 |
| 36 | 3300005548 | Ga0070665_100007215 | Ga0070665_1000072157 | 423 |
| 37 | 3300005834 | Ga0068851_10000220 | Ga0068851_1000022014 | 423 |
| 38 | 3300005841 | Ga0068863_100011123 | Ga0068863_1000111236 | 423 |
| 39 | 3300005843 | Ga0068860_100004796 | Ga0068860_1000047964 | 423 |
| 40 | 3300006237 | Ga0097621_100012504 | Ga0097621_1000125044 | 423 |
| 41 | 3300013308 | Ga0157375_10003068 | Ga0157375_100030683 | 423 |
| 42 | 3300025321 | Ga0207656_10006828 | Ga0207656_100068282 | 423 |
| 43 | 3300025893 | Ga0207682_10004174 | Ga0207682_100041744 | 423 |
| 44 | 3300025907 | Ga0207645_10000607 | Ga0207645_1000060711 | 423 |
| 45 | 3300025908 | Ga0207643_10005613 | Ga0207643_100056134 | 423 |
| 46 | 3300025926 | Ga0207659_10023722 | Ga0207659_100237222 | 423 |
| 47 | 3300025931 | Ga0207644_10023131 | Ga0207644_100231314 | 423 |
| 48 | 3300025937 | Ga0207669_10014609 | Ga0207669_100146093 | 423 |
| 49 | 3300025938 | Ga0207704_10038206 | Ga0207704_100382061 | 423 |
| 50 | 3300025940 | Ga0207691_10000279 | Ga0207691_1000027944 | 423 |
| 51 | 3300025942 | Ga0207689_10086600 | Ga0207689_100866002 | 423 |
| 52 | 3300025960 | Ga0207651_10007291 | Ga0207651_100072914 | 423 |
| 53 | 3300025972 | Ga0207668_10026878 | Ga0207668_100268783 | 423 |
| 54 | 3300025981 | Ga0207640_10195973 | Ga0207640_101959731 | 423 |
| 55 | 3300025986 | Ga0207658_10017859 | Ga0207658_100178592 | 423 |
| 56 | 3300026023 | Ga0207677_10025978 | Ga0207677_100259783 | 423 |
| 57 | 3300026035 | Ga0207703_10010851 | Ga0207703_100108514 | 423 |
| 58 | 3300026041 | Ga0207639_10005242 | Ga0207639_100052425 | 423 |
| 59 | 3300026067 | Ga0207678_10006313 | Ga0207678_100063137 | 423 |
| 60 | 3300026089 | Ga0207648_10012263 | Ga0207648_100122633 | 423 |
| 61 | 3300026118 | Ga0207675_100065145 | Ga0207675_1000651452 | 423 |
| 62 | 3300026121 | Ga0207683_10000003 | Ga0207683_1000000314 | 423 |
| 63 | 3300028379 | Ga0268266_10001663 | Ga0268266_1000166322 | 423 |
| 64 | 3300028381 | Ga0268264_10033015 | Ga0268264_100330153 | 423 |
| 65 | 3300032002 | Ga0307416_100016145 | Ga0307416_1000161455 | 428 |
| 66 | 3300044712 | Ga0453684_0083116 | Ga0453684_0083116_235_1542 | 429 |
| 67 | 3300046663 | Ga0495635_0020851 | Ga0495635_0020851_831_2192 | 430 |
| 68 | 3300005330 | Ga0070690_100001695 | Ga0070690_1000016956 | 431 |
| 69 | 3300005336 | Ga0070680_100130793 | Ga0070680_1001307932 | 431 |
| 70 | 3300005338 | Ga0068868_100024330 | Ga0068868_1000243303 | 431 |
| 71 | 3300005343 | Ga0070687_100080791 | Ga0070687_1000807911 | 431 |
| 72 | 3300005345 | Ga0070692_10090227 | Ga0070692_100902272 | 431 |
| 73 | 3300005365 | Ga0070688_100065905 | Ga0070688_1000659052 | 431 |
| 74 | 3300005438 | Ga0070701_10000879 | Ga0070701_100008799 | 431 |
| 75 | 3300005440 | Ga0070705_100023482 | Ga0070705_1000234824 | 431 |
| 76 | 3300005441 | Ga0070700_100000172 | Ga0070700_1000001722 | 431 |
| 77 | 3300005456 | Ga0070678_100026396 | Ga0070678_1000263962 | 431 |
| 78 | 3300005544 | Ga0070686_100000603 | Ga0070686_10000060316 | 431 |
| 79 | 3300005546 | Ga0070696_100018153 | Ga0070696_1000181535 | 431 |
| 80 | 3300005547 | Ga0070693_100006079 | Ga0070693_1000060794 | 431 |
| 81 | 3300005615 | Ga0070702_100000059 | Ga0070702_10000005921 | 431 |
| 82 | 3300005719 | Ga0068861_100000637 | Ga0068861_1000006374 | 431 |
| 83 | 3300005842 | Ga0068858_100001249 | Ga0068858_10000124916 | 431 |
| 84 | 3300005843 | Ga0068860_100048280 | Ga0068860_1000482802 | 431 |
| 85 | 3300005844 | Ga0068862_100007062 | Ga0068862_1000070622 | 431 |
| 86 | 3300006358 | Ga0068871_100001061 | Ga0068871_10000106112 | 431 |
| 87 | 3300006846 | Ga0075430_100009206 | Ga0075430_1000092067 | 431 |
| 88 | 3300006847 | Ga0075431_100000324 | Ga0075431_10000032417 | 431 |
| 89 | 3300006880 | Ga0075429_100040723 | Ga0075429_1000407232 | 431 |
| 90 | 3300006881 | Ga0068865_100000303 | Ga0068865_10000030316 | 431 |
| 91 | 3300009098 | Ga0105245_10000063 | Ga0105245_1000006340 | 431 |
| 92 | 3300009148 | Ga0105243_10000358 | Ga0105243_1000035814 | 431 |
| 93 | 3300009176 | Ga0105242_10001369 | Ga0105242_100013697 | 431 |
| 94 | 3300009177 | Ga0105248_10111641 | Ga0105248_101116412 | 431 |
| 95 | 3300009553 | Ga0105249_10122279 | Ga0105249_101222792 | 431 |
| 96 | 3300011119 | Ga0105246_10036410 | Ga0105246_100364103 | 431 |
| 97 | 3300011119 | Ga0105246_10047683 | Ga0105246_100476831 | 431 |
| 98 | 3300013297 | Ga0157378_10000193 | Ga0157378_1000019342 | 431 |
| 99 | 3300014326 | Ga0157380_10000537 | Ga0157380_1000053717 | 431 |
| 100 | 3300025899 | Ga0207642_10001671 | Ga0207642_100016715 | 431 |
| 101 | 3300025908 | Ga0207643_10002271 | Ga0207643_100022712 | 431 |
| 102 | 3300025927 | Ga0207687_10010501 | Ga0207687_100105012 | 431 |
| 103 | 3300025934 | Ga0207686_10001851 | Ga0207686_1000185112 | 431 |
| 104 | 3300025935 | Ga0207709_10104762 | Ga0207709_101047621 | 431 |
| 105 | 3300025938 | Ga0207704_10053770 | Ga0207704_100537703 | 431 |
| 106 | 3300025942 | Ga0207689_10000156 | Ga0207689_1000015645 | 431 |
| 107 | 3300026023 | Ga0207677_10075313 | Ga0207677_100753133 | 431 |
| 108 | 3300026035 | Ga0207703_10038328 | Ga0207703_100383282 | 431 |
| 109 | 3300026075 | Ga0207708_10002916 | Ga0207708_100029162 | 431 |
| 110 | 3300026089 | Ga0207648_10000131 | Ga0207648_1000013164 | 431 |
| 111 | 3300026118 | Ga0207675_100000084 | Ga0207675_10000008427 | 431 |
| 112 | 3300028380 | Ga0268265_10021192 | Ga0268265_100211922 | 431 |
| 113 | 3300028381 | Ga0268264_10014632 | Ga0268264_100146322 | 431 |
| 114 | 3300032005 | Ga0307411_10051387 | Ga0307411_100513873 | 431 |
| 115 | 3300045051 | Ga0451576_0100505 | Ga0451576_0100505_321_1631 | 431 |
| 116 | 3300048903 | Ga0496100_0169783 | Ga0496100_0169783_187_1497 | 431 |
| 117 | 3300048910 | Ga0496107_0117423 | Ga0496107_0117423_476_1786 | 431 |
| 118 | 3300048917 | Ga0496114_0028994 | Ga0496114_0028994_230_1564 | 431 |
| 119 | 3300050508 | nmdc:mga09592_30226_c1 | nmdc:mga09592_30226_c1_352_1659 | 431 |
| 120 | 3300050509 | nmdc:mga0qj67_178219_c1 | nmdc:mga0qj67_178219_c1_200_1507 | 431 |
| 121 | 3300050510 | nmdc:mga06r32_812_c1 | nmdc:mga06r32_812_c1_25204_26511 | 431 |
| 122 | 3300005327 | Ga0070658_10091341 | Ga0070658_100913412 | 432 |
| 123 | 3300005328 | Ga0070676_10004249 | Ga0070676_100042494 | 432 |
| 124 | 3300005328 | Ga0070676_10070082 | Ga0070676_100700822 | 432 |
| 125 | 3300005329 | Ga0070683_100022323 | Ga0070683_1000223231 | 432 |
| 126 | 3300005331 | Ga0070670_100028538 | Ga0070670_1000285383 | 432 |
| 127 | 3300005334 | Ga0068869_100003777 | Ga0068869_1000037778 | 432 |
| 128 | 3300005335 | Ga0070666_10067613 | Ga0070666_100676132 | 432 |
| 129 | 3300005336 | Ga0070680_100171981 | Ga0070680_1001719811 | 432 |
| 130 | 3300005338 | Ga0068868_100136692 | Ga0068868_1001366921 | 432 |
| 131 | 3300005339 | Ga0070660_100115409 | Ga0070660_1001154092 | 432 |
| 132 | 3300005340 | Ga0070689_100013932 | Ga0070689_1000139325 | 432 |
| 133 | 3300005343 | Ga0070687_100021560 | Ga0070687_1000215602 | 432 |
| 134 | 3300005344 | Ga0070661_100005429 | Ga0070661_1000054294 | 432 |
| 135 | 3300005344 | Ga0070661_100087282 | Ga0070661_1000872822 | 432 |
| 136 | 3300005354 | Ga0070675_100165825 | Ga0070675_1001658251 | 432 |
| 137 | 3300005355 | Ga0070671_100004955 | Ga0070671_1000049555 | 432 |
| 138 | 3300005355 | Ga0070671_100006548 | Ga0070671_1000065487 | 432 |
| 139 | 3300005355 | Ga0070671_100026054 | Ga0070671_1000260542 | 432 |
| 140 | 3300005364 | Ga0070673_100008988 | Ga0070673_1000089885 | 432 |
| 141 | 3300005364 | Ga0070673_100217709 | Ga0070673_1002177092 | 432 |
