F483301

General Info

Members Datasets Scaffolds Average Seq Length
846 434 706 90

Family's Representative Sequence

Representative Sequence 3300039447|Ga0436361_0215157|Ga0436361_0215157_148655_148966
Length 103
Sequence MCYAGRTHRQGKFMSHTIRDQAKLLARVRRLSGQTAALEKQLTNGTECSAVLQQIAAIRGAVNGLMAAVIEGHLSVHLVDQPDEAQRQKDLEVVLQVIKSYLK

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
3 2547132181 Kosakonia sacchari SP1 Isolate Stem
4 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
5 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
6 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
7 2561511199 Enterobacter sp. R4-368 Isolate Nodule
8 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
9 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
10 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
11 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
12 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
13 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
14 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
15 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
16 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
17 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
18 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
19 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
20 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
21 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
22 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
23 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
24 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
25 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
26 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
27 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
28 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
29 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
30 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
31 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
32 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
33 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
34 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
35 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
36 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
37 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
38 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
39 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
40 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
41 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
42 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
43 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
44 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
45 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
46 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
47 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
48 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
49 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
50 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
51 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
52 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
53 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
54 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
55 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
56 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
57 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
58 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
59 2636415599 Klebsiella variicola DX120E Isolate Unclassified
60 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
61 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
62 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
63 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
64 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
65 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
66 2711768156 Atlantibacter hermannii DDE1 Isolate Unclassified
67 2751185917 Enterobacter sp. HK169 Isolate Unclassified
68 2765235841 Pseudomonas putida AA7 Isolate Unclassified
69 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
70 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
71 2775507074 Klebsiella sp. D5A Isolate Unclassified
72 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
73 2791355275 Enterobacter sp. Sa187 Isolate Unclassified
74 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
75 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
76 2821118458 Enterobacter asburiae 609 Isolate Unclassified
77 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
78 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
79 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
80 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
81 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
82 2842733646 Variovorax sp. R-72446 Isolate Unclassified
83 2844425489 Enterobacter cloacae SBP-8 Isolate Rhizosphere
84 2846033681 Chromobacterium sinusclupearum MWU13-2610 Isolate Rhizosphere
85 2846037992 Chromobacterium alticapitis MWU14-2602 Isolate Rhizosphere
86 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
87 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
88 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
89 2885266251 Ralstonia sp. SET104 Isolate Nodule
90 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
91 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
92 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
93 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
94 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
95 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
96 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
97 2919150387 Rahnella aceris 1817 Isolate Unclassified
98 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
99 2923525760 Aeromonas caviae SLBN-129 Isolate Rhizosphere
100 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
101 2927143783 Rahnella sp. 2050 Isolate Unclassified
102 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
103 2928058823 Ralstonia sp. 1138 Isolate Unclassified
104 2935625433 Kosakonia sp. 1610 Isolate Rhizosphere
105 2937539931 Pantoea sp. LS15 Isolate Unclassified
106 2939568625 Lelliottia sp. 489 Isolate Rhizosphere
107 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
108 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
109 2939617950 Kosakonia cowanii 2056 Isolate Rhizosphere
110 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
111 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
112 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
113 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
114 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
115 2974435778 Kosakonia cowanii SORGH_AS 304 Isolate Unclassified
116 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
117 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
118 2998344455 Vogesella urethralis SLBN-145 Isolate Rhizosphere
119 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
120 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
121 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
122 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
123 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
124 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
125 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
126 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
127 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
128 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
129 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
130 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
131 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
132 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
133 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
134 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
135 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
136 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
137 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
138 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
139 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
140 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
141 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
142 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
143 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
144 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
145 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
146 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
147 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
148 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
149 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
150 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
151 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
152 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
153 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
154 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
155 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
156 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
157 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
158 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
159 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
160 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
161 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
162 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
163 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
164 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
165 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
166 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
167 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
168 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
169 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
170 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
171 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
172 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
173 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
174 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
175 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
176 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
177 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
178 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
179 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
180 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
181 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
182 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
183 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
184 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
185 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
186 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
187 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
188 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
189 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
190 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
191 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
192 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
193 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
194 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
195 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
196 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
197 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
198 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
199 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
200 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
201 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
202 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
203 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
204 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
205 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
206 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
207 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
208 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
209 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
210 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
211 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
212 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
213 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
214 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
215 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
216 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
217 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
218 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
219 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
220 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
221 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
222 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
223 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
224 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
225 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
226 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
227 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
228 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
229 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
230 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
231 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
232 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
233 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
234 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
235 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
236 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
237 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
238 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
239 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
240 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
241 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
242 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
243 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
244 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
245 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
246 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
247 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
248 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
249 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
250 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
251 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
252 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
253 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
254 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
255 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
256 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
280 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
282 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
283 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
284 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
286 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
287 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
288 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
289 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
290 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
291 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
292 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
293 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
294 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
296 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
297 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
298 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
299 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
300 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
301 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
302 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
303 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
304 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
305 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
306 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
307 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
308 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
309 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
310 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
311 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
312 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
313 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
314 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
315 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
316 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
317 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
318 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
319 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
320 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
321 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
322 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
323 3300044650 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E Metagenome Unclassified
324 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
325 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
326 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
327 3300044671 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E Metagenome Unclassified
328 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
329 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
330 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
331 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
332 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
333 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
334 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
335 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
336 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
337 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
338 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
339 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
340 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
341 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
342 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
343 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
344 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
345 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
346 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
347 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
348 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
349 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
350 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
351 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
352 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
353 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
354 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
355 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
356 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
357 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
358 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
359 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
360 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
361 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
362 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
363 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
364 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
365 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
366 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
367 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
368 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
369 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
370 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
371 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
372 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
373 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
374 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
375 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
376 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
377 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
378 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
379 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
380 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
381 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
382 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
383 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
384 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
385 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
386 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
387 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
388 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
389 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
390 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
391 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
392 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
393 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
394 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
395 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
396 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
397 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
398 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
399 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
400 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
401 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
402 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
403 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
404 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
405 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
406 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
407 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
408 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
409 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
410 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
411 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
412 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
413 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
414 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
415 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
416 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
417 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
418 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
419 8001522603 Methylomicrobium sp. RS1 Isolate Unclassified
420 8018221730 Enterobacter sp. CM29 Isolate Unclassified
421 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
422 8019504834 Atlantibacter hermannii 1903 Isolate Rhizosphere
423 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
424 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
425 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere
426 8052494512 Pseudomonas putida LD6 Isolate Unclassified
427 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
428 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere
429 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
430 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
431 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
432 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere
433 8055693939 Hafnia alvei A23BA Isolate Rhizosphere
434 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 83.22
Metatranscriptomes 0.35
Isolates 16.43