| 142 | 3300005365 | Ga0070688_100024961 | Ga0070688_1000249613 | 432 |
| 143 | 3300005366 | Ga0070659_100065208 | Ga0070659_1000652082 | 432 |
| 144 | 3300005366 | Ga0070659_100072790 | Ga0070659_1000727902 | 432 |
| 145 | 3300005367 | Ga0070667_100031905 | Ga0070667_1000319052 | 432 |
| 146 | 3300005434 | Ga0070709_10079172 | Ga0070709_100791722 | 432 |
| 147 | 3300005441 | Ga0070700_100014588 | Ga0070700_1000145883 | 432 |
| 148 | 3300005455 | Ga0070663_100013073 | Ga0070663_1000130732 | 432 |
| 149 | 3300005457 | Ga0070662_100000408 | Ga0070662_10000040815 | 432 |
| 150 | 3300005539 | Ga0068853_100008754 | Ga0068853_1000087544 | 432 |
| 151 | 3300005543 | Ga0070672_100154487 | Ga0070672_1001544871 | 432 |
| 152 | 3300005544 | Ga0070686_100026482 | Ga0070686_1000264821 | 432 |
| 153 | 3300005548 | Ga0070665_100029715 | Ga0070665_1000297152 | 432 |
| 154 | 3300005563 | Ga0068855_100000446 | Ga0068855_10000044615 | 432 |
| 155 | 3300005563 | Ga0068855_100033254 | Ga0068855_1000332546 | 432 |
| 156 | 3300005563 | Ga0068855_100066882 | Ga0068855_1000668823 | 432 |
| 157 | 3300005564 | Ga0070664_100001654 | Ga0070664_1000016544 | 432 |
| 158 | 3300005564 | Ga0070664_100028764 | Ga0070664_1000287643 | 432 |
| 159 | 3300005564 | Ga0070664_100225025 | Ga0070664_1002250251 | 432 |
| 160 | 3300005577 | Ga0068857_100010303 | Ga0068857_1000103032 | 432 |
| 161 | 3300005578 | Ga0068854_100050570 | Ga0068854_1000505701 | 432 |
| 162 | 3300005614 | Ga0068856_100000418 | Ga0068856_10000041827 | 432 |
| 163 | 3300005614 | Ga0068856_100099304 | Ga0068856_1000993042 | 432 |
| 164 | 3300005615 | Ga0070702_100016722 | Ga0070702_1000167223 | 432 |
| 165 | 3300005616 | Ga0068852_100011110 | Ga0068852_1000111102 | 432 |
| 166 | 3300005617 | Ga0068859_100095565 | Ga0068859_1000955652 | 432 |
| 167 | 3300005618 | Ga0068864_100088765 | Ga0068864_1000887652 | 432 |
| 168 | 3300005718 | Ga0068866_10002710 | Ga0068866_100027102 | 432 |
| 169 | 3300005719 | Ga0068861_100013882 | Ga0068861_1000138825 | 432 |
| 170 | 3300005840 | Ga0068870_10006416 | Ga0068870_100064164 | 432 |
| 171 | 3300005842 | Ga0068858_100123481 | Ga0068858_1001234813 | 432 |
| 172 | 3300005844 | Ga0068862_100012664 | Ga0068862_1000126642 | 432 |
| 173 | 3300006173 | Ga0070716_100001986 | Ga0070716_1000019865 | 432 |
| 174 | 3300006237 | Ga0097621_100019887 | Ga0097621_1000198875 | 432 |
| 175 | 3300006358 | Ga0068871_100020334 | Ga0068871_1000203344 | 432 |
| 176 | 3300006881 | Ga0068865_100043549 | Ga0068865_1000435491 | 432 |
| 177 | 3300006914 | Ga0075436_100003228 | Ga0075436_1000032287 | 432 |
| 178 | 3300006931 | Ga0097620_100095571 | Ga0097620_1000955712 | 432 |
| 179 | 3300007265 | Ga0099794_10009164 | Ga0099794_100091642 | 432 |
| 180 | 3300009093 | Ga0105240_10019253 | Ga0105240_100192533 | 432 |
| 181 | 3300009177 | Ga0105248_10002576 | Ga0105248_100025764 | 432 |
| 182 | 3300009177 | Ga0105248_10199327 | Ga0105248_101993271 | 432 |
| 183 | 3300009553 | Ga0105249_10081638 | Ga0105249_100816382 | 432 |
| 184 | 3300009553 | Ga0105249_10131918 | Ga0105249_101319182 | 432 |
| 185 | 3300013100 | Ga0157373_10002367 | Ga0157373_1000236713 | 432 |
| 186 | 3300013102 | Ga0157371_10000303 | Ga0157371_1000030315 | 432 |
| 187 | 3300013105 | Ga0157369_10008265 | Ga0157369_100082655 | 432 |
| 188 | 3300013296 | Ga0157374_10017795 | Ga0157374_100177955 | 432 |
| 189 | 3300013296 | Ga0157374_10285258 | Ga0157374_102852581 | 432 |
| 190 | 3300013297 | Ga0157378_10017022 | Ga0157378_100170224 | 432 |
| 191 | 3300013307 | Ga0157372_10000697 | Ga0157372_1000069715 | 432 |
| 192 | 3300013307 | Ga0157372_10007476 | Ga0157372_100074768 | 432 |
| 193 | 3300013307 | Ga0157372_10046020 | Ga0157372_100460203 | 432 |
| 194 | 3300013308 | Ga0157375_10249925 | Ga0157375_102499252 | 432 |
| 195 | 3300014325 | Ga0163163_10005701 | Ga0163163_100057014 | 432 |
| 196 | 3300014326 | Ga0157380_10114274 | Ga0157380_101142742 | 432 |
| 197 | 3300014745 | Ga0157377_10028035 | Ga0157377_100280352 | 432 |
| 198 | 3300014968 | Ga0157379_10044720 | Ga0157379_100447203 | 432 |
| 199 | 3300017792 | Ga0163161_10012835 | Ga0163161_100128355 | 432 |
| 200 | 3300025290 | Ga0207673_1006063 | Ga0207673_10060632 | 432 |
| 201 | 3300025315 | Ga0207697_10000773 | Ga0207697_100007736 | 432 |
| 202 | 3300025893 | Ga0207682_10000450 | Ga0207682_100004506 | 432 |
| 203 | 3300025901 | Ga0207688_10000624 | Ga0207688_1000062413 | 432 |
| 204 | 3300025903 | Ga0207680_10048809 | Ga0207680_100488091 | 432 |
| 205 | 3300025907 | Ga0207645_10004261 | Ga0207645_100042616 | 432 |
| 206 | 3300025907 | Ga0207645_10004739 | Ga0207645_100047393 | 432 |
| 207 | 3300025907 | Ga0207645_10064542 | Ga0207645_100645424 | 432 |
| 208 | 3300025908 | Ga0207643_10001509 | Ga0207643_100015099 | 432 |
| 209 | 3300025909 | Ga0207705_10204508 | Ga0207705_102045082 | 432 |
| 210 | 3300025918 | Ga0207662_10025321 | Ga0207662_100253212 | 432 |
| 211 | 3300025919 | Ga0207657_10001131 | Ga0207657_1000113123 | 432 |
| 212 | 3300025920 | Ga0207649_10001689 | Ga0207649_100016896 | 432 |
| 213 | 3300025923 | Ga0207681_10079958 | Ga0207681_100799582 | 432 |
| 214 | 3300025924 | Ga0207694_10070723 | Ga0207694_100707233 | 432 |
| 215 | 3300025925 | Ga0207650_10006114 | Ga0207650_100061145 | 432 |
| 216 | 3300025926 | Ga0207659_10011055 | Ga0207659_100110552 | 432 |
| 217 | 3300025931 | Ga0207644_10008411 | Ga0207644_100084112 | 432 |
| 218 | 3300025931 | Ga0207644_10023989 | Ga0207644_100239893 | 432 |
| 219 | 3300025931 | Ga0207644_10048403 | Ga0207644_100484032 | 432 |
| 220 | 3300025932 | Ga0207690_10000955 | Ga0207690_1000095518 | 432 |
| 221 | 3300025932 | Ga0207690_10017119 | Ga0207690_100171192 | 432 |
| 222 | 3300025933 | Ga0207706_10000023 | Ga0207706_1000002380 | 432 |
| 223 | 3300025933 | Ga0207706_10001994 | Ga0207706_100019946 | 432 |
| 224 | 3300025933 | Ga0207706_10109603 | Ga0207706_101096032 | 432 |
| 225 | 3300025939 | Ga0207665_10000689 | Ga0207665_1000068916 | 432 |
| 226 | 3300025940 | Ga0207691_10001973 | Ga0207691_100019736 | 432 |
| 227 | 3300025940 | Ga0207691_10028393 | Ga0207691_100283936 | 432 |
| 228 | 3300025941 | Ga0207711_10007918 | Ga0207711_100079182 | 432 |
| 229 | 3300025941 | Ga0207711_10056754 | Ga0207711_100567542 | 432 |
| 230 | 3300025942 | Ga0207689_10000356 | Ga0207689_1000035636 | 432 |
| 231 | 3300025944 | Ga0207661_10156828 | Ga0207661_101568282 | 432 |
| 232 | 3300025944 | Ga0207661_10201225 | Ga0207661_102012251 | 432 |
| 233 | 3300025945 | Ga0207679_10000921 | Ga0207679_1000092116 | 432 |
| 234 | 3300025945 | Ga0207679_10022254 | Ga0207679_100222542 | 432 |
| 235 | 3300025945 | Ga0207679_10285787 | Ga0207679_102857871 | 432 |
| 236 | 3300025949 | Ga0207667_10000758 | Ga0207667_1000075823 | 432 |
| 237 | 3300025949 | Ga0207667_10019494 | Ga0207667_100194942 | 432 |
| 238 | 3300025960 | Ga0207651_10002721 | Ga0207651_100027216 | 432 |
| 239 | 3300025960 | Ga0207651_10053579 | Ga0207651_100535792 | 432 |
| 240 | 3300025972 | Ga0207668_10113006 | Ga0207668_101130062 | 432 |
| 241 | 3300025981 | Ga0207640_10005966 | Ga0207640_100059667 | 432 |
| 242 | 3300025986 | Ga0207658_10017195 | Ga0207658_100171953 | 432 |
| 243 | 3300026023 | Ga0207677_10029697 | Ga0207677_100296972 | 432 |
| 244 | 3300026035 | Ga0207703_10021430 | Ga0207703_100214302 | 432 |
| 245 | 3300026041 | Ga0207639_10016150 | Ga0207639_100161505 | 432 |
| 246 | 3300026041 | Ga0207639_10029303 | Ga0207639_100293033 | 432 |
| 247 | 3300026067 | Ga0207678_10007347 | Ga0207678_100073477 | 432 |
| 248 | 3300026067 | Ga0207678_10092253 | Ga0207678_100922532 | 432 |
| 249 | 3300026075 | Ga0207708_10003451 | Ga0207708_100034517 | 432 |
| 250 | 3300026078 | Ga0207702_10093620 | Ga0207702_100936202 | 432 |
| 251 | 3300026088 | Ga0207641_10189242 | Ga0207641_101892422 | 432 |
| 252 | 3300026089 | Ga0207648_10006719 | Ga0207648_100067199 | 432 |
| 253 | 3300026116 | Ga0207674_10003777 | Ga0207674_100037776 | 432 |
| 254 | 3300026118 | Ga0207675_100003475 | Ga0207675_10000347513 | 432 |
| 255 | 3300026118 | Ga0207675_100114847 | Ga0207675_1001148474 | 432 |
| 256 | 3300026121 | Ga0207683_10098736 | Ga0207683_100987362 | 432 |
| 257 | 3300026142 | Ga0207698_10032398 | Ga0207698_100323983 | 432 |
| 258 | 3300026142 | Ga0207698_10086596 | Ga0207698_100865962 | 432 |
| 259 | 3300026142 | Ga0207698_10217694 | Ga0207698_102176942 | 432 |
| 260 | 3300027665 | Ga0209983_1006691 | Ga0209983_10066912 | 432 |
| 261 | 3300027682 | Ga0209971_1003106 | Ga0209971_10031063 | 432 |
| 262 | 3300027717 | Ga0209998_10004607 | Ga0209998_100046072 | 432 |
| 263 | 3300027876 | Ga0209974_10000416 | Ga0209974_1000041613 | 432 |
| 264 | 3300031548 | Ga0307408_100035285 | Ga0307408_1000352852 | 432 |
| 265 | 3300031731 | Ga0307405_10027286 | Ga0307405_100272861 | 432 |
| 266 | 3300031824 | Ga0307413_10013141 | Ga0307413_100131413 | 432 |
| 267 | 3300031903 | Ga0307407_10031575 | Ga0307407_100315752 | 432 |
| 268 | 3300031911 | Ga0307412_10093807 | Ga0307412_100938072 | 432 |
| 269 | 3300032005 | Ga0307411_10013827 | Ga0307411_100138272 | 432 |
| 270 | 3300035083 | Ga0373926_0032533 | Ga0373926_0032533_283_1596 | 432 |
| 271 | 3300035086 | Ga0373934_0026175 | Ga0373934_0026175_67_1380 | 432 |
| 272 | 3300035118 | Ga0373954_0002509 | Ga0373954_0002509_292_1605 | 432 |
| 273 | 3300035118 | Ga0373954_0057387 | Ga0373954_0057387_252_1565 | 432 |
| 274 | 3300035119 | Ga0373956_0006016 | Ga0373956_0006016_3497_4810 | 432 |
| 275 | 3300035119 | Ga0373956_0024752 | Ga0373956_0024752_354_1667 | 432 |
| 276 | 3300035172 | Ga0373955_0071631 | Ga0373955_0071631_43_1356 | 432 |
| 277 | 3300035172 | Ga0373955_0093536 | Ga0373955_0093536_50_1363 | 432 |
| 278 | 3300035410 | Ga0373924_0022609 | Ga0373924_0022609_517_1830 | 432 |
| 279 | 3300035691 | Ga0373931_0016282 | Ga0373931_0016282_1224_2540 | 432 |
| 280 | 3300035692 | Ga0373935_0034864 | Ga0373935_0034864_80_1393 | 432 |
| 281 | 3300035695 | Ga0373927_0073388 | Ga0373927_0073388_600_1916 | 432 |
| 282 | 3300035724 | Ga0373933_0001392 | Ga0373933_0001392_8631_9944 | 432 |
| 283 | 3300035724 | Ga0373933_0013082 | Ga0373933_0013082_3045_4358 | 432 |
| 284 | 3300035724 | Ga0373933_0100565 | Ga0373933_0100565_120_1433 | 432 |
| 285 | 3300036401 | Ga0373937_0100340 | Ga0373937_0100340_305_1618 | 432 |
| 286 | 3300036401 | Ga0373937_0259237 | Ga0373937_0259237_260_1600 | 432 |
| 287 | 3300042876 | Ga0451577_0172152 | Ga0451577_0172152_561_1904 | 432 |
| 288 | 3300046454 | Ga0495592_0000449 | Ga0495592_0000449_5799_7112 | 432 |
| 289 | 3300046454 | Ga0495592_0126142 | Ga0495592_0126142_412_1725 | 432 |
| 290 | 3300046461 | Ga0495641_0032708 | Ga0495641_0032708_742_2055 | 432 |
| 291 | 3300046462 | Ga0495651_0005865 | Ga0495651_0005865_984_2297 | 432 |
| 292 | 3300046475 | Ga0495639_0026618 | Ga0495639_0026618_354_1667 | 432 |
| 293 | 3300046476 | Ga0495662_0067504 | Ga0495662_0067504_57_1370 | 432 |
| 294 | 3300046516 | Ga0495628_0001138 | Ga0495628_0001138_3820_5133 | 432 |
| 295 | 3300046516 | Ga0495628_0066320 | Ga0495628_0066320_1132_2436 | 432 |
| 296 | 3300046517 | Ga0495630_0054504 | Ga0495630_0054504_30_1343 | 432 |
| 297 | 3300046529 | Ga0495652_0000659 | Ga0495652_0000659_15768_17081 | 432 |
| 298 | 3300046535 | Ga0495586_0050563 | Ga0495586_0050563_48_1361 | 432 |
| 299 | 3300046543 | Ga0495645_0000440 | Ga0495645_0000440_13432_14745 | 432 |
| 300 | 3300046559 | Ga0495667_0020317 | Ga0495667_0020317_2983_4296 | 432 |
| 301 | 3300046559 | Ga0495667_0030314 | Ga0495667_0030314_1771_3084 | 432 |
| 302 | 3300046559 | Ga0495667_0120564 | Ga0495667_0120564_322_1635 | 432 |
| 303 | 3300046642 | Ga0495634_0084487 | Ga0495634_0084487_681_1994 | 432 |
| 304 | 3300046675 | Ga0495657_0156652 | Ga0495657_0156652_73_1377 | 432 |
| 305 | 3300046678 | Ga0495599_0004166 | Ga0495599_0004166_2509_3822 | 432 |
| 306 | 3300046678 | Ga0495599_0076490 | Ga0495599_0076490_93_1406 | 432 |
| 307 | 3300046690 | Ga0495624_0037097 | Ga0495624_0037097_1080_2393 | 432 |
| 308 | 3300046809 | Ga0495600_0013358 | Ga0495600_0013358_2649_3962 | 432 |
| 309 | 3300047319 | Ga0495674_0038632 | Ga0495674_0038632_353_1666 | 432 |
| 310 | 3300047322 | Ga0495680_0030053 | Ga0495680_0030053_248_1561 | 432 |
| 311 | 3300047444 | Ga0495675_0021513 | Ga0495675_0021513_1751_3064 | 432 |
| 312 | 3300048904 | Ga0496101_0011258 | Ga0496101_0011258_247_1560 | 432 |
| 313 | 3300048907 | Ga0496104_0013445 | Ga0496104_0013445_4564_5877 | 432 |
| 314 | 3300048910 | Ga0496107_0021530 | Ga0496107_0021530_369_1685 | 432 |
| 315 | 3300048911 | Ga0496108_0032097 | Ga0496108_0032097_1198_2511 | 432 |
| 316 | 3300048912 | Ga0496109_0022046 | Ga0496109_0022046_3858_5171 | 432 |
| 317 | 3300048914 | Ga0496111_0181126 | Ga0496111_0181126_82_1395 | 432 |
| 318 | 3300049570 | Ga0501033_0061934 | Ga0501033_0061934_756_2069 | 432 |
| 319 | 3300049572 | Ga0501036_0056028 | Ga0501036_0056028_877_2190 | 432 |
| 320 | 3300049575 | Ga0501039_0006097 | Ga0501039_0006097_3185_4498 | 432 |
| 321 | 3300049576 | Ga0501040_0026030 | Ga0501040_0026030_2422_3735 | 432 |
| 322 | 3300049577 | Ga0501041_0004612 | Ga0501041_0004612_220_1533 | 432 |
| 323 | 3300049578 | Ga0501042_0009824 | Ga0501042_0009824_4816_6129 | 432 |
| 324 | 3300049579 | Ga0501043_0018087 | Ga0501043_0018087_4040_5353 | 432 |
| 325 | 3300049580 | Ga0501046_0125910 | Ga0501046_0125910_311_1624 | 432 |
| 326 | 3300049582 | Ga0501048_0013661 | Ga0501048_0013661_619_1932 | 432 |
| 327 | 3300049588 | Ga0501072_0003128 | Ga0501072_0003128_2357_3670 | 432 |
| 328 | 3300049592 | Ga0501076_0001401 | Ga0501076_0001401_10912_12225 | 432 |
| 329 | 3300049592 | Ga0501076_0022117 | Ga0501076_0022117_1283_2596 | 432 |
| 330 | 3300049593 | Ga0501077_0038307 | Ga0501077_0038307_1176_2549 | 432 |
| 331 | 3300049741 | Ga0501079_0011165 | Ga0501079_0011165_2171_3484 | 432 |
| 332 | 3300049742 | Ga0501080_0004046 | Ga0501080_0004046_519_1832 | 432 |
| 333 | 3300049743 | Ga0501081_0001144 | Ga0501081_0001144_951_2264 | 432 |
| 334 | 3300049824 | Ga0501045_0116137 | Ga0501045_0116137_296_1609 | 432 |
| 335 | 3300050511 | nmdc:mga08y16_33921_c1 | nmdc:mga08y16_33921_c1_237_1550 | 432 |
| 336 | 3300050514 | nmdc:mga08x19_5379_c1 | nmdc:mga08x19_5379_c1_4165_5478 | 432 |
| 337 | 3300053077 | Ga0495601_0007667 | Ga0495601_0007667_2645_3958 | 432 |
| 338 | 3300053084 | Ga0495595_0072999 | Ga0495595_0072999_114_1427 | 432 |
| 339 | 3300053085 | Ga0495619_0014518 | Ga0495619_0014518_1872_3185 | 432 |
| 340 | 3300054114 | Ga0501084_0018856 | Ga0501084_0018856_223_1536 | 432 |
| 341 | 3300060353 | Ga0501082_0004457 | Ga0501082_0004457_3568_4881 | 432 |
| 342 | 3300061734 | Ga0530510_0010172 | Ga0530510_0010172_4953_6266 | 432 |
| 343 | 3300061734 | Ga0530510_0049821 | Ga0530510_0049821_531_1844 | 432 |
| 344 | 3300005327 | Ga0070658_10002818 | Ga0070658_100028189 | 433 |
| 345 | 3300005327 | Ga0070658_10065015 | Ga0070658_100650153 | 433 |
| 346 | 3300005328 | Ga0070676_10001315 | Ga0070676_100013153 | 433 |
| 347 | 3300005329 | Ga0070683_100028571 | Ga0070683_1000285713 | 433 |
| 348 | 3300005331 | Ga0070670_100001918 | Ga0070670_1000019187 | 433 |