Biome Distribution

Category Percentage (%)
Aerial Root 0.24
Bulb 0
Endosphere 14.78
Nodule 4.61
Rhizoplane 9.93
Rhizosphere 49.88
Stem 0.12
Stem Tuber 0
Unclassified 20.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_126825 2162886007 Bacteria 6799
2 SwRhRL2b_contig_1451602 2162886007 Bacteria 1926
3 SwRhRL2b_contig_2947596 2162886007 Bacteria 5019
4 SwRhRL2b_contig_3517994 2162886007 Bacteria 2072
5 SwRhRL2b_contig_372564 2162886007 Bacteria 2805
6 JGI24741J21665_1000832 3300001915 Bacteria 9280
7 JGI24740J21852_10000282 3300001979 Bacteria 21596
8 JGI24740J21852_10000391 3300001979 Bacteria 18782
9 JGI24742J22300_10056359 3300002244 Bacteria 718
10 JGI25156J39149_1002231 3300002705 Bacteria 7160
11 JGI25156J39149_1022518 3300002705 Bacteria 1069
12 JGI25156J39149_1034333 3300002705 Bacteria 735
13 JGI25162J39368_1000009 3300002737 Bacteria 389795
14 JGI25154J39366_1003436 3300002738 Bacteria 3328
15 JGI25163J39215_1000150 3300002771 Bacteria 27415
16 JGI25164J39214_1000002 3300002772 Bacteria 406570
17 JGI25152J39213_1000878 3300002773 Bacteria 14793
18 JGI25152J39213_1005507 3300002773 Bacteria 3668
19 JGI25150J39212_1009220 3300002774 Bacteria 1892
20 JGI25153J46596_10001192 3300003215 Bacteria 15710
21 rootH2_10055337 3300003320 Bacteria 4704
22 rootL2_10039490 3300003322 Bacteria 3756
23 rootH1_10139962 3300003323 Bacteria 1000
24 Ga0006562J51391_1101642 3300003578 Bacteria 2160
25 Ga0055538_1000015 3300003751 Bacteria 311166
26 Ga0055538_1006716 3300003751 Bacteria 1098
27 Ga0055538_1006820 3300003751 Bacteria 1082
28 Ga0055539_1000009 3300003752 Bacteria 406566
29 Ga0055539_1000231 3300003752 Bacteria 39116
30 Ga0055533_1000012 3300003756 Bacteria 406566
31 Ga0055533_1002682 3300003756 Bacteria 3932
32 Ga0055533_1010696 3300003756 Bacteria 1028
33 Ga0055533_1011907 3300003756 Bacteria 930
34 Ga0055532_1000040 3300003758 Bacteria 198031
35 Ga0055525_1000014 3300003759 Bacteria 406566
36 Ga0055525_1000161 3300003759 Bacteria 87478
37 Ga0055525_1000412 3300003759 Bacteria 26101
38 Ga0055527_1003918 3300003760 Bacteria 2121
39 Ga0055535_1000029 3300003761 Bacteria 198031
40 Ga0055542_1000896 3300003762 Bacteria 20368
41 Ga0055542_1017797 3300003762 Bacteria 1092
42 Ga0055529_1000055 3300003763 Bacteria 197545
43 Ga0055529_1000358 3300003763 Bacteria 49858
44 Ga0055526_1000392 3300003771 Bacteria 35369
45 Ga0055537_1000099 3300003773 Bacteria 65218
46 Ga0055524_1000106 3300003775 Bacteria 103668
47 Ga0055524_1000720 3300003775 Bacteria 22675
48 Ga0055524_1003256 3300003775 Bacteria 7951
49 Ga0055536_1025590 3300003781 Bacteria 1677
50 Ga0055536_1051273 3300003781 Bacteria 905
51 Ga0055534_1000023 3300003784 Bacteria 135301
52 Ga0055528_1000030 3300003790 Bacteria 121679
53 Ga0055530_10001128 3300003791 Bacteria 20838
54 Ga0055530_10057085 3300003791 Bacteria 883
55 Ga0055540_1000110 3300003792 Bacteria 88766
56 Ga0055540_1023871 3300003792 Bacteria 1530
57 Ga0055540_1043757 3300003792 Bacteria 954
58 Ga0055531_10006208 3300003794 Bacteria 6822
59 Ga0055531_10012991 3300003794 Bacteria 3873
60 Ga0055531_10014883 3300003794 Bacteria 3473
61 Ga0055541_1000006 3300003841 Bacteria 406566
62 Ga0055541_1000930 3300003841 Bacteria 6953
63 Ga0055541_1011058 3300003841 Bacteria 1336
64 Ga0055541_1026099 3300003841 Bacteria 623
65 Ga0058692_1000113 3300003856 Bacteria 52711
66 Ga0058692_1000602 3300003856 Bacteria 15103
67 Ga0058692_1000693 3300003856 Bacteria 13849
68 Ga0058692_1004633 3300003856 Bacteria 4049
69 Ga0058692_1006711 3300003856 Bacteria 3126
70 Ga0058692_1035184 3300003856 Bacteria 915
71 Ga0065165_1000087 3300005262 Bacteria 152471
72 Ga0065704_10000330 3300005289 Bacteria 31445
73 Ga0065704_10000780 3300005289 Bacteria 47095
74 Ga0065704_10000959 3300005289 Bacteria 34794
75 Ga0065704_10002644 3300005289 Bacteria 8029
76 Ga0065704_10004459 3300005289 Bacteria 4891
77 Ga0065704_10075146 3300005289 Bacteria 5767
78 Ga0065704_10235622 3300005289 Bacteria 1000
79 Ga0065704_10488540 3300005289 Bacteria 676
80 Ga0070658_10044744 3300005327 Bacteria 3578
81 Ga0070658_10906998 3300005327 Bacteria 766
82 Ga0070658_11624685 3300005327 Bacteria 560
83 Ga0070676_10115665 3300005328 Bacteria 1676
84 Ga0070683_100369963 3300005329 Bacteria 1365
85 Ga0070670_100605951 3300005331 Bacteria 980
86 Ga0070677_10032659 3300005333 Bacteria 1998
87 Ga0070666_10006517 3300005335 Bacteria 7169
88 Ga0070682_100079964 3300005337 Bacteria 2112
89 Ga0068868_100142618 3300005338 Bacteria 1968
90 Ga0070661_100000037 3300005344 Bacteria 107325
91 Ga0070661_100301568 3300005344 Bacteria 1247
92 Ga0070668_100192959 3300005347 Bacteria 1669
93 Ga0070675_100039642 3300005354 Bacteria 3845
94 Ga0070674_100027072 3300005356 Bacteria 3754
95 Ga0070673_100083429 3300005364 Bacteria 2596
96 Ga0070688_100838368 3300005365 Bacteria 721
97 Ga0070659_100048378 3300005366 Bacteria 3340
98 Ga0070667_100282219 3300005367 Bacteria 1491
99 Ga0070667_101888182 3300005367 Bacteria 562
100 Ga0070663_100000001 3300005455 Bacteria 318372
101 Ga0070663_100076870 3300005455 Bacteria 2443
102 Ga0070678_100001501 3300005456 Bacteria 12460
103 Ga0070662_100684936 3300005457 Bacteria 866
104 Ga0068867_100125519 3300005459 Bacteria 1988
105 Ga0070699_100166688 3300005518 Bacteria 1951
106 Ga0070672_100000254 3300005543 Bacteria 30164
107 Ga0070665_100010108 3300005548 Bacteria 9545
108 Ga0070665_101356378 3300005548 Bacteria 721
109 Ga0070664_100000006 3300005564 Bacteria 189856
110 Ga0070664_100035207 3300005564 Bacteria 4203
111 Ga0068857_100015730 3300005577 Bacteria 6618
112 Ga0068857_100016805 3300005577 Bacteria 6410
113 Ga0068854_100000048 3300005578 Bacteria 88075
114 Ga0068854_101870349 3300005578 Bacteria 551
115 Ga0068856_100001024 3300005614 Bacteria 29757
116 Ga0068852_100015788 3300005616 Bacteria 5871
117 Ga0068860_100323014 3300005843 Bacteria 1515
118 Ga0075364_10007807 3300006051 Bacteria 6371
119 Ga0075364_10020788 3300006051 Bacteria 4131
120 Ga0075364_10083933 3300006051 Bacteria 2108
121 Ga0075369_10366777 3300006186 Bacteria 677
122 Ga0075366_10164832 3300006195 Bacteria 1343
123 Ga0097621_100079914 3300006237 Bacteria 2719
124 Ga0075370_10092920 3300006353 Bacteria 1741
125 Ga0068871_100017779 3300006358 Bacteria 5390
126 Ga0068865_100428289 3300006881 Bacteria 1089
127 Ga0099823_1000188 3300006944 Bacteria 34181
128 Ga0099823_1023592 3300006944 Bacteria 5624
129 Ga0099823_1046333 3300006944 Bacteria 2860
130 Ga0079104_1000021 3300006946 Bacteria 247219
131 Ga0079104_1000030 3300006946 Bacteria 207526
132 Ga0079104_1000074 3300006946 Bacteria 150348
133 Ga0079104_1000233 3300006946 Bacteria 75184
134 Ga0079104_1000304 3300006946 Bacteria 62246
135 Ga0079104_1000379 3300006946 Bacteria 52134
136 Ga0079104_1000614 3300006946 Bacteria 34956
137 Ga0079104_1001907 3300006946 Bacteria 12579
138 Ga0079104_1001912 3300006946 Bacteria 12553
139 Ga0079104_1003263 3300006946 Bacteria 7759
140 Ga0079104_1003310 3300006946 Bacteria 7646
141 Ga0079104_1027699 3300006946 Bacteria 1449
142 Ga0099826_10314074 3300006948 Bacteria 795
143 Ga0105251_10000116 3300009011 Bacteria 79645
144 Ga0105251_10000391 3300009011 Bacteria 42881
145 Ga0105251_10000402 3300009011 Bacteria 42216
146 Ga0105251_10001684 3300009011 Bacteria 18581
147 Ga0105251_10001933 3300009011 Bacteria 16960
148 Ga0105251_10007995 3300009011 Bacteria 6415
149 Ga0105251_10047940 3300009011 Bacteria 2050
150 Ga0105251_10140078 3300009011 Bacteria 1094
151 Ga0105251_10189782 3300009011 Bacteria 926
152 Ga0105251_10419148 3300009011 Bacteria 617
153 Ga0105244_10000014 3300009036 Bacteria 257018
154 Ga0105244_10000037 3300009036 Bacteria 161621
155 Ga0105244_10000441 3300009036 Bacteria 38203
156 Ga0105244_10001143 3300009036 Bacteria 22016
157 Ga0105244_10002103 3300009036 Bacteria 15310
158 Ga0105244_10003362 3300009036 Bacteria 11460
159 Ga0105244_10004018 3300009036 Bacteria 10285
160 Ga0105244_10004186 3300009036 Bacteria 10037
161 Ga0105244_10016508 3300009036 Bacteria 4204
162 Ga0105244_10039965 3300009036 Bacteria 2439
163 Ga0105244_10044840 3300009036 Bacteria 2277
164 Ga0105244_10180488 3300009036 Bacteria 1001
165 Ga0105244_10224961 3300009036 Bacteria 879
166 Ga0105250_10000059 3300009092 Bacteria 109549
167 Ga0105250_10000095 3300009092 Bacteria 78639
168 Ga0105250_10000114 3300009092 Bacteria 72357
169 Ga0105250_10000314 3300009092 Bacteria 37777
170 Ga0105250_10001759 3300009092 Bacteria 11382
171 Ga0105250_10003658 3300009092 Bacteria 7236
172 Ga0105250_10007459 3300009092 Bacteria 4696
173 Ga0105250_10029457 3300009092 Bacteria 2208
174 Ga0105250_10056063 3300009092 Bacteria 1582
175 Ga0105250_10158913 3300009092 Bacteria 943
176 Ga0105250_10166296 3300009092 Bacteria 922
177 Ga0105250_10371351 3300009092 Bacteria 630
178 Ga0105240_10065701 3300009093 Bacteria 4502
179 Ga0105240_11229364 3300009093 Bacteria 792
180 Ga0105243_10092171 3300009148 Bacteria 2497
181 Ga0105243_10390862 3300009148 Bacteria 1289
182 Ga0105242_11770245 3300009176 Bacteria 656
183 Ga0105248_10371889 3300009177 Bacteria 1609
184 Ga0105248_11417259 3300009177 Bacteria 786
185 Ga0105035_102206 3300009988 Bacteria 1419
186 Ga0157319_1000004 3300012497 Bacteria 394735
187 Ga0157373_10027127 3300013100 Bacteria 4133
188 Ga0157373_10705675 3300013100 Bacteria 739
189 Ga0157371_10000080 3300013102 Bacteria 152121
190 Ga0157371_10004407 3300013102 Bacteria 12303
191 Ga0157371_10010046 3300013102 Bacteria 7400
192 Ga0157371_10027367 3300013102 Bacteria 4136
193 Ga0157370_10000032 3300013104 Bacteria 138963
194 Ga0157370_10013528 3300013104 Bacteria 8401
195 Ga0157370_11337536 3300013104 Bacteria 645
196 Ga0157369_10004887 3300013105 Bacteria 15718
197 Ga0157369_10012746 3300013105 Bacteria 9532
198 Ga0157374_10001918 3300013296 Bacteria 17429
199 Ga0157378_10002043 3300013297 Bacteria 18066
200 Ga0163162_10202467 3300013306 Unclassified 2114
201 Ga0163162_11279187 3300013306 Bacteria 833
202 Ga0157372_10000235 3300013307 Bacteria 61511
203 Ga0157372_10042246 3300013307 Bacteria 5042
204 Ga0157372_11150297 3300013307 Bacteria 897
205 Ga0157375_10228889 3300013308 Bacteria 2018
206 Ga0182008_10020234 3300014497 Bacteria 3429
207 Ga0157379_11779471 3300014968 Bacteria 605
208 Ga0182006_1000051 3300015261 Bacteria 183089
209 Ga0182006_1008993 3300015261 Bacteria 4500
210 Ga0182006_1101162 3300015261 Bacteria 1023
211 Ga0182006_1161344 3300015261 Bacteria 755
212 Ga0182007_10013207 3300015262 Bacteria 3157
213 Ga0183366_1001 3300015679 Bacteria 2743932
214 Ga0183370_1001 3300015680 Bacteria 2743932
215 Ga0183369_1001 3300015685 Bacteria 2743932
216 Ga0183368_1001 3300015687 Bacteria 2743932
217 Ga0183361_15589 3300016635 Bacteria 681
218 Ga0163161_10039031 3300017792 Bacteria 3407
219 Ga0163161_10043096 3300017792 Bacteria 3249
220 Ga0163161_10154321 3300017792 Bacteria 1747
221 Ga0206351_10514496 3300020077 Bacteria 2992
222 Ga0154015_1601999 3300020610 Bacteria 9748
223 Ga0213872_10000007 3300021361 Bacteria 228206
224 Ga0213872_10000101 3300021361 Bacteria 79972
225 Ga0213872_10000114 3300021361 Bacteria 74773
226 Ga0213872_10023478 3300021361 Bacteria 2838
227 Ga0213872_10036776 3300021361 Bacteria 2236
228 Ga0213872_10045189 3300021361 Bacteria 2004
229 Ga0213872_10083600 3300021361 Unclassified 1432
230 Ga0213876_10000069 3300021384 Bacteria 125594
231 Ga0209760_100051 3300025207 Bacteria 105257
232 Ga0209784_100001 3300025224 Bacteria 3600592
233 Ga0209784_100006 3300025224 Bacteria 930704
234 Ga0209784_100177 3300025224 Bacteria 53382
235 Ga0209784_100373 3300025224 Bacteria 21044
236 Ga0209784_104707 3300025224 Bacteria 941
237 Ga0209566_100001 3300025225 Bacteria 3600765
238 Ga0209566_100002 3300025225 Bacteria 2614868
239 Ga0209566_100615 3300025225 Bacteria 22046
240 Ga0209566_102391 3300025225 Bacteria 3522
241 Ga0209674_100002 3300025226 Bacteria 3600592
242 Ga0209674_100010 3300025226 Bacteria 1038638
243 Ga0209674_100060 3300025226 Bacteria 282102
244 Ga0209674_100076 3300025226 Bacteria 210323
245 Ga0209674_111246 3300025226 Bacteria 920
246 Ga0209674_115881 3300025226 Bacteria 640
247 Ga0209672_100231 3300025228 Bacteria 42532
248 Ga0209147_100018 3300025229 Bacteria 515719
249 Ga0209563_100002 3300025230 Bacteria 2045675
250 Ga0209563_100041 3300025230 Bacteria 407467
251 Ga0209563_100088 3300025230 Bacteria 175375
252 Ga0209563_109598 3300025230 Bacteria 1455
253 Ga0209563_112646 3300025230 Bacteria 1146
254 Ga0209563_128624 3300025230 Bacteria 548
255 Ga0207427_100020 3300025231 Bacteria 507515
256 Ga0209437_100001 3300025233 Bacteria 2045675
257 Ga0209258_100028 3300025242 Bacteria 515719
258 Ga0207425_1000851 3300025245 Bacteria 15022
259 Ga0207425_1007356 3300025245 Bacteria 2916
260 Ga0209646_1000043 3300025246 Bacteria 343652
261 Ga0209026_1008003 3300025250 Bacteria 2273
262 Ga0209677_100002 3300025253 Bacteria 2045675
263 Ga0209677_100007 3300025253 Bacteria 1021332
264 Ga0209148_1000265 3300025254 Bacteria 82436
265 Ga0209148_1003982 3300025254 Bacteria 3788
266 Ga0209759_1001678 3300025256 Bacteria 11541
267 Ga0209759_1006235 3300025256 Bacteria 4042
268 Ga0209759_1007283 3300025256 Bacteria 3581
269 Ga0209759_1025248 3300025256 Bacteria 1268
270 Ga0209129_1000004 3300025258 Bacteria 884499
271 Ga0209129_1000095 3300025258 Bacteria 171644
272 Ga0209565_1000003 3300025263 Bacteria 1099648
273 Ga0209565_1013066 3300025263 Bacteria 1954
274 Ga0209565_1065433 3300025263 Bacteria 623
275 Ga0209455_1000065 3300025272 Bacteria 321272
276 Ga0209673_1000003 3300025273 Bacteria 980859
277 Ga0209675_1000003 3300025291 Bacteria 1003982
278 Ga0209675_1033427 3300025291 Bacteria 1193
279 Ga0209676_1004975 3300025292 Bacteria 7131
280 Ga0209676_1021713 3300025292 Bacteria 2146
281 Ga0209564_1000012 3300025295 Bacteria 792078
282 Ga0209564_1000062 3300025295 Bacteria 321275
283 Ga0209758_1000072 3300025297 Bacteria 277776
284 Ga0209758_1000121 3300025297 Bacteria 192028
285 Ga0209050_1000596 3300025298 Bacteria 57689
286 Ga0209050_1008139 3300025298 Bacteria 5682
287 Ga0209256_1000225 3300025299 Bacteria 103720
288 Ga0209256_1000235 3300025299 Bacteria 98834
289 Ga0209256_1000570 3300025299 Bacteria 52605
290 Ga0209051_1000148 3300025303 Bacteria 132600
291 Ga0209257_1000380 3300025304 Bacteria 88824
292 Ga0209257_1000973 3300025304 Bacteria 39141
293 Ga0209257_1144702 3300025304 Bacteria 530
294 Ga0207696_1000005 3300025711 Bacteria 642078
295 Ga0207696_1000024 3300025711 Bacteria 420123
296 Ga0207696_1000038 3300025711 Bacteria 328221
297 Ga0207696_1000088 3300025711 Bacteria 190313
298 Ga0207696_1000876 3300025711 Bacteria 18743
299 Ga0207696_1001588 3300025711 Bacteria 12013
300 Ga0207696_1003787 3300025711 Bacteria 6738
301 Ga0207696_1009538 3300025711 Bacteria 3615
302 Ga0207696_1011547 3300025711 Bacteria 3172
303 Ga0207696_1022646 3300025711 Bacteria 1993
304 Ga0207696_1047875 3300025711 Bacteria 1231
305 Ga0207655_1000001 3300025728 Bacteria 1866413
306 Ga0207655_1000009 3300025728 Bacteria 664676
307 Ga0207655_1000063 3300025728 Bacteria 257028
308 Ga0207655_1000117 3300025728 Bacteria 161655
309 Ga0207655_1000247 3300025728 Bacteria 87805
310 Ga0207655_1000413 3300025728 Bacteria 58877
311 Ga0207655_1007341 3300025728 Bacteria 7155
312 Ga0207655_1011857 3300025728 Bacteria 5147
313 Ga0207655_1037020 3300025728 Bacteria 2154
314 Ga0207655_1039934 3300025728 Bacteria 2032
315 Ga0207655_1073796 3300025728 Bacteria 1257
316 Ga0207655_1153162 3300025728 Bacteria 727
317 Ga0207655_1240663 3300025728 Bacteria 518
318 Ga0207713_1000002 3300025735 Bacteria 1061749
319 Ga0207713_1000003 3300025735 Bacteria 860698
320 Ga0207713_1000029 3300025735 Bacteria 285054
321 Ga0207713_1001125 3300025735 Bacteria 22736
322 Ga0207713_1001486 3300025735 Bacteria 18542
323 Ga0207713_1001919 3300025735 Bacteria 15755
324 Ga0207713_1003804 3300025735 Bacteria 10108
325 Ga0207713_1040624 3300025735 Bacteria 1950
326 Ga0207713_1059498 3300025735 Bacteria 1466
327 Ga0207713_1073884 3300025735 Bacteria 1249
328 Ga0207713_1098300 3300025735 Bacteria 1015
329 Ga0207680_10017223 3300025903 Bacteria 3813
330 Ga0207645_10120582 3300025907 Bacteria 1702
331 Ga0207705_10904618 3300025909 Bacteria 684
332 Ga0207705_11174230 3300025909 Bacteria 589
333 Ga0207684_10923533 3300025910 Unclassified 733
334 Ga0207695_10001905 3300025913 Bacteria 32553
335 Ga0207649_10000622 3300025920 Bacteria 23839
336 Ga0207649_10255087 3300025920 Bacteria 1265
337 Ga0207650_10499866 3300025925 Bacteria 1016
338 Ga0207659_10069391 3300025926 Bacteria 2567
339 Ga0207644_10046235 3300025931 Bacteria 3100
340 Ga0207706_10693556 3300025933 Bacteria 870
341 Ga0207686_10622463 3300025934 Bacteria 852
342 Ga0207709_10238524 3300025935 Bacteria 1321
343 Ga0207709_10279130 3300025935 Bacteria 1233
344 Ga0207669_10057947 3300025937 Bacteria 2361
345 Ga0207704_10590550 3300025938 Bacteria 908
346 Ga0207691_10000218 3300025940 Bacteria 55649
347 Ga0207711_10803426 3300025941 Bacteria 876
348 Ga0207679_10000012 3300025945 Bacteria 339773
349 Ga0207679_11238541 3300025945 Bacteria 685