| 349 | 3300005331 | Ga0070670_100025763 | Ga0070670_1000257633 | 433 |
| 350 | 3300005331 | Ga0070670_100027040 | Ga0070670_1000270403 | 433 |
| 351 | 3300005331 | Ga0070670_100036152 | Ga0070670_1000361522 | 433 |
| 352 | 3300005331 | Ga0070670_100071650 | Ga0070670_1000716502 | 433 |
| 353 | 3300005334 | Ga0068869_100000754 | Ga0068869_1000007542 | 433 |
| 354 | 3300005335 | Ga0070666_10002654 | Ga0070666_100026543 | 433 |
| 355 | 3300005335 | Ga0070666_10061782 | Ga0070666_100617822 | 433 |
| 356 | 3300005337 | Ga0070682_100022514 | Ga0070682_1000225143 | 433 |
| 357 | 3300005338 | Ga0068868_100000331 | Ga0068868_10000033126 | 433 |
| 358 | 3300005338 | Ga0068868_100022802 | Ga0068868_1000228023 | 433 |
| 359 | 3300005339 | Ga0070660_100006726 | Ga0070660_1000067263 | 433 |
| 360 | 3300005339 | Ga0070660_100059575 | Ga0070660_1000595752 | 433 |
| 361 | 3300005339 | Ga0070660_100081270 | Ga0070660_1000812702 | 433 |
| 362 | 3300005340 | Ga0070689_100068077 | Ga0070689_1000680772 | 433 |
| 363 | 3300005344 | Ga0070661_100001661 | Ga0070661_1000016613 | 433 |
| 364 | 3300005344 | Ga0070661_100008702 | Ga0070661_1000087026 | 433 |
| 365 | 3300005344 | Ga0070661_100010495 | Ga0070661_1000104956 | 433 |
| 366 | 3300005347 | Ga0070668_100001693 | Ga0070668_1000016933 | 433 |
| 367 | 3300005347 | Ga0070668_100027410 | Ga0070668_1000274102 | 433 |
| 368 | 3300005347 | Ga0070668_100037212 | Ga0070668_1000372122 | 433 |
| 369 | 3300005347 | Ga0070668_100158638 | Ga0070668_1001586382 | 433 |
| 370 | 3300005353 | Ga0070669_100004986 | Ga0070669_1000049863 | 433 |
| 371 | 3300005353 | Ga0070669_100075859 | Ga0070669_1000758593 | 433 |
| 372 | 3300005353 | Ga0070669_100109037 | Ga0070669_1001090372 | 433 |
| 373 | 3300005354 | Ga0070675_100002186 | Ga0070675_10000218610 | 433 |
| 374 | 3300005354 | Ga0070675_100003389 | Ga0070675_1000033895 | 433 |
| 375 | 3300005354 | Ga0070675_100018910 | Ga0070675_1000189104 | 433 |
| 376 | 3300005354 | Ga0070675_100033543 | Ga0070675_1000335432 | 433 |
| 377 | 3300005354 | Ga0070675_100261446 | Ga0070675_1002614461 | 433 |
| 378 | 3300005355 | Ga0070671_100013316 | Ga0070671_1000133163 | 433 |
| 379 | 3300005355 | Ga0070671_100042738 | Ga0070671_1000427382 | 433 |
| 380 | 3300005355 | Ga0070671_100061778 | Ga0070671_1000617782 | 433 |
| 381 | 3300005356 | Ga0070674_100018018 | Ga0070674_1000180183 | 433 |
| 382 | 3300005356 | Ga0070674_100020622 | Ga0070674_1000206223 | 433 |
| 383 | 3300005356 | Ga0070674_100026335 | Ga0070674_1000263353 | 433 |
| 384 | 3300005364 | Ga0070673_100018356 | Ga0070673_1000183564 | 433 |
| 385 | 3300005364 | Ga0070673_100052411 | Ga0070673_1000524112 | 433 |
| 386 | 3300005364 | Ga0070673_100089880 | Ga0070673_1000898803 | 433 |
| 387 | 3300005364 | Ga0070673_100129222 | Ga0070673_1001292222 | 433 |
| 388 | 3300005365 | Ga0070688_100037786 | Ga0070688_1000377863 | 433 |
| 389 | 3300005366 | Ga0070659_100009388 | Ga0070659_1000093884 | 433 |
| 390 | 3300005367 | Ga0070667_100007230 | Ga0070667_1000072303 | 433 |
| 391 | 3300005367 | Ga0070667_100075791 | Ga0070667_1000757912 | 433 |
| 392 | 3300005367 | Ga0070667_100137359 | Ga0070667_1001373592 | 433 |
| 393 | 3300005434 | Ga0070709_10002723 | Ga0070709_100027235 | 433 |
| 394 | 3300005435 | Ga0070714_100000181 | Ga0070714_10000018140 | 433 |
| 395 | 3300005436 | Ga0070713_100008842 | Ga0070713_1000088426 | 433 |
| 396 | 3300005437 | Ga0070710_10024716 | Ga0070710_100247162 | 433 |
| 397 | 3300005439 | Ga0070711_100045623 | Ga0070711_1000456232 | 433 |
| 398 | 3300005439 | Ga0070711_100049911 | Ga0070711_1000499112 | 433 |
| 399 | 3300005440 | Ga0070705_100010619 | Ga0070705_1000106192 | 433 |
| 400 | 3300005441 | Ga0070700_100101104 | Ga0070700_1001011042 | 433 |
| 401 | 3300005445 | Ga0070708_100002049 | Ga0070708_1000020493 | 433 |
| 402 | 3300005455 | Ga0070663_100016349 | Ga0070663_1000163492 | 433 |
| 403 | 3300005456 | Ga0070678_100000798 | Ga0070678_10000079816 | 433 |
| 404 | 3300005456 | Ga0070678_100003408 | Ga0070678_1000034085 | 433 |
| 405 | 3300005456 | Ga0070678_100004668 | Ga0070678_1000046682 | 433 |
| 406 | 3300005456 | Ga0070678_100098283 | Ga0070678_1000982832 | 433 |
| 407 | 3300005457 | Ga0070662_100024047 | Ga0070662_1000240472 | 433 |
| 408 | 3300005458 | Ga0070681_10008661 | Ga0070681_100086617 | 433 |
| 409 | 3300005458 | Ga0070681_10048491 | Ga0070681_100484912 | 433 |
| 410 | 3300005459 | Ga0068867_100005477 | Ga0068867_1000054775 | 433 |
| 411 | 3300005459 | Ga0068867_100023773 | Ga0068867_1000237731 | 433 |
| 412 | 3300005459 | Ga0068867_100029903 | Ga0068867_1000299034 | 433 |
| 413 | 3300005459 | Ga0068867_100092481 | Ga0068867_1000924811 | 433 |
| 414 | 3300005459 | Ga0068867_100105628 | Ga0068867_1001056281 | 433 |
| 415 | 3300005518 | Ga0070699_100006309 | Ga0070699_1000063094 | 433 |
| 416 | 3300005530 | Ga0070679_100016424 | Ga0070679_1000164242 | 433 |
| 417 | 3300005530 | Ga0070679_100071283 | Ga0070679_1000712833 | 433 |
| 418 | 3300005535 | Ga0070684_100030046 | Ga0070684_1000300463 | 433 |
| 419 | 3300005539 | Ga0068853_100017674 | Ga0068853_1000176743 | 433 |
| 420 | 3300005539 | Ga0068853_100030893 | Ga0068853_1000308932 | 433 |
| 421 | 3300005539 | Ga0068853_100333599 | Ga0068853_1003335991 | 433 |
| 422 | 3300005543 | Ga0070672_100001410 | Ga0070672_1000014103 | 433 |
| 423 | 3300005543 | Ga0070672_100003340 | Ga0070672_1000033404 | 433 |
| 424 | 3300005543 | Ga0070672_100009746 | Ga0070672_1000097463 | 433 |
| 425 | 3300005548 | Ga0070665_100001882 | Ga0070665_1000018823 | 433 |
| 426 | 3300005548 | Ga0070665_100020892 | Ga0070665_1000208922 | 433 |
| 427 | 3300005563 | Ga0068855_100012930 | Ga0068855_1000129305 | 433 |
| 428 | 3300005563 | Ga0068855_100060258 | Ga0068855_1000602584 | 433 |
| 429 | 3300005563 | Ga0068855_100062422 | Ga0068855_1000624223 | 433 |
| 430 | 3300005563 | Ga0068855_100148008 | Ga0068855_1001480082 | 433 |
| 431 | 3300005564 | Ga0070664_100007848 | Ga0070664_1000078481 | 433 |
| 432 | 3300005564 | Ga0070664_100016574 | Ga0070664_1000165746 | 433 |
| 433 | 3300005564 | Ga0070664_100028590 | Ga0070664_1000285902 | 433 |
| 434 | 3300005577 | Ga0068857_100004996 | Ga0068857_1000049963 | 433 |
| 435 | 3300005578 | Ga0068854_100014448 | Ga0068854_1000144482 | 433 |
| 436 | 3300005614 | Ga0068856_100002692 | Ga0068856_10000269219 | 433 |
| 437 | 3300005614 | Ga0068856_100043154 | Ga0068856_1000431542 | 433 |
| 438 | 3300005614 | Ga0068856_100108587 | Ga0068856_1001085872 | 433 |
| 439 | 3300005615 | Ga0070702_100025182 | Ga0070702_1000251822 | 433 |
| 440 | 3300005616 | Ga0068852_100003068 | Ga0068852_1000030684 | 433 |
| 441 | 3300005617 | Ga0068859_100009665 | Ga0068859_1000096653 | 433 |
| 442 | 3300005617 | Ga0068859_100013680 | Ga0068859_1000136802 | 433 |
| 443 | 3300005617 | Ga0068859_100227830 | Ga0068859_1002278302 | 433 |
| 444 | 3300005618 | Ga0068864_100001133 | Ga0068864_10000113320 | 433 |
| 445 | 3300005618 | Ga0068864_100001473 | Ga0068864_10000147317 | 433 |
| 446 | 3300005618 | Ga0068864_100006751 | Ga0068864_1000067514 | 433 |
| 447 | 3300005618 | Ga0068864_100021353 | Ga0068864_1000213533 | 433 |
| 448 | 3300005618 | Ga0068864_100079912 | Ga0068864_1000799123 | 433 |
| 449 | 3300005718 | Ga0068866_10028293 | Ga0068866_100282932 | 433 |
| 450 | 3300005719 | Ga0068861_100009329 | Ga0068861_1000093293 | 433 |
| 451 | 3300005719 | Ga0068861_100103362 | Ga0068861_1001033622 | 433 |
| 452 | 3300005834 | Ga0068851_10004519 | Ga0068851_100045192 | 433 |
| 453 | 3300005834 | Ga0068851_10056785 | Ga0068851_100567852 | 433 |
| 454 | 3300005840 | Ga0068870_10002168 | Ga0068870_100021683 | 433 |
| 455 | 3300005840 | Ga0068870_10002355 | Ga0068870_100023553 | 433 |
| 456 | 3300005841 | Ga0068863_100000926 | Ga0068863_10000092615 | 433 |
| 457 | 3300005841 | Ga0068863_100002580 | Ga0068863_1000025803 | 433 |
| 458 | 3300005841 | Ga0068863_100015831 | Ga0068863_1000158313 | 433 |
| 459 | 3300005841 | Ga0068863_100038818 | Ga0068863_1000388184 | 433 |
| 460 | 3300005841 | Ga0068863_100208846 | Ga0068863_1002088462 | 433 |
| 461 | 3300005842 | Ga0068858_100003386 | Ga0068858_1000033863 | 433 |
| 462 | 3300005842 | Ga0068858_100011276 | Ga0068858_1000112764 | 433 |
| 463 | 3300005842 | Ga0068858_100013794 | Ga0068858_1000137943 | 433 |
| 464 | 3300005842 | Ga0068858_100027866 | Ga0068858_1000278663 | 433 |
| 465 | 3300005842 | Ga0068858_100027946 | Ga0068858_1000279465 | 433 |
| 466 | 3300005842 | Ga0068858_100145844 | Ga0068858_1001458442 | 433 |
| 467 | 3300005843 | Ga0068860_100001199 | Ga0068860_10000119915 | 433 |
| 468 | 3300005843 | Ga0068860_100009785 | Ga0068860_1000097854 | 433 |
| 469 | 3300005843 | Ga0068860_100030080 | Ga0068860_1000300803 | 433 |
| 470 | 3300005843 | Ga0068860_100091463 | Ga0068860_1000914631 | 433 |
| 471 | 3300005843 | Ga0068860_100104794 | Ga0068860_1001047942 | 433 |
| 472 | 3300005843 | Ga0068860_100166833 | Ga0068860_1001668332 | 433 |
| 473 | 3300005843 | Ga0068860_100263635 | Ga0068860_1002636352 | 433 |
| 474 | 3300005844 | Ga0068862_100003428 | Ga0068862_1000034285 | 433 |
| 475 | 3300005844 | Ga0068862_100025506 | Ga0068862_1000255064 | 433 |
| 476 | 3300005844 | Ga0068862_100052797 | Ga0068862_1000527973 | 433 |
| 477 | 3300005844 | Ga0068862_100133146 | Ga0068862_1001331462 | 433 |
| 478 | 3300005844 | Ga0068862_100256340 | Ga0068862_1002563401 | 433 |
| 479 | 3300005985 | Ga0081539_10008389 | Ga0081539_100083894 | 433 |
| 480 | 3300006195 | Ga0075366_10000310 | Ga0075366_100003105 | 433 |
| 481 | 3300006237 | Ga0097621_100001144 | Ga0097621_10000114415 | 433 |
| 482 | 3300006237 | Ga0097621_100019011 | Ga0097621_1000190113 | 433 |
| 483 | 3300006237 | Ga0097621_100106286 | Ga0097621_1001062862 | 433 |
| 484 | 3300006358 | Ga0068871_100010412 | Ga0068871_1000104127 | 433 |
| 485 | 3300006358 | Ga0068871_100010933 | Ga0068871_1000109335 | 433 |
| 486 | 3300006358 | Ga0068871_100060833 | Ga0068871_1000608333 | 433 |
| 487 | 3300006358 | Ga0068871_100075336 | Ga0068871_1000753362 | 433 |
| 488 | 3300006358 | Ga0068871_100077274 | Ga0068871_1000772742 | 433 |
| 489 | 3300006871 | Ga0075434_100175498 | Ga0075434_1001754982 | 433 |
| 490 | 3300006881 | Ga0068865_100016281 | Ga0068865_1000162813 | 433 |
| 491 | 3300006881 | Ga0068865_100040902 | Ga0068865_1000409023 | 433 |
| 492 | 3300006931 | Ga0097620_100009664 | Ga0097620_1000096643 | 433 |
| 493 | 3300006931 | Ga0097620_100013680 | Ga0097620_1000136805 | 433 |
| 494 | 3300006931 | Ga0097620_100227815 | Ga0097620_1002278152 | 433 |
| 495 | 3300009093 | Ga0105240_10016077 | Ga0105240_100160772 | 433 |
| 496 | 3300009093 | Ga0105240_10020409 | Ga0105240_100204092 | 433 |
| 497 | 3300009093 | Ga0105240_10118753 | Ga0105240_101187533 | 433 |
| 498 | 3300009148 | Ga0105243_10036829 | Ga0105243_100368291 | 433 |
| 499 | 3300009174 | Ga0105241_10005388 | Ga0105241_100053885 | 433 |
| 500 | 3300009174 | Ga0105241_10059368 | Ga0105241_100593683 | 433 |
| 501 | 3300009177 | Ga0105248_10002137 | Ga0105248_100021374 | 433 |
| 502 | 3300009177 | Ga0105248_10002406 | Ga0105248_1000240619 | 433 |
| 503 | 3300009177 | Ga0105248_10087383 | Ga0105248_100873832 | 433 |
| 504 | 3300009545 | Ga0105237_10050564 | Ga0105237_100505643 | 433 |
| 505 | 3300009551 | Ga0105238_10001151 | Ga0105238_1000115119 | 433 |
| 506 | 3300009551 | Ga0105238_10016621 | Ga0105238_100166212 | 433 |
| 507 | 3300009553 | Ga0105249_10034951 | Ga0105249_100349513 | 433 |
| 508 | 3300009553 | Ga0105249_10104951 | Ga0105249_101049513 | 433 |
| 509 | 3300013100 | Ga0157373_10007388 | Ga0157373_100073886 | 433 |
| 510 | 3300013100 | Ga0157373_10027061 | Ga0157373_100270612 | 433 |
| 511 | 3300013102 | Ga0157371_10026330 | Ga0157371_100263304 | 433 |
| 512 | 3300013104 | Ga0157370_10005226 | Ga0157370_100052269 | 433 |
| 513 | 3300013104 | Ga0157370_10009339 | Ga0157370_100093396 | 433 |
| 514 | 3300013104 | Ga0157370_10026960 | Ga0157370_100269603 | 433 |
| 515 | 3300013104 | Ga0157370_10029442 | Ga0157370_100294426 | 433 |
| 516 | 3300013104 | Ga0157370_10064548 | Ga0157370_100645482 | 433 |
| 517 | 3300013104 | Ga0157370_10121566 | Ga0157370_101215662 | 433 |
| 518 | 3300013105 | Ga0157369_10004421 | Ga0157369_1000442112 | 433 |
| 519 | 3300013105 | Ga0157369_10070675 | Ga0157369_100706752 | 433 |
| 520 | 3300013105 | Ga0157369_10096169 | Ga0157369_100961691 | 433 |
| 521 | 3300013105 | Ga0157369_10137920 | Ga0157369_101379202 | 433 |
| 522 | 3300013296 | Ga0157374_10006165 | Ga0157374_100061655 | 433 |
| 523 | 3300013297 | Ga0157378_10034161 | Ga0157378_100341613 | 433 |
| 524 | 3300013297 | Ga0157378_10154106 | Ga0157378_101541061 | 433 |
| 525 | 3300013306 | Ga0163162_10005453 | Ga0163162_100054535 | 433 |
| 526 | 3300013306 | Ga0163162_10027395 | Ga0163162_100273954 | 433 |
| 527 | 3300013306 | Ga0163162_10027992 | Ga0163162_100279924 | 433 |
| 528 | 3300013306 | Ga0163162_10192072 | Ga0163162_101920722 | 433 |
| 529 | 3300013307 | Ga0157372_10013266 | Ga0157372_100132662 | 433 |
| 530 | 3300013307 | Ga0157372_10074469 | Ga0157372_100744693 | 433 |
| 531 | 3300013307 | Ga0157372_10086192 | Ga0157372_100861922 | 433 |
| 532 | 3300013308 | Ga0157375_10001643 | Ga0157375_1000164315 | 433 |
| 533 | 3300013308 | Ga0157375_10045571 | Ga0157375_100455713 | 433 |
| 534 | 3300013308 | Ga0157375_10067589 | Ga0157375_100675892 | 433 |
| 535 | 3300014325 | Ga0163163_10010919 | Ga0163163_100109193 | 433 |
| 536 | 3300014325 | Ga0163163_10139510 | Ga0163163_101395103 | 433 |
| 537 | 3300014326 | Ga0157380_10062492 | Ga0157380_100624922 | 433 |
| 538 | 3300014326 | Ga0157380_10116030 | Ga0157380_101160302 | 433 |
| 539 | 3300014968 | Ga0157379_10002346 | Ga0157379_100023464 | 433 |
| 540 | 3300014968 | Ga0157379_10007068 | Ga0157379_100070683 | 433 |
| 541 | 3300014968 | Ga0157379_10011575 | Ga0157379_100115752 | 433 |
| 542 | 3300014968 | Ga0157379_10147406 | Ga0157379_101474062 | 433 |
| 543 | 3300014968 | Ga0157379_10179313 | Ga0157379_101793132 | 433 |
| 544 | 3300014969 | Ga0157376_10009076 | Ga0157376_100090764 | 433 |
| 545 | 3300014969 | Ga0157376_10013612 | Ga0157376_100136122 | 433 |
| 546 | 3300014969 | Ga0157376_10028202 | Ga0157376_100282023 | 433 |
| 547 | 3300014969 | Ga0157376_10077975 | Ga0157376_100779752 | 433 |
| 548 | 3300017792 | Ga0163161_10019362 | Ga0163161_100193623 | 433 |
| 549 | 3300020082 | Ga0206353_10212916 | Ga0206353_102129162 | 433 |
| 550 | 3300025315 | Ga0207697_10002747 | Ga0207697_100027473 | 433 |
| 551 | 3300025315 | Ga0207697_10031146 | Ga0207697_100311462 | 433 |
| 552 | 3300025315 | Ga0207697_10062282 | Ga0207697_100622821 | 433 |
| 553 | 3300025321 | Ga0207656_10026039 | Ga0207656_100260391 | 433 |
| 554 | 3300025899 | Ga0207642_10031977 | Ga0207642_100319772 | 433 |
| 555 | 3300025901 | Ga0207688_10006888 | Ga0207688_100068883 | 433 |
| 556 | 3300025901 | Ga0207688_10013405 | Ga0207688_100134052 | 433 |
| 557 | 3300025903 | Ga0207680_10010559 | Ga0207680_100105593 | 433 |
| 558 | 3300025903 | Ga0207680_10012191 | Ga0207680_100121913 | 433 |
| 559 | 3300025907 | Ga0207645_10000241 | Ga0207645_1000024133 | 433 |
| 560 | 3300025907 | Ga0207645_10019084 | Ga0207645_100190844 | 433 |