350 Ga0207651_10055698 3300025960 Bacteria 2717
351 Ga0207640_10000055 3300025981 Bacteria 94930
352 Ga0207658_10226035 3300025986 Bacteria 1577
353 Ga0207658_11601086 3300025986 Bacteria 595
354 Ga0207677_10110953 3300026023 Bacteria 2042
355 Ga0207678_10000243 3300026067 Bacteria 49278
356 Ga0207678_10105618 3300026067 Bacteria 2403
357 Ga0207702_10000028 3300026078 Bacteria 183005
358 Ga0207674_10012817 3300026116 Bacteria 9358
359 Ga0207674_10093516 3300026116 Bacteria 2995
360 Ga0207675_102443981 3300026118 Bacteria 534
361 Ga0207683_10001508 3300026121 Bacteria 20979
362 Ga0207698_10014504 3300026142 Bacteria 5241
363 Ga0209281_1000001 3300027111 Bacteria 1933496
364 Ga0209281_1000004 3300027111 Bacteria 1253949
365 Ga0209281_1000006 3300027111 Bacteria 1170244
366 Ga0209281_1000012 3300027111 Bacteria 684886
367 Ga0209281_1000024 3300027111 Bacteria 499062
368 Ga0209281_1000066 3300027111 Bacteria 284953
369 Ga0209281_1000076 3300027111 Bacteria 263350
370 Ga0209281_1000078 3300027111 Bacteria 261622
371 Ga0209281_1000143 3300027111 Bacteria 174070
372 Ga0209281_1000441 3300027111 Bacteria 59960
373 Ga0209281_1000495 3300027111 Bacteria 53514
374 Ga0209281_1001539 3300027111 Bacteria 12846
375 Ga0209281_1001686 3300027111 Bacteria 11558
376 Ga0209389_1000002 3300027296 Bacteria 333932
377 Ga0209389_1062744 3300027296 Bacteria 2247
378 Ga0209371_1000001 3300027312 Bacteria 2771503
379 Ga0209371_1000002 3300027312 Bacteria 1551985
380 Ga0209371_1000060 3300027312 Bacteria 235042
381 Ga0209371_1000409 3300027312 Bacteria 44442
382 Ga0209371_1000461 3300027312 Bacteria 40005
383 Ga0209371_1002127 3300027312 Bacteria 11670
384 Ga0209371_1003406 3300027312 Bacteria 7774
385 Ga0209371_1010149 3300027312 Bacteria 2924
386 Ga0209371_1014177 3300027312 Bacteria 2196
387 Ga0209371_1016332 3300027312 Bacteria 1962
388 Ga0209371_1020821 3300027312 Bacteria 1606
389 Ga0209371_1021744 3300027312 Bacteria 1549
390 Ga0209371_1032234 3300027312 Bacteria 1129
391 Ga0209371_1046621 3300027312 Bacteria 851
392 Ga0209981_1018028 3300027378 Bacteria 999
393 Ga0209984_1027163 3300027424 Bacteria 801
394 Ga0209982_1002637 3300027552 Bacteria 2522
395 Ga0209983_1002692 3300027665 Bacteria 3856
396 Ga0209971_1001469 3300027682 Bacteria 5861
397 Ga0268266_10004753 3300028379 Bacteria 12912
398 Ga0268266_10325382 3300028379 Bacteria 1440
399 Ga0265318_10094615 3300028577 Bacteria 1100
400 Ga0268256_1000001 3300030500 Bacteria 2771065
401 Ga0268256_1000002 3300030500 Bacteria 1535763
402 Ga0268256_1000084 3300030500 Bacteria 164658
403 Ga0268256_1000204 3300030500 Bacteria 67389
404 Ga0268256_1000350 3300030500 Bacteria 44442
405 Ga0268256_1001863 3300030500 Bacteria 11670
406 Ga0268256_1003174 3300030500 Bacteria 7639
407 Ga0268256_1005705 3300030500 Bacteria 4807
408 Ga0268256_1008045 3300030500 Bacteria 3660
409 Ga0268256_1013096 3300030500 Bacteria 2531
410 Ga0268256_1015719 3300030500 Bacteria 2196
411 Ga0268256_1018151 3300030500 Bacteria 1962
412 Ga0268256_1023345 3300030500 Bacteria 1607
413 Ga0268256_1036660 3300030500 Bacteria 1129
414 Ga0268256_1052522 3300030500 Bacteria 851
415 Ga0265327_10000082 3300031251 Bacteria 205610
416 Ga0265327_10019345 3300031251 Bacteria 4190
417 Ga0307408_100000132 3300031548 Bacteria 82821
418 Ga0307408_100054074 3300031548 Bacteria 2902
419 Ga0307408_100592827 3300031548 Bacteria 984
420 Ga0307514_10001593 3300031649 Bacteria 26758
421 Ga0316576_10029059 3300031727 Bacteria 3903
422 Ga0316578_10009605 3300031728 Bacteria 4978
423 Ga0307405_10200390 3300031731 Bacteria 1449
424 Ga0307406_10021259 3300031901 Bacteria 3836
425 Ga0373937_1707707 3300036401 Unclassified 576
426 Ga0395899_0347015 3300037312 Bacteria 994
427 Ga0395900_0005028 3300037418 Bacteria 13874
428 Ga0395900_1002697 3300037418 Bacteria 755
429 Ga0395905_0211363 3300037471 Bacteria 1818
430 Ga0436365_0368505 3300039437 Bacteria 454216
431 Ga0436361_0163583 3300039447 Bacteria 173204
432 Ga0436361_0213400 3300039447 Bacteria 127007
433 Ga0436361_0215157 3300039447 Bacteria 166868
434 Ga0436361_0383736 3300039447 Unclassified 866
435 Ga0436361_0470793 3300039447 Bacteria 641
436 Ga0436361_0900730 3300039447 Bacteria 6275
437 Ga0436361_0947981 3300039447 Bacteria 1372
438 Ga0436361_1016242 3300039447 Bacteria 21235
439 Ga0436361_1029236 3300039447 Bacteria 2952
440 Ga0436361_1157107 3300039447 Bacteria 11574
441 Ga0439438_038487 3300041405 Bacteria 1248
442 Ga0451791_0647974 3300041451 Bacteria 552
443 Ga0451807_0601058 3300041486 Bacteria 1558
444 Ga0451837_0103931 3300041494 Bacteria 502
445 Ga0451853_0649462 3300041512 Bacteria 523
446 Ga0451853_1040831 3300041512 Bacteria 1165
447 Ga0439432_002855 3300042006 Bacteria 6441
448 Ga0439432_066336 3300042006 Bacteria 1105
449 Ga0439452_000002 3300042010 Bacteria 1377577
450 Ga0439452_000014 3300042010 Bacteria 344969
451 Ga0439452_000016 3300042010 Bacteria 338131
452 Ga0439452_000175 3300042010 Bacteria 47916
453 Ga0450890_003582 3300042127 Bacteria 2061
454 Ga0450900_002594 3300042136 Bacteria 1931
455 Ga0450900_015129 3300042136 Bacteria 1035
456 Ga0450902_045051 3300042137 Bacteria 753
457 Ga0439459_0001664 3300042438 Bacteria 3308
458 Ga0439464_0106781 3300042439 Bacteria 854
459 Ga0451577_0012119 3300042876 Bacteria 8110
460 Ga0466986_0012345 3300044650 Bacteria 5332
461 Ga0466969_0026952 3300044656 Bacteria 2945
462 Ga0466969_0440708 3300044656 Unclassified 592
463 Ga0466969_0465759 3300044656 Bacteria 575
464 Ga0466972_0004818 3300044658 Bacteria 6765
465 Ga0466981_0000010 3300044669 Bacteria 133630
466 Ga0466978_0027080 3300044671 Bacteria 3455
467 Ga0466982_0006994 3300044672 Bacteria 5517
468 Ga0453683_0760638 3300044673 Bacteria 637
469 Ga0466965_0008065 3300044683 Bacteria 4863
470 Ga0466965_0070097 3300044683 Bacteria 1762
471 Ga0466966_0045072 3300044684 Bacteria 2820
472 Ga0466966_0114479 3300044684 Bacteria 1661
473 Ga0466961_0000995 3300044693 Bacteria 17488
474 Ga0466961_0005576 3300044693 Bacteria 7948
475 Ga0466963_0109955 3300044694 Bacteria 1891
476 Ga0466963_0274098 3300044694 Bacteria 1185
477 Ga0466964_0025662 3300044706 Bacteria 2302
478 Ga0466964_0096091 3300044706 Bacteria 1298
479 Ga0453684_0763665 3300044712 Bacteria 1045
480 Ga0466971_0010314 3300044719 Bacteria 4081
481 Ga0466970_0003254 3300044765 Bacteria 7896
482 Ga0466957_0044066 3300044842 Bacteria 2703
483 Ga0466960_0018919 3300044901 Bacteria 3025
484 Ga0466959_0007774 3300045049 Bacteria 7541
485 Ga0466959_0055576 3300045049 Bacteria 2890
486 Ga0451576_0005011 3300045051 Bacteria 16829
487 Ga0466958_1009096 3300045836 Bacteria 543
488 Ga0466967_0076032 3300045976 Bacteria 3019
489 Ga0466967_0086004 3300045976 Bacteria 2848
490 Ga0495591_020952 3300046458 Bacteria 2145
491 Ga0495638_0021272 3300046460 Bacteria 4277
492 Ga0495651_0137910 3300046462 Bacteria 1773
493 Ga0495653_0637304 3300046463 Bacteria 652
494 Ga0495650_0000005 3300046471 Bacteria 766553
495 Ga0495650_0000043 3300046471 Bacteria 357197
496 Ga0495650_0008788 3300046471 Bacteria 5843
497 Ga0495650_0071835 3300046471 Bacteria 1356
498 Ga0495582_0219873 3300046473 Bacteria 1087
499 Ga0495616_0312196 3300046513 Bacteria 662
500 Ga0495620_0214757 3300046515 Bacteria 737
501 Ga0495628_0810451 3300046516 Bacteria 655
502 Ga0495637_0088113 3300046520 Bacteria 1228
503 Ga0495648_0148793 3300046524 Bacteria 1223
504 Ga0495642_0123996 3300046528 Bacteria 1109
505 Ga0495654_0000223 3300046530 Bacteria 52992
506 Ga0495654_0040481 3300046530 Bacteria 2322
507 Ga0495654_0397735 3300046530 Bacteria 547
508 Ga0495609_0237918 3300046538 Bacteria 752
509 Ga0495597_0000632 3300046542 Bacteria 28707
510 Ga0495597_0005786 3300046542 Bacteria 6483
511 Ga0495645_0707312 3300046543 Bacteria 611
512 Ga0495625_0000662 3300046660 Bacteria 49094
513 Ga0495588_0037160 3300046674 Bacteria 2473
514 Ga0495623_0302316 3300046679 Bacteria 884
515 Ga0495624_0508079 3300046690 Bacteria 721
516 Ga0495649_0001472 3300046694 Bacteria 17707
517 Ga0495649_0040716 3300046694 Bacteria 2542
518 Ga0495660_0000012 3300046810 Bacteria 350701
519 Ga0495672_0000034 3300047320 Bacteria 290832
520 Ga0495672_0000036 3300047320 Bacteria 279648
521 Ga0495680_0547774 3300047322 Bacteria 780
522 Ga0495675_0037724 3300047444 Bacteria 3077
523 Ga0495675_0138223 3300047444 Bacteria 1511
524 Ga0495675_0323718 3300047444 Bacteria 911
525 Ga0495679_029788 3300047446 Bacteria 1778
526 Ga0495679_039542 3300047446 Bacteria 1470
527 Ga0495679_056463 3300047446 Bacteria 1163
528 Ga0495679_171935 3300047446 Bacteria 576
529 Ga0495673_0000007 3300047469 Bacteria 796722
530 Ga0495684_0194989 3300047471 Bacteria 1495
531 Ga0496100_0014438 3300048903 Bacteria 4585
532 Ga0496100_0041571 3300048903 Bacteria 2931
533 Ga0496100_0680463 3300048903 Bacteria 802
534 Ga0496101_0303289 3300048904 Bacteria 1251
535 Ga0496101_1335683 3300048904 Bacteria 560
536 Ga0496104_0000043 3300048907 Bacteria 154773
537 Ga0496104_0001633 3300048907 Bacteria 19357
538 Ga0496104_0011028 3300048907 Bacteria 8086
539 Ga0496104_0039938 3300048907 Bacteria 4396
540 Ga0496104_0233549 3300048907 Bacteria 1751
541 Ga0496104_1313605 3300048907 Bacteria 626
542 Ga0496105_0008843 3300048908 Bacteria 7845
543 Ga0496105_0902545 3300048908 Bacteria 666
544 Ga0496107_1042305 3300048910 Bacteria 592
545 Ga0496108_0236379 3300048911 Bacteria 1589
546 Ga0496108_0408826 3300048911 Bacteria 1185
547 Ga0496109_0086533 3300048912 Bacteria 2894
548 Ga0496109_0120028 3300048912 Bacteria 2449
549 Ga0496109_0417172 3300048912 Bacteria 1268
550 Ga0496110_0081513 3300048913 Bacteria 2884
551 Ga0496110_0095437 3300048913 Bacteria 2663
552 Ga0496110_0230681 3300048913 Bacteria 1684
553 Ga0496111_0157304 3300048914 Bacteria 1686
554 Ga0496113_0471996 3300048916 Bacteria 1008
555 Ga0496114_0004699 3300048917 Bacteria 10623
556 Ga0496114_0174075 3300048917 Bacteria 1877
557 Ga0496114_0896757 3300048917 Bacteria 768
558 Ga0496115_0440301 3300048918 Bacteria 1054
559 Ga0496116_0000066 3300048919 Bacteria 264035
560 Ga0496116_0000870 3300048919 Bacteria 37662
561 Ga0496116_0006527 3300048919 Bacteria 10568
562 Ga0496116_0077663 3300048919 Bacteria 2073
563 Ga0496116_0094773 3300048919 Bacteria 1803
564 Ga0496117_0000020 3300048920 Bacteria 458405
565 Ga0496117_0001276 3300048920 Bacteria 37337
566 Ga0496117_0003356 3300048920 Bacteria 18676
567 Ga0496117_0003520 3300048920 Bacteria 18130
568 Ga0496117_0008312 3300048920 Bacteria 9876
569 Ga0496117_0010307 3300048920 Bacteria 8544
570 Ga0496117_0014895 3300048920 Bacteria 6669
571 Ga0496117_0023798 3300048920 Bacteria 4865
572 Ga0496117_0106419 3300048920 Bacteria 1760
573 Ga0496118_0000015 3300048921 Bacteria 551359
574 Ga0496118_0001324 3300048921 Bacteria 37554
575 Ga0496118_0001862 3300048921 Bacteria 30191
576 Ga0496118_0004771 3300048921 Bacteria 15859
577 Ga0496118_0013175 3300048921 Bacteria 7844
578 Ga0496118_0024247 3300048921 Bacteria 5244
579 Ga0496118_0024879 3300048921 Bacteria 5153
580 Ga0496118_0294103 3300048921 Bacteria 895
581 Ga0496119_0000001 3300048922 Bacteria 789520
582 Ga0496119_0000157 3300048922 Bacteria 93908
583 Ga0496119_0000230 3300048922 Bacteria 78527
584 Ga0496119_0001866 3300048922 Bacteria 24347
585 Ga0496119_0012016 3300048922 Bacteria 7083
586 Ga0496119_0016595 3300048922 Bacteria 5592
587 Ga0496119_0018063 3300048922 Bacteria 5269
588 Ga0496120_0000237 3300048923 Bacteria 94224
589 Ga0496120_0000324 3300048923 Bacteria 79261
590 Ga0496120_0004284 3300048923 Bacteria 12115
591 Ga0496120_0013419 3300048923 Bacteria 5515
592 Ga0496120_0015493 3300048923 Bacteria 5023
593 Ga0496120_0052113 3300048923 Bacteria 2332
594 Ga0496121_0000160 3300048924 Bacteria 146354
595 Ga0496121_0000415 3300048924 Bacteria 84560
596 Ga0496121_0001137 3300048924 Bacteria 46735
597 Ga0496121_0001182 3300048924 Bacteria 45659
598 Ga0496121_0001228 3300048924 Bacteria 44611
599 Ga0496121_0001573 3300048924 Bacteria 38016
600 Ga0496121_0010366 3300048924 Bacteria 10526
601 Ga0496121_0015722 3300048924 Bacteria 7889
602 Ga0496121_0136003 3300048924 Bacteria 1831
603 Ga0496121_0169499 3300048924 Bacteria 1587
604 Ga0496122_0000110 3300048925 Bacteria 190142
605 Ga0496122_0000265 3300048925 Bacteria 117022
606 Ga0496122_0002210 3300048925 Bacteria 28395
607 Ga0496122_0003353 3300048925 Bacteria 21111
608 Ga0496122_0013774 3300048925 Bacteria 7884
609 Ga0496122_0014483 3300048925 Bacteria 7618
610 Ga0496122_0018211 3300048925 Bacteria 6504
611 Ga0496122_0029788 3300048925 Bacteria 4591
612 Ga0496122_0030520 3300048925 Bacteria 4514
613 Ga0496122_0048913 3300048925 Bacteria 3246
614 Ga0496122_0069357 3300048925 Bacteria 2525
615 Ga0496122_0071347 3300048925 Bacteria 2476
616 Ga0496122_0137985 3300048925 Bacteria 1532
617 Ga0496122_0264419 3300048925 Bacteria 952
618 Ga0496122_0383982 3300048925 Bacteria 719
619 Ga0496122_0464532 3300048925 Bacteria 624
620 Ga0496123_0000014 3300048926 Bacteria 433465
621 Ga0496123_0000081 3300048926 Bacteria 190142
622 Ga0496123_0000836 3300048926 Bacteria 49282
623 Ga0496123_0002902 3300048926 Bacteria 20057
624 Ga0496123_0004375 3300048926 Bacteria 14912
625 Ga0496123_0009244 3300048926 Bacteria 8905
626 Ga0496123_0018392 3300048926 Bacteria 5562
627 Ga0496123_0020602 3300048926 Bacteria 5153
628 Ga0496123_0022982 3300048926 Bacteria 4787
629 Ga0496123_0072065 3300048926 Bacteria 2152
630 Ga0496123_0125578 3300048926 Bacteria 1433
631 Ga0496123_0155295 3300048926 Bacteria 1228
632 Ga0496123_0156102 3300048926 Bacteria 1223
633 Ga0496123_0208454 3300048926 Bacteria 995
634 Ga0496123_0507797 3300048926 Bacteria 525
635 Ga0496124_0000425 3300048927 Bacteria 75572
636 Ga0496124_0000530 3300048927 Bacteria 65033
637 Ga0496124_0002230 3300048927 Bacteria 25811
638 Ga0496124_0007334 3300048927 Bacteria 11745
639 Ga0496124_0007785 3300048927 Bacteria 11314
640 Ga0496124_0020587 3300048927 Bacteria 6089
641 Ga0496124_0022612 3300048927 Bacteria 5758
642 Ga0496124_0038214 3300048927 Bacteria 4169
643 Ga0496124_0046466 3300048927 Bacteria 3717
644 Ga0496124_0052569 3300048927 Bacteria 3460
645 Ga0496124_0064702 3300048927 Bacteria 3052
646 Ga0496124_0386554 3300048927 Bacteria 976
647 Ga0496124_0857130 3300048927 Unclassified 556
648 Ga0496125_0000009 3300048928 Bacteria 677678
649 Ga0496125_0000033 3300048928 Bacteria 351850
650 Ga0496125_0000081 3300048928 Bacteria 228069
651 Ga0496125_0000485 3300048928 Bacteria 69763
652 Ga0496125_0000500 3300048928 Bacteria 68387
653 Ga0496125_0001753 3300048928 Bacteria 30084
654 Ga0496125_0011561 3300048928 Bacteria 8817
655 Ga0496125_0012612 3300048928 Bacteria 8372
656 Ga0496125_0021460 3300048928 Bacteria 6023
657 Ga0496125_0031255 3300048928 Bacteria 4747
658 Ga0496125_0158093 3300048928 Bacteria 1544
659 Ga0496125_0299173 3300048928 Bacteria 986
660 Ga0496126_0000125 3300048929 Bacteria 180236
661 Ga0496126_0000142 3300048929 Bacteria 164438
662 Ga0496126_0001066 3300048929 Bacteria 46225
663 Ga0496126_0011764 3300048929 Bacteria 9011
664 Ga0496126_0015085 3300048929 Bacteria 7785
665 Ga0496126_0070970 3300048929 Bacteria 3101
666 Ga0496126_0072656 3300048929 Bacteria 3059
667 Ga0496126_0123048 3300048929 Bacteria 2247
668 Ga0496126_0271622 3300048929 Bacteria 1407
669 Ga0496126_0353454 3300048929 Bacteria 1201
670 Ga0496126_0544862 3300048929 Bacteria 921
671 Ga0496126_0595563 3300048929 Bacteria 871
672 Ga0496126_0615915 3300048929 Bacteria 853
673 Ga0496126_1078239 3300048929 Bacteria 598
674 Ga0496126_1199688 3300048929 Bacteria 558
675 Ga0496126_1320864 3300048929 Bacteria 524
676 Ga0495682_0326167 3300049460 Unclassified 541
677 Ga0501043_0000010 3300049579 Bacteria 206374
678 Ga0501046_0000097 3300049580 Bacteria 93650
679 Ga0501046_0221889 3300049580 Bacteria 1399
680 Ga0501047_0000026 3300049581 Bacteria 225296
681 Ga0501048_0001099 3300049582 Bacteria 20303
682 Ga0501209_284628 3300049656 Bacteria 519
683 Ga0501241_020201 3300049758 Bacteria 1224
684 Ga0501035_1034296 3300049822 Unclassified 644
685 Ga0501044_0248561 3300049823 Bacteria 1720
686 Ga0501044_0349284 3300049823 Bacteria 1399
687 Ga0501044_0471667 3300049823 Bacteria 1159
688 Ga0501044_0508542 3300049823 Bacteria 1105
689 Ga0501044_1065913 3300049823 Bacteria 678
690 Ga0501045_0014425 3300049824 Bacteria 5599
691 nmdc:mga00v17_265436_c1 3300050491 Bacteria 1114
692 nmdc:mga00v17_461224_c1 3300050491 Bacteria 825
693 nmdc:mga0k408_61882_c1 3300050493 Bacteria 2176
694 nmdc:mga07m45_51893_c1 3300050496 Bacteria 2314
695 Ga0495655_0240109 3300053083 Unclassified 606
696 Ga0500651_0000354 3300053093 Bacteria 25764
697 Ga0500651_0024668 3300053093 Bacteria 3771
698 Ga0500607_061665 3300053121 Bacteria 1962
699 Ga0500618_000007 3300053125 Bacteria 226268
700 Ga0500559_0555969 3300053136 Unclassified 523
701 Ga0500564_373155 3300053138 Unclassified 524
702 Ga0500573_0005353 3300053140 Bacteria 6871
703 Ga0500627_0187982 3300053158 Bacteria 928
704 Ga0500634_0000356 3300053161 Bacteria 14511
705 Ga0500636_0000081 3300053177 Bacteria 47382
706 Ga0466962_0004792 3300061719 Bacteria 6509