| 561 | 3300025907 | Ga0207645_10136745 | Ga0207645_101367452 | 433 |
| 562 | 3300025908 | Ga0207643_10001508 | Ga0207643_100015089 | 433 |
| 563 | 3300025908 | Ga0207643_10012665 | Ga0207643_100126653 | 433 |
| 564 | 3300025909 | Ga0207705_10028758 | Ga0207705_100287582 | 433 |
| 565 | 3300025911 | Ga0207654_10020290 | Ga0207654_100202903 | 433 |
| 566 | 3300025912 | Ga0207707_10063509 | Ga0207707_100635092 | 433 |
| 567 | 3300025912 | Ga0207707_10192213 | Ga0207707_101922132 | 433 |
| 568 | 3300025913 | Ga0207695_10004983 | Ga0207695_100049836 | 433 |
| 569 | 3300025913 | Ga0207695_10009417 | Ga0207695_100094174 | 433 |
| 570 | 3300025914 | Ga0207671_10082410 | Ga0207671_100824102 | 433 |
| 571 | 3300025916 | Ga0207663_10016461 | Ga0207663_100164612 | 433 |
| 572 | 3300025917 | Ga0207660_10007339 | Ga0207660_100073395 | 433 |
| 573 | 3300025919 | Ga0207657_10000160 | Ga0207657_1000016017 | 433 |
| 574 | 3300025919 | Ga0207657_10041915 | Ga0207657_100419154 | 433 |
| 575 | 3300025919 | Ga0207657_10050272 | Ga0207657_100502723 | 433 |
| 576 | 3300025919 | Ga0207657_10069071 | Ga0207657_100690712 | 433 |
| 577 | 3300025919 | Ga0207657_10125689 | Ga0207657_101256892 | 433 |
| 578 | 3300025920 | Ga0207649_10001979 | Ga0207649_100019793 | 433 |
| 579 | 3300025920 | Ga0207649_10004509 | Ga0207649_100045093 | 433 |
| 580 | 3300025920 | Ga0207649_10006307 | Ga0207649_100063072 | 433 |
| 581 | 3300025921 | Ga0207652_10006852 | Ga0207652_100068526 | 433 |
| 582 | 3300025921 | Ga0207652_10017279 | Ga0207652_100172792 | 433 |
| 583 | 3300025921 | Ga0207652_10146661 | Ga0207652_101466612 | 433 |
| 584 | 3300025923 | Ga0207681_10000854 | Ga0207681_100008542 | 433 |
| 585 | 3300025923 | Ga0207681_10077247 | Ga0207681_100772472 | 433 |
| 586 | 3300025923 | Ga0207681_10171959 | Ga0207681_101719592 | 433 |
| 587 | 3300025924 | Ga0207694_10004092 | Ga0207694_100040923 | 433 |
| 588 | 3300025924 | Ga0207694_10012266 | Ga0207694_100122662 | 433 |
| 589 | 3300025925 | Ga0207650_10000838 | Ga0207650_1000083818 | 433 |
| 590 | 3300025925 | Ga0207650_10001440 | Ga0207650_1000144016 | 433 |
| 591 | 3300025925 | Ga0207650_10008750 | Ga0207650_100087504 | 433 |
| 592 | 3300025925 | Ga0207650_10010249 | Ga0207650_100102495 | 433 |
| 593 | 3300025925 | Ga0207650_10030656 | Ga0207650_100306562 | 433 |
| 594 | 3300025925 | Ga0207650_10037369 | Ga0207650_100373692 | 433 |
| 595 | 3300025925 | Ga0207650_10041963 | Ga0207650_100419632 | 433 |
| 596 | 3300025926 | Ga0207659_10000360 | Ga0207659_1000036013 | 433 |
| 597 | 3300025926 | Ga0207659_10162220 | Ga0207659_101622202 | 433 |
| 598 | 3300025929 | Ga0207664_10020199 | Ga0207664_100201993 | 433 |
| 599 | 3300025929 | Ga0207664_10045535 | Ga0207664_100455353 | 433 |
| 600 | 3300025931 | Ga0207644_10001134 | Ga0207644_100011344 | 433 |
| 601 | 3300025931 | Ga0207644_10020376 | Ga0207644_100203764 | 433 |
| 602 | 3300025931 | Ga0207644_10065347 | Ga0207644_100653473 | 433 |
| 603 | 3300025932 | Ga0207690_10139188 | Ga0207690_101391882 | 433 |
| 604 | 3300025932 | Ga0207690_10171294 | Ga0207690_101712942 | 433 |
| 605 | 3300025933 | Ga0207706_10039233 | Ga0207706_100392332 | 433 |
| 606 | 3300025933 | Ga0207706_10061538 | Ga0207706_100615383 | 433 |
| 607 | 3300025933 | Ga0207706_10065036 | Ga0207706_100650362 | 433 |
| 608 | 3300025937 | Ga0207669_10003410 | Ga0207669_100034105 | 433 |
| 609 | 3300025937 | Ga0207669_10004208 | Ga0207669_100042085 | 433 |
| 610 | 3300025937 | Ga0207669_10038364 | Ga0207669_100383642 | 433 |
| 611 | 3300025937 | Ga0207669_10039661 | Ga0207669_100396612 | 433 |
| 612 | 3300025938 | Ga0207704_10001298 | Ga0207704_100012982 | 433 |
| 613 | 3300025940 | Ga0207691_10000368 | Ga0207691_1000036833 | 433 |
| 614 | 3300025940 | Ga0207691_10005465 | Ga0207691_100054659 | 433 |
| 615 | 3300025940 | Ga0207691_10006104 | Ga0207691_100061044 | 433 |
| 616 | 3300025940 | Ga0207691_10035519 | Ga0207691_100355193 | 433 |
| 617 | 3300025940 | Ga0207691_10062461 | Ga0207691_100624612 | 433 |
| 618 | 3300025940 | Ga0207691_10254686 | Ga0207691_102546861 | 433 |
| 619 | 3300025941 | Ga0207711_10153910 | Ga0207711_101539102 | 433 |
| 620 | 3300025942 | Ga0207689_10000038 | Ga0207689_100000387 | 433 |
| 621 | 3300025942 | Ga0207689_10008074 | Ga0207689_100080742 | 433 |
| 622 | 3300025945 | Ga0207679_10088627 | Ga0207679_100886272 | 433 |
| 623 | 3300025945 | Ga0207679_10189840 | Ga0207679_101898401 | 433 |
| 624 | 3300025949 | Ga0207667_10001121 | Ga0207667_1000112110 | 433 |
| 625 | 3300025949 | Ga0207667_10017635 | Ga0207667_100176355 | 433 |
| 626 | 3300025949 | Ga0207667_10106935 | Ga0207667_101069352 | 433 |
| 627 | 3300025960 | Ga0207651_10004440 | Ga0207651_100044406 | 433 |
| 628 | 3300025960 | Ga0207651_10030053 | Ga0207651_100300532 | 433 |
| 629 | 3300025960 | Ga0207651_10093928 | Ga0207651_100939282 | 433 |
| 630 | 3300025972 | Ga0207668_10001355 | Ga0207668_1000135515 | 433 |
| 631 | 3300025972 | Ga0207668_10029264 | Ga0207668_100292643 | 433 |
| 632 | 3300025972 | Ga0207668_10056181 | Ga0207668_100561812 | 433 |
| 633 | 3300025981 | Ga0207640_10033317 | Ga0207640_100333173 | 433 |
| 634 | 3300025981 | Ga0207640_10056264 | Ga0207640_100562642 | 433 |
| 635 | 3300025986 | Ga0207658_10020189 | Ga0207658_100201892 | 433 |
| 636 | 3300025986 | Ga0207658_10040737 | Ga0207658_100407372 | 433 |
| 637 | 3300025986 | Ga0207658_10089373 | Ga0207658_100893731 | 433 |
| 638 | 3300025986 | Ga0207658_10107314 | Ga0207658_101073142 | 433 |
| 639 | 3300025986 | Ga0207658_10172568 | Ga0207658_101725681 | 433 |
| 640 | 3300026023 | Ga0207677_10000770 | Ga0207677_100007705 | 433 |
| 641 | 3300026035 | Ga0207703_10000830 | Ga0207703_100008304 | 433 |
| 642 | 3300026035 | Ga0207703_10017574 | Ga0207703_100175743 | 433 |
| 643 | 3300026035 | Ga0207703_10028916 | Ga0207703_100289162 | 433 |
| 644 | 3300026035 | Ga0207703_10035154 | Ga0207703_100351543 | 433 |
| 645 | 3300026035 | Ga0207703_10130804 | Ga0207703_101308042 | 433 |
| 646 | 3300026041 | Ga0207639_10003604 | Ga0207639_100036044 | 433 |
| 647 | 3300026067 | Ga0207678_10025966 | Ga0207678_100259664 | 433 |
| 648 | 3300026075 | Ga0207708_10017071 | Ga0207708_100170713 | 433 |
| 649 | 3300026075 | Ga0207708_10025022 | Ga0207708_100250224 | 433 |
| 650 | 3300026075 | Ga0207708_10080021 | Ga0207708_100800213 | 433 |
| 651 | 3300026075 | Ga0207708_10193713 | Ga0207708_101937132 | 433 |
| 652 | 3300026078 | Ga0207702_10003505 | Ga0207702_100035054 | 433 |
| 653 | 3300026078 | Ga0207702_10017725 | Ga0207702_100177256 | 433 |
| 654 | 3300026078 | Ga0207702_10043250 | Ga0207702_100432502 | 433 |
| 655 | 3300026088 | Ga0207641_10000735 | Ga0207641_1000073521 | 433 |
| 656 | 3300026088 | Ga0207641_10014768 | Ga0207641_100147684 | 433 |
| 657 | 3300026088 | Ga0207641_10158533 | Ga0207641_101585332 | 433 |
| 658 | 3300026089 | Ga0207648_10000089 | Ga0207648_1000008915 | 433 |
| 659 | 3300026089 | Ga0207648_10007022 | Ga0207648_100070227 | 433 |
| 660 | 3300026089 | Ga0207648_10008186 | Ga0207648_100081862 | 433 |
| 661 | 3300026089 | Ga0207648_10009299 | Ga0207648_100092993 | 433 |
| 662 | 3300026089 | Ga0207648_10040851 | Ga0207648_100408513 | 433 |
| 663 | 3300026089 | Ga0207648_10043857 | Ga0207648_100438571 | 433 |
| 664 | 3300026095 | Ga0207676_10004767 | Ga0207676_100047673 | 433 |
| 665 | 3300026095 | Ga0207676_10012250 | Ga0207676_100122503 | 433 |
| 666 | 3300026095 | Ga0207676_10028759 | Ga0207676_100287593 | 433 |
| 667 | 3300026095 | Ga0207676_10094534 | Ga0207676_100945342 | 433 |
| 668 | 3300026095 | Ga0207676_10113914 | Ga0207676_101139142 | 433 |
| 669 | 3300026116 | Ga0207674_10000053 | Ga0207674_1000005367 | 433 |
| 670 | 3300026116 | Ga0207674_10000236 | Ga0207674_1000023645 | 433 |
| 671 | 3300026116 | Ga0207674_10048923 | Ga0207674_100489234 | 433 |
| 672 | 3300026118 | Ga0207675_100001262 | Ga0207675_10000126218 | 433 |
| 673 | 3300026118 | Ga0207675_100029491 | Ga0207675_1000294912 | 433 |
| 674 | 3300026118 | Ga0207675_100050974 | Ga0207675_1000509742 | 433 |
| 675 | 3300026121 | Ga0207683_10000325 | Ga0207683_1000032521 | 433 |
| 676 | 3300026121 | Ga0207683_10003106 | Ga0207683_100031065 | 433 |
| 677 | 3300026121 | Ga0207683_10011603 | Ga0207683_100116034 | 433 |
| 678 | 3300026121 | Ga0207683_10016833 | Ga0207683_100168333 | 433 |
| 679 | 3300026121 | Ga0207683_10047008 | Ga0207683_100470083 | 433 |
| 680 | 3300026121 | Ga0207683_10140292 | Ga0207683_101402922 | 433 |
| 681 | 3300026142 | Ga0207698_10001020 | Ga0207698_100010209 | 433 |
| 682 | 3300026142 | Ga0207698_10001266 | Ga0207698_100012669 | 433 |
| 683 | 3300026142 | Ga0207698_10064341 | Ga0207698_100643412 | 433 |
| 684 | 3300028379 | Ga0268266_10015641 | Ga0268266_100156416 | 433 |
| 685 | 3300028380 | Ga0268265_10033262 | Ga0268265_100332622 | 433 |
| 686 | 3300028380 | Ga0268265_10064328 | Ga0268265_100643281 | 433 |
| 687 | 3300028380 | Ga0268265_10098932 | Ga0268265_100989321 | 433 |
| 688 | 3300028380 | Ga0268265_10106866 | Ga0268265_101068662 | 433 |
| 689 | 3300028381 | Ga0268264_10003730 | Ga0268264_100037309 | 433 |
| 690 | 3300028381 | Ga0268264_10008746 | Ga0268264_100087463 | 433 |
| 691 | 3300028381 | Ga0268264_10099853 | Ga0268264_100998533 | 433 |
| 692 | 3300028381 | Ga0268264_10267652 | Ga0268264_102676522 | 433 |
| 693 | 3300031235 | Ga0265330_10005529 | Ga0265330_100055292 | 433 |
| 694 | 3300031238 | Ga0265332_10000451 | Ga0265332_1000045123 | 433 |
| 695 | 3300031241 | Ga0265325_10010336 | Ga0265325_100103362 | 433 |
| 696 | 3300031242 | Ga0265329_10000638 | Ga0265329_100006383 | 433 |
| 697 | 3300031344 | Ga0265316_10015495 | Ga0265316_100154953 | 433 |
| 698 | 3300031824 | Ga0307413_10000389 | Ga0307413_100003895 | 433 |
| 699 | 3300031852 | Ga0307410_10018949 | Ga0307410_100189491 | 433 |
| 700 | 3300031901 | Ga0307406_10005268 | Ga0307406_100052684 | 433 |
| 701 | 3300032002 | Ga0307416_100005189 | Ga0307416_1000051895 | 433 |
| 702 | 3300032004 | Ga0307414_10007699 | Ga0307414_100076993 | 433 |
| 703 | 3300032126 | Ga0307415_100030106 | Ga0307415_1000301063 | 433 |
| 704 | 3300037466 | Ga0395898_0258520 | Ga0395898_0258520_146_1465 | 433 |
| 705 | 3300037471 | Ga0395905_0031217 | Ga0395905_0031217_2475_3794 | 433 |
| 706 | 3300041486 | Ga0451807_0007505 | Ga0451807_0007505_116_1435 | 433 |
| 707 | 3300045976 | Ga0466967_0095983 | Ga0466967_0095983_563_1882 | 433 |
| 708 | 3300046537 | Ga0495598_0001069 | Ga0495598_0001069_3292_4614 | 433 |
| 709 | 3300046683 | Ga0495658_0028442 | Ga0495658_0028442_1447_2769 | 433 |
| 710 | 3300048905 | Ga0496102_0020676 | Ga0496102_0020676_2934_4253 | 433 |
| 711 | 3300048906 | Ga0496103_0048807 | Ga0496103_0048807_109_1458 | 433 |
| 712 | 3300048909 | Ga0496106_0133803 | Ga0496106_0133803_448_1767 | 433 |
| 713 | 3300048909 | Ga0496106_0172096 | Ga0496106_0172096_103_1422 | 433 |
| 714 | 3300048911 | Ga0496108_0045263 | Ga0496108_0045263_2273_3592 | 433 |
| 715 | 3300048911 | Ga0496108_0164065 | Ga0496108_0164065_246_1565 | 433 |
| 716 | 3300048911 | Ga0496108_0200125 | Ga0496108_0200125_114_1433 | 433 |
| 717 | 3300048912 | Ga0496109_0013476 | Ga0496109_0013476_191_1510 | 433 |
| 718 | 3300048915 | Ga0496112_0009119 | Ga0496112_0009119_619_1938 | 433 |
| 719 | 3300048915 | Ga0496112_0074107 | Ga0496112_0074107_1897_3216 | 433 |
| 720 | 3300048916 | Ga0496113_0108602 | Ga0496113_0108602_299_1618 | 433 |
| 721 | 3300048917 | Ga0496114_0009997 | Ga0496114_0009997_661_1980 | 433 |
| 722 | 3300048917 | Ga0496114_0133964 | Ga0496114_0133964_97_1452 | 433 |
| 723 | 3300049573 | Ga0501037_0032421 | Ga0501037_0032421_1973_3301 | 433 |
| 724 | 3300049581 | Ga0501047_0004408 | Ga0501047_0004408_3178_4497 | 433 |
| 725 | 3300049586 | Ga0501070_0023657 | Ga0501070_0023657_1540_2859 | 433 |
| 726 | 3300049589 | Ga0501073_0068292 | Ga0501073_0068292_1003_2322 | 433 |
| 727 | 3300049741 | Ga0501079_0099326 | Ga0501079_0099326_15_1334 | 433 |
| 728 | 3300049742 | Ga0501080_0005610 | Ga0501080_0005610_6906_8225 | 433 |
| 729 | 3300049742 | Ga0501080_0312246 | Ga0501080_0312246_70_1413 | 433 |
| 730 | 3300049744 | Ga0501083_0027583 | Ga0501083_0027583_2128_3447 | 433 |
| 731 | 3300049744 | Ga0501083_0110886 | Ga0501083_0110886_110_1453 | 433 |
| 732 | 3300050493 | nmdc:mga0k408_165_c1 | nmdc:mga0k408_165_c1_4933_6285 | 433 |
| 733 | 3300050512 | nmdc:mga0n895_203537_c1 | nmdc:mga0n895_203537_c1_141_1460 | 433 |
| 734 | 3300050515 | nmdc:mga0a205_227090_c1 | nmdc:mga0a205_227090_c1_210_1529 | 433 |
| 735 | 3300053084 | Ga0495595_0039823 | Ga0495595_0039823_278_1597 | 433 |
| 736 | 3300005330 | Ga0070690_100097400 | Ga0070690_1000974001 | 434 |
| 737 | 3300005331 | Ga0070670_100036353 | Ga0070670_1000363532 | 434 |
| 738 | 3300005334 | Ga0068869_100016570 | Ga0068869_1000165703 | 434 |
| 739 | 3300005334 | Ga0068869_100143419 | Ga0068869_1001434192 | 434 |
| 740 | 3300005337 | Ga0070682_100029031 | Ga0070682_1000290311 | 434 |
| 741 | 3300005338 | Ga0068868_100020762 | Ga0068868_1000207623 | 434 |
| 742 | 3300005338 | Ga0068868_100081181 | Ga0068868_1000811812 | 434 |
| 743 | 3300005343 | Ga0070687_100009630 | Ga0070687_1000096303 | 434 |
| 744 | 3300005344 | Ga0070661_100025284 | Ga0070661_1000252842 | 434 |
| 745 | 3300005345 | Ga0070692_10047732 | Ga0070692_100477322 | 434 |
| 746 | 3300005355 | Ga0070671_100137220 | Ga0070671_1001372202 | 434 |
| 747 | 3300005356 | Ga0070674_100038752 | Ga0070674_1000387521 | 434 |
| 748 | 3300005365 | Ga0070688_100015042 | Ga0070688_1000150423 | 434 |
| 749 | 3300005436 | Ga0070713_100020637 | Ga0070713_1000206373 | 434 |
| 750 | 3300005436 | Ga0070713_100031689 | Ga0070713_1000316892 | 434 |
| 751 | 3300005444 | Ga0070694_100029412 | Ga0070694_1000294123 | 434 |
| 752 | 3300005445 | Ga0070708_100017991 | Ga0070708_1000179915 | 434 |
| 753 | 3300005457 | Ga0070662_100063254 | Ga0070662_1000632542 | 434 |
| 754 | 3300005468 | Ga0070707_100024556 | Ga0070707_1000245563 | 434 |
| 755 | 3300005471 | Ga0070698_100156980 | Ga0070698_1001569802 | 434 |
| 756 | 3300005518 | Ga0070699_100013133 | Ga0070699_1000131333 | 434 |
| 757 | 3300005536 | Ga0070697_100128907 | Ga0070697_1001289072 | 434 |
| 758 | 3300005543 | Ga0070672_100061679 | Ga0070672_1000616792 | 434 |
| 759 | 3300005544 | Ga0070686_100008401 | Ga0070686_1000084012 | 434 |
| 760 | 3300005545 | Ga0070695_100024345 | Ga0070695_1000243452 | 434 |
| 761 | 3300005546 | Ga0070696_100012935 | Ga0070696_1000129353 | 434 |
| 762 | 3300005546 | Ga0070696_100037807 | Ga0070696_1000378072 | 434 |
| 763 | 3300005548 | Ga0070665_100051903 | Ga0070665_1000519032 | 434 |
| 764 | 3300005549 | Ga0070704_100004254 | Ga0070704_1000042545 | 434 |
| 765 | 3300005564 | Ga0070664_100147225 | Ga0070664_1001472252 | 434 |
| 766 | 3300005614 | Ga0068856_100138573 | Ga0068856_1001385732 | 434 |
| 767 | 3300005618 | Ga0068864_100006741 | Ga0068864_1000067413 | 434 |
| 768 | 3300005834 | Ga0068851_10029005 | Ga0068851_100290052 | 434 |
| 769 | 3300005842 | Ga0068858_100015673 | Ga0068858_1000156736 | 434 |
| 770 | 3300006173 | Ga0070716_100014590 | Ga0070716_1000145903 | 434 |
| 771 | 3300006175 | Ga0070712_100000349 | Ga0070712_1000003495 | 434 |