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300014497 Ga0182008_10020234 Ga0182008_100202344 76
2 3300015261 Ga0182006_1101162 Ga0182006_11011622 76
3 3300015262 Ga0182007_10013207 Ga0182007_100132072 76
4 3300053136 Ga0500559_0555969 Ga0500559_0555969_113_388 76
5 iso_pu_bacteria 2894023352 2894024787 84
6 3300046679 Ga0495623_0302316 Ga0495623_0302316_334_609 86
7 3300047444 Ga0495675_0037724 Ga0495675_0037724_1060_1335 86
8 3300047444 Ga0495675_0138223 Ga0495675_0138223_1053_1328 86
9 3300047444 Ga0495675_0323718 Ga0495675_0323718_290_565 86
10 3300047471 Ga0495684_0194989 Ga0495684_0194989_164_439 86
11 iso_pu_bacteria 2510917026 2511168992 86
12 iso_pu_bacteria 2585427591 2585829481 86
13 iso_pu_bacteria 2585427592 2585834846 86
14 iso_pu_bacteria 2585427633 2585994865 86
15 iso_pu_bacteria 2585427634 2585999405 86
16 iso_pu_bacteria 2596583598 2597029415 86
17 iso_pu_bacteria 2599185178 2599447353 86
18 iso_pu_bacteria 2602042109 2603865354 86
19 iso_pu_bacteria 2667528173 2671109924 86
20 iso_pu_bacteria 2671180115 2671584691 86
21 iso_pu_bacteria 2821123053 2821124004 86
22 iso_pu_bacteria 2838736955 2838738966 86
23 iso_pu_bacteria 2841840854 2841842864 86
24 iso_pu_bacteria 2842140634 2842142645 86
25 iso_pu_bacteria 2846033681 2846036374 86
26 iso_pu_bacteria 2846037992 2846038211 86
27 iso_pu_bacteria 2854916844 2854921761 86
28 iso_pu_bacteria 2857531043 2857531566 86
29 iso_pu_bacteria 2885266251 2885268772 86
30 iso_pu_bacteria 2891670763 2891674600 86
31 iso_pu_bacteria 2904474040 2904477244 86
32 iso_pu_bacteria 2919150387 2919153411 86
33 iso_pu_bacteria 2919171160 2919171691 86
34 iso_pu_bacteria 2927143783 2927144037 86
35 iso_pu_bacteria 2928058823 2928060728 86
36 iso_pu_bacteria 2939573065 2939576248 86
37 iso_pu_bacteria 8018405270 8018408533 86
38 iso_pu_bacteria 8055693939 8055695692 86
39 iso_pu_bacteria 2547132181 2547695908 87
40 iso_pu_bacteria 2554235132 2554816430 87
41 iso_pu_bacteria 2554235231 2555245629 87
42 iso_pu_bacteria 2554235234 2555258054 87
43 iso_pu_bacteria 2561511199 2562462593 87
44 iso_pu_bacteria 2599185169 2599409108 87
45 iso_pu_bacteria 2600255254 2601522385 87
46 iso_pu_bacteria 2600255255 2601527411 87
47 iso_pu_bacteria 2600255256 2601532831 87
48 iso_pu_bacteria 2600255257 2601538201 87
49 iso_pu_bacteria 2600255280 2601614241 87
50 iso_pu_bacteria 2600255281 2601618963 87
51 iso_pu_bacteria 2600255287 2601642433 87
52 iso_pu_bacteria 2600255288 2601647280 87
53 iso_pu_bacteria 2600255289 2601652389 87
54 iso_pu_bacteria 2600255290 2601657716 87
55 iso_pu_bacteria 2600255291 2601662254 87
56 iso_pu_bacteria 2600255298 2601695211 87
57 iso_pu_bacteria 2600255299 2601699886 87
58 iso_pu_bacteria 2600255300 2601705513 87
59 iso_pu_bacteria 2600255301 2601710541 87
60 iso_pu_bacteria 2600255302 2601715554 87
61 iso_pu_bacteria 2600255303 2601720238 87
62 iso_pu_bacteria 2600255304 2601725959 87
63 iso_pu_bacteria 2600255305 2601730502 87
64 iso_pu_bacteria 2600255306 2601735518 87
65 iso_pu_bacteria 2600255307 2601740216 87
66 iso_pu_bacteria 2600255309 2601750705 87
67 iso_pu_bacteria 2600255310 2601756143 87
68 iso_pu_bacteria 2600255311 2601763376 87
69 iso_pu_bacteria 2600255392 2602017958 87
70 iso_pu_bacteria 2602042046 2603637710 87
71 iso_pu_bacteria 2602042047 2603642386 87
72 iso_pu_bacteria 2602042052 2603659622 87
73 iso_pu_bacteria 2602042053 2603664898 87
74 iso_pu_bacteria 2602042066 2603698501 87
75 iso_pu_bacteria 2602042067 2603702990 87
76 iso_pu_bacteria 2602042103 2603837891 87
77 iso_pu_bacteria 2602042104 2603842968 87
78 iso_pu_bacteria 2602042105 2603848042 87
79 iso_pu_bacteria 2602042106 2603853113 87
80 iso_pu_bacteria 2602042109 2603867052 87
81 iso_pu_bacteria 2602042110 2603871167 87
82 iso_pu_bacteria 2602042111 2603876081 87
83 iso_pu_bacteria 2603880178 2606048360 87
84 iso_pu_bacteria 2603880184 2606069325 87
85 iso_pu_bacteria 2603880202 2606145134 87
86 iso_pu_bacteria 2603880211 2606175762 87
87 iso_pu_bacteria 2606217733 2608382643 87
88 iso_pu_bacteria 2609459761 2609912340 87
89 iso_pu_bacteria 2636415599 2637225013 87
90 iso_pu_bacteria 2667528172 2671102900 87
91 iso_pu_bacteria 2671180115 2671585732 87
92 iso_pu_bacteria 2675903046 2676406250 87
93 iso_pu_bacteria 2681812866 2681997314 87
94 iso_pu_bacteria 2681812869 2682005384 87
95 iso_pu_bacteria 2711768156 2712469905 87
96 iso_pu_bacteria 2751185917 2753855983 87
97 iso_pu_bacteria 2765235841 2765585998 87
98 iso_pu_bacteria 2765235842 2765588954 87
99 iso_pu_bacteria 2775506706 2775539003 87
100 iso_pu_bacteria 2775507074 2777023346 87
101 iso_pu_bacteria 2791355010 2792313126 87
102 iso_pu_bacteria 2791355275 2793405463 87
103 iso_pu_bacteria 2811995292 2813728748 87
104 iso_pu_bacteria 2814123068 2814696271 87
105 iso_pu_bacteria 2821118458 2821119814 87
106 iso_pu_bacteria 2823373977 2823374746 87
107 iso_pu_bacteria 2842733646 2842738580 87
108 iso_pu_bacteria 2844425489 2844427526 87
109 iso_pu_bacteria 2884086401 2884088657 87
110 iso_pu_bacteria 2886848708 2886851554 87
111 iso_pu_bacteria 2891670763 2891670887 87
112 iso_pu_bacteria 2894414249 2894414380 87
113 iso_pu_bacteria 2904513164 2904514100 87
114 iso_pu_bacteria 2919108558 2919109296 87
115 iso_pu_bacteria 2923525760 2923527106 87
116 iso_pu_bacteria 2923634449 2923634854 87
117 iso_pu_bacteria 2927833300 2927834093 87
118 iso_pu_bacteria 2935625433 2935626556 87
119 iso_pu_bacteria 2937539931 2937541662 87
120 iso_pu_bacteria 2939568625 2939569129 87
121 iso_pu_bacteria 2939573065 2939573546 87
122 iso_pu_bacteria 2939607340 2939611108 87
123 iso_pu_bacteria 2939617950 2939621223 87
124 iso_pu_bacteria 2939642701 2939643825 87
125 iso_pu_bacteria 2945874760 2945877820 87
126 iso_pu_bacteria 2969079654 2969082003 87
127 iso_pu_bacteria 2971820967 2971823855 87
128 iso_pu_bacteria 2974310843 2974312120 87
129 iso_pu_bacteria 2974435778 2974438534 87
130 iso_pu_bacteria 2984559226 2984564437 87
131 iso_pu_bacteria 2984595703 2984597169 87
132 iso_pu_bacteria 2998344455 2998347102 87
133 iso_pu_bacteria 3000376612 3000379194 87
134 iso_pu_bacteria 8001522603 8001524877 87
135 iso_pu_bacteria 8018221730 8018223433 87
136 iso_pu_bacteria 8018405270 8018407783 87
137 iso_pu_bacteria 8019504834 8019507928 87
138 iso_pu_bacteria 8021622325 8021623370 87
139 iso_pu_bacteria 8021626552 8021626697 87
140 iso_pu_bacteria 8021648035 8021650654 87
141 iso_pu_bacteria 8052494512 8052495434 87
142 iso_pu_bacteria 8054844752 8054845875 87
143 iso_pu_bacteria 8054849141 8054853210 87
144 iso_pu_bacteria 8054929484 8054932789 87
145 iso_pu_bacteria 8055087960 8055089298 87
146 iso_pu_bacteria 8055092621 8055092646 87
147 iso_pu_bacteria 8055097453 8055098949 87
148 iso_pu_bacteria 8057304971 8057309361 87
149 3300005455 Ga0070663_100076870 Ga0070663_1000768702 88
150 3300026067 Ga0207678_10105618 Ga0207678_101056182 88
151 3300049580 Ga0501046_0221889 Ga0501046_0221889_921_1193 88
152 3300049822 Ga0501035_1034296 Ga0501035_1034296_347_613 88
153 3300049823 Ga0501044_0248561 Ga0501044_0248561_964_1236 88
154 3300003322 rootL2_10039490 rootL2_100394901 89
155 3300003773 Ga0055537_1000099 Ga0055537_100009948 89
156 3300003775 Ga0055524_1003256 Ga0055524_10032566 89
157 3300003784 Ga0055534_1000023 Ga0055534_100002365 89
158 3300003790 Ga0055528_1000030 Ga0055528_100003065 89
159 3300005327 Ga0070658_10044744 Ga0070658_100447444 89
160 3300005367 Ga0070667_101888182 Ga0070667_1018881821 89
161 3300009092 Ga0105250_10158913 Ga0105250_101589132 89
162 3300025263 Ga0209565_1000003 Ga0209565_1000003175 89
163 3300025273 Ga0209673_1000003 Ga0209673_100000361 89
164 3300025291 Ga0209675_1000003 Ga0209675_1000003863 89
165 3300025295 Ga0209564_1000012 Ga0209564_1000012672 89
166 3300025299 Ga0209256_1000235 Ga0209256_100023527 89
167 3300025986 Ga0207658_11601086 Ga0207658_116010862 89
168 3300027378 Ga0209981_1018028 Ga0209981_10180282 89
169 3300027424 Ga0209984_1027163 Ga0209984_10271632 89
170 3300027552 Ga0209982_1002637 Ga0209982_10026372 89
171 3300027665 Ga0209983_1002692 Ga0209983_10026922 89
172 3300027682 Ga0209971_1001469 Ga0209971_10014693 89
173 3300037418 Ga0395900_1002697 Ga0395900_1002697_416_685 89
174 3300048903 Ga0496100_0680463 Ga0496100_0680463_293_562 89
175 3300048904 Ga0496101_1335683 Ga0496101_1335683_97_366 89
176 3300049823 Ga0501044_1065913 Ga0501044_1065913_223_492 89
177 2162886007 SwRhRL2b_contig_2947596 SwRhRL2b_0208.00005350 90
178 3300001915 JGI24741J21665_1000832 JGI24741J21665_10008324 90
179 3300001979 JGI24740J21852_10000282 JGI24740J21852_100002824 90
180 3300001979 JGI24740J21852_10000391 JGI24740J21852_1000039114 90
181 3300002705 JGI25156J39149_1002231 JGI25156J39149_10022319 90
182 3300002705 JGI25156J39149_1022518 JGI25156J39149_10225182 90
183 3300002705 JGI25156J39149_1034333 JGI25156J39149_10343332 90
184 3300002737 JGI25162J39368_1000009 JGI25162J39368_1000009192 90
185 3300002738 JGI25154J39366_1003436 JGI25154J39366_10034365 90
186 3300002771 JGI25163J39215_1000150 JGI25163J39215_100015012 90
187 3300002772 JGI25164J39214_1000002 JGI25164J39214_1000002155 90
188 3300003578 Ga0006562J51391_1101642 Ga0006562J51391_11016424 90
189 3300003751 Ga0055538_1000015 Ga0055538_1000015116 90
190 3300003751 Ga0055538_1006716 Ga0055538_10067162 90
191 3300003751 Ga0055538_1006820 Ga0055538_10068202 90
192 3300003752 Ga0055539_1000009 Ga0055539_1000009207 90
193 3300003752 Ga0055539_1000231 Ga0055539_100023122 90
194 3300003756 Ga0055533_1000012 Ga0055533_1000012154 90
195 3300003756 Ga0055533_1002682 Ga0055533_10026822 90
196 3300003756 Ga0055533_1010696 Ga0055533_10106962 90
197 3300003756 Ga0055533_1011907 Ga0055533_10119073 90
198 3300003758 Ga0055532_1000040 Ga0055532_1000040150 90
199 3300003759 Ga0055525_1000014 Ga0055525_1000014207 90
200 3300003759 Ga0055525_1000412 Ga0055525_100041222 90
201 3300003760 Ga0055527_1003918 Ga0055527_10039183 90
202 3300003761 Ga0055535_1000029 Ga0055535_1000029150 90
203 3300003762 Ga0055542_1000896 Ga0055542_100089610 90
204 3300003762 Ga0055542_1017797 Ga0055542_10177972 90
205 3300003763 Ga0055529_1000055 Ga0055529_100005533 90
206 3300003763 Ga0055529_1000358 Ga0055529_100035820 90
207 3300003781 Ga0055536_1025590 Ga0055536_10255904 90
208 3300003791 Ga0055530_10057085 Ga0055530_100570852 90
209 3300003792 Ga0055540_1023871 Ga0055540_10238711 90
210 3300003792 Ga0055540_1043757 Ga0055540_10437572 90
211 3300003794 Ga0055531_10012991 Ga0055531_100129916 90
212 3300003841 Ga0055541_1000006 Ga0055541_1000006154 90
213 3300003841 Ga0055541_1000930 Ga0055541_10009307 90
214 3300003841 Ga0055541_1011058 Ga0055541_10110582 90
215 3300003841 Ga0055541_1026099 Ga0055541_10260991 90
216 3300005289 Ga0065704_10000959 Ga0065704_1000095925 90
217 3300005289 Ga0065704_10488540 Ga0065704_104885401 90
218 3300005327 Ga0070658_11624685 Ga0070658_116246851 90
219 3300005329 Ga0070683_100369963 Ga0070683_1003699632 90
220 3300005337 Ga0070682_100079964 Ga0070682_1000799643 90
221 3300005344 Ga0070661_100000037 Ga0070661_10000003773 90
222 3300005455 Ga0070663_100000001 Ga0070663_100000001144 90
223 3300005564 Ga0070664_100000006 Ga0070664_10000000621 90
224 3300005577 Ga0068857_100015730 Ga0068857_1000157301 90
225 3300005578 Ga0068854_100000048 Ga0068854_10000004821 90
226 3300005614 Ga0068856_100001024 Ga0068856_10000102424 90
227 3300005616 Ga0068852_100015788 Ga0068852_1000157884 90
228 3300006051 Ga0075364_10020788 Ga0075364_100207883 90
229 3300006946 Ga0079104_1000074 Ga0079104_100007458 90
230 3300006946 Ga0079104_1027699 Ga0079104_10276992 90
231 3300006948 Ga0099826_10314074 Ga0099826_103140741 90
232 3300009011 Ga0105251_10000116 Ga0105251_1000011623 90
233 3300009036 Ga0105244_10000441 Ga0105244_100004416 90
234 3300009036 Ga0105244_10003362 Ga0105244_100033628 90
235 3300009036 Ga0105244_10004186 Ga0105244_100041863 90
236 3300009092 Ga0105250_10000095 Ga0105250_100000955 90
237 3300009092 Ga0105250_10000114 Ga0105250_100001149 90
238 3300009092 Ga0105250_10001759 Ga0105250_100017596 90
239 3300009093 Ga0105240_10065701 Ga0105240_100657012 90
240 3300009176 Ga0105242_11770245 Ga0105242_117702452 90
241 3300009177 Ga0105248_11417259 Ga0105248_114172592 90
242 3300009988 Ga0105035_102206 Ga0105035_1022061 90
243 3300013100 Ga0157373_10027127 Ga0157373_100271274 90
244 3300013100 Ga0157373_10705675 Ga0157373_107056752 90
245 3300013102 Ga0157371_10000080 Ga0157371_1000008029 90
246 3300013104 Ga0157370_10000032 Ga0157370_10000032128 90
247 3300013105 Ga0157369_10004887 Ga0157369_100048879 90
248 3300013306 Ga0163162_11279187 Ga0163162_112791871 90
249 3300013307 Ga0157372_10000235 Ga0157372_1000023561 90
250 3300015261 Ga0182006_1008993 Ga0182006_10089934 90
251 3300015261 Ga0182006_1161344 Ga0182006_11613442 90
252 3300017792 Ga0163161_10039031 Ga0163161_100390313 90
253 3300020077 Ga0206351_10514496 Ga0206351_105144961 90
254 3300020610 Ga0154015_1601999 Ga0154015_16019995 90
255 3300021361 Ga0213872_10000007 Ga0213872_10000007145 90
256 3300021361 Ga0213872_10000101 Ga0213872_1000010161 90
257 3300021361 Ga0213872_10000114 Ga0213872_1000011423 90
258 3300025207 Ga0209760_100051 Ga0209760_10005159 90
259 3300025224 Ga0209784_100001 Ga0209784_1000012039 90
260 3300025224 Ga0209784_100006 Ga0209784_100006361 90
261 3300025224 Ga0209784_100177 Ga0209784_10017734 90
262 3300025224 Ga0209784_100373 Ga0209784_10037310 90
263 3300025224 Ga0209784_104707 Ga0209784_1047072 90
264 3300025225 Ga0209566_100001 Ga0209566_1000012039 90
265 3300025225 Ga0209566_100002 Ga0209566_100002361 90
266 3300025225 Ga0209566_100615 Ga0209566_1006156 90
267 3300025225 Ga0209566_102391 Ga0209566_1023912 90
268 3300025226 Ga0209674_100002 Ga0209674_1000022039 90
269 3300025226 Ga0209674_100010 Ga0209674_100010776 90
270 3300025226 Ga0209674_100060 Ga0209674_10006056 90
271 3300025226 Ga0209674_100076 Ga0209674_10007666 90
272 3300025226 Ga0209674_111246 Ga0209674_1112462 90
273 3300025228 Ga0209672_100231 Ga0209672_10023131 90
274 3300025229 Ga0209147_100018 Ga0209147_100018150 90
275 3300025230 Ga0209563_100002 Ga0209563_100002574 90
276 3300025230 Ga0209563_100041 Ga0209563_100041111 90
277 3300025230 Ga0209563_109598 Ga0209563_1095982 90
278 3300025230 Ga0209563_112646 Ga0209563_1126462 90
279 3300025230 Ga0209563_128624 Ga0209563_1286242 90
280 3300025231 Ga0207427_100020 Ga0207427_100020202 90
281 3300025233 Ga0209437_100001 Ga0209437_100001574 90
282 3300025242 Ga0209258_100028 Ga0209258_100028150 90
283 3300025246 Ga0209646_1000043 Ga0209646_1000043158 90
284 3300025250 Ga0209026_1008003 Ga0209026_10080032 90
285 3300025253 Ga0209677_100002 Ga0209677_100002574 90
286 3300025253 Ga0209677_100007 Ga0209677_100007361 90
287 3300025254 Ga0209148_1000265 Ga0209148_100026566 90
288 3300025254 Ga0209148_1003982 Ga0209148_10039824 90
289 3300025256 Ga0209759_1006235 Ga0209759_10062354 90
290 3300025256 Ga0209759_1007283 Ga0209759_10072832 90
291 3300025256 Ga0209759_1025248 Ga0209759_10252482 90
292 3300025272 Ga0209455_1000065 Ga0209455_1000065150 90
293 3300025292 Ga0209676_1021713 Ga0209676_10217133 90
294 3300025297 Ga0209758_1000121 Ga0209758_100012116 90
295 3300025298 Ga0209050_1008139 Ga0209050_10081397 90
296 3300025304 Ga0209257_1144702 Ga0209257_11447022 90
297 3300025711 Ga0207696_1000024 Ga0207696_1000024126 90
298 3300025711 Ga0207696_1000038 Ga0207696_1000038164 90
299 3300025711 Ga0207696_1000876 Ga0207696_100087612 90
300 3300025711 Ga0207696_1001588 Ga0207696_100158811 90
301 3300025728 Ga0207655_1000413 Ga0207655_100041332 90
302 3300025728 Ga0207655_1007341 Ga0207655_10073415 90
303 3300025728 Ga0207655_1011857 Ga0207655_10118575 90
304 3300025735 Ga0207713_1000002 Ga0207713_1000002136 90
305 3300025909 Ga0207705_10904618 Ga0207705_109046182 90
306 3300025913 Ga0207695_10001905 Ga0207695_1000190516 90
307 3300025920 Ga0207649_10000622 Ga0207649_100006226 90
308 3300025934 Ga0207686_10622463 Ga0207686_106224632 90
309 3300025945 Ga0207679_10000012 Ga0207679_10000012156 90
310 3300025981 Ga0207640_10000055 Ga0207640_1000005531 90
311 3300026067 Ga0207678_10000243 Ga0207678_1000024332 90
312 3300026078 Ga0207702_10000028 Ga0207702_10000028156 90
313 3300026116 Ga0207674_10012817 Ga0207674_100128179 90
314 3300026142 Ga0207698_10014504 Ga0207698_100145045 90
315 3300027111 Ga0209281_1000066 Ga0209281_100006656 90
316 3300027111 Ga0209281_1000078 Ga0209281_1000078100 90
317 3300027312 Ga0209371_1032234 Ga0209371_10322343 90
318 3300030500 Ga0268256_1036660 Ga0268256_10366603 90
319 3300031251 Ga0265327_10000082 Ga0265327_1000008226 90
320 3300031251 Ga0265327_10019345 Ga0265327_100193452 90
321 3300031548 Ga0307408_100592827 Ga0307408_1005928272 90
322 3300031731 Ga0307405_10200390 Ga0307405_102003902 90
323 3300037312 Ga0395899_0347015 Ga0395899_0347015_236_508 90
324 3300037418 Ga0395900_0005028 Ga0395900_0005028_9707_9979 90
325 3300037471 Ga0395905_0211363 Ga0395905_0211363_284_556 90
326 3300039447 Ga0436361_0163583 Ga0436361_0163583_85498_85770 90
327 3300039447 Ga0436361_0213400 Ga0436361_0213400_70354_70626 90
328 3300039447 Ga0436361_0215157 Ga0436361_0215157_148655_148966 90
329 3300039447 Ga0436361_0383736 Ga0436361_0383736_426_713 90
330 3300039447 Ga0436361_0947981 Ga0436361_0947981_746_1018 90
331 3300041494 Ga0451837_0103931 Ga0451837_0103931_156_428 90
332 3300041512 Ga0451853_0649462 Ga0451853_0649462_200_472 90
333 3300044650 Ga0466986_0012345 Ga0466986_0012345_4211_4483 90
334 3300044656 Ga0466969_0465759 Ga0466969_0465759_260_532 90
335 3300044658 Ga0466972_0004818 Ga0466972_0004818_3958_4230 90
336 3300044671 Ga0466978_0027080 Ga0466978_0027080_2023_2295 90
337 3300044672 Ga0466982_0006994 Ga0466982_0006994_2280_2552 90
338 3300044683 Ga0466965_0008065 Ga0466965_0008065_2731_3003 90
339 3300044684 Ga0466966_0114479 Ga0466966_0114479_1152_1424 90
340 3300044693 Ga0466961_0005576 Ga0466961_0005576_3893_4165 90
341 3300044694 Ga0466963_0109955 Ga0466963_0109955_1437_1709 90
342 3300044706 Ga0466964_0025662 Ga0466964_0025662_369_641 90
343 3300044719 Ga0466971_0010314 Ga0466971_0010314_1801_2073 90
344 3300044765 Ga0466970_0003254 Ga0466970_0003254_3835_4107 90
345 3300044842 Ga0466957_0044066 Ga0466957_0044066_525_797 90
346 3300044901 Ga0466960_0018919 Ga0466960_0018919_1508_1780 90
347 3300045049 Ga0466959_0007774 Ga0466959_0007774_3474_3746 90
348 3300045836 Ga0466958_1009096 Ga0466958_1009096_221_493 90
349 3300045976 Ga0466967_0076032 Ga0466967_0076032_1880_2152 90
350 3300045976 Ga0466967_0086004 Ga0466967_0086004_1830_2102 90
351 3300046462 Ga0495651_0137910 Ga0495651_0137910_1361_1633 90
352 3300046463 Ga0495653_0637304 Ga0495653_0637304_247_519 90
353 3300046471 Ga0495650_0000043 Ga0495650_0000043_265213_265485 90
354 3300046471 Ga0495650_0008788 Ga0495650_0008788_2994_3266 90
355 3300046516 Ga0495628_0810451 Ga0495628_0810451_16_288 90
356 3300046520 Ga0495637_0088113 Ga0495637_0088113_116_388 90
357 3300046528 Ga0495642_0123996 Ga0495642_0123996_494_766 90
358 3300046530 Ga0495654_0000223 Ga0495654_0000223_40176_40448 90
359 3300046542 Ga0495597_0005786 Ga0495597_0005786_15_287 90
360 3300046543 Ga0495645_0707312 Ga0495645_0707312_270_542 90
361 3300046810 Ga0495660_0000012 Ga0495660_0000012_154337_154609 90
362 3300047322 Ga0495680_0547774 Ga0495680_0547774_494_766 90
363 3300047446 Ga0495679_029788 Ga0495679_029788_297_569 90
364 3300048907 Ga0496104_0001633 Ga0496104_0001633_13357_13629 90
365 3300048907 Ga0496104_0039938 Ga0496104_0039938_80_352 90
366 3300048911 Ga0496108_0236379 Ga0496108_0236379_770_1042 90
367 3300048912 Ga0496109_0086533 Ga0496109_0086533_524_796 90
368 3300048912 Ga0496109_0417172 Ga0496109_0417172_671_943 90
369 3300048913 Ga0496110_0095437 Ga0496110_0095437_1365_1637 90
370 3300048913 Ga0496110_0230681 Ga0496110_0230681_393_677 90
371 3300048914 Ga0496111_0157304 Ga0496111_0157304_108_380 90
372 3300048917 Ga0496114_0896757 Ga0496114_0896757_257_529 90
373 3300048919 Ga0496116_0000066 Ga0496116_0000066_191853_192125 90
374 3300048920 Ga0496117_0003356 Ga0496117_0003356_18386_18658 90
375 3300048920 Ga0496117_0014895 Ga0496117_0014895_927_1199 90
376 3300048921 Ga0496118_0004771 Ga0496118_0004771_12556_12828 90
377 3300048922 Ga0496119_0000157 Ga0496119_0000157_35272_35544 90
378 3300048922 Ga0496119_0018063 Ga0496119_0018063_2604_2876 90
379 3300048923 Ga0496120_0000237 Ga0496120_0000237_35341_35613 90
380 3300048923 Ga0496120_0015493 Ga0496120_0015493_1274_1546 90
381 3300048925 Ga0496122_0000110 Ga0496122_0000110_189699_189971 90
382 3300048925 Ga0496122_0069357 Ga0496122_0069357_16_288 90
383 3300048925 Ga0496122_0264419 Ga0496122_0264419_594_866 90
384 3300048926 Ga0496123_0000081 Ga0496123_0000081_172_444 90
385 3300048926 Ga0496123_0072065 Ga0496123_0072065_1826_2098 90
386 3300048926 Ga0496123_0507797 Ga0496123_0507797_109_381 90
387 3300048927 Ga0496124_0000530 Ga0496124_0000530_31071_31343 90
388 3300048927 Ga0496124_0038214 Ga0496124_0038214_3779_4051 90
389 3300048928 Ga0496125_0000033 Ga0496125_0000033_78281_78553 90
390 3300048928 Ga0496125_0000081 Ga0496125_0000081_153530_153802 90
391 3300048928 Ga0496125_0031255 Ga0496125_0031255_4425_4697 90
392 3300048929 Ga0496126_0001066 Ga0496126_0001066_14984_15256 90
393 3300048929 Ga0496126_0011764 Ga0496126_0011764_3548_3835 90
394 3300048929 Ga0496126_0544862 Ga0496126_0544862_623_895 90
395 3300049656 Ga0501209_284628 Ga0501209_284628_112_384 90
396 3300049758 Ga0501241_020201 Ga0501241_020201_889_1173 90
397 3300049823 Ga0501044_0471667 Ga0501044_0471667_784_1059 90
398 3300050491 nmdc:mga00v17_265436_c1 nmdc:mga00v17_265436_c1_41_313 90
399 3300053121 Ga0500607_061665 Ga0500607_061665_1173_1445 90
400 3300053125 Ga0500618_000007 Ga0500618_000007_68632_68904 90
401 3300053138 Ga0500564_373155 Ga0500564_373155_204_476 90
402 3300053140 Ga0500573_0005353 Ga0500573_0005353_3040_3312 90
403 3300053158 Ga0500627_0187982 Ga0500627_0187982_403_675 90
404 3300053161 Ga0500634_0000356 Ga0500634_0000356_13906_14178 90
405 3300053177 Ga0500636_0000081 Ga0500636_0000081_2933_3205 90
406 3300061719 Ga0466962_0004792 Ga0466962_0004792_3064_3336 90
407 2162886007 SwRhRL2b_contig_126825 SwRhRL2b_0250.00003520 91
408 2162886007 SwRhRL2b_contig_1451602 SwRhRL2b_0217.00001260 91
409 2162886007 SwRhRL2b_contig_3517994 SwRhRL2b_0730.00007030 91
410 2162886007 SwRhRL2b_contig_372564 SwRhRL2b_0484.00006750 91
411 3300002244 JGI24742J22300_10056359 JGI24742J22300_100563591 91
412 3300002773 JGI25152J39213_1000878 JGI25152J39213_10008782 91
413 3300002773 JGI25152J39213_1005507 JGI25152J39213_10055073 91
414 3300002774 JGI25150J39212_1009220 JGI25150J39212_10092201 91
415 3300003215 JGI25153J46596_10001192 JGI25153J46596_1000119222 91
416 3300003320 rootH2_10055337 rootH2_100553374 91
417 3300003323 rootH1_10139962 rootH1_101399622 91
418 3300003759 Ga0055525_1000161 Ga0055525_100016164 91
419 3300003771 Ga0055526_1000392 Ga0055526_100039217 91
420 3300003775 Ga0055524_1000106 Ga0055524_100010656 91
421 3300003775 Ga0055524_1000720 Ga0055524_100072016 91
422 3300003781 Ga0055536_1051273 Ga0055536_10512731 91
423 3300003791 Ga0055530_10001128 Ga0055530_100011283 91
424 3300003792 Ga0055540_1000110 Ga0055540_100011028 91
425 3300003794 Ga0055531_10006208 Ga0055531_100062082 91
426 3300003794 Ga0055531_10014883 Ga0055531_100148832 91
427 3300003856 Ga0058692_1000113 Ga0058692_100011338 91
428 3300003856 Ga0058692_1000602 Ga0058692_100060214 91
429 3300003856 Ga0058692_1000693 Ga0058692_10006932 91
430 3300003856 Ga0058692_1004633 Ga0058692_10046334 91
431 3300003856 Ga0058692_1006711 Ga0058692_10067111 91
432 3300003856 Ga0058692_1035184 Ga0058692_10351841 91
433 3300005262 Ga0065165_1000087 Ga0065165_1000087124 91
434 3300005289 Ga0065704_10000330 Ga0065704_1000033010 91
435 3300005289 Ga0065704_10000780 Ga0065704_1000078033 91
436 3300005289 Ga0065704_10002644 Ga0065704_100026443 91
437 3300005289 Ga0065704_10004459 Ga0065704_100044592 91
438 3300005289 Ga0065704_10075146 Ga0065704_100751463 91
439 3300005289 Ga0065704_10235622 Ga0065704_102356222 91
440 3300005327 Ga0070658_10906998 Ga0070658_109069981 91
441 3300005328 Ga0070676_10115665 Ga0070676_101156652 91
442 3300005331 Ga0070670_100605951 Ga0070670_1006059512 91
443 3300005333 Ga0070677_10032659 Ga0070677_100326592 91
444 3300005335 Ga0070666_10006517 Ga0070666_100065177 91
445 3300005338 Ga0068868_100142618 Ga0068868_1001426183 91
446 3300005344 Ga0070661_100301568 Ga0070661_1003015682 91
447 3300005347 Ga0070668_100192959 Ga0070668_1001929593 91
448 3300005354 Ga0070675_100039642 Ga0070675_1000396423 91
449 3300005356 Ga0070674_100027072 Ga0070674_1000270722 91
450 3300005364 Ga0070673_100083429 Ga0070673_1000834294 91
451 3300005365 Ga0070688_100838368 Ga0070688_1008383681 91
452 3300005366 Ga0070659_100048378 Ga0070659_1000483781 91
453 3300005367 Ga0070667_100282219 Ga0070667_1002822192 91
454 3300005456 Ga0070678_100001501 Ga0070678_1000015013 91
455 3300005457 Ga0070662_100684936 Ga0070662_1006849361 91
456 3300005459 Ga0068867_100125519 Ga0068867_1001255193 91
457 3300005518 Ga0070699_100166688 Ga0070699_1001666882 91
458 3300005543 Ga0070672_100000254 Ga0070672_10000025430 91
459 3300005548 Ga0070665_100010108 Ga0070665_1000101086 91
460 3300005548 Ga0070665_101356378 Ga0070665_1013563781 91
461 3300005564 Ga0070664_100035207 Ga0070664_1000352074 91
462 3300005577 Ga0068857_100016805 Ga0068857_1000168058 91
463 3300005578 Ga0068854_101870349 Ga0068854_1018703491 91
464 3300005843 Ga0068860_100323014 Ga0068860_1003230143 91
465 3300006051 Ga0075364_10007807 Ga0075364_100078074 91
466 3300006051 Ga0075364_10083933 Ga0075364_100839333 91
467 3300006186 Ga0075369_10366777 Ga0075369_103667772 91
468 3300006195 Ga0075366_10164832 Ga0075366_101648322 91
469 3300006237 Ga0097621_100079914 Ga0097621_1000799144 91
470 3300006353 Ga0075370_10092920 Ga0075370_100929203 91
471 3300006358 Ga0068871_100017779 Ga0068871_1000177792 91
472 3300006881 Ga0068865_100428289 Ga0068865_1004282892 91
473 3300006944 Ga0099823_1000188 Ga0099823_100018832 91
474 3300006944 Ga0099823_1023592 Ga0099823_10235926 91
475 3300006944 Ga0099823_1046333 Ga0099823_10463333 91
476 3300006946 Ga0079104_1000021 Ga0079104_100002186 91
477 3300006946 Ga0079104_1000030 Ga0079104_100003028 91
478 3300006946 Ga0079104_1000233 Ga0079104_100023316 91
479 3300006946 Ga0079104_1000304 Ga0079104_100030447 91
480 3300006946 Ga0079104_1000379 Ga0079104_100037933 91
481 3300006946 Ga0079104_1000614 Ga0079104_100061422 91
482 3300006946 Ga0079104_1001907 Ga0079104_10019076 91
483 3300006946 Ga0079104_1001912 Ga0079104_10019123 91
484 3300006946 Ga0079104_1003263 Ga0079104_10032638 91
485 3300006946 Ga0079104_1003310 Ga0079104_10033102 91
486 3300009011 Ga0105251_10000391 Ga0105251_1000039124 91
487 3300009011 Ga0105251_10000402 Ga0105251_100004022 91
488 3300009011 Ga0105251_10001684 Ga0105251_1000168411 91
489 3300009011 Ga0105251_10001933 Ga0105251_100019338 91
490 3300009011 Ga0105251_10007995 Ga0105251_100079955 91
491 3300009011 Ga0105251_10047940 Ga0105251_100479402 91
492 3300009011 Ga0105251_10140078 Ga0105251_101400782 91
493 3300009011 Ga0105251_10189782 Ga0105251_101897822 91
494 3300009011 Ga0105251_10419148 Ga0105251_104191482 91
495 3300009036 Ga0105244_10000014 Ga0105244_1000001439 91
496 3300009036 Ga0105244_10000037 Ga0105244_10000037122 91
497 3300009036 Ga0105244_10001143 Ga0105244_1000114311 91
498 3300009036 Ga0105244_10002103 Ga0105244_100021035 91
499 3300009036 Ga0105244_10004018 Ga0105244_1000401810 91
500 3300009036 Ga0105244_10016508 Ga0105244_100165084 91
501 3300009036 Ga0105244_10039965 Ga0105244_100399652 91
502 3300009036 Ga0105244_10044840 Ga0105244_100448402 91
503 3300009036 Ga0105244_10180488 Ga0105244_101804882 91
504 3300009036 Ga0105244_10224961 Ga0105244_102249612 91
505 3300009092 Ga0105250_10000059 Ga0105250_1000005976 91
506 3300009092 Ga0105250_10000314 Ga0105250_1000031431 91
507 3300009092 Ga0105250_10003658 Ga0105250_100036588 91
508 3300009092 Ga0105250_10007459 Ga0105250_100074594 91
509 3300009092 Ga0105250_10029457 Ga0105250_100294571 91
510 3300009092 Ga0105250_10056063 Ga0105250_100560632 91
511 3300009092 Ga0105250_10166296 Ga0105250_101662962 91
512 3300009092 Ga0105250_10371351 Ga0105250_103713512 91
513 3300009093 Ga0105240_11229364 Ga0105240_112293642 91
514 3300009148 Ga0105243_10092171 Ga0105243_100921713 91
515 3300009148 Ga0105243_10390862 Ga0105243_103908622 91
516 3300009177 Ga0105248_10371889 Ga0105248_103718893 91
517 3300012497 Ga0157319_1000004 Ga0157319_100000438 91
518 3300013102 Ga0157371_10004407 Ga0157371_1000440722 91
519 3300013102 Ga0157371_10010046 Ga0157371_100100466 91
520 3300013102 Ga0157371_10027367 Ga0157371_100273673 91
521 3300013104 Ga0157370_10013528 Ga0157370_100135282 91
522 3300013104 Ga0157370_11337536 Ga0157370_113375361 91
523 3300013105 Ga0157369_10012746 Ga0157369_100127464 91
524 3300013296 Ga0157374_10001918 Ga0157374_100019182 91
525 3300013297 Ga0157378_10002043 Ga0157378_100020439 91
526 3300013306 Ga0163162_10202467 Ga0163162_102024676 91
527 3300013307 Ga0157372_10042246 Ga0157372_100422463 91
528 3300013307 Ga0157372_11150297 Ga0157372_111502971 91
529 3300013308 Ga0157375_10228889 Ga0157375_102288892 91
530 3300014968 Ga0157379_11779471 Ga0157379_117794711 91
531 3300015261 Ga0182006_1000051 Ga0182006_1000051119 91
532 3300015679 Ga0183366_1001 Ga0183366_10011384 91
533 3300015680 Ga0183370_1001 Ga0183370_10011384 91
534 3300015685 Ga0183369_1001 Ga0183369_10011384 91
535 3300015687 Ga0183368_1001 Ga0183368_10011384 91
536 3300016635 Ga0183361_15589 Ga0183361_155891 91
537 3300017792 Ga0163161_10043096 Ga0163161_100430966 91
538 3300017792 Ga0163161_10154321 Ga0163161_101543213 91
539 3300021361 Ga0213872_10023478 Ga0213872_100234783 91
540 3300021361 Ga0213872_10036776 Ga0213872_100367762 91
541 3300021361 Ga0213872_10045189 Ga0213872_100451893 91
542 3300021361 Ga0213872_10083600 Ga0213872_100836002 91
543 3300021384 Ga0213876_10000069 Ga0213876_10000069121 91
544 3300025226 Ga0209674_115881 Ga0209674_1158812 91
545 3300025230 Ga0209563_100088 Ga0209563_10008828 91
546 3300025245 Ga0207425_1000851 Ga0207425_100085112 91
547 3300025245 Ga0207425_1007356 Ga0207425_10073563 91
548 3300025256 Ga0209759_1001678 Ga0209759_10016788 91
549 3300025258 Ga0209129_1000004 Ga0209129_1000004361 91
550 3300025258 Ga0209129_1000095 Ga0209129_100009558 91
551 3300025263 Ga0209565_1013066 Ga0209565_10130663 91
552 3300025263 Ga0209565_1065433 Ga0209565_10654331 91
553 3300025291 Ga0209675_1033427 Ga0209675_10334272 91
554 3300025292 Ga0209676_1004975 Ga0209676_10049758 91
555 3300025295 Ga0209564_1000062 Ga0209564_1000062183 91
556 3300025297 Ga0209758_1000072 Ga0209758_1000072101 91
557 3300025298 Ga0209050_1000596 Ga0209050_100059640 91
558 3300025299 Ga0209256_1000225 Ga0209256_100022567 91
559 3300025299 Ga0209256_1000570 Ga0209256_100057049 91
560 3300025303 Ga0209051_1000148 Ga0209051_100014881 91
561 3300025304 Ga0209257_1000380 Ga0209257_100038028 91
562 3300025304 Ga0209257_1000973 Ga0209257_10009736 91
563 3300025711 Ga0207696_1000005 Ga0207696_1000005113 91
564 3300025711 Ga0207696_1000088 Ga0207696_1000088117 91
565 3300025711 Ga0207696_1003787 Ga0207696_10037872 91
566 3300025711 Ga0207696_1009538 Ga0207696_10095384 91
567 3300025711 Ga0207696_1011547 Ga0207696_10115472 91
568 3300025711 Ga0207696_1022646 Ga0207696_10226463 91
569 3300025711 Ga0207696_1047875 Ga0207696_10478752 91
570 3300025728 Ga0207655_1000001 Ga0207655_10000011367 91
571 3300025728 Ga0207655_1000009 Ga0207655_1000009578 91
572 3300025728 Ga0207655_1000063 Ga0207655_100006340 91
573 3300025728 Ga0207655_1000117 Ga0207655_1000117121 91
574 3300025728 Ga0207655_1000247 Ga0207655_100024764 91
575 3300025728 Ga0207655_1037020 Ga0207655_10370203 91
576 3300025728 Ga0207655_1039934 Ga0207655_10399341 91
577 3300025728 Ga0207655_1073796 Ga0207655_10737962 91
578 3300025728 Ga0207655_1153162 Ga0207655_11531622 91
579 3300025728 Ga0207655_1240663 Ga0207655_12406631 91
580 3300025735 Ga0207713_1000002 Ga0207713_1000002355 91
581 3300025735 Ga0207713_1000003 Ga0207713_1000003679 91
582 3300025735 Ga0207713_1000029 Ga0207713_1000029197 91
583 3300025735 Ga0207713_1001125 Ga0207713_10011251 91
584 3300025735 Ga0207713_1001486 Ga0207713_10014864 91
585 3300025735 Ga0207713_1001919 Ga0207713_100191914 91
586 3300025735 Ga0207713_1003804 Ga0207713_10038041 91
587 3300025735 Ga0207713_1040624 Ga0207713_10406241 91
588 3300025735 Ga0207713_1059498 Ga0207713_10594982 91
589 3300025735 Ga0207713_1073884 Ga0207713_10738842 91
590 3300025735 Ga0207713_1098300 Ga0207713_10983002 91
591 3300025903 Ga0207680_10017223 Ga0207680_100172233 91
592 3300025907 Ga0207645_10120582 Ga0207645_101205822 91
593 3300025909 Ga0207705_11174230 Ga0207705_111742302 91
594 3300025910 Ga0207684_10923533 Ga0207684_109235332 91
595 3300025920 Ga0207649_10255087 Ga0207649_102550872 91
596 3300025925 Ga0207650_10499866 Ga0207650_104998662 91
597 3300025926 Ga0207659_10069391 Ga0207659_100693914 91
598 3300025931 Ga0207644_10046235 Ga0207644_100462352 91
599 3300025933 Ga0207706_10693556 Ga0207706_106935562 91
600 3300025935 Ga0207709_10238524 Ga0207709_102385242 91
601 3300025935 Ga0207709_10279130 Ga0207709_102791302 91
602 3300025937 Ga0207669_10057947 Ga0207669_100579472 91
603 3300025938 Ga0207704_10590550 Ga0207704_105905502 91
604 3300025940 Ga0207691_10000218 Ga0207691_100002189 91
605 3300025941 Ga0207711_10803426 Ga0207711_108034262 91
606 3300025945 Ga0207679_11238541 Ga0207679_112385412 91
607 3300025960 Ga0207651_10055698 Ga0207651_100556982 91
608 3300025986 Ga0207658_10226035 Ga0207658_102260353 91
609 3300026023 Ga0207677_10110953 Ga0207677_101109531 91
610 3300026116 Ga0207674_10093516 Ga0207674_100935163 91
611 3300026118 Ga0207675_102443981 Ga0207675_1024439812 91
612 3300026121 Ga0207683_10001508 Ga0207683_1000150811 91
613 3300027111 Ga0209281_1000001 Ga0209281_1000001600 91
614 3300027111 Ga0209281_1000004 Ga0209281_10000041082 91
615 3300027111 Ga0209281_1000006 Ga0209281_1000006910 91
616 3300027111 Ga0209281_1000012 Ga0209281_1000012212 91
617 3300027111 Ga0209281_1000024 Ga0209281_1000024319 91
618 3300027111 Ga0209281_1000076 Ga0209281_1000076245 91
619 3300027111 Ga0209281_1000143 Ga0209281_100014311 91
620 3300027111 Ga0209281_1000441 Ga0209281_100044142 91
621 3300027111 Ga0209281_1000495 Ga0209281_100049525 91
622 3300027111 Ga0209281_1001539 Ga0209281_10015393 91
623 3300027111 Ga0209281_1001686 Ga0209281_10016869 91
624 3300027296 Ga0209389_1000002 Ga0209389_100000213 91
625 3300027296 Ga0209389_1062744 Ga0209389_10627442 91
626 3300027312 Ga0209371_1000001 Ga0209371_10000011318 91
627 3300027312 Ga0209371_1000002 Ga0209371_1000002643 91
628 3300027312 Ga0209371_1000060 Ga0209371_100006083 91
629 3300027312 Ga0209371_1000409 Ga0209371_100040913 91
630 3300027312 Ga0209371_1000461 Ga0209371_100046125 91
631 3300027312 Ga0209371_1002127 Ga0209371_10021278 91
632 3300027312 Ga0209371_1003406 Ga0209371_10034063 91
633 3300027312 Ga0209371_1010149 Ga0209371_10101492 91
634 3300027312 Ga0209371_1014177 Ga0209371_10141773 91
635 3300027312 Ga0209371_1016332 Ga0209371_10163322 91
636 3300027312 Ga0209371_1020821 Ga0209371_10208212 91
637 3300027312 Ga0209371_1021744 Ga0209371_10217442 91
638 3300027312 Ga0209371_1046621 Ga0209371_10466212 91
639 3300028379 Ga0268266_10004753 Ga0268266_100047534 91
640 3300028379 Ga0268266_10325382 Ga0268266_103253821 91
641 3300028577 Ga0265318_10094615 Ga0265318_100946152 91
642 3300030500 Ga0268256_1000001 Ga0268256_10000011324 91
643 3300030500 Ga0268256_1000002 Ga0268256_1000002820 91
644 3300030500 Ga0268256_1000084 Ga0268256_1000084146 91
645 3300030500 Ga0268256_1000204 Ga0268256_100020453 91
646 3300030500 Ga0268256_1000350 Ga0268256_100035032 91
647 3300030500 Ga0268256_1001863 Ga0268256_10018638 91
648 3300030500 Ga0268256_1003174 Ga0268256_10031743 91
649 3300030500 Ga0268256_1005705 Ga0268256_10057056 91
650 3300030500 Ga0268256_1008045 Ga0268256_10080452 91
651 3300030500 Ga0268256_1013096 Ga0268256_10130962 91
652 3300030500 Ga0268256_1015719 Ga0268256_10157191 91
653 3300030500 Ga0268256_1018151 Ga0268256_10181512 91
654 3300030500 Ga0268256_1023345 Ga0268256_10233452 91
655 3300030500 Ga0268256_1052522 Ga0268256_10525221 91
656 3300031548 Ga0307408_100000132 Ga0307408_10000013236 91
657 3300031548 Ga0307408_100054074 Ga0307408_1000540742 91
658 3300031649 Ga0307514_10001593 Ga0307514_1000159312 91
659 3300031727 Ga0316576_10029059 Ga0316576_100290592 91
660 3300031728 Ga0316578_10009605 Ga0316578_100096054 91
661 3300031901 Ga0307406_10021259 Ga0307406_100212595 91
662 3300036401 Ga0373937_1707707 Ga0373937_1707707_154_429 91
663 3300039437 Ga0436365_0368505 Ga0436365_0368505_30225_30500 91
664 3300039447 Ga0436361_0470793 Ga0436361_0470793_86_361 91
665 3300039447 Ga0436361_0900730 Ga0436361_0900730_4174_4461 91
666 3300039447 Ga0436361_1016242 Ga0436361_1016242_14150_14437 91
667 3300039447 Ga0436361_1029236 Ga0436361_1029236_1471_1746 91
668 3300039447 Ga0436361_1157107 Ga0436361_1157107_4238_4513 91
669 3300041405 Ga0439438_038487 Ga0439438_038487_668_943 91
670 3300041451 Ga0451791_0647974 Ga0451791_0647974_91_390 91
671 3300041486 Ga0451807_0601058 Ga0451807_0601058_164_439 91
672 3300041512 Ga0451853_1040831 Ga0451853_1040831_381_656 91
673 3300042006 Ga0439432_002855 Ga0439432_002855_401_676 91
674 3300042006 Ga0439432_066336 Ga0439432_066336_346_621 91
675 3300042010 Ga0439452_000002 Ga0439452_000002_985186_985461 91
676 3300042010 Ga0439452_000014 Ga0439452_000014_107954_108229 91
677 3300042010 Ga0439452_000016 Ga0439452_000016_230831_231106 91
678 3300042010 Ga0439452_000175 Ga0439452_000175_19063_19338 91
679 3300042127 Ga0450890_003582 Ga0450890_003582_449_724 91
680 3300042136 Ga0450900_002594 Ga0450900_002594_446_721 91
681 3300042136 Ga0450900_015129 Ga0450900_015129_256_531 91
682 3300042137 Ga0450902_045051 Ga0450902_045051_369_644 91
683 3300042438 Ga0439459_0001664 Ga0439459_0001664_1782_2057 91
684 3300042439 Ga0439464_0106781 Ga0439464_0106781_306_581 91
685 3300042876 Ga0451577_0012119 Ga0451577_0012119_1850_2125 91
686 3300044656 Ga0466969_0026952 Ga0466969_0026952_579_854 91
687 3300044656 Ga0466969_0440708 Ga0466969_0440708_284_574 91
688 3300044669 Ga0466981_0000010 Ga0466981_0000010_40942_41217 91
689 3300044673 Ga0453683_0760638 Ga0453683_0760638_153_428 91
690 3300044683 Ga0466965_0070097 Ga0466965_0070097_420_695 91
691 3300044684 Ga0466966_0045072 Ga0466966_0045072_2256_2531 91
692 3300044693 Ga0466961_0000995 Ga0466961_0000995_1289_1564 91
693 3300044694 Ga0466963_0274098 Ga0466963_0274098_255_530 91
694 3300044706 Ga0466964_0096091 Ga0466964_0096091_23_298 91
695 3300044712 Ga0453684_0763665 Ga0453684_0763665_52_327 91
696 3300045049 Ga0466959_0055576 Ga0466959_0055576_1824_2099 91
697 3300045051 Ga0451576_0005011 Ga0451576_0005011_7013_7288 91
698 3300046458 Ga0495591_020952 Ga0495591_020952_1573_1848 91
699 3300046460 Ga0495638_0021272 Ga0495638_0021272_317_592 91
700 3300046471 Ga0495650_0000005 Ga0495650_0000005_446486_446761 91
701 3300046471 Ga0495650_0071835 Ga0495650_0071835_570_860 91
702 3300046473 Ga0495582_0219873 Ga0495582_0219873_308_583 91
703 3300046513 Ga0495616_0312196 Ga0495616_0312196_135_410 91
704 3300046515 Ga0495620_0214757 Ga0495620_0214757_232_507 91
705 3300046524 Ga0495648_0148793 Ga0495648_0148793_349_624 91
706 3300046530 Ga0495654_0040481 Ga0495654_0040481_346_621 91
707 3300046530 Ga0495654_0397735 Ga0495654_0397735_188_463 91
708 3300046538 Ga0495609_0237918 Ga0495609_0237918_84_359 91
709 3300046542 Ga0495597_0000632 Ga0495597_0000632_5361_5636 91
710 3300046660 Ga0495625_0000662 Ga0495625_0000662_339_614 91
711 3300046674 Ga0495588_0037160 Ga0495588_0037160_1725_2000 91
712 3300046690 Ga0495624_0508079 Ga0495624_0508079_198_473 91
713 3300046694 Ga0495649_0001472 Ga0495649_0001472_17070_17345 91
714 3300046694 Ga0495649_0040716 Ga0495649_0040716_1792_2067 91
715 3300047320 Ga0495672_0000034 Ga0495672_0000034_275001_275276 91
716 3300047320 Ga0495672_0000036 Ga0495672_0000036_155656_155931 91
717 3300047446 Ga0495679_039542 Ga0495679_039542_56_346 91
718 3300047446 Ga0495679_056463 Ga0495679_056463_81_356 91
719 3300047446 Ga0495679_171935 Ga0495679_171935_137_412 91
720 3300047469 Ga0495673_0000007 Ga0495673_0000007_778244_778519 91
721 3300048903 Ga0496100_0014438 Ga0496100_0014438_3045_3332 91
722 3300048903 Ga0496100_0041571 Ga0496100_0041571_2384_2659 91
723 3300048904 Ga0496101_0303289 Ga0496101_0303289_517_792 91
724 3300048907 Ga0496104_0000043 Ga0496104_0000043_130476_130751 91
725 3300048907 Ga0496104_0011028 Ga0496104_0011028_7531_7821 91
726 3300048907 Ga0496104_0233549 Ga0496104_0233549_446_721 91
727 3300048907 Ga0496104_1313605 Ga0496104_1313605_245_520 91
728 3300048908 Ga0496105_0008843 Ga0496105_0008843_3368_3643 91
729 3300048908 Ga0496105_0902545 Ga0496105_0902545_357_632 91
730 3300048910 Ga0496107_1042305 Ga0496107_1042305_161_436 91
731 3300048911 Ga0496108_0408826 Ga0496108_0408826_197_472 91
732 3300048912 Ga0496109_0120028 Ga0496109_0120028_139_414 91
733 3300048913 Ga0496110_0081513 Ga0496110_0081513_1484_1759 91
734 3300048916 Ga0496113_0471996 Ga0496113_0471996_483_758 91
735 3300048917 Ga0496114_0004699 Ga0496114_0004699_1095_1370 91
736 3300048917 Ga0496114_0174075 Ga0496114_0174075_216_491 91
737 3300048918 Ga0496115_0440301 Ga0496115_0440301_26_301 91
738 3300048919 Ga0496116_0000870 Ga0496116_0000870_16233_16508 91
739 3300048919 Ga0496116_0006527 Ga0496116_0006527_76_351 91
740 3300048919 Ga0496116_0077663 Ga0496116_0077663_1324_1599 91
741 3300048919 Ga0496116_0094773 Ga0496116_0094773_1324_1599 91
742 3300048920 Ga0496117_0000020 Ga0496117_0000020_220627_220902 91
743 3300048920 Ga0496117_0001276 Ga0496117_0001276_12061_12336 91
744 3300048920 Ga0496117_0003520 Ga0496117_0003520_14293_14568 91
745 3300048920 Ga0496117_0008312 Ga0496117_0008312_4614_4889 91
746 3300048920 Ga0496117_0010307 Ga0496117_0010307_6347_6622 91
747 3300048920 Ga0496117_0023798 Ga0496117_0023798_2578_2853 91
748 3300048920 Ga0496117_0106419 Ga0496117_0106419_1025_1315 91
749 3300048921 Ga0496118_0000015 Ga0496118_0000015_235843_236118 91
750 3300048921 Ga0496118_0001324 Ga0496118_0001324_29539_29814 91
751 3300048921 Ga0496118_0001862 Ga0496118_0001862_29420_29710 91
752 3300048921 Ga0496118_0013175 Ga0496118_0013175_1691_1966 91
753 3300048921 Ga0496118_0024247 Ga0496118_0024247_50_325 91
754 3300048921 Ga0496118_0024879 Ga0496118_0024879_681_956 91
755 3300048921 Ga0496118_0294103 Ga0496118_0294103_592_867 91
756 3300048922 Ga0496119_0000001 Ga0496119_0000001_475898_476173 91
757 3300048922 Ga0496119_0000230 Ga0496119_0000230_30542_30832 91
758 3300048922 Ga0496119_0001866 Ga0496119_0001866_16151_16426 91
759 3300048922 Ga0496119_0012016 Ga0496119_0012016_36_311 91
760 3300048922 Ga0496119_0016595 Ga0496119_0016595_4272_4547 91
761 3300048923 Ga0496120_0000324 Ga0496120_0000324_33709_33999 91
762 3300048923 Ga0496120_0004284 Ga0496120_0004284_8058_8333 91
763 3300048923 Ga0496120_0013419 Ga0496120_0013419_3934_4209 91
764 3300048923 Ga0496120_0052113 Ga0496120_0052113_103_378 91
765 3300048924 Ga0496121_0000160 Ga0496121_0000160_136787_137062 91
766 3300048924 Ga0496121_0000415 Ga0496121_0000415_76553_76828 91
767 3300048924 Ga0496121_0001137 Ga0496121_0001137_15903_16178 91
768 3300048924 Ga0496121_0001182 Ga0496121_0001182_44994_45269 91
769 3300048924 Ga0496121_0001228 Ga0496121_0001228_11166_11441 91
770 3300048924 Ga0496121_0001573 Ga0496121_0001573_1864_2139 91
771 3300048924 Ga0496121_0010366 Ga0496121_0010366_2392_2667 91
772 3300048924 Ga0496121_0015722 Ga0496121_0015722_6843_7118 91
773 3300048924 Ga0496121_0136003 Ga0496121_0136003_597_872 91
774 3300048924 Ga0496121_0169499 Ga0496121_0169499_984_1259 91
775 3300048925 Ga0496122_0000265 Ga0496122_0000265_97539_97814 91
776 3300048925 Ga0496122_0002210 Ga0496122_0002210_24575_24850 91
777 3300048925 Ga0496122_0003353 Ga0496122_0003353_17302_17577 91
778 3300048925 Ga0496122_0013774 Ga0496122_0013774_7385_7660 91
779 3300048925 Ga0496122_0014483 Ga0496122_0014483_3454_3729 91
780 3300048925 Ga0496122_0018211 Ga0496122_0018211_4930_5205 91
781 3300048925 Ga0496122_0029788 Ga0496122_0029788_4269_4544 91
782 3300048925 Ga0496122_0030520 Ga0496122_0030520_1266_1541 91
783 3300048925 Ga0496122_0048913 Ga0496122_0048913_51_326 91
784 3300048925 Ga0496122_0071347 Ga0496122_0071347_999_1274 91
785 3300048925 Ga0496122_0137985 Ga0496122_0137985_944_1234 91
786 3300048925 Ga0496122_0383982 Ga0496122_0383982_408_683 91
787 3300048925 Ga0496122_0464532 Ga0496122_0464532_22_297 91
788 3300048926 Ga0496123_0000014 Ga0496123_0000014_97539_97814 91
789 3300048926 Ga0496123_0000836 Ga0496123_0000836_36636_36911 91
790 3300048926 Ga0496123_0002902 Ga0496123_0002902_19133_19408 91
791 3300048926 Ga0496123_0004375 Ga0496123_0004375_7833_8108 91
792 3300048926 Ga0496123_0009244 Ga0496123_0009244_3701_3976 91
793 3300048926 Ga0496123_0018392 Ga0496123_0018392_1965_2240 91
794 3300048926 Ga0496123_0020602 Ga0496123_0020602_4229_4504 91
795 3300048926 Ga0496123_0022982 Ga0496123_0022982_1311_1586 91
796 3300048926 Ga0496123_0125578 Ga0496123_0125578_441_716 91
797 3300048926 Ga0496123_0155295 Ga0496123_0155295_51_326 91
798 3300048926 Ga0496123_0156102 Ga0496123_0156102_57_332 91
799 3300048926 Ga0496123_0208454 Ga0496123_0208454_485_760 91
800 3300048927 Ga0496124_0000425 Ga0496124_0000425_41020_41295 91
801 3300048927 Ga0496124_0002230 Ga0496124_0002230_13430_13705 91
802 3300048927 Ga0496124_0007334 Ga0496124_0007334_7461_7736 91
803 3300048927 Ga0496124_0007785 Ga0496124_0007785_3287_3562 91
804 3300048927 Ga0496124_0020587 Ga0496124_0020587_1764_2039 91
805 3300048927 Ga0496124_0022612 Ga0496124_0022612_4291_4566 91
806 3300048927 Ga0496124_0046466 Ga0496124_0046466_595_870 91
807 3300048927 Ga0496124_0052569 Ga0496124_0052569_346_621 91
808 3300048927 Ga0496124_0064702 Ga0496124_0064702_341_616 91
809 3300048927 Ga0496124_0386554 Ga0496124_0386554_549_824 91
810 3300048927 Ga0496124_0857130 Ga0496124_0857130_196_471 91
811 3300048928 Ga0496125_0000009 Ga0496125_0000009_271416_271691 91
812 3300048928 Ga0496125_0000485 Ga0496125_0000485_44732_45007 91
813 3300048928 Ga0496125_0000500 Ga0496125_0000500_4270_4545 91
814 3300048928 Ga0496125_0001753 Ga0496125_0001753_12992_13267 91
815 3300048928 Ga0496125_0011561 Ga0496125_0011561_5821_6096 91
816 3300048928 Ga0496125_0012612 Ga0496125_0012612_8061_8336 91
817 3300048928 Ga0496125_0021460 Ga0496125_0021460_36_311 91
818 3300048928 Ga0496125_0158093 Ga0496125_0158093_1258_1533 91
819 3300048928 Ga0496125_0299173 Ga0496125_0299173_620_895 91
820 3300048929 Ga0496126_0000125 Ga0496126_0000125_53538_53813 91
821 3300048929 Ga0496126_0000142 Ga0496126_0000142_22628_22903 91
822 3300048929 Ga0496126_0015085 Ga0496126_0015085_5167_5442 91
823 3300048929 Ga0496126_0070970 Ga0496126_0070970_339_614 91
824 3300048929 Ga0496126_0072656 Ga0496126_0072656_171_446 91
825 3300048929 Ga0496126_0123048 Ga0496126_0123048_1440_1715 91
826 3300048929 Ga0496126_0271622 Ga0496126_0271622_1068_1358 91
827 3300048929 Ga0496126_0353454 Ga0496126_0353454_16_291 91
828 3300048929 Ga0496126_0595563 Ga0496126_0595563_447_722 91
829 3300048929 Ga0496126_0615915 Ga0496126_0615915_545_820 91
830 3300048929 Ga0496126_1078239 Ga0496126_1078239_241_516 91
831 3300048929 Ga0496126_1199688 Ga0496126_1199688_145_420 91
832 3300048929 Ga0496126_1320864 Ga0496126_1320864_164_439 91
833 3300049460 Ga0495682_0326167 Ga0495682_0326167_57_332 91
834 3300049579 Ga0501043_0000010 Ga0501043_0000010_69442_69717 91
835 3300049580 Ga0501046_0000097 Ga0501046_0000097_70757_71032 91
836 3300049581 Ga0501047_0000026 Ga0501047_0000026_155639_155914 91
837 3300049582 Ga0501048_0001099 Ga0501048_0001099_3424_3699 91
838 3300049823 Ga0501044_0349284 Ga0501044_0349284_741_1016 91
839 3300049823 Ga0501044_0508542 Ga0501044_0508542_524_805 91
840 3300049824 Ga0501045_0014425 Ga0501045_0014425_1888_2163 91
841 3300050491 nmdc:mga00v17_461224_c1 nmdc:mga00v17_461224_c1_49_324 91
842 3300050493 nmdc:mga0k408_61882_c1 nmdc:mga0k408_61882_c1_509_784 91
843 3300050496 nmdc:mga07m45_51893_c1 nmdc:mga07m45_51893_c1_1809_2084 91
844 3300053083 Ga0495655_0240109 Ga0495655_0240109_132_413 91
845 3300053093 Ga0500651_0000354 Ga0500651_0000354_132_407 91
846 3300053093 Ga0500651_0024668 Ga0500651_0024668_1873_2148 91

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02583

Trns_repr_metal

Metal-sensitive transcriptional repressor

20

100

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
8enk-assembly1.cif.gz_E crystal structure of uap56 in complex with tho1, the yeast homolog of human sarnp 0.9763 14 50
6ahx-assembly1.cif.gz_A-2 copper-sensing operon regulator protein (csorgz) 0.9563 9 63
6y07-assembly1.cif.gz_A designing a granulopoietic protein by topological rescaffolding 1: sohair 0.9347 6 59
8cwy-assembly1.cif.gz_B accurate computational design of genetically encoded 3d protein crystals 0.9274 6 60
5lcy-assembly1.cif.gz_C formaldehyde-responsive regulator frmr e64h variant from salmonella enterica serovar typhimurium 0.9257 2 89
ID Description Score Start End Superfamily
3cqzA01 Few Secondary Structures;Irregular;DNA Excision Repair, Uvrb; Chain A;RNA polymerase II, clamp domain 0.9618 12 51 4.10.860.120
5lcyB00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Metal-sensitive repressor, helix protomer 0.9261 2 89 1.20.58.1000
5lcyA00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Metal-sensitive repressor, helix protomer 0.9258 2 89 1.20.58.1000
5lcyC00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Metal-sensitive repressor, helix protomer 0.9257 2 89 1.20.58.1000
5lcyD00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Metal-sensitive repressor, helix protomer 0.9255 2 89 1.20.58.1000
ID Description Score Start End GO Terms
AF-X1XHB0-F1-model_v4 deleted 0.9764 1 91
AF-A0A6D0EJ32-F1-model_v4 deleted 0.9753 1 77
AF-A0A3N1PEW1-F1-model_v4 DNA-binding FrmR family transcriptional regulator 0.9736 4 89 GO:0003677
GO:0045892
GO:0046872
AF-A0A0G0AWL3-F1-model_v4 Copper-sensing transcriptional repressor CsoR 0.9711 2 61 GO:0003677
GO:0005737
GO:0045892
GO:0046872
AF-A0A4R0DHJ8-F1-model_v4 Metal/formaldehyde-sensitive transcriptional repressor 0.9693 1 91 GO:0003677
GO:0005737
GO:0045892
GO:0046872

Feature Viewer

pLDDT pTM Quality
90.52 0.73 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map