| 772 | 3300009093 | Ga0105240_10028424 | Ga0105240_100284246 | 434 |
| 773 | 3300009098 | Ga0105245_10023418 | Ga0105245_100234183 | 434 |
| 774 | 3300009174 | Ga0105241_10154834 | Ga0105241_101548342 | 434 |
| 775 | 3300009176 | Ga0105242_10184139 | Ga0105242_101841392 | 434 |
| 776 | 3300009545 | Ga0105237_10095561 | Ga0105237_100955612 | 434 |
| 777 | 3300009551 | Ga0105238_10286457 | Ga0105238_102864571 | 434 |
| 778 | 3300013100 | Ga0157373_10103618 | Ga0157373_101036182 | 434 |
| 779 | 3300013104 | Ga0157370_10017164 | Ga0157370_100171643 | 434 |
| 780 | 3300013296 | Ga0157374_10001563 | Ga0157374_100015633 | 434 |
| 781 | 3300013306 | Ga0163162_10084689 | Ga0163162_100846893 | 434 |
| 782 | 3300013307 | Ga0157372_10235506 | Ga0157372_102355062 | 434 |
| 783 | 3300014325 | Ga0163163_10031133 | Ga0163163_100311333 | 434 |
| 784 | 3300014745 | Ga0157377_10015363 | Ga0157377_100153632 | 434 |
| 785 | 3300014968 | Ga0157379_10159207 | Ga0157379_101592072 | 434 |
| 786 | 3300025899 | Ga0207642_10026484 | Ga0207642_100264842 | 434 |
| 787 | 3300025911 | Ga0207654_10028871 | Ga0207654_100288713 | 434 |
| 788 | 3300025912 | Ga0207707_10083836 | Ga0207707_100838363 | 434 |
| 789 | 3300025915 | Ga0207693_10001075 | Ga0207693_1000107515 | 434 |
| 790 | 3300025915 | Ga0207693_10019259 | Ga0207693_100192592 | 434 |
| 791 | 3300025918 | Ga0207662_10017725 | Ga0207662_100177253 | 434 |
| 792 | 3300025919 | Ga0207657_10005759 | Ga0207657_100057594 | 434 |
| 793 | 3300025920 | Ga0207649_10133708 | Ga0207649_101337082 | 434 |
| 794 | 3300025925 | Ga0207650_10036940 | Ga0207650_100369402 | 434 |
| 795 | 3300025927 | Ga0207687_10028353 | Ga0207687_100283533 | 434 |
| 796 | 3300025927 | Ga0207687_10056987 | Ga0207687_100569873 | 434 |
| 797 | 3300025929 | Ga0207664_10003175 | Ga0207664_100031757 | 434 |
| 798 | 3300025933 | Ga0207706_10011380 | Ga0207706_100113805 | 434 |
| 799 | 3300025934 | Ga0207686_10006650 | Ga0207686_100066505 | 434 |
| 800 | 3300025936 | Ga0207670_10010067 | Ga0207670_100100675 | 434 |
| 801 | 3300025941 | Ga0207711_10011043 | Ga0207711_100110433 | 434 |
| 802 | 3300025942 | Ga0207689_10079553 | Ga0207689_100795532 | 434 |
| 803 | 3300025949 | Ga0207667_10282092 | Ga0207667_102820921 | 434 |
| 804 | 3300025981 | Ga0207640_10114749 | Ga0207640_101147491 | 434 |
| 805 | 3300026023 | Ga0207677_10000445 | Ga0207677_100004454 | 434 |
| 806 | 3300026035 | Ga0207703_10004139 | Ga0207703_100041392 | 434 |
| 807 | 3300026067 | Ga0207678_10011136 | Ga0207678_100111366 | 434 |
| 808 | 3300026088 | Ga0207641_10008846 | Ga0207641_100088462 | 434 |
| 809 | 3300026089 | Ga0207648_10070992 | Ga0207648_100709922 | 434 |
| 810 | 3300026095 | Ga0207676_10003423 | Ga0207676_100034236 | 434 |
| 811 | 3300026116 | Ga0207674_10015118 | Ga0207674_100151185 | 434 |
| 812 | 3300026118 | Ga0207675_100019834 | Ga0207675_1000198346 | 434 |
| 813 | 3300026121 | Ga0207683_10014625 | Ga0207683_100146253 | 434 |
| 814 | 3300028379 | Ga0268266_10141487 | Ga0268266_101414871 | 434 |
| 815 | 3300035089 | Ga0373944_0007147 | Ga0373944_0007147_1100_2425 | 434 |
| 816 | 3300035117 | Ga0373953_0021472 | Ga0373953_0021472_496_1821 | 434 |
| 817 | 3300035118 | Ga0373954_0016585 | Ga0373954_0016585_741_2066 | 434 |
| 818 | 3300035119 | Ga0373956_0007137 | Ga0373956_0007137_779_2104 | 434 |
| 819 | 3300035410 | Ga0373924_0037148 | Ga0373924_0037148_217_1542 | 434 |
| 820 | 3300035724 | Ga0373933_0029443 | Ga0373933_0029443_1436_2761 | 434 |
| 821 | 3300036401 | Ga0373937_0027633 | Ga0373937_0027633_2611_3936 | 434 |
| 822 | 3300036401 | Ga0373937_0033469 | Ga0373937_0033469_889_2214 | 434 |
| 823 | 3300036401 | Ga0373937_0084621 | Ga0373937_0084621_1497_2822 | 434 |
| 824 | 3300037068 | Ga0373925_0007841 | Ga0373925_0007841_6202_7527 | 434 |
| 825 | 3300037068 | Ga0373925_0018129 | Ga0373925_0018129_2742_4067 | 434 |
| 826 | 3300042005 | Ga0439448_0027325 | Ga0439448_0027325_21_1346 | 434 |
| 827 | 3300046455 | Ga0495603_0059176 | Ga0495603_0059176_678_2003 | 434 |
| 828 | 3300046472 | Ga0495580_0145673 | Ga0495580_0145673_227_1552 | 434 |
| 829 | 3300046473 | Ga0495582_0030744 | Ga0495582_0030744_752_2077 | 434 |
| 830 | 3300046476 | Ga0495662_0040349 | Ga0495662_0040349_609_1934 | 434 |
| 831 | 3300046499 | Ga0495594_0044783 | Ga0495594_0044783_648_1973 | 434 |
| 832 | 3300046517 | Ga0495630_0103640 | Ga0495630_0103640_478_1803 | 434 |
| 833 | 3300046543 | Ga0495645_0010412 | Ga0495645_0010412_2133_3458 | 434 |
| 834 | 3300046664 | Ga0495659_0032949 | Ga0495659_0032949_320_1645 | 434 |
| 835 | 3300046679 | Ga0495623_0039948 | Ga0495623_0039948_1096_2421 | 434 |
| 836 | 3300046681 | Ga0495647_0001220 | Ga0495647_0001220_5982_7307 | 434 |
| 837 | 3300046689 | Ga0495613_0147544 | Ga0495613_0147544_153_1478 | 434 |
| 838 | 3300047315 | Ga0495581_0005311 | Ga0495581_0005311_1317_2642 | 434 |
| 839 | 3300047673 | Ga0495593_0036160 | Ga0495593_0036160_1110_2435 | 434 |
| 840 | 3300048904 | Ga0496101_0078956 | Ga0496101_0078956_540_1865 | 434 |
| 841 | 3300048906 | Ga0496103_0016993 | Ga0496103_0016993_107_1432 | 434 |
| 842 | 3300048908 | Ga0496105_0110565 | Ga0496105_0110565_920_2245 | 434 |
| 843 | 3300048911 | Ga0496108_0092980 | Ga0496108_0092980_791_2116 | 434 |
| 844 | 3300048915 | Ga0496112_0003510 | Ga0496112_0003510_3821_5146 | 434 |
| 845 | 3300048918 | Ga0496115_0034802 | Ga0496115_0034802_1379_2704 | 434 |
| 846 | 3300053085 | Ga0495619_0019523 | Ga0495619_0019523_447_1772 | 434 |
| 847 | 3300003322 | rootL2_10002570 | rootL2_100025707 | 442 |
| 848 | 3300039447 | Ga0436361_0133183 | Ga0436361_0133183_4135_5463 | 442 |
| 849 | 3300039447 | Ga0436361_0366030 | Ga0436361_0366030_16819_18147 | 442 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5wze-assembly1.cif.gz_C | the structure of pseudomonas aeruginosa aminopeptidase pepp | 0.9366 | 1 | 441 |
| 2bwt-assembly1.cif.gz_A | asp260ala escherichia coli aminopeptidase p | 0.9328 | 1 | 441 |
| 2bww-assembly1.cif.gz_A | his350ala escherichia coli aminopeptidase p | 0.9323 | 1 | 441 |
| 1jaw-assembly1.cif.gz_A | aminopeptidase p from e. coli low ph form | 0.9314 | 1 | 441 |
| 2bwu-assembly1.cif.gz_A | asp271ala escherichia coli aminopeptidase p | 0.926 | 1 | 441 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q4CSP6_205_383_3.90.230.10 | Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily | 0.9774 | 173 | 339 | 3.90.230.10 |
| 4pv4A02 | Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily | 0.9682 | 171 | 441 | 3.90.230.10 |
| 3ig4F02 | Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily | 0.9623 | 173 | 441 | 3.90.230.10 |
| 4pv4A02 | Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily | 0.9574 | 171 | 441 | 3.90.230.10 |
| af_Q9NQH7_247_507_3.90.230.10 | Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily | 0.9428 | 173 | 441 | 3.90.230.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3C1SPG2-F1-model_v4 | Xaa-Pro aminopeptidase (EC 3.4.11.9) | 0.9941 | 202 | 376 |
GO:0004177
GO:0005829 GO:0006508 GO:0046872 |
| AF-A0A3S4GV02-F1-model_v4 | Xaa-Pro aminopeptidase (EC 3.4.11.9) | 0.9786 | 160 | 380 |
GO:0004177
GO:0005829 GO:0006508 GO:0008235 GO:0046872 |
| AF-A0A3C1SPG2-F1-model_v4 | Xaa-Pro aminopeptidase (EC 3.4.11.9) | 0.9719 | 202 | 376 |
GO:0004177
GO:0005829 GO:0006508 GO:0046872 |
| AF-A0A539DPD0-F1-model_v4 | Xaa-Pro aminopeptidase (EC 3.4.11.9) | 0.9708 | 216 | 442 |
GO:0004177
GO:0005829 GO:0006508 GO:0046872 |
| AF-A0A7Y7AV82-F1-model_v4 | deleted | 0.9694 | 248 | 441 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar