F483127
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 842 | 314 | 817 | 194 |
Family's Representative Sequence
| Representative Sequence | 3300005563|Ga0068855_100330629|Ga0068855_1003306292 |
| Length | 230 |
| Sequence | MARHPVPILLRHPGLAGQPSCAEPAPTLQTGHSRAAMNEPTSDVDSRDRMLLRRMAAGDHAALETLYRTYHGGLCRFLSRLTRRADLIEEIVNDCFWIAWRKADSFHGDSRVSTWIMGIAYRCGLKALRQRGDEPVDDYALREGRGPSHDPDEDRELRDWLGKGLEHLSADQRVVVELVYGVGNSLDEVAAIMQSPVGTVKARLFHARVKLRNTLPTLAGDSPAQQENKS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2593339238 | Luteibacter sp. UNCMF366Tsu5.1 | Isolate | Unclassified |
| 2 | 2643221562 | Rhodanobacter sp. Root561 | Isolate | Unclassified |
| 3 | 2718218334 | Luteibacter rhizovicinus LJ96 | Isolate | Rhizosphere |
| 4 | 2734482264 | Dyella sp. AD052 | Isolate | Unclassified |
| 5 | 2738543009 | Luteibacter sp. OK325 | Isolate | Unclassified |
| 6 | 2739367700 | Dyella sp. YR388 | Isolate | Unclassified |
| 7 | 2747842501 | Xanthomonas sp. WCS2014-23 | Isolate | Unclassified |
| 8 | 2818991440 | Luteibacter yeojuensis 583 | Isolate | Unclassified |
| 9 | 2818991457 | Xanthomonas translucens 569 | Isolate | Unclassified |
| 10 | 2842914999 | Luteibacter sp. R-72151 | Isolate | Unclassified |
| 11 | 2842918807 | Luteibacter sp. R-73110 | Isolate | Unclassified |
| 12 | 2852684882 | Xanthomonas sp. JAI131 | Isolate | Rhizosphere |
| 13 | 2884338543 | Luteibacter pinisoli MAH-14 | Isolate | Rhizosphere |
| 14 | 2884411467 | Dyella sp. AD56 | Isolate | Rhizosphere |
| 15 | 2904463128 | Luteibacter yeojuensis 3191 | Isolate | Unclassified |
| 16 | 2919130084 | Xanthomonas sp. 1678 | Isolate | Rhizosphere |
| 17 | 2928963466 | Dyella japonica 1073 | Isolate | Unclassified |
| 18 | 2929195423 | Xanthomonas sp. R-73098 Hybrid assembly | Isolate | Unclassified |
| 19 | 2939611941 | Rhodanobacter soli 1757 | Isolate | Rhizosphere |
| 20 | 2941471342 | Luteibacter sp. 621 | Isolate | Unclassified |
| 21 | 2941489479 | Lysobacter enzymogenes 2943 | Isolate | Rhizosphere |
| 22 | 2953994433 | Luteibacter sp. W1I16 | Isolate | Rhizosphere |
| 23 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 24 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 25 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 26 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 27 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 28 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 29 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 30 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 31 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 32 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 33 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 34 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 35 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 36 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 37 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 38 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 39 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 40 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 41 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 42 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 43 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 44 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 45 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 46 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 47 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 48 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 49 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 50 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 51 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 52 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 53 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 54 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 55 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 60 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 63 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 69 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 76 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 77 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 78 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 79 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 80 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 84 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 85 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 86 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 87 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 88 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 89 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 90 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 91 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 92 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 93 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 94 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 96 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 97 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 98 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 107 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 114 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 115 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 116 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 117 | 3300015685 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 | Metagenome | Unclassified |
| 118 | 3300015689 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 | Metagenome | Rhizosphere |
| 119 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 121 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 122 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 123 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 124 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 125 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 126 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 127 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 128 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 129 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 130 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 140 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 141 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 142 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 145 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 146 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 148 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 150 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 188 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 189 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 190 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 191 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 192 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 193 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 194 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 195 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 196 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 197 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 198 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 199 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 200 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 201 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 202 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 203 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 204 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 205 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 206 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 207 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 208 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 209 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 210 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 211 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 212 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 213 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 214 | 3300044536 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA2E | Metagenome | Unclassified |
| 215 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 216 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 217 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 218 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 219 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 220 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 221 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 222 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 223 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 224 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 225 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 226 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 227 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 228 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 229 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 230 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 231 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 262 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 263 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 264 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 265 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 266 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 267 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 268 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 269 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 270 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 271 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 272 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 273 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 274 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 275 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 276 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 277 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 278 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 279 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 282 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049650 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought | Metagenome | Rhizosphere |
| 298 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 303 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 304 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 305 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 306 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 307 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 308 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 309 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 310 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 311 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 312 | 8021622325 | Xanthomonas sp. LMG12462 | Isolate | Rhizosphere |
| 313 | 8021626552 | Xanthomonas sp. LMG12460 | Isolate | Rhizosphere |
| 314 | 8021648035 | Xanthomonas sp. LMG 12461 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.94 |
| Metatranscriptomes | 3.09 |
| Isolates | 2.97 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.83 |
| Nodule | 0 |
| Rhizoplane | 2.61 |
| Rhizosphere | 73.04 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.52 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1002320 | 3300001904 | Bacteria | 3360 |
| 2 | JGI24741J21665_1034746 | 3300001915 | Bacteria | 749 |
| 3 | JGI24740J21852_10000025 | 3300001979 | Bacteria | 49637 |
| 4 | JGI24740J21852_10011029 | 3300001979 | Bacteria | 3456 |
| 5 | JGI24740J21852_10020598 | 3300001979 | Unclassified | 2298 |
| 6 | JGI24739J22299_10000022 | 3300001989 | Bacteria | 45280 |
| 7 | JGI24739J22299_10001242 | 3300001989 | Bacteria | 9588 |
| 8 | JGI24737J22298_10003356 | 3300001990 | Bacteria | 5663 |
| 9 | JGI24737J22298_10004305 | 3300001990 | Bacteria | 4971 |
| 10 | JGI24735J21928_10009193 | 3300002067 | Bacteria | 3178 |
| 11 | JGI24735J21928_10054048 | 3300002067 | Bacteria | 1157 |
| 12 | JGI24738J21930_10000095 | 3300002075 | Bacteria | 20134 |
| 13 | JGI25156J39149_1004438 | 3300002705 | Bacteria | 4273 |
| 14 | JGI25156J39149_1012740 | 3300002705 | Bacteria | 1829 |
| 15 | JGI25162J39368_1000018 | 3300002737 | Bacteria | 277875 |
| 16 | JGI25162J39368_1000567 | 3300002737 | Bacteria | 27104 |
| 17 | JGI25162J39368_1000594 | 3300002737 | Bacteria | 26267 |
| 18 | JGI25154J39366_1004513 | 3300002738 | Bacteria | 2474 |
| 19 | JGI25157J39369_1000011 | 3300002741 | Bacteria | 206831 |
| 20 | JGI25157J39369_1001115 | 3300002741 | Bacteria | 11931 |
| 21 | JGI25157J39369_1001478 | 3300002741 | Bacteria | 8667 |
| 22 | JGI25157J39369_1001590 | 3300002741 | Bacteria | 7978 |
| 23 | JGI25163J39215_1000291 | 3300002771 | Bacteria | 17182 |
| 24 | JGI25163J39215_1000356 | 3300002771 | Bacteria | 15075 |
| 25 | JGI25164J39214_1000007 | 3300002772 | Bacteria | 312507 |
| 26 | JGI25164J39214_1000198 | 3300002772 | Bacteria | 51603 |
| 27 | JGI25164J39214_1003959 | 3300002772 | Bacteria | 1772 |
| 28 | JGI25152J39213_1001511 | 3300002773 | Bacteria | 9902 |
| 29 | JGI25165J46597_1000029 | 3300003214 | Bacteria | 312507 |
| 30 | JGI25165J46597_1000354 | 3300003214 | Bacteria | 51605 |
| 31 | JGI25153J46596_10001310 | 3300003215 | Bacteria | 14890 |
| 32 | JGI25153J46596_10008411 | 3300003215 | Bacteria | 4935 |
| 33 | rootH2_10115902 | 3300003320 | Bacteria | 3922 |
| 34 | rootL2_10061659 | 3300003322 | Bacteria | 5680 |
| 35 | rootL2_10241063 | 3300003322 | Bacteria | 7305 |
| 36 | rootH1_10111193 | 3300003323 | Bacteria | 3323 |
| 37 | rootH1_10129136 | 3300003323 | Bacteria | 4831 |
| 38 | rootH1_10203752 | 3300003323 | Bacteria | 2414 |
| 39 | Ga0006562J51391_1062436 | 3300003578 | Bacteria | 7601 |
| 40 | Ga0006562J51391_1062438 | 3300003578 | Bacteria | 4950 |
| 41 | Ga0055538_1001241 | 3300003751 | Bacteria | 5276 |
| 42 | Ga0055539_1000706 | 3300003752 | Bacteria | 8527 |
| 43 | Ga0055533_1000373 | 3300003756 | Bacteria | 18160 |
| 44 | Ga0055525_1000059 | 3300003759 | Bacteria | 202797 |
| 45 | Ga0055527_1000050 | 3300003760 | Bacteria | 104542 |
| 46 | Ga0055527_1000128 | 3300003760 | Bacteria | 53342 |
| 47 | Ga0055527_1006447 | 3300003760 | Bacteria | 1469 |
| 48 | Ga0055535_1000025 | 3300003761 | Bacteria | 213549 |
| 49 | Ga0055535_1000119 | 3300003761 | Bacteria | 84990 |
| 50 | Ga0055535_1000287 | 3300003761 | Bacteria | 53346 |
| 51 | Ga0055535_1000295 | 3300003761 | Bacteria | 51620 |
| 52 | Ga0055535_1001844 | 3300003761 | Bacteria | 9073 |
| 53 | Ga0055542_1000024 | 3300003762 | Bacteria | 277875 |
| 54 | Ga0055542_1000057 | 3300003762 | Bacteria | 162955 |
| 55 | Ga0055542_1000082 | 3300003762 | Bacteria | 128120 |
| 56 | Ga0055542_1000119 | 3300003762 | Bacteria | 104542 |
| 57 | Ga0055542_1000180 | 3300003762 | Bacteria | 78192 |
| 58 | Ga0055542_1000311 | 3300003762 | Bacteria | 53346 |
| 59 | Ga0055529_1000029 | 3300003763 | Bacteria | 277978 |
| 60 | Ga0055529_1000049 | 3300003763 | Bacteria | 208413 |
| 61 | Ga0055529_1000329 | 3300003763 | Bacteria | 53347 |
| 62 | Ga0055529_1000514 | 3300003763 | Bacteria | 34100 |
| 63 | Ga0055529_1021040 | 3300003763 | Bacteria | 811 |
| 64 | Ga0055526_1010167 | 3300003771 | Bacteria | 4413 |
| 65 | Ga0055541_1019038 | 3300003841 | Bacteria | 837 |
| 66 | Ga0058692_1000029 | 3300003856 | Bacteria | 189475 |
| 67 | Ga0065165_1000653 | 3300005262 | Bacteria | 50050 |
| 68 | Ga0065165_1002406 | 3300005262 | Bacteria | 15970 |
| 69 | Ga0070658_10006547 | 3300005327 | Bacteria | 9447 |
| 70 | Ga0070658_10082190 | 3300005327 | Bacteria | 2647 |
| 71 | Ga0070683_100575992 | 3300005329 | Bacteria | 1077 |
| 72 | Ga0070670_100453862 | 3300005331 | Bacteria | 1136 |
| 73 | Ga0070666_10000001 | 3300005335 | Bacteria | 543080 |
| 74 | Ga0070680_100000627 | 3300005336 | Bacteria | 24578 |
| 75 | Ga0070680_100001693 | 3300005336 | Bacteria | 16162 |
| 76 | Ga0070682_100000659 | 3300005337 | Bacteria | 20965 |
| 77 | Ga0070682_100001204 | 3300005337 | Bacteria | 14746 |
| 78 | Ga0070682_100015698 | 3300005337 | Bacteria | 4392 |
| 79 | Ga0070682_100020889 | 3300005337 | Bacteria | 3859 |
| 80 | Ga0070682_100119907 | 3300005337 | Bacteria | 1764 |
| 81 | Ga0070660_100004295 | 3300005339 | Bacteria | 9844 |
| 82 | Ga0070660_100193727 | 3300005339 | Bacteria | 1647 |
| 83 | Ga0070660_100340277 | 3300005339 | Bacteria | 1234 |
| 84 | Ga0070660_100425709 | 3300005339 | Bacteria | 1099 |
| 85 | Ga0070689_100002151 | 3300005340 | Bacteria | 12768 |
| 86 | Ga0070691_10011476 | 3300005341 | Bacteria | 4047 |
| 87 | Ga0070661_100002927 | 3300005344 | Bacteria | 11769 |
| 88 | Ga0070661_100004341 | 3300005344 | Bacteria | 9783 |
| 89 | Ga0070661_100011343 | 3300005344 | Bacteria | 6210 |
| 90 | Ga0070661_100019995 | 3300005344 | Bacteria | 4772 |
| 91 | Ga0070661_100070367 | 3300005344 | Bacteria | 2573 |
| 92 | Ga0070661_100139879 | 3300005344 | Bacteria | 1824 |
| 93 | Ga0070661_100357199 | 3300005344 | Bacteria | 1147 |
| 94 | Ga0070692_10006380 | 3300005345 | Bacteria | 5120 |
| 95 | Ga0070692_10050482 | 3300005345 | Bacteria | 2160 |
| 96 | Ga0070692_10136632 | 3300005345 | Bacteria | 1383 |
| 97 | Ga0070668_100255069 | 3300005347 | Bacteria | 1457 |
| 98 | Ga0070668_100553881 | 3300005347 | Bacteria | 1001 |
| 99 | Ga0070669_100028490 | 3300005353 | Unclassified | 4023 |
| 100 | Ga0070688_100007703 | 3300005365 | Bacteria | 5816 |
| 101 | Ga0070659_100001016 | 3300005366 | Bacteria | 20566 |
| 102 | Ga0070659_100044182 | 3300005366 | Bacteria | 3487 |
| 103 | Ga0070659_100100599 | 3300005366 | Bacteria | 2326 |
| 104 | Ga0070659_100283617 | 3300005366 | Bacteria | 1378 |
| 105 | Ga0070659_100326010 | 3300005366 | Bacteria | 1284 |
| 106 | Ga0070667_100286557 | 3300005367 | Bacteria | 1480 |
| 107 | Ga0070714_100000055 | 3300005435 | Bacteria | 103321 |
| 108 | Ga0070714_100001542 | 3300005435 | Bacteria | 16793 |
| 109 | Ga0070711_100458618 | 3300005439 | Bacteria | 1044 |
| 110 | Ga0070663_100013140 | 3300005455 | Bacteria | 5265 |
| 111 | Ga0070663_100016945 | 3300005455 | Bacteria | 4743 |
| 112 | Ga0070663_100049637 | 3300005455 | Bacteria | 2981 |
| 113 | Ga0070663_100059399 | 3300005455 | Bacteria | 2748 |
| 114 | Ga0070663_100096149 | 3300005455 | Bacteria | 2203 |
| 115 | Ga0070663_100142980 | 3300005455 | Bacteria | 1828 |
| 116 | Ga0070663_100380499 | 3300005455 | Bacteria | 1149 |
| 117 | Ga0070663_100419214 | 3300005455 | Bacteria | 1098 |
| 118 | Ga0070663_100611877 | 3300005455 | Bacteria | 917 |
| 119 | Ga0070662_100002882 | 3300005457 | Bacteria | 10670 |
| 120 | Ga0070662_100055312 | 3300005457 | Bacteria | 2878 |
| 121 | Ga0070662_100171934 | 3300005457 | Bacteria | 1702 |
| 122 | Ga0070681_10000076 | 3300005458 | Bacteria | 73378 |
| 123 | Ga0070681_10000082 | 3300005458 | Bacteria | 71460 |
| 124 | Ga0070681_10001769 | 3300005458 | Bacteria | 19376 |
| 125 | Ga0070681_10002020 | 3300005458 | Bacteria | 18373 |
| 126 | Ga0070681_10019691 | 3300005458 | Bacteria | 6759 |
| 127 | Ga0070681_10038625 | 3300005458 | Bacteria | 4786 |
| 128 | Ga0070681_10139828 | 3300005458 | Bacteria | 2351 |
| 129 | Ga0068867_100253558 | 3300005459 | Unclassified | 1432 |
| 130 | Ga0070685_10003104 | 3300005466 | Bacteria | 8443 |
| 131 | Ga0070679_100000150 | 3300005530 | Bacteria | 56196 |
| 132 | Ga0070679_100002690 | 3300005530 | Bacteria | 16189 |
| 133 | Ga0070679_100038896 | 3300005530 | Bacteria | 4730 |
| 134 | Ga0070679_100331383 | 3300005530 | Bacteria | 1470 |
| 135 | Ga0068853_100026573 | 3300005539 | Bacteria | 4861 |
| 136 | Ga0068853_100050144 | 3300005539 | Bacteria | 3590 |
| 137 | Ga0068853_100077903 | 3300005539 | Bacteria | 2896 |
| 138 | Ga0068853_100080474 | 3300005539 | Bacteria | 2850 |
| 139 | Ga0070696_100006301 | 3300005546 | Bacteria | 7945 |
| 140 | Ga0070696_100007828 | 3300005546 | Bacteria | 7135 |
| 141 | Ga0070696_100039568 | 3300005546 | Bacteria | 3255 |
| 142 | Ga0070696_100078297 | 3300005546 | Bacteria | 2337 |
| 143 | Ga0070696_100135184 | 3300005546 | Bacteria | 1797 |
| 144 | Ga0070696_100151582 | 3300005546 | Bacteria | 1702 |
| 145 | Ga0070693_100002312 | 3300005547 | Bacteria | 8745 |
| 146 | Ga0070693_100215864 | 3300005547 | Bacteria | 1254 |
| 147 | Ga0070693_100268260 | 3300005547 | Bacteria | 1138 |
| 148 | Ga0070665_100004680 | 3300005548 | Bacteria | 14287 |
| 149 | Ga0068855_100008081 | 3300005563 | Bacteria | 12713 |
| 150 | Ga0068855_100028324 | 3300005563 | Bacteria | 6700 |
| 151 | Ga0068855_100029024 | 3300005563 | Bacteria | 6616 |
| 152 | Ga0068855_100045182 | 3300005563 | Bacteria | 5209 |
| 153 | Ga0068855_100059762 | 3300005563 | Bacteria | 4459 |
| 154 | Ga0068855_100068677 | 3300005563 | Bacteria | 4125 |
| 155 | Ga0068855_100098070 | 3300005563 | Bacteria | 3376 |
| 156 | Ga0068855_100330629 | 3300005563 | Bacteria | 1682 |
| 157 | Ga0068857_100000491 | 3300005577 | Bacteria | 28321 |
| 158 | Ga0068857_100004884 | 3300005577 | Bacteria | 11372 |
| 159 | Ga0068857_100006493 | 3300005577 | Bacteria | 10030 |
| 160 | Ga0068857_100008883 | 3300005577 | Bacteria | 8703 |
| 161 | Ga0068857_100041984 | 3300005577 | Bacteria | 4055 |
| 162 | Ga0068857_100050181 | 3300005577 | Bacteria | 3702 |
| 163 | Ga0068857_100097524 | 3300005577 | Bacteria | 2636 |
| 164 | Ga0068854_100000046 | 3300005578 | Bacteria | 91434 |
| 165 | Ga0068854_100000553 | 3300005578 | Bacteria | 22562 |
| 166 | Ga0068854_100006463 | 3300005578 | Bacteria | 7456 |
| 167 | Ga0068854_100095604 | 3300005578 | Bacteria | 2218 |
| 168 | Ga0068856_100000455 | 3300005614 | Bacteria | 45174 |
| 169 | Ga0068856_100000920 | 3300005614 | Bacteria | 31509 |
| 170 | Ga0068856_100092872 | 3300005614 | Bacteria | 3003 |
| 171 | Ga0068856_100197240 | 3300005614 | Bacteria | 2027 |
| 172 | Ga0068856_100351172 | 3300005614 | Bacteria | 1493 |
| 173 | Ga0068852_100027789 | 3300005616 | Bacteria | 4617 |
| 174 | Ga0068852_100031022 | 3300005616 | Bacteria | 4405 |
| 175 | Ga0068852_100041326 | 3300005616 | Bacteria | 3896 |
| 176 | Ga0068852_100073063 | 3300005616 | Bacteria | 3016 |
| 177 | Ga0068852_100128436 | 3300005616 | Bacteria | 2331 |
| 178 | Ga0068859_100058280 | 3300005617 | Bacteria | 3890 |
| 179 | Ga0068851_10009883 | 3300005834 | Bacteria | 4443 |
| 180 | Ga0068851_10019857 | 3300005834 | Bacteria | 3248 |
| 181 | Ga0068858_100076311 | 3300005842 | Bacteria | 3112 |
| 182 | Ga0068858_100119741 | 3300005842 | Bacteria | 2461 |
| 183 | Ga0068858_100124197 | 3300005842 | Bacteria | 2416 |
| 184 | Ga0068860_100012176 | 3300005843 | Bacteria | 8474 |
| 185 | Ga0068860_100030058 | 3300005843 | Bacteria | 5225 |
| 186 | Ga0068862_100133895 | 3300005844 | Unclassified | 2195 |
| 187 | Ga0068862_100386074 | 3300005844 | Bacteria | 1307 |
| 188 | Ga0070712_100379513 | 3300006175 | Bacteria | 1163 |
| 189 | Ga0097621_100262196 | 3300006237 | Unclassified | 1516 |
| 190 | Ga0075370_10187359 | 3300006353 | Bacteria | 1219 |
| 191 | Ga0075428_100245945 | 3300006844 | Bacteria | 1929 |
| 192 | Ga0075430_100299149 | 3300006846 | Bacteria | 1331 |
| 193 | Ga0097620_100058280 | 3300006931 | Bacteria | 3890 |
| 194 | Ga0105240_10000034 | 3300009093 | Bacteria | 278179 |
| 195 | Ga0105240_10000115 | 3300009093 | Bacteria | 165594 |
| 196 | Ga0105240_10002188 | 3300009093 | Bacteria | 31901 |
| 197 | Ga0105240_10023081 | 3300009093 | Bacteria | 8239 |
| 198 | Ga0105240_10038777 | 3300009093 | Bacteria | 6108 |
| 199 | Ga0105240_10055731 | 3300009093 | Bacteria | 4949 |
| 200 | Ga0105240_10096528 | 3300009093 | Bacteria | 3602 |
| 201 | Ga0105240_10180600 | 3300009093 | Bacteria | 2490 |
| 202 | Ga0105240_11158244 | 3300009093 | Bacteria | 820 |
| 203 | Ga0111539_10093213 | 3300009094 | Unclassified | 3538 |
| 204 | Ga0105247_10018919 | 3300009101 | Bacteria | 4136 |
| 205 | Ga0105241_10071434 | 3300009174 | Bacteria | 2695 |
| 206 | Ga0105241_10101948 | 3300009174 | Bacteria | 2283 |
| 207 | Ga0105241_10102134 | 3300009174 | Bacteria | 2281 |
| 208 | Ga0105237_10000016 | 3300009545 | Bacteria | 256506 |
| 209 | Ga0105237_10000292 | 3300009545 | Bacteria | 69307 |
| 210 | Ga0105237_10000371 | 3300009545 | Bacteria | 63699 |
| 211 | Ga0105237_10022992 | 3300009545 | Bacteria | 6393 |
| 212 | Ga0105237_10395027 | 3300009545 | Bacteria | 1388 |
| 213 | Ga0105237_10899028 | 3300009545 | Bacteria | 892 |
| 214 | Ga0105238_10000513 | 3300009551 | Bacteria | 40634 |
| 215 | Ga0105238_10004930 | 3300009551 | Bacteria | 13211 |
| 216 | Ga0105238_10014761 | 3300009551 | Bacteria | 7899 |
| 217 | Ga0105238_10114787 | 3300009551 | Bacteria | 2672 |
| 218 | Ga0105238_10222523 | 3300009551 | Bacteria | 1864 |
| 219 | Ga0105238_10484842 | 3300009551 | Bacteria | 1236 |
| 220 | Ga0105239_10000028 | 3300010375 | Bacteria | 243470 |
| 221 | Ga0105239_10022879 | 3300010375 | Bacteria | 6889 |
| 222 | Ga0105239_10224363 | 3300010375 | Bacteria | 2107 |
| 223 | Ga0157314_1000063 | 3300012500 | Bacteria | 11461 |
| 224 | Ga0157373_10004360 | 3300013100 | Bacteria | 10659 |
| 225 | Ga0157373_10011828 | 3300013100 | Bacteria | 6411 |
| 226 | Ga0157373_10013694 | 3300013100 | Bacteria | 5946 |
| 227 | Ga0157373_10057998 | 3300013100 | Bacteria | 2745 |
| 228 | Ga0157373_10099316 | 3300013100 | Bacteria | 2048 |
| 229 | Ga0157373_10251251 | 3300013100 | Bacteria | 1251 |
| 230 | Ga0157373_10461128 | 3300013100 | Bacteria | 915 |
| 231 | Ga0157371_10012309 | 3300013102 | Bacteria | 6546 |
| 232 | Ga0157371_10020425 | 3300013102 | Bacteria | 4874 |
| 233 | Ga0157371_10022989 | 3300013102 | Bacteria | 4558 |
| 234 | Ga0157371_10029872 | 3300013102 | Bacteria | 3935 |
| 235 | Ga0157371_10050082 | 3300013102 | Bacteria | 2968 |
| 236 | Ga0157371_10059351 | 3300013102 | Bacteria | 2712 |
| 237 | Ga0157371_10093988 | 3300013102 | Bacteria | 2125 |
| 238 | Ga0157371_10270923 | 3300013102 | Bacteria | 1225 |
| 239 | Ga0157370_10007212 | 3300013104 | Bacteria | 12133 |
| 240 | Ga0157370_10009789 | 3300013104 | Bacteria | 10166 |
| 241 | Ga0157370_10011801 | 3300013104 | Bacteria | 9118 |
| 242 | Ga0157370_10044317 | 3300013104 | Bacteria | 4276 |
| 243 | Ga0157370_10047443 | 3300013104 | Bacteria | 4117 |
| 244 | Ga0157370_10097411 | 3300013104 | Bacteria | 2759 |
| 245 | Ga0157370_10103285 | 3300013104 | Bacteria | 2668 |
| 246 | Ga0157370_10107394 | 3300013104 | Bacteria | 2611 |
| 247 | Ga0157370_10263870 | 3300013104 | Bacteria | 1591 |
| 248 | Ga0157370_10855558 | 3300013104 | Bacteria | 826 |
| 249 | Ga0157369_10001146 | 3300013105 | Bacteria | 33054 |
| 250 | Ga0157369_10006957 | 3300013105 | Bacteria | 13046 |
| 251 | Ga0157369_10010587 | 3300013105 | Bacteria | 10499 |
| 252 | Ga0157369_10018469 | 3300013105 | Bacteria | 7817 |
| 253 | Ga0157369_10067314 | 3300013105 | Bacteria | 3851 |
| 254 | Ga0157369_10087141 | 3300013105 | Bacteria | 3334 |
| 255 | Ga0157369_10575070 | 3300013105 | Bacteria | 1164 |
| 256 | Ga0163162_10001591 | 3300013306 | Bacteria | 21239 |
| 257 | Ga0163162_10051171 | 3300013306 | Bacteria | 4144 |
| 258 | Ga0157372_10010749 | 3300013307 | Bacteria | 9744 |
| 259 | Ga0157372_10033446 | 3300013307 | Bacteria | 5648 |
| 260 | Ga0157372_10039362 | 3300013307 | Bacteria | 5217 |
| 261 | Ga0157372_10066986 | 3300013307 | Bacteria | 4034 |
| 262 | Ga0157372_10147519 | 3300013307 | Bacteria | 2713 |
| 263 | Ga0157372_10183051 | 3300013307 | Bacteria | 2425 |
| 264 | Ga0157372_10237491 | 3300013307 | Bacteria | 2114 |
| 265 | Ga0157372_10370452 | 3300013307 | Bacteria | 1669 |
| 266 | Ga0182008_10015782 | 3300014497 | Bacteria | 3935 |
| 267 | Ga0182008_10048243 | 3300014497 | Bacteria | 2115 |
| 268 | Ga0182008_10062622 | 3300014497 | Bacteria | 1833 |
| 269 | Ga0182008_10105886 | 3300014497 | Bacteria | 1391 |
| 270 | Ga0182008_10109647 | 3300014497 | Bacteria | 1368 |
| 271 | Ga0182008_10305399 | 3300014497 | Bacteria | 834 |
| 272 | Ga0182006_1000061 | 3300015261 | Bacteria | 156823 |
| 273 | Ga0182006_1007237 | 3300015261 | Bacteria | 5096 |
| 274 | Ga0182006_1012331 | 3300015261 | Bacteria | 3736 |
| 275 | Ga0182006_1037503 | 3300015261 | Bacteria | 1921 |
| 276 | Ga0182006_1041976 | 3300015261 | Bacteria | 1794 |
| 277 | Ga0182007_10005804 | 3300015262 | Bacteria | 5366 |
| 278 | Ga0182007_10009625 | 3300015262 | Bacteria | 3881 |
| 279 | Ga0182007_10011279 | 3300015262 | Bacteria | 3482 |
| 280 | Ga0182005_1001560 | 3300015265 | Bacteria | 9061 |
| 281 | Ga0182005_1003115 | 3300015265 | Bacteria | 5711 |
| 282 | Ga0183369_1004 | 3300015685 | Bacteria | 539301 |
| 283 | Ga0183360_10001 | 3300015689 | Bacteria | 3943671 |
| 284 | Ga0163161_10046760 | 3300017792 | Bacteria | 3123 |
| 285 | Ga0163161_10065114 | 3300017792 | Bacteria | 2659 |
| 286 | Ga0197907_10080030 | 3300020069 | Bacteria | 6332 |
| 287 | Ga0197907_10217144 | 3300020069 | Bacteria | 1686 |
| 288 | Ga0206356_10379243 | 3300020070 | Bacteria | 2960 |
| 289 | Ga0206356_10546730 | 3300020070 | Bacteria | 4793 |
| 290 | Ga0206349_1686371 | 3300020075 | Bacteria | 1670 |
| 291 | Ga0206355_1394520 | 3300020076 | Bacteria | 1181 |
| 292 | Ga0206352_10220409 | 3300020078 | Bacteria | 2931 |
| 293 | Ga0206352_10962774 | 3300020078 | Bacteria | 1129 |
| 294 | Ga0206350_10303956 | 3300020080 | Bacteria | 1596 |
| 295 | Ga0206354_10121428 | 3300020081 | Bacteria | 4729 |
| 296 | Ga0206354_10883312 | 3300020081 | Bacteria | 13243 |
| 297 | Ga0206354_11113808 | 3300020081 | Bacteria | 3972 |
| 298 | Ga0206354_11431445 | 3300020081 | Bacteria | 1826 |
| 299 | Ga0206353_10063786 | 3300020082 | Bacteria | 9300 |
| 300 | Ga0206353_11738411 | 3300020082 | Bacteria | 1968 |
| 301 | Ga0206353_11944126 | 3300020082 | Bacteria | 4124 |
| 302 | Ga0206353_11975562 | 3300020082 | Bacteria | 892 |
| 303 | Ga0154015_1139938 | 3300020610 | Bacteria | 2708 |
| 304 | Ga0154015_1183830 | 3300020610 | Bacteria | 841 |
| 305 | Ga0154015_1595600 | 3300020610 | Bacteria | 4141 |
| 306 | Ga0154015_1641253 | 3300020610 | Bacteria | 1119 |
| 307 | Ga0224712_10005613 | 3300022467 | Bacteria | 3514 |
| 308 | Ga0224712_10037405 | 3300022467 | Bacteria | 1806 |
| 309 | Ga0224712_10178530 | 3300022467 | Bacteria | 955 |
| 310 | Ga0209760_100384 | 3300025207 | Bacteria | 11402 |
| 311 | Ga0209784_100026 | 3300025224 | Bacteria | 371540 |
| 312 | Ga0209566_103460 | 3300025225 | Bacteria | 2417 |
| 313 | Ga0209674_100026 | 3300025226 | Bacteria | 490631 |
| 314 | Ga0209674_101816 | 3300025226 | Bacteria | 5105 |
| 315 | Ga0209672_100007 | 3300025228 | Bacteria | 959482 |
| 316 | Ga0209672_100017 | 3300025228 | Bacteria | 514236 |
| 317 | Ga0209672_100239 | 3300025228 | Bacteria | 41496 |
| 318 | Ga0209672_100412 | 3300025228 | Bacteria | 25217 |
| 319 | Ga0209672_101232 | 3300025228 | Bacteria | 10326 |
| 320 | Ga0209563_100074 | 3300025230 | Bacteria | 224912 |
| 321 | Ga0207427_100023 | 3300025231 | Bacteria | 439725 |
| 322 | Ga0207427_100213 | 3300025231 | Bacteria | 51669 |
| 323 | Ga0207427_104431 | 3300025231 | Bacteria | 2369 |
| 324 | Ga0207427_106434 | 3300025231 | Bacteria | 1490 |
| 325 | Ga0209437_100069 | 3300025233 | Bacteria | 307733 |
| 326 | Ga0209437_100194 | 3300025233 | Bacteria | 121991 |
| 327 | Ga0209437_100381 | 3300025233 | Bacteria | 43879 |
| 328 | Ga0209437_100838 | 3300025233 | Bacteria | 13401 |
| 329 | Ga0209258_100017 | 3300025242 | Bacteria | 590785 |
| 330 | Ga0209258_100038 | 3300025242 | Bacteria | 398959 |
| 331 | Ga0209258_100059 | 3300025242 | Bacteria | 324934 |
| 332 | Ga0209258_100118 | 3300025242 | Bacteria | 183558 |
| 333 | Ga0209258_100144 | 3300025242 | Bacteria | 163814 |
| 334 | Ga0209258_100635 | 3300025242 | Bacteria | 27631 |
| 335 | Ga0209258_102018 | 3300025242 | Bacteria | 5845 |
| 336 | Ga0207425_1001356 | 3300025245 | Bacteria | 10440 |
| 337 | Ga0209646_1000264 | 3300025246 | Bacteria | 51141 |
| 338 | Ga0209646_1001043 | 3300025246 | Bacteria | 8360 |
| 339 | Ga0209646_1001117 | 3300025246 | Bacteria | 7912 |
| 340 | Ga0209026_1000036 | 3300025250 | Bacteria | 296607 |
| 341 | Ga0209026_1000044 | 3300025250 | Bacteria | 266550 |
| 342 | Ga0209026_1000191 | 3300025250 | Bacteria | 88578 |
| 343 | Ga0209026_1000785 | 3300025250 | Bacteria | 17557 |
| 344 | Ga0209026_1005549 | 3300025250 | Bacteria | 3361 |
| 345 | Ga0209677_103542 | 3300025253 | Bacteria | 4978 |
| 346 | Ga0209148_1000002 | 3300025254 | Bacteria | 2399500 |
| 347 | Ga0209148_1000009 | 3300025254 | Bacteria | 1395625 |
| 348 | Ga0209148_1000010 | 3300025254 | Bacteria | 1265567 |
| 349 | Ga0209148_1000024 | 3300025254 | Bacteria | 669890 |
| 350 | Ga0209148_1000044 | 3300025254 | Bacteria | 458417 |
| 351 | Ga0209148_1000141 | 3300025254 | Bacteria | 163821 |
| 352 | Ga0209148_1000706 | 3300025254 | Bacteria | 26856 |
| 353 | Ga0209759_1000023 | 3300025256 | Bacteria | 321695 |
| 354 | Ga0209759_1000517 | 3300025256 | Bacteria | 41788 |
| 355 | Ga0209759_1000779 | 3300025256 | Bacteria | 26706 |
| 356 | Ga0209759_1001117 | 3300025256 | Bacteria | 17277 |
| 357 | Ga0209759_1014477 | 3300025256 | Bacteria | 2084 |
| 358 | Ga0209129_1000035 | 3300025258 | Bacteria | 329303 |
| 359 | Ga0209129_1001844 | 3300025258 | Bacteria | 11219 |
| 360 | Ga0209233_1000009 | 3300025261 | Bacteria | 1265567 |
| 361 | Ga0209233_1000323 | 3300025261 | Bacteria | 51669 |
| 362 | Ga0209233_1014309 | 3300025261 | Bacteria | 2239 |
| 363 | Ga0209233_1015779 | 3300025261 | Bacteria | 2094 |
| 364 | Ga0209233_1031104 | 3300025261 | Bacteria | 1250 |
| 365 | Ga0209565_1002154 | 3300025263 | Bacteria | 7411 |
| 366 | Ga0209565_1023712 | 3300025263 | Bacteria | 1259 |
| 367 | Ga0209455_1000010 | 3300025272 | Bacteria | 959482 |
| 368 | Ga0209455_1000020 | 3300025272 | Bacteria | 702259 |
| 369 | Ga0209455_1000025 | 3300025272 | Bacteria | 670673 |
| 370 | Ga0209455_1000032 | 3300025272 | Bacteria | 514243 |
| 371 | Ga0209455_1000380 | 3300025272 | Bacteria | 40273 |
| 372 | Ga0209455_1005134 | 3300025272 | Bacteria | 4117 |
| 373 | Ga0209455_1009394 | 3300025272 | Bacteria | 2572 |
| 374 | Ga0209564_1000024 | 3300025295 | Bacteria | 535041 |
| 375 | Ga0209758_1000066 | 3300025297 | Bacteria | 298620 |
| 376 | Ga0209758_1000290 | 3300025297 | Bacteria | 98878 |
| 377 | Ga0209758_1021411 | 3300025297 | Bacteria | 3015 |
| 378 | Ga0207426_1013399 | 3300025302 | Bacteria | 3040 |
| 379 | Ga0209257_1026233 | 3300025304 | Bacteria | 1969 |
| 380 | Ga0209257_1055762 | 3300025304 | Bacteria | 1094 |
| 381 | Ga0207656_10004076 | 3300025321 | Bacteria | 5070 |
| 382 | Ga0207656_10009850 | 3300025321 | Bacteria | 3557 |
| 383 | Ga0207710_10008401 | 3300025900 | Bacteria | 4354 |
| 384 | Ga0207680_10000003 | 3300025903 | Bacteria | 925264 |
| 385 | Ga0207647_10000237 | 3300025904 | Bacteria | 45127 |
| 386 | Ga0207647_10001096 | 3300025904 | Bacteria | 20884 |
| 387 | Ga0207647_10003895 | 3300025904 | Bacteria | 11149 |
| 388 | Ga0207647_10003907 | 3300025904 | Bacteria | 11132 |
| 389 | Ga0207647_10021325 | 3300025904 | Bacteria | 4326 |
| 390 | Ga0207705_10000029 | 3300025909 | Bacteria | 239897 |
| 391 | Ga0207705_10000439 | 3300025909 | Bacteria | 35994 |
| 392 | Ga0207705_10000614 | 3300025909 | Bacteria | 29837 |
| 393 | Ga0207705_10003279 | 3300025909 | Bacteria | 12329 |
| 394 | Ga0207705_10006884 | 3300025909 | Bacteria | 8402 |
| 395 | Ga0207705_10046918 | 3300025909 | Bacteria | 3106 |
| 396 | Ga0207707_10000018 | 3300025912 | Bacteria | 215518 |
| 397 | Ga0207707_10000036 | 3300025912 | Bacteria | 146159 |
| 398 | Ga0207707_10000042 | 3300025912 | Bacteria | 126050 |
| 399 | Ga0207707_10000049 | 3300025912 | Bacteria | 117480 |
| 400 | Ga0207707_10001192 | 3300025912 | Bacteria | 24480 |
| 401 | Ga0207707_10001753 | 3300025912 | Bacteria | 19927 |
| 402 | Ga0207707_10014212 | 3300025912 | Bacteria | 6935 |
| 403 | Ga0207707_10019535 | 3300025912 | Bacteria | 5915 |
| 404 | Ga0207707_10028042 | 3300025912 | Bacteria | 4921 |
| 405 | Ga0207707_10028420 | 3300025912 | Bacteria | 4888 |
| 406 | Ga0207707_10049094 | 3300025912 | Bacteria | 3677 |
| 407 | Ga0207695_10000101 | 3300025913 | Bacteria | 258504 |
| 408 | Ga0207695_10000116 | 3300025913 | Bacteria | 239510 |
| 409 | Ga0207695_10000307 | 3300025913 | Bacteria | 118870 |
| 410 | Ga0207695_10001055 | 3300025913 | Bacteria | 48329 |
| 411 | Ga0207695_10001683 | 3300025913 | Bacteria | 35550 |
| 412 | Ga0207695_10013533 | 3300025913 | Bacteria | 9722 |
| 413 | Ga0207695_10018303 | 3300025913 | Bacteria | 8104 |
| 414 | Ga0207695_10030863 | 3300025913 | Bacteria | 5894 |
| 415 | Ga0207695_10035270 | 3300025913 | Bacteria | 5428 |
| 416 | Ga0207671_10000013 | 3300025914 | Bacteria | 478458 |
| 417 | Ga0207671_10002057 | 3300025914 | Bacteria | 22047 |
| 418 | Ga0207660_10000206 | 3300025917 | Bacteria | 37525 |
| 419 | Ga0207660_10000948 | 3300025917 | Bacteria | 19217 |
| 420 | Ga0207660_10001219 | 3300025917 | Bacteria | 17202 |
| 421 | Ga0207660_10003795 | 3300025917 | Bacteria | 9840 |
| 422 | Ga0207660_10047625 | 3300025917 | Bacteria | 3032 |
| 423 | Ga0207657_10006454 | 3300025919 | Bacteria | 12154 |
| 424 | Ga0207657_10007522 | 3300025919 | Bacteria | 11165 |
| 425 | Ga0207657_10032347 | 3300025919 | Bacteria | 4727 |
| 426 | Ga0207657_10091368 | 3300025919 | Bacteria | 2539 |
| 427 | Ga0207657_10532016 | 3300025919 | Bacteria | 919 |
| 428 | Ga0207657_10554293 | 3300025919 | Bacteria | 899 |
| 429 | Ga0207649_10000219 | 3300025920 | Bacteria | 46974 |
| 430 | Ga0207649_10069089 | 3300025920 | Bacteria | 2248 |
| 431 | Ga0207649_10118571 | 3300025920 | Bacteria | 1781 |
| 432 | Ga0207649_10167275 | 3300025920 | Bacteria | 1528 |
| 433 | Ga0207652_10000014 | 3300025921 | Bacteria | 196569 |
| 434 | Ga0207652_10000099 | 3300025921 | Bacteria | 93755 |
| 435 | Ga0207652_10001601 | 3300025921 | Bacteria | 19926 |
| 436 | Ga0207652_10002446 | 3300025921 | Bacteria | 15682 |
| 437 | Ga0207652_10004532 | 3300025921 | Bacteria | 11278 |
| 438 | Ga0207652_10069664 | 3300025921 | Bacteria | 3054 |
| 439 | Ga0207652_10097407 | 3300025921 | Bacteria | 2592 |
| 440 | Ga0207681_10037105 | 3300025923 | Unclassified | 3220 |
| 441 | Ga0207694_10000151 | 3300025924 | Bacteria | 71870 |
| 442 | Ga0207694_10020553 | 3300025924 | Bacteria | 4997 |
| 443 | Ga0207694_10114991 | 3300025924 | Bacteria | 2143 |
| 444 | Ga0207694_10314550 | 3300025924 | Bacteria | 1291 |
| 445 | Ga0207664_10000030 | 3300025929 | Bacteria | 179903 |
| 446 | Ga0207664_10003028 | 3300025929 | Bacteria | 11174 |
| 447 | Ga0207690_10000096 | 3300025932 | Bacteria | 72704 |
| 448 | Ga0207690_10002264 | 3300025932 | Bacteria | 11741 |
| 449 | Ga0207690_10004228 | 3300025932 | Bacteria | 8484 |
| 450 | Ga0207690_10006491 | 3300025932 | Bacteria | 6935 |
| 451 | Ga0207690_10009614 | 3300025932 | Bacteria | 5740 |
| 452 | Ga0207690_10017568 | 3300025932 | Bacteria | 4371 |
| 453 | Ga0207690_10052709 | 3300025932 | Bacteria | 2726 |
| 454 | Ga0207690_10058549 | 3300025932 | Bacteria | 2606 |
| 455 | Ga0207690_10694526 | 3300025932 | Bacteria | 836 |
| 456 | Ga0207706_10003820 | 3300025933 | Bacteria | 14360 |
| 457 | Ga0207706_10025734 | 3300025933 | Bacteria | 5271 |
| 458 | Ga0207706_10060840 | 3300025933 | Bacteria | 3326 |
| 459 | Ga0207670_10000897 | 3300025936 | Bacteria | 15695 |
| 460 | Ga0207711_10923001 | 3300025941 | Unclassified | 811 |
| 461 | Ga0207661_10006602 | 3300025944 | Bacteria | 8200 |
| 462 | Ga0207661_10009873 | 3300025944 | Bacteria | 6856 |
| 463 | Ga0207661_10364657 | 3300025944 | Bacteria | 1305 |
| 464 | Ga0207679_10010175 | 3300025945 | Bacteria | 6052 |
| 465 | Ga0207679_10731834 | 3300025945 | Bacteria | 899 |
| 466 | Ga0207667_10000040 | 3300025949 | Bacteria | 275827 |
| 467 | Ga0207667_10000047 | 3300025949 | Bacteria | 240471 |
| 468 | Ga0207667_10000075 | 3300025949 | Bacteria | 169836 |
| 469 | Ga0207667_10002530 | 3300025949 | Bacteria | 22759 |
| 470 | Ga0207667_10002947 | 3300025949 | Bacteria | 21120 |
| 471 | Ga0207667_10012337 | 3300025949 | Bacteria | 9857 |
| 472 | Ga0207667_10013444 | 3300025949 | Bacteria | 9368 |
| 473 | Ga0207667_10254442 | 3300025949 | Bacteria | 1797 |
| 474 | Ga0207667_10431429 | 3300025949 | Bacteria | 1340 |
| 475 | Ga0207640_10000009 | 3300025981 | Bacteria | 283101 |
| 476 | Ga0207640_10000461 | 3300025981 | Bacteria | 24827 |
| 477 | Ga0207640_10000682 | 3300025981 | Bacteria | 19736 |
| 478 | Ga0207640_10002087 | 3300025981 | Bacteria | 10754 |
| 479 | Ga0207640_10005417 | 3300025981 | Bacteria | 6958 |
| 480 | Ga0207640_10079017 | 3300025981 | Bacteria | 2241 |
| 481 | Ga0207640_10100430 | 3300025981 | Bacteria | 2027 |
| 482 | Ga0207640_10233420 | 3300025981 | Bacteria | 1417 |
| 483 | Ga0207658_10117124 | 3300025986 | Bacteria | 2117 |
| 484 | Ga0207703_10057954 | 3300026035 | Bacteria | 3160 |
| 485 | Ga0207703_10278225 | 3300026035 | Bacteria | 1519 |
| 486 | Ga0207703_10399113 | 3300026035 | Bacteria | 1275 |
| 487 | Ga0207639_10000403 | 3300026041 | Bacteria | 29844 |
| 488 | Ga0207639_10001846 | 3300026041 | Bacteria | 14260 |
| 489 | Ga0207639_10008206 | 3300026041 | Bacteria | 7148 |
| 490 | Ga0207639_10352579 | 3300026041 | Bacteria | 1314 |
| 491 | Ga0207639_10408235 | 3300026041 | Bacteria | 1225 |
| 492 | Ga0207678_10000612 | 3300026067 | Bacteria | 32677 |
| 493 | Ga0207678_10001123 | 3300026067 | Bacteria | 24559 |
| 494 | Ga0207678_10002596 | 3300026067 | Bacteria | 16458 |
| 495 | Ga0207678_10017625 | 3300026067 | Bacteria | 6268 |
| 496 | Ga0207678_10024508 | 3300026067 | Bacteria | 5271 |
| 497 | Ga0207678_10030697 | 3300026067 | Bacteria | 4692 |
| 498 | Ga0207678_10042733 | 3300026067 | Bacteria | 3924 |
| 499 | Ga0207678_10117295 | 3300026067 | Bacteria | 2271 |
| 500 | Ga0207678_10127520 | 3300026067 | Bacteria | 2170 |
| 501 | Ga0207678_10129015 | 3300026067 | Bacteria | 2156 |
| 502 | Ga0207678_10180379 | 3300026067 | Bacteria | 1803 |
| 503 | Ga0207678_10438790 | 3300026067 | Bacteria | 1134 |
| 504 | Ga0207678_10538969 | 3300026067 | Bacteria | 1020 |
| 505 | Ga0207702_10000608 | 3300026078 | Bacteria | 39599 |
| 506 | Ga0207702_10002529 | 3300026078 | Bacteria | 17222 |
| 507 | Ga0207702_10005706 | 3300026078 | Bacteria | 10855 |
| 508 | Ga0207702_10275207 | 3300026078 | Bacteria | 1589 |
| 509 | Ga0207648_10274219 | 3300026089 | Unclassified | 1507 |
| 510 | Ga0207648_11019481 | 3300026089 | Bacteria | 775 |
| 511 | Ga0207674_10000012 | 3300026116 | Bacteria | 193220 |
| 512 | Ga0207674_10004576 | 3300026116 | Bacteria | 16605 |
| 513 | Ga0207674_10008336 | 3300026116 | Bacteria | 11991 |
| 514 | Ga0207674_10009386 | 3300026116 | Bacteria | 11184 |
| 515 | Ga0207674_10014417 | 3300026116 | Bacteria | 8731 |
| 516 | Ga0207674_10027320 | 3300026116 | Bacteria | 6039 |
| 517 | Ga0207674_10129007 | 3300026116 | Bacteria | 2493 |
| 518 | Ga0207698_10000152 | 3300026142 | Bacteria | 44402 |
| 519 | Ga0207698_10001073 | 3300026142 | Bacteria | 15905 |
| 520 | Ga0207698_10022815 | 3300026142 | Bacteria | 4360 |
| 521 | Ga0207698_10126755 | 3300026142 | Bacteria | 2173 |
| 522 | Ga0268266_10000011 | 3300028379 | Bacteria | 757403 |
| 523 | Ga0268265_10074347 | 3300028380 | Bacteria | 2658 |
| 524 | Ga0268265_10349700 | 3300028380 | Bacteria | 1349 |
| 525 | Ga0268265_10363697 | 3300028380 | Unclassified | 1325 |
| 526 | Ga0268265_10720434 | 3300028380 | Bacteria | 966 |
| 527 | Ga0268264_10054343 | 3300028381 | Bacteria | 3344 |
| 528 | Ga0268264_10069026 | 3300028381 | Bacteria | 2988 |
| 529 | Ga0307515_10284519 | 3300028794 | Bacteria | 1357 |
| 530 | Ga0307515_10614803 | 3300028794 | Bacteria | 698 |
| 531 | Ga0265338_10390956 | 3300028800 | Bacteria | 993 |
| 532 | Ga0265340_10014712 | 3300031247 | Bacteria | 4081 |
| 533 | Ga0265340_10233119 | 3300031247 | Bacteria | 823 |
| 534 | Ga0265331_10083517 | 3300031250 | Bacteria | 1481 |
| 535 | Ga0307412_10000592 | 3300031911 | Bacteria | 21434 |
| 536 | Ga0307416_100767751 | 3300032002 | Bacteria | 1058 |
| 537 | Ga0307510_10003183 | 3300033180 | Bacteria | 19050 |
| 538 | Ga0307510_10216741 | 3300033180 | Bacteria | 1430 |
| 539 | Ga0395899_0000062 | 3300037312 | Bacteria | 211388 |
| 540 | Ga0395899_0018866 | 3300037312 | Bacteria | 5241 |
| 541 | Ga0395899_0025640 | 3300037312 | Bacteria | 4450 |
| 542 | Ga0395899_0067173 | 3300037312 | Bacteria | 2631 |
| 543 | Ga0395899_0088006 | 3300037312 | Bacteria | 2253 |
| 544 | Ga0395899_0308698 | 3300037312 | Bacteria | 1068 |
| 545 | Ga0395900_0000039 | 3300037418 | Bacteria | 248722 |
| 546 | Ga0395900_0016300 | 3300037418 | Bacteria | 7575 |
| 547 | Ga0395900_0036728 | 3300037418 | Bacteria | 5050 |
| 548 | Ga0395900_0278537 | 3300037418 | Bacteria | 1665 |
| 549 | Ga0395900_0471676 | 3300037418 | Bacteria | 1208 |
| 550 | Ga0395898_0000140 | 3300037466 | Bacteria | 190587 |
| 551 | Ga0395898_0006775 | 3300037466 | Bacteria | 12200 |
| 552 | Ga0395898_0108134 | 3300037466 | Bacteria | 2666 |
| 553 | Ga0395898_0211832 | 3300037466 | Bacteria | 1848 |
| 554 | Ga0395905_0252157 | 3300037471 | Bacteria | 1648 |
| 555 | Ga0395905_0408977 | 3300037471 | Bacteria | 1252 |
| 556 | Ga0395901_0000215 | 3300038443 | Bacteria | 72912 |
| 557 | Ga0395901_0002859 | 3300038443 | Bacteria | 17439 |
| 558 | Ga0395901_0022178 | 3300038443 | Bacteria | 6506 |
| 559 | Ga0395901_0069528 | 3300038443 | Bacteria | 3667 |
| 560 | Ga0395901_0070487 | 3300038443 | Bacteria | 3642 |
| 561 | Ga0395901_0131605 | 3300038443 | Bacteria | 2629 |
| 562 | Ga0395901_0225936 | 3300038443 | Bacteria | 1955 |
| 563 | Ga0395901_0522629 | 3300038443 | Bacteria | 1205 |
| 564 | Ga0439436_0000063 | 3300041404 | Bacteria | 29794 |
| 565 | Ga0439465_0001557 | 3300041413 | Bacteria | 7457 |
| 566 | Ga0451793_0622521 | 3300041452 | Bacteria | 6672 |
| 567 | Ga0451793_0733104 | 3300041452 | Bacteria | 1033 |
| 568 | Ga0451795_1375120 | 3300041456 | Bacteria | 874 |
| 569 | Ga0451800_0901466 | 3300041459 | Bacteria | 1660 |
| 570 | Ga0451806_170739 | 3300041462 | Bacteria | 1595 |
| 571 | Ga0451804_1024051 | 3300041463 | Bacteria | 1514 |
| 572 | Ga0451807_1329070 | 3300041486 | Bacteria | 1604 |
| 573 | Ga0451833_1479516 | 3300041491 | Bacteria | 1060 |
| 574 | Ga0451839_1292742 | 3300041496 | Bacteria | 816 |
| 575 | Ga0439437_001853 | 3300042000 | Bacteria | 2243 |
| 576 | Ga0439445_0008323 | 3300042004 | Bacteria | 2425 |
| 577 | Ga0439432_010194 | 3300042006 | Bacteria | 3262 |
| 578 | Ga0450908_000063 | 3300042184 | Bacteria | 21431 |
| 579 | Ga0439459_0000678 | 3300042438 | Bacteria | 4650 |
| 580 | Ga0439459_0022160 | 3300042438 | Bacteria | 1227 |
| 581 | Ga0466988_0162073 | 3300044536 | Bacteria | 1297 |
| 582 | Ga0466969_0002237 | 3300044656 | Bacteria | 10334 |
| 583 | Ga0466969_0075315 | 3300044656 | Bacteria | 1617 |
| 584 | Ga0466972_0043646 | 3300044658 | Bacteria | 2176 |
| 585 | Ga0466982_0000008 | 3300044672 | Bacteria | 240089 |
| 586 | Ga0466982_0002390 | 3300044672 | Bacteria | 7610 |
| 587 | Ga0466965_0002578 | 3300044683 | Bacteria | 7745 |
| 588 | Ga0466966_0002292 | 3300044684 | Bacteria | 12471 |
| 589 | Ga0466966_0015333 | 3300044684 | Bacteria | 5067 |
| 590 | Ga0466966_0016192 | 3300044684 | Bacteria | 4930 |
| 591 | Ga0466961_0002335 | 3300044693 | Bacteria | 11788 |
| 592 | Ga0466961_0002655 | 3300044693 | Bacteria | 11099 |
| 593 | Ga0466961_0003660 | 3300044693 | Bacteria | 9582 |
| 594 | Ga0466961_0094923 | 3300044693 | Bacteria | 1881 |
| 595 | Ga0466961_0173436 | 3300044693 | Bacteria | 1341 |
| 596 | Ga0466961_0227073 | 3300044693 | Bacteria | 1149 |
| 597 | Ga0466963_0093523 | 3300044694 | Bacteria | 2050 |
| 598 | Ga0466964_0037442 | 3300044706 | Bacteria | 1948 |
| 599 | Ga0466971_0013101 | 3300044719 | Bacteria | 3636 |
| 600 | Ga0466971_0040583 | 3300044719 | Bacteria | 2090 |
| 601 | Ga0466971_0316907 | 3300044719 | Bacteria | 751 |
| 602 | Ga0466968_0050108 | 3300044735 | Bacteria | 1780 |
| 603 | Ga0466970_0000163 | 3300044765 | Bacteria | 31774 |
| 604 | Ga0466970_0018568 | 3300044765 | Bacteria | 3601 |
| 605 | Ga0466970_0479993 | 3300044765 | Bacteria | 714 |
| 606 | Ga0466957_0035438 | 3300044842 | Bacteria | 2994 |
| 607 | Ga0466957_0039415 | 3300044842 | Bacteria | 2850 |
| 608 | Ga0466960_0020456 | 3300044901 | Bacteria | 2931 |
| 609 | Ga0466959_0000383 | 3300045049 | Bacteria | 26156 |
| 610 | Ga0466959_0008445 | 3300045049 | Bacteria | 7283 |
| 611 | Ga0466959_0026648 | 3300045049 | Bacteria | 4284 |
| 612 | Ga0466958_0006626 | 3300045836 | Bacteria | 6315 |
| 613 | Ga0466958_0016066 | 3300045836 | Bacteria | 4305 |
| 614 | Ga0466958_0097079 | 3300045836 | Bacteria | 1828 |
| 615 | Ga0466958_0134176 | 3300045836 | Bacteria | 1556 |
| 616 | Ga0466967_0345550 | 3300045976 | Bacteria | 1439 |
| 617 | Ga0495617_000114 | 3300046452 | Bacteria | 56455 |
| 618 | Ga0495617_000412 | 3300046452 | Bacteria | 23404 |
| 619 | Ga0495638_0000063 | 3300046460 | Bacteria | 185733 |
| 620 | Ga0495638_0000065 | 3300046460 | Bacteria | 170849 |
| 621 | Ga0495638_0000135 | 3300046460 | Bacteria | 118223 |
| 622 | Ga0495638_0000148 | 3300046460 | Bacteria | 110710 |
| 623 | Ga0495638_0011938 | 3300046460 | Bacteria | 5971 |
| 624 | Ga0495650_0000078 | 3300046471 | Bacteria | 245487 |
| 625 | Ga0495650_0000222 | 3300046471 | Bacteria | 118200 |
| 626 | Ga0495650_0001488 | 3300046471 | Bacteria | 22356 |
| 627 | Ga0495650_0010026 | 3300046471 | Bacteria | 5330 |
| 628 | Ga0495605_0204633 | 3300046474 | Bacteria | 859 |
| 629 | Ga0495584_0001381 | 3300046491 | Bacteria | 14631 |
| 630 | Ga0495585_0000063 | 3300046492 | Bacteria | 109530 |
| 631 | Ga0495585_0003226 | 3300046492 | Bacteria | 11126 |
| 632 | Ga0495607_0000029 | 3300046501 | Bacteria | 155005 |
| 633 | Ga0495607_0000100 | 3300046501 | Bacteria | 91570 |
| 634 | Ga0495607_0004039 | 3300046501 | Bacteria | 11006 |
| 635 | Ga0495606_0000351 | 3300046507 | Bacteria | 78808 |
| 636 | Ga0495606_0000427 | 3300046507 | Bacteria | 70054 |
| 637 | Ga0495606_0001737 | 3300046507 | Bacteria | 27992 |
| 638 | Ga0495606_0028699 | 3300046507 | Bacteria | 3920 |
| 639 | Ga0495606_0071954 | 3300046507 | Bacteria | 2175 |
| 640 | Ga0495606_0225441 | 3300046507 | Bacteria | 1053 |
| 641 | Ga0495610_0002695 | 3300046512 | Bacteria | 14636 |
| 642 | Ga0495610_0085140 | 3300046512 | Bacteria | 1443 |
| 643 | Ga0495616_0000183 | 3300046513 | Bacteria | 53040 |
| 644 | Ga0495616_0014578 | 3300046513 | Bacteria | 4395 |
| 645 | Ga0495620_0000090 | 3300046515 | Bacteria | 73605 |
| 646 | Ga0495620_0019009 | 3300046515 | Bacteria | 3390 |
| 647 | Ga0495631_0000055 | 3300046518 | Bacteria | 69950 |
| 648 | Ga0495631_0000458 | 3300046518 | Bacteria | 27678 |
| 649 | Ga0495632_0008465 | 3300046519 | Bacteria | 6312 |
| 650 | Ga0495632_0024202 | 3300046519 | Bacteria | 3230 |
| 651 | Ga0495637_0005939 | 3300046520 | Bacteria | 6174 |
| 652 | Ga0495648_0000324 | 3300046524 | Bacteria | 53060 |
| 653 | Ga0495648_0009773 | 3300046524 | Bacteria | 7386 |
| 654 | Ga0495609_0004473 | 3300046538 | Bacteria | 7638 |
| 655 | Ga0495633_0009082 | 3300046558 | Bacteria | 5526 |
| 656 | Ga0495668_0002335 | 3300046616 | Bacteria | 15798 |
| 657 | Ga0495611_0000003 | 3300046648 | Bacteria | 395679 |
| 658 | Ga0495611_0000018 | 3300046648 | Bacteria | 126654 |
| 659 | Ga0495625_0000019 | 3300046660 | Bacteria | 298330 |
| 660 | Ga0495625_0021104 | 3300046660 | Bacteria | 5020 |
| 661 | Ga0495625_0104538 | 3300046660 | Bacteria | 1941 |
| 662 | Ga0495625_0116267 | 3300046660 | Bacteria | 1824 |
| 663 | Ga0495625_0123154 | 3300046660 | Bacteria | 1762 |
| 664 | Ga0495661_0001253 | 3300046665 | Bacteria | 21924 |
| 665 | Ga0495661_0240530 | 3300046665 | Bacteria | 929 |
| 666 | Ga0495670_0000081 | 3300046691 | Bacteria | 42730 |
| 667 | Ga0495670_0000602 | 3300046691 | Bacteria | 17157 |
| 668 | Ga0495670_0028808 | 3300046691 | Bacteria | 2753 |
| 669 | Ga0495671_0000611 | 3300046692 | Bacteria | 26141 |
| 670 | Ga0495649_0003118 | 3300046694 | Bacteria | 11354 |
| 671 | Ga0495649_0078981 | 3300046694 | Bacteria | 1760 |
| 672 | Ga0495589_0000018 | 3300046794 | Bacteria | 204851 |
| 673 | Ga0495660_0000164 | 3300046810 | Bacteria | 71324 |
| 674 | Ga0495660_0000223 | 3300046810 | Bacteria | 56336 |
| 675 | Ga0495683_0001383 | 3300047323 | Bacteria | 16072 |
| 676 | Ga0495679_000017 | 3300047446 | Bacteria | 263230 |
| 677 | Ga0495673_0000004 | 3300047469 | Bacteria | 1354526 |
| 678 | Ga0495673_0000133 | 3300047469 | Bacteria | 137275 |
| 679 | Ga0495673_0000318 | 3300047469 | Bacteria | 62287 |
| 680 | Ga0495673_0018718 | 3300047469 | Bacteria | 3486 |
| 681 | Ga0495686_0000033 | 3300047472 | Bacteria | 342031 |
| 682 | Ga0495686_0000527 | 3300047472 | Bacteria | 55036 |
| 683 | Ga0495686_0003732 | 3300047472 | Bacteria | 12988 |
| 684 | Ga0495686_0008030 | 3300047472 | Bacteria | 7823 |
| 685 | Ga0495686_0066483 | 3300047472 | Bacteria | 2227 |
| 686 | Ga0496100_0000781 | 3300048903 | Bacteria | 15174 |
| 687 | Ga0496100_0119632 | 3300048903 | Bacteria | 1840 |
| 688 | Ga0496101_0009582 | 3300048904 | Bacteria | 6370 |
| 689 | Ga0496101_0084238 | 3300048904 | Bacteria | 2354 |
| 690 | Ga0496102_0166073 | 3300048905 | Bacteria | 2077 |
| 691 | Ga0496102_0251893 | 3300048905 | Bacteria | 1665 |
| 692 | Ga0496105_0000292 | 3300048908 | Bacteria | 33006 |
| 693 | Ga0496106_0052036 | 3300048909 | Bacteria | 3088 |
| 694 | Ga0496106_0122965 | 3300048909 | Bacteria | 2030 |
| 695 | Ga0496107_0024465 | 3300048910 | Bacteria | 4272 |
| 696 | Ga0496107_0290366 | 3300048910 | Bacteria | 1217 |
| 697 | Ga0496107_0332135 | 3300048910 | Bacteria | 1131 |
| 698 | Ga0496115_0000072 | 3300048918 | Bacteria | 91408 |
| 699 | Ga0496115_0004358 | 3300048918 | Bacteria | 10242 |
| 700 | Ga0496115_0095944 | 3300048918 | Bacteria | 2427 |
| 701 | Ga0496116_0088552 | 3300048919 | Bacteria | 1891 |
| 702 | Ga0496117_0012299 | 3300048920 | Bacteria | 7564 |
| 703 | Ga0496117_0026259 | 3300048920 | Bacteria | 4561 |
| 704 | Ga0496117_0027636 | 3300048920 | Bacteria | 4414 |
| 705 | Ga0496117_0083089 | 3300048920 | Bacteria | 2095 |
| 706 | Ga0496118_0000865 | 3300048921 | Bacteria | 47971 |
| 707 | Ga0496118_0001698 | 3300048921 | Bacteria | 32205 |
| 708 | Ga0496118_0003419 | 3300048921 | Bacteria | 20039 |
| 709 | Ga0496118_0007498 | 3300048921 | Bacteria | 11541 |
| 710 | Ga0496119_0000030 | 3300048922 | Bacteria | 240167 |
| 711 | Ga0496119_0002030 | 3300048922 | Bacteria | 22904 |
| 712 | Ga0496119_0260519 | 3300048922 | Bacteria | 870 |
| 713 | Ga0496120_0000015 | 3300048923 | Bacteria | 310795 |
| 714 | Ga0496120_0000033 | 3300048923 | Bacteria | 218355 |
| 715 | Ga0496120_0225709 | 3300048923 | Bacteria | 892 |
| 716 | Ga0496121_0000063 | 3300048924 | Bacteria | 273080 |
| 717 | Ga0496121_0000109 | 3300048924 | Bacteria | 187307 |
| 718 | Ga0496121_0000633 | 3300048924 | Bacteria | 65667 |
| 719 | Ga0496121_0000922 | 3300048924 | Bacteria | 53157 |
| 720 | Ga0496121_0002272 | 3300048924 | Bacteria | 29909 |
| 721 | Ga0496121_0018889 | 3300048924 | Bacteria | 6920 |
| 722 | Ga0496121_0059446 | 3300048924 | Bacteria | 3151 |
| 723 | Ga0496121_0065660 | 3300048924 | Bacteria | 2951 |
| 724 | Ga0496121_0108098 | 3300048924 | Bacteria | 2128 |
| 725 | Ga0496121_0131212 | 3300048924 | Bacteria | 1875 |
| 726 | Ga0496121_0251492 | 3300048924 | Bacteria | 1225 |
| 727 | Ga0496121_0263927 | 3300048924 | Bacteria | 1187 |
| 728 | Ga0496122_0006000 | 3300048925 | Bacteria | 14189 |
| 729 | Ga0496122_0025750 | 3300048925 | Bacteria | 5096 |
| 730 | Ga0496122_0073026 | 3300048925 | Bacteria | 2435 |
| 731 | Ga0496123_0005505 | 3300048926 | Bacteria | 12731 |
| 732 | Ga0496123_0030269 | 3300048926 | Bacteria | 3965 |
| 733 | Ga0496123_0192713 | 3300048926 | Bacteria | 1053 |
| 734 | Ga0496124_0000763 | 3300048927 | Bacteria | 52572 |
| 735 | Ga0496124_0005424 | 3300048927 | Bacteria | 14354 |
| 736 | Ga0496124_0095312 | 3300048927 | Bacteria | 2419 |
| 737 | Ga0496125_0000044 | 3300048928 | Bacteria | 296762 |
| 738 | Ga0496125_0001166 | 3300048928 | Bacteria | 39790 |
| 739 | Ga0496126_0001457 | 3300048929 | Bacteria | 36967 |
| 740 | Ga0496126_0004543 | 3300048929 | Bacteria | 16500 |
| 741 | Ga0496126_0007800 | 3300048929 | Bacteria | 11669 |
| 742 | Ga0496126_0050859 | 3300048929 | Bacteria | 3775 |
| 743 | Ga0496126_0096004 | 3300048929 | Bacteria | 2599 |
| 744 | Ga0496126_0378631 | 3300048929 | Bacteria | 1152 |
| 745 | Ga0496126_0490696 | 3300048929 | Bacteria | 983 |
| 746 | Ga0495678_000152 | 3300049459 | Bacteria | 83891 |
| 747 | Ga0495678_033497 | 3300049459 | Bacteria | 2120 |
| 748 | Ga0495682_0003681 | 3300049460 | Bacteria | 6759 |
| 749 | Ga0495682_0004504 | 3300049460 | Bacteria | 5944 |
| 750 | Ga0495682_0008410 | 3300049460 | Bacteria | 4063 |
| 751 | Ga0501298_023967 | 3300049521 | Bacteria | 1160 |
| 752 | Ga0501032_0063381 | 3300049569 | Bacteria | 2475 |
| 753 | Ga0501033_0147609 | 3300049570 | Bacteria | 1698 |
| 754 | Ga0501034_0351593 | 3300049571 | Bacteria | 1402 |
| 755 | Ga0501036_0023361 | 3300049572 | Bacteria | 5208 |
| 756 | Ga0501037_0030992 | 3300049573 | Bacteria | 3949 |
| 757 | Ga0501037_0089240 | 3300049573 | Bacteria | 2231 |
| 758 | Ga0501037_0113767 | 3300049573 | Bacteria | 1948 |
| 759 | Ga0501037_0145832 | 3300049573 | Bacteria | 1693 |
| 760 | Ga0501038_0008320 | 3300049574 | Bacteria | 9548 |
| 761 | Ga0501038_0195290 | 3300049574 | Bacteria | 1627 |
| 762 | Ga0501038_0252901 | 3300049574 | Bacteria | 1395 |
| 763 | Ga0501043_0097426 | 3300049579 | Bacteria | 2312 |
| 764 | Ga0501043_0374305 | 3300049579 | Bacteria | 1079 |
| 765 | Ga0501046_0253963 | 3300049580 | Bacteria | 1293 |
| 766 | Ga0501046_0352865 | 3300049580 | Bacteria | 1068 |
| 767 | Ga0501047_0078755 | 3300049581 | Bacteria | 3169 |
| 768 | Ga0501047_0150264 | 3300049581 | Bacteria | 2205 |
| 769 | Ga0501047_0301893 | 3300049581 | Bacteria | 1443 |
| 770 | Ga0501047_0323984 | 3300049581 | Bacteria | 1380 |
| 771 | Ga0501069_0054954 | 3300049585 | Bacteria | 2217 |
| 772 | Ga0501070_0006571 | 3300049586 | Bacteria | 9896 |
| 773 | Ga0501070_0025227 | 3300049586 | Bacteria | 4984 |
| 774 | Ga0501070_0033602 | 3300049586 | Bacteria | 4293 |
| 775 | Ga0501070_0155144 | 3300049586 | Bacteria | 1888 |
| 776 | Ga0501070_0166670 | 3300049586 | Bacteria | 1815 |
| 777 | Ga0501070_0376082 | 3300049586 | Bacteria | 1151 |
| 778 | Ga0501070_0447998 | 3300049586 | Bacteria | 1041 |
| 779 | Ga0501070_0672590 | 3300049586 | Bacteria | 820 |
| 780 | Ga0501071_0000682 | 3300049587 | Bacteria | 17738 |
| 781 | Ga0501071_0732020 | 3300049587 | Bacteria | 762 |
| 782 | Ga0501073_0003157 | 3300049589 | Bacteria | 12356 |
| 783 | Ga0501073_0125095 | 3300049589 | Bacteria | 1782 |
| 784 | Ga0501074_0000064 | 3300049590 | Bacteria | 50638 |
| 785 | Ga0501074_0015297 | 3300049590 | Bacteria | 5576 |
| 786 | Ga0501077_0028303 | 3300049593 | Bacteria | 3561 |
| 787 | Ga0501199_008637 | 3300049650 | Bacteria | 1070 |
| 788 | Ga0501079_0090092 | 3300049741 | Bacteria | 2376 |
| 789 | Ga0501079_0455174 | 3300049741 | Bacteria | 1005 |
| 790 | Ga0501079_0506862 | 3300049741 | Bacteria | 949 |
| 791 | Ga0501080_0000816 | 3300049742 | Bacteria | 25408 |
| 792 | Ga0501080_0022292 | 3300049742 | Bacteria | 5866 |
| 793 | Ga0501080_0081299 | 3300049742 | Bacteria | 3010 |
| 794 | Ga0501080_0618270 | 3300049742 | Bacteria | 960 |
| 795 | Ga0501035_0001993 | 3300049822 | Bacteria | 20407 |
| 796 | Ga0501035_0026002 | 3300049822 | Bacteria | 5361 |
| 797 | Ga0501035_0049805 | 3300049822 | Bacteria | 3754 |
| 798 | Ga0501035_0171146 | 3300049822 | Bacteria | 1876 |
| 799 | Ga0501035_0197599 | 3300049822 | Bacteria | 1726 |
| 800 | Ga0501044_0005303 | 3300049823 | Bacteria | 14336 |
| 801 | Ga0501044_0019098 | 3300049823 | Bacteria | 7338 |
| 802 | Ga0501044_0021274 | 3300049823 | Bacteria | 6924 |
| 803 | Ga0501044_0167382 | 3300049823 | Bacteria | 2171 |
| 804 | nmdc:mga07m45_49751_c1 | 3300050496 | Bacteria | 2360 |
| 805 | nmdc:mga08y16_225864_c1 | 3300050511 | Unclassified | 1937 |
| 806 | Ga0500643_000029 | 3300053087 | Bacteria | 211149 |
| 807 | Ga0500643_002345 | 3300053087 | Bacteria | 9893 |
| 808 | Ga0500646_0053849 | 3300053090 | Bacteria | 1167 |
| 809 | Ga0500555_000260 | 3300053103 | Bacteria | 23244 |
| 810 | Ga0500597_000371 | 3300053120 | Bacteria | 9331 |
| 811 | Ga0500633_0000233 | 3300053160 | Bacteria | 7951 |
| 812 | Ga0500634_0006547 | 3300053161 | Bacteria | 5650 |
| 813 | Ga0500645_000287 | 3300053730 | Bacteria | 36290 |
| 814 | Ga0466962_0001068 | 3300061719 | Bacteria | 12599 |
| 815 | Ga0466962_0009173 | 3300061719 | Bacteria | 4738 |
| 816 | Ga0466962_0011240 | 3300061719 | Bacteria | 4310 |
| 817 | Ga0466962_0068530 | 3300061719 | Bacteria | 1694 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005345 | Ga0070692_10136632 | Ga0070692_101366322 | 167 |
| 2 | 3300005844 | Ga0068862_100386074 | Ga0068862_1003860742 | 175 |
| 3 | 3300006844 | Ga0075428_100245945 | Ga0075428_1002459452 | 175 |
| 4 | 3300006846 | Ga0075430_100299149 | Ga0075430_1002991492 | 175 |
| 5 | 3300028380 | Ga0268265_10349700 | Ga0268265_103497002 | 175 |
| 6 | 3300005353 | Ga0070669_100028490 | Ga0070669_1000284903 | 176 |
| 7 | 3300005459 | Ga0068867_100253558 | Ga0068867_1002535582 | 176 |
| 8 | 3300005844 | Ga0068862_100133895 | Ga0068862_1001338952 | 176 |
| 9 | 3300009094 | Ga0111539_10093213 | Ga0111539_100932133 | 176 |
| 10 | 3300025923 | Ga0207681_10037105 | Ga0207681_100371053 | 176 |
| 11 | 3300025941 | Ga0207711_10923001 | Ga0207711_109230011 | 176 |
| 12 | 3300026089 | Ga0207648_10274219 | Ga0207648_102742192 | 176 |
| 13 | 3300028380 | Ga0268265_10363697 | Ga0268265_103636972 | 176 |
| 14 | 3300050511 | nmdc:mga08y16_225864_c1 | nmdc:mga08y16_225864_c1_1149_1766 | 176 |
| 15 | 3300001979 | JGI24740J21852_10011029 | JGI24740J21852_100110293 | 178 |
| 16 | 3300001979 | JGI24740J21852_10020598 | JGI24740J21852_100205981 | 178 |
| 17 | 3300001989 | JGI24739J22299_10001242 | JGI24739J22299_100012429 | 178 |
| 18 | 3300001990 | JGI24737J22298_10004305 | JGI24737J22298_100043054 | 178 |
| 19 | 3300002067 | JGI24735J21928_10009193 | JGI24735J21928_100091935 | 178 |
| 20 | 3300005455 | Ga0070663_100059399 | Ga0070663_1000593994 | 178 |
| 21 | 3300005563 | Ga0068855_100045182 | Ga0068855_1000451825 | 178 |
| 22 | 3300005577 | Ga0068857_100004884 | Ga0068857_1000048845 | 178 |
| 23 | 3300005834 | Ga0068851_10019857 | Ga0068851_100198572 | 178 |
| 24 | 3300005842 | Ga0068858_100119741 | Ga0068858_1001197413 | 178 |
| 25 | 3300009093 | Ga0105240_10038777 | Ga0105240_100387779 | 178 |
| 26 | 3300009174 | Ga0105241_10101948 | Ga0105241_101019485 | 178 |
| 27 | 3300009545 | Ga0105237_10000292 | Ga0105237_1000029247 | 178 |
| 28 | 3300012500 | Ga0157314_1000063 | Ga0157314_100006317 | 178 |
| 29 | 3300022467 | Ga0224712_10005613 | Ga0224712_100056136 | 178 |
| 30 | 3300025321 | Ga0207656_10009850 | Ga0207656_100098506 | 178 |
| 31 | 3300025913 | Ga0207695_10035270 | Ga0207695_100352705 | 178 |
| 32 | 3300026035 | Ga0207703_10278225 | Ga0207703_102782253 | 178 |
| 33 | 3300026067 | Ga0207678_10129015 | Ga0207678_101290152 | 178 |
| 34 | 3300026116 | Ga0207674_10008336 | Ga0207674_1000833613 | 178 |
| 35 | 3300048924 | Ga0496121_0018889 | Ga0496121_0018889_2815_3375 | 178 |
| 36 | 3300006353 | Ga0075370_10187359 | Ga0075370_101873592 | 186 |
| 37 | 3300037471 | Ga0395905_0252157 | Ga0395905_0252157_274_861 | 186 |
| 38 | 3300041496 | Ga0451839_1292742 | Ga0451839_1292742_120_746 | 186 |
| 39 | 3300050496 | nmdc:mga07m45_49751_c1 | nmdc:mga07m45_49751_c1_1316_1915 | 186 |
| 40 | 3300002773 | JGI25152J39213_1001511 | JGI25152J39213_10015117 | 187 |
| 41 | 3300003215 | JGI25153J46596_10001310 | JGI25153J46596_100013106 | 187 |
| 42 | 3300003323 | rootH1_10129136 | rootH1_101291364 | 187 |
| 43 | 3300003771 | Ga0055526_1010167 | Ga0055526_10101673 | 187 |
| 44 | 3300025245 | Ga0207425_1001356 | Ga0207425_10013563 | 187 |
| 45 | 3300025258 | Ga0209129_1000035 | Ga0209129_1000035164 | 187 |
| 46 | 3300025261 | Ga0209233_1031104 | Ga0209233_10311042 | 187 |
| 47 | 3300025263 | Ga0209565_1023712 | Ga0209565_10237122 | 187 |
| 48 | 3300025295 | Ga0209564_1000024 | Ga0209564_1000024358 | 187 |
| 49 | 3300025297 | Ga0209758_1000066 | Ga0209758_1000066154 | 187 |
| 50 | 3300025304 | Ga0209257_1026233 | Ga0209257_10262333 | 187 |
| 51 | 3300028794 | Ga0307515_10284519 | Ga0307515_102845192 | 188 |
| 52 | iso_pu_bacteria | 2818991440 | 2819566072 | 188 |
| 53 | iso_pu_bacteria | 2884338543 | 2884339229 | 188 |
| 54 | iso_pu_bacteria | 2904463128 | 2904466343 | 188 |
| 55 | iso_pu_bacteria | 2941471342 | 2941475496 | 188 |
| 56 | 3300013102 | Ga0157371_10093988 | Ga0157371_100939882 | 189 |
| 57 | 3300013104 | Ga0157370_10855558 | Ga0157370_108555581 | 189 |
| 58 | 3300049569 | Ga0501032_0063381 | Ga0501032_0063381_1561_2145 | 189 |
| 59 | 3300049570 | Ga0501033_0147609 | Ga0501033_0147609_461_1045 | 189 |
| 60 | 3300049573 | Ga0501037_0089240 | Ga0501037_0089240_1133_1717 | 189 |
| 61 | 3300049574 | Ga0501038_0008320 | Ga0501038_0008320_8262_8846 | 189 |
| 62 | 3300049581 | Ga0501047_0323984 | Ga0501047_0323984_509_1093 | 189 |
| 63 | 3300049586 | Ga0501070_0155144 | Ga0501070_0155144_1123_1707 | 189 |
| 64 | 3300049587 | Ga0501071_0732020 | Ga0501071_0732020_67_651 | 189 |
| 65 | 3300049822 | Ga0501035_0026002 | Ga0501035_0026002_4046_4630 | 189 |
| 66 | 3300049823 | Ga0501044_0019098 | Ga0501044_0019098_5443_6027 | 189 |
| 67 | iso_pu_bacteria | 8021622325 | 8021623531 | 189 |
| 68 | iso_pu_bacteria | 8021626552 | 8021629023 | 189 |
| 69 | iso_pu_bacteria | 8021648035 | 8021649925 | 189 |
| 70 | 3300006237 | Ga0097621_100262196 | Ga0097621_1002621961 | 190 |
| 71 | iso_pu_bacteria | 2593339238 | 2595447477 | 190 |
| 72 | iso_pu_bacteria | 2643221562 | 2643831214 | 190 |
| 73 | iso_pu_bacteria | 2718218334 | 2721025889 | 190 |
| 74 | iso_pu_bacteria | 2734482264 | 2735834147 | 190 |
| 75 | iso_pu_bacteria | 2738543009 | 2739225557 | 190 |
| 76 | iso_pu_bacteria | 2739367700 | 2739730451 | 190 |
| 77 | iso_pu_bacteria | 2818991457 | 2819663931 | 190 |
| 78 | iso_pu_bacteria | 2842914999 | 2842915480 | 190 |
| 79 | iso_pu_bacteria | 2842918807 | 2842920555 | 190 |
| 80 | iso_pu_bacteria | 2852684882 | 2852685697 | 190 |
| 81 | iso_pu_bacteria | 2884411467 | 2884413088 | 190 |
| 82 | iso_pu_bacteria | 2919130084 | 2919131837 | 190 |
| 83 | iso_pu_bacteria | 2928963466 | 2928964486 | 190 |
| 84 | iso_pu_bacteria | 2929195423 | 2929197792 | 190 |
| 85 | iso_pu_bacteria | 2939611941 | 2939613603 | 190 |
| 86 | iso_pu_bacteria | 2941489479 | 2941489770 | 190 |
| 87 | 3300002705 | JGI25156J39149_1012740 | JGI25156J39149_10127402 | 191 |
| 88 | 3300002741 | JGI25157J39369_1001478 | JGI25157J39369_10014782 | 191 |
| 89 | 3300003752 | Ga0055539_1000706 | Ga0055539_10007066 | 191 |
| 90 | 3300003756 | Ga0055533_1000373 | Ga0055533_10003737 | 191 |
| 91 | 3300003759 | Ga0055525_1000059 | Ga0055525_100005957 | 191 |
| 92 | 3300003760 | Ga0055527_1000050 | Ga0055527_100005058 | 191 |
| 93 | 3300003760 | Ga0055527_1000128 | Ga0055527_100012821 | 191 |
| 94 | 3300003761 | Ga0055535_1000119 | Ga0055535_100011939 | 191 |
| 95 | 3300003761 | Ga0055535_1000287 | Ga0055535_100028727 | 191 |
| 96 | 3300003761 | Ga0055535_1001844 | Ga0055535_10018448 | 191 |
| 97 | 3300003762 | Ga0055542_1000057 | Ga0055542_100005765 | 191 |
| 98 | 3300003762 | Ga0055542_1000119 | Ga0055542_100011958 | 191 |
| 99 | 3300003762 | Ga0055542_1000311 | Ga0055542_100031127 | 191 |
| 100 | 3300003763 | Ga0055529_1000329 | Ga0055529_100032921 | 191 |
| 101 | 3300003763 | Ga0055529_1000514 | Ga0055529_10005143 | 191 |
| 102 | 3300005337 | Ga0070682_100000659 | Ga0070682_10000065910 | 191 |
| 103 | 3300005339 | Ga0070660_100004295 | Ga0070660_1000042954 | 191 |
| 104 | 3300005366 | Ga0070659_100001016 | Ga0070659_10000101610 | 191 |
| 105 | 3300005455 | Ga0070663_100380499 | Ga0070663_1003804992 | 191 |
| 106 | 3300005458 | Ga0070681_10038625 | Ga0070681_100386255 | 191 |
| 107 | 3300005614 | Ga0068856_100000455 | Ga0068856_10000045526 | 191 |
| 108 | 3300013102 | Ga0157371_10050082 | Ga0157371_100500823 | 191 |
| 109 | 3300015261 | Ga0182006_1041976 | Ga0182006_10419763 | 191 |
| 110 | 3300025226 | Ga0209674_100026 | Ga0209674_100026161 | 191 |
| 111 | 3300025228 | Ga0209672_100007 | Ga0209672_100007762 | 191 |
| 112 | 3300025228 | Ga0209672_100017 | Ga0209672_100017292 | 191 |
| 113 | 3300025228 | Ga0209672_100412 | Ga0209672_10041220 | 191 |
| 114 | 3300025230 | Ga0209563_100074 | Ga0209563_100074115 | 191 |
| 115 | 3300025242 | Ga0209258_100017 | Ga0209258_10001758 | 191 |
| 116 | 3300025242 | Ga0209258_100038 | Ga0209258_10003820 | 191 |
| 117 | 3300025242 | Ga0209258_100144 | Ga0209258_10014474 | 191 |
| 118 | 3300025250 | Ga0209026_1000044 | Ga0209026_1000044131 | 191 |
| 119 | 3300025253 | Ga0209677_103542 | Ga0209677_1035423 | 191 |
| 120 | 3300025254 | Ga0209148_1000009 | Ga0209148_1000009920 | 191 |
| 121 | 3300025254 | Ga0209148_1000044 | Ga0209148_100004458 | 191 |
| 122 | 3300025254 | Ga0209148_1000141 | Ga0209148_100014163 | 191 |
| 123 | 3300025256 | Ga0209759_1000517 | Ga0209759_10005172 | 191 |
| 124 | 3300025272 | Ga0209455_1000010 | Ga0209455_1000010762 | 191 |
| 125 | 3300025272 | Ga0209455_1000032 | Ga0209455_1000032292 | 191 |
| 126 | 3300025272 | Ga0209455_1005134 | Ga0209455_10051343 | 191 |
| 127 | 3300025912 | Ga0207707_10019535 | Ga0207707_100195352 | 191 |
| 128 | 3300025919 | Ga0207657_10032347 | Ga0207657_100323474 | 191 |
| 129 | 3300025932 | Ga0207690_10004228 | Ga0207690_100042287 | 191 |
| 130 | 3300026067 | Ga0207678_10538969 | Ga0207678_105389692 | 191 |
| 131 | 3300026078 | Ga0207702_10002529 | Ga0207702_100025294 | 191 |
| 132 | 3300028800 | Ga0265338_10390956 | Ga0265338_103909562 | 191 |
| 133 | 3300031247 | Ga0265340_10014712 | Ga0265340_100147123 | 191 |
| 134 | 3300031247 | Ga0265340_10233119 | Ga0265340_102331192 | 191 |
| 135 | 3300031250 | Ga0265331_10083517 | Ga0265331_100835172 | 191 |
| 136 | 3300037312 | Ga0395899_0000062 | Ga0395899_0000062_200275_200856 | 191 |
| 137 | 3300037418 | Ga0395900_0000039 | Ga0395900_0000039_92364_92945 | 191 |
| 138 | 3300037466 | Ga0395898_0000140 | Ga0395898_0000140_10490_11071 | 191 |
| 139 | 3300044536 | Ga0466988_0162073 | Ga0466988_0162073_244_834 | 191 |
| 140 | 3300044656 | Ga0466969_0002237 | Ga0466969_0002237_4776_5366 | 191 |
| 141 | 3300044656 | Ga0466969_0075315 | Ga0466969_0075315_1008_1589 | 191 |
| 142 | 3300044683 | Ga0466965_0002578 | Ga0466965_0002578_2679_3260 | 191 |
| 143 | 3300044684 | Ga0466966_0002292 | Ga0466966_0002292_11862_12443 | 191 |
| 144 | 3300044684 | Ga0466966_0015333 | Ga0466966_0015333_4466_5056 | 191 |
| 145 | 3300044693 | Ga0466961_0002335 | Ga0466961_0002335_1627_2208 | 191 |
| 146 | 3300044693 | Ga0466961_0002655 | Ga0466961_0002655_5495_6085 | 191 |
| 147 | 3300044693 | Ga0466961_0003660 | Ga0466961_0003660_4259_4840 | 191 |
| 148 | 3300044693 | Ga0466961_0094923 | Ga0466961_0094923_258_839 | 191 |
| 149 | 3300044693 | Ga0466961_0227073 | Ga0466961_0227073_29_610 | 191 |
| 150 | 3300044694 | Ga0466963_0093523 | Ga0466963_0093523_144_725 | 191 |
| 151 | 3300044719 | Ga0466971_0013101 | Ga0466971_0013101_1093_1674 | 191 |
| 152 | 3300044719 | Ga0466971_0316907 | Ga0466971_0316907_15_596 | 191 |
| 153 | 3300044765 | Ga0466970_0000163 | Ga0466970_0000163_23218_23799 | 191 |
| 154 | 3300044765 | Ga0466970_0479993 | Ga0466970_0479993_105_686 | 191 |
| 155 | 3300044842 | Ga0466957_0035438 | Ga0466957_0035438_1211_1792 | 191 |
| 156 | 3300045049 | Ga0466959_0000383 | Ga0466959_0000383_3898_4479 | 191 |
| 157 | 3300045049 | Ga0466959_0008445 | Ga0466959_0008445_297_878 | 191 |
| 158 | 3300045049 | Ga0466959_0026648 | Ga0466959_0026648_2216_2797 | 191 |
| 159 | 3300045836 | Ga0466958_0006626 | Ga0466958_0006626_1049_1630 | 191 |
| 160 | 3300045836 | Ga0466958_0016066 | Ga0466958_0016066_2723_3304 | 191 |
| 161 | 3300045836 | Ga0466958_0097079 | Ga0466958_0097079_568_1149 | 191 |
| 162 | 3300045976 | Ga0466967_0345550 | Ga0466967_0345550_640_1221 | 191 |
| 163 | 3300049521 | Ga0501298_023967 | Ga0501298_023967_424_1017 | 191 |
| 164 | 3300049650 | Ga0501199_008637 | Ga0501199_008637_11_604 | 191 |
| 165 | 3300061719 | Ga0466962_0001068 | Ga0466962_0001068_11312_11893 | 191 |
| 166 | 3300061719 | Ga0466962_0011240 | Ga0466962_0011240_2283_2873 | 191 |
| 167 | 3300061719 | Ga0466962_0068530 | Ga0466962_0068530_1020_1601 | 191 |
| 168 | iso_pu_bacteria | 2747842501 | 2748015665 | 191 |
| 169 | 3300001904 | JGI24736J21556_1002320 | JGI24736J21556_10023201 | 192 |
| 170 | 3300001915 | JGI24741J21665_1034746 | JGI24741J21665_10347461 | 192 |
| 171 | 3300001979 | JGI24740J21852_10000025 | JGI24740J21852_1000002534 | 192 |
| 172 | 3300001989 | JGI24739J22299_10000022 | JGI24739J22299_1000002229 | 192 |
| 173 | 3300001990 | JGI24737J22298_10003356 | JGI24737J22298_100033565 | 192 |
| 174 | 3300002067 | JGI24735J21928_10054048 | JGI24735J21928_100540482 | 192 |
| 175 | 3300002075 | JGI24738J21930_10000095 | JGI24738J21930_1000009510 | 192 |
| 176 | 3300002705 | JGI25156J39149_1004438 | JGI25156J39149_10044382 | 192 |
| 177 | 3300002737 | JGI25162J39368_1000018 | JGI25162J39368_1000018143 | 192 |
| 178 | 3300002737 | JGI25162J39368_1000567 | JGI25162J39368_10005679 | 192 |
| 179 | 3300002737 | JGI25162J39368_1000594 | JGI25162J39368_100059426 | 192 |
| 180 | 3300002738 | JGI25154J39366_1004513 | JGI25154J39366_10045133 | 192 |
| 181 | 3300002741 | JGI25157J39369_1000011 | JGI25157J39369_100001145 | 192 |
| 182 | 3300002741 | JGI25157J39369_1001115 | JGI25157J39369_10011157 | 192 |
| 183 | 3300002741 | JGI25157J39369_1001590 | JGI25157J39369_10015904 | 192 |
| 184 | 3300002771 | JGI25163J39215_1000291 | JGI25163J39215_100029112 | 192 |
| 185 | 3300002771 | JGI25163J39215_1000356 | JGI25163J39215_100035613 | 192 |
| 186 | 3300002772 | JGI25164J39214_1000007 | JGI25164J39214_1000007143 | 192 |
| 187 | 3300002772 | JGI25164J39214_1000198 | JGI25164J39214_100019829 | 192 |
| 188 | 3300002772 | JGI25164J39214_1003959 | JGI25164J39214_10039593 | 192 |
| 189 | 3300003214 | JGI25165J46597_1000029 | JGI25165J46597_1000029144 | 192 |
| 190 | 3300003214 | JGI25165J46597_1000354 | JGI25165J46597_100035429 | 192 |
| 191 | 3300003215 | JGI25153J46596_10008411 | JGI25153J46596_100084114 | 192 |
| 192 | 3300003320 | rootH2_10115902 | rootH2_101159021 | 192 |
| 193 | 3300003322 | rootL2_10061659 | rootL2_100616593 | 192 |
| 194 | 3300003322 | rootL2_10241063 | rootL2_102410633 | 192 |
| 195 | 3300003323 | rootH1_10111193 | rootH1_101111933 | 192 |
| 196 | 3300003323 | rootH1_10203752 | rootH1_102037525 | 192 |
| 197 | 3300003578 | Ga0006562J51391_1062436 | Ga0006562J51391_10624365 | 192 |
| 198 | 3300003578 | Ga0006562J51391_1062438 | Ga0006562J51391_10624383 | 192 |
| 199 | 3300003751 | Ga0055538_1001241 | Ga0055538_10012414 | 192 |
| 200 | 3300003760 | Ga0055527_1006447 | Ga0055527_10064471 | 192 |
| 201 | 3300003761 | Ga0055535_1000025 | Ga0055535_100002549 | 192 |
| 202 | 3300003761 | Ga0055535_1000295 | Ga0055535_100029526 | 192 |
| 203 | 3300003762 | Ga0055542_1000024 | Ga0055542_1000024143 | 192 |
| 204 | 3300003762 | Ga0055542_1000082 | Ga0055542_100008223 | 192 |
| 205 | 3300003762 | Ga0055542_1000180 | Ga0055542_10001809 | 192 |
| 206 | 3300003763 | Ga0055529_1000029 | Ga0055529_1000029143 | 192 |
| 207 | 3300003763 | Ga0055529_1000049 | Ga0055529_100004955 | 192 |
| 208 | 3300003763 | Ga0055529_1021040 | Ga0055529_10210402 | 192 |
| 209 | 3300003841 | Ga0055541_1019038 | Ga0055541_10190381 | 192 |
| 210 | 3300003856 | Ga0058692_1000029 | Ga0058692_1000029107 | 192 |
| 211 | 3300005262 | Ga0065165_1000653 | Ga0065165_10006538 | 192 |
| 212 | 3300005262 | Ga0065165_1002406 | Ga0065165_10024065 | 192 |
| 213 | 3300005327 | Ga0070658_10006547 | Ga0070658_100065474 | 192 |
| 214 | 3300005327 | Ga0070658_10082190 | Ga0070658_100821902 | 192 |
| 215 | 3300005329 | Ga0070683_100575992 | Ga0070683_1005759922 | 192 |
| 216 | 3300005331 | Ga0070670_100453862 | Ga0070670_1004538622 | 192 |
| 217 | 3300005335 | Ga0070666_10000001 | Ga0070666_10000001234 | 192 |
| 218 | 3300005336 | Ga0070680_100000627 | Ga0070680_1000006276 | 192 |
| 219 | 3300005336 | Ga0070680_100001693 | Ga0070680_10000169318 | 192 |
| 220 | 3300005337 | Ga0070682_100001204 | Ga0070682_1000012048 | 192 |
| 221 | 3300005337 | Ga0070682_100015698 | Ga0070682_1000156983 | 192 |
| 222 | 3300005337 | Ga0070682_100020889 | Ga0070682_1000208894 | 192 |
| 223 | 3300005337 | Ga0070682_100119907 | Ga0070682_1001199072 | 192 |
| 224 | 3300005339 | Ga0070660_100193727 | Ga0070660_1001937272 | 192 |
| 225 | 3300005339 | Ga0070660_100340277 | Ga0070660_1003402772 | 192 |
| 226 | 3300005339 | Ga0070660_100425709 | Ga0070660_1004257092 | 192 |
| 227 | 3300005340 | Ga0070689_100002151 | Ga0070689_10000215112 | 192 |
| 228 | 3300005341 | Ga0070691_10011476 | Ga0070691_100114763 | 192 |
| 229 | 3300005344 | Ga0070661_100002927 | Ga0070661_1000029278 | 192 |
| 230 | 3300005344 | Ga0070661_100004341 | Ga0070661_1000043414 | 192 |
| 231 | 3300005344 | Ga0070661_100011343 | Ga0070661_1000113438 | 192 |
| 232 | 3300005344 | Ga0070661_100019995 | Ga0070661_1000199953 | 192 |
| 233 | 3300005344 | Ga0070661_100070367 | Ga0070661_1000703673 | 192 |
| 234 | 3300005344 | Ga0070661_100139879 | Ga0070661_1001398792 | 192 |
| 235 | 3300005344 | Ga0070661_100357199 | Ga0070661_1003571991 | 192 |
| 236 | 3300005345 | Ga0070692_10006380 | Ga0070692_100063803 | 192 |
| 237 | 3300005345 | Ga0070692_10050482 | Ga0070692_100504823 | 192 |
| 238 | 3300005347 | Ga0070668_100255069 | Ga0070668_1002550692 | 192 |
| 239 | 3300005347 | Ga0070668_100553881 | Ga0070668_1005538812 | 192 |
| 240 | 3300005365 | Ga0070688_100007703 | Ga0070688_1000077032 | 192 |
| 241 | 3300005366 | Ga0070659_100044182 | Ga0070659_1000441822 | 192 |
| 242 | 3300005366 | Ga0070659_100100599 | Ga0070659_1001005994 | 192 |
| 243 | 3300005366 | Ga0070659_100283617 | Ga0070659_1002836172 | 192 |
| 244 | 3300005366 | Ga0070659_100326010 | Ga0070659_1003260101 | 192 |
| 245 | 3300005367 | Ga0070667_100286557 | Ga0070667_1002865572 | 192 |
| 246 | 3300005435 | Ga0070714_100000055 | Ga0070714_10000005568 | 192 |
| 247 | 3300005435 | Ga0070714_100001542 | Ga0070714_1000015427 | 192 |
| 248 | 3300005439 | Ga0070711_100458618 | Ga0070711_1004586182 | 192 |
| 249 | 3300005455 | Ga0070663_100013140 | Ga0070663_1000131405 | 192 |
| 250 | 3300005455 | Ga0070663_100016945 | Ga0070663_1000169455 | 192 |
| 251 | 3300005455 | Ga0070663_100049637 | Ga0070663_1000496373 | 192 |
| 252 | 3300005455 | Ga0070663_100096149 | Ga0070663_1000961492 | 192 |
| 253 | 3300005455 | Ga0070663_100142980 | Ga0070663_1001429802 | 192 |
| 254 | 3300005455 | Ga0070663_100419214 | Ga0070663_1004192142 | 192 |
| 255 | 3300005455 | Ga0070663_100611877 | Ga0070663_1006118771 | 192 |
| 256 | 3300005457 | Ga0070662_100002882 | Ga0070662_1000028827 | 192 |
| 257 | 3300005457 | Ga0070662_100055312 | Ga0070662_1000553124 | 192 |
| 258 | 3300005457 | Ga0070662_100171934 | Ga0070662_1001719342 | 192 |
| 259 | 3300005458 | Ga0070681_10000076 | Ga0070681_1000007635 | 192 |
| 260 | 3300005458 | Ga0070681_10000082 | Ga0070681_1000008216 | 192 |
| 261 | 3300005458 | Ga0070681_10001769 | Ga0070681_100017693 | 192 |
| 262 | 3300005458 | Ga0070681_10002020 | Ga0070681_100020206 | 192 |
| 263 | 3300005458 | Ga0070681_10019691 | Ga0070681_100196918 | 192 |
| 264 | 3300005458 | Ga0070681_10139828 | Ga0070681_101398283 | 192 |
| 265 | 3300005466 | Ga0070685_10003104 | Ga0070685_100031047 | 192 |
| 266 | 3300005530 | Ga0070679_100000150 | Ga0070679_10000015014 | 192 |
| 267 | 3300005530 | Ga0070679_100002690 | Ga0070679_10000269018 | 192 |
| 268 | 3300005530 | Ga0070679_100038896 | Ga0070679_1000388963 | 192 |
| 269 | 3300005530 | Ga0070679_100331383 | Ga0070679_1003313831 | 192 |
| 270 | 3300005539 | Ga0068853_100026573 | Ga0068853_1000265733 | 192 |
| 271 | 3300005539 | Ga0068853_100050144 | Ga0068853_1000501443 | 192 |
| 272 | 3300005539 | Ga0068853_100077903 | Ga0068853_1000779033 | 192 |
| 273 | 3300005539 | Ga0068853_100080474 | Ga0068853_1000804741 | 192 |
| 274 | 3300005546 | Ga0070696_100006301 | Ga0070696_1000063018 | 192 |
| 275 | 3300005546 | Ga0070696_100007828 | Ga0070696_1000078285 | 192 |
| 276 | 3300005546 | Ga0070696_100039568 | Ga0070696_1000395683 | 192 |
| 277 | 3300005546 | Ga0070696_100078297 | Ga0070696_1000782972 | 192 |
| 278 | 3300005546 | Ga0070696_100135184 | Ga0070696_1001351843 | 192 |
| 279 | 3300005546 | Ga0070696_100151582 | Ga0070696_1001515822 | 192 |
| 280 | 3300005547 | Ga0070693_100002312 | Ga0070693_1000023126 | 192 |
| 281 | 3300005547 | Ga0070693_100215864 | Ga0070693_1002158642 | 192 |
| 282 | 3300005547 | Ga0070693_100268260 | Ga0070693_1002682601 | 192 |
| 283 | 3300005548 | Ga0070665_100004680 | Ga0070665_1000046804 | 192 |
| 284 | 3300005563 | Ga0068855_100008081 | Ga0068855_1000080818 | 192 |
| 285 | 3300005563 | Ga0068855_100028324 | Ga0068855_1000283243 | 192 |
| 286 | 3300005563 | Ga0068855_100029024 | Ga0068855_1000290242 | 192 |
| 287 | 3300005563 | Ga0068855_100059762 | Ga0068855_1000597623 | 192 |
| 288 | 3300005563 | Ga0068855_100068677 | Ga0068855_1000686773 | 192 |
| 289 | 3300005563 | Ga0068855_100098070 | Ga0068855_1000980703 | 192 |
| 290 | 3300005563 | Ga0068855_100330629 | Ga0068855_1003306292 | 192 |
| 291 | 3300005577 | Ga0068857_100000491 | Ga0068857_10000049116 | 192 |
| 292 | 3300005577 | Ga0068857_100006493 | Ga0068857_10000649310 | 192 |
| 293 | 3300005577 | Ga0068857_100008883 | Ga0068857_1000088837 | 192 |
| 294 | 3300005577 | Ga0068857_100041984 | Ga0068857_1000419842 | 192 |
| 295 | 3300005577 | Ga0068857_100050181 | Ga0068857_1000501813 | 192 |
| 296 | 3300005577 | Ga0068857_100097524 | Ga0068857_1000975243 | 192 |
| 297 | 3300005578 | Ga0068854_100000046 | Ga0068854_10000004666 | 192 |
| 298 | 3300005578 | Ga0068854_100000553 | Ga0068854_1000005533 | 192 |
| 299 | 3300005578 | Ga0068854_100006463 | Ga0068854_1000064633 | 192 |
| 300 | 3300005578 | Ga0068854_100095604 | Ga0068854_1000956042 | 192 |
| 301 | 3300005614 | Ga0068856_100000920 | Ga0068856_1000009209 | 192 |
| 302 | 3300005614 | Ga0068856_100092872 | Ga0068856_1000928722 | 192 |
| 303 | 3300005614 | Ga0068856_100197240 | Ga0068856_1001972403 | 192 |
| 304 | 3300005614 | Ga0068856_100351172 | Ga0068856_1003511722 | 192 |
| 305 | 3300005616 | Ga0068852_100027789 | Ga0068852_1000277894 | 192 |
| 306 | 3300005616 | Ga0068852_100031022 | Ga0068852_1000310224 | 192 |
| 307 | 3300005616 | Ga0068852_100041326 | Ga0068852_1000413263 | 192 |
| 308 | 3300005616 | Ga0068852_100073063 | Ga0068852_1000730633 | 192 |
| 309 | 3300005616 | Ga0068852_100128436 | Ga0068852_1001284363 | 192 |
| 310 | 3300005617 | Ga0068859_100058280 | Ga0068859_1000582804 | 192 |
| 311 | 3300005834 | Ga0068851_10009883 | Ga0068851_100098832 | 192 |
| 312 | 3300005842 | Ga0068858_100076311 | Ga0068858_1000763114 | 192 |
| 313 | 3300005842 | Ga0068858_100124197 | Ga0068858_1001241973 | 192 |
| 314 | 3300005843 | Ga0068860_100012176 | Ga0068860_1000121763 | 192 |
| 315 | 3300005843 | Ga0068860_100030058 | Ga0068860_1000300583 | 192 |
| 316 | 3300006175 | Ga0070712_100379513 | Ga0070712_1003795132 | 192 |
| 317 | 3300006931 | Ga0097620_100058280 | Ga0097620_1000582803 | 192 |
| 318 | 3300009093 | Ga0105240_10000034 | Ga0105240_1000003455 | 192 |
| 319 | 3300009093 | Ga0105240_10000115 | Ga0105240_1000011522 | 192 |
| 320 | 3300009093 | Ga0105240_10002188 | Ga0105240_1000218810 | 192 |
| 321 | 3300009093 | Ga0105240_10023081 | Ga0105240_100230817 | 192 |
| 322 | 3300009093 | Ga0105240_10055731 | Ga0105240_100557314 | 192 |
| 323 | 3300009093 | Ga0105240_10096528 | Ga0105240_100965283 | 192 |
| 324 | 3300009093 | Ga0105240_10180600 | Ga0105240_101806003 | 192 |
| 325 | 3300009093 | Ga0105240_11158244 | Ga0105240_111582441 | 192 |
| 326 | 3300009101 | Ga0105247_10018919 | Ga0105247_100189192 | 192 |
| 327 | 3300009174 | Ga0105241_10071434 | Ga0105241_100714343 | 192 |
| 328 | 3300009174 | Ga0105241_10102134 | Ga0105241_101021343 | 192 |
| 329 | 3300009545 | Ga0105237_10000016 | Ga0105237_1000001657 | 192 |
| 330 | 3300009545 | Ga0105237_10000371 | Ga0105237_1000037140 | 192 |
| 331 | 3300009545 | Ga0105237_10022992 | Ga0105237_100229925 | 192 |
| 332 | 3300009545 | Ga0105237_10395027 | Ga0105237_103950272 | 192 |
| 333 | 3300009545 | Ga0105237_10899028 | Ga0105237_108990282 | 192 |
| 334 | 3300009551 | Ga0105238_10000513 | Ga0105238_1000051331 | 192 |
| 335 | 3300009551 | Ga0105238_10004930 | Ga0105238_100049306 | 192 |
| 336 | 3300009551 | Ga0105238_10014761 | Ga0105238_100147613 | 192 |
| 337 | 3300009551 | Ga0105238_10114787 | Ga0105238_101147874 | 192 |
| 338 | 3300009551 | Ga0105238_10222523 | Ga0105238_102225234 | 192 |
| 339 | 3300009551 | Ga0105238_10484842 | Ga0105238_104848422 | 192 |
| 340 | 3300010375 | Ga0105239_10000028 | Ga0105239_10000028186 | 192 |
| 341 | 3300010375 | Ga0105239_10022879 | Ga0105239_100228796 | 192 |
| 342 | 3300010375 | Ga0105239_10224363 | Ga0105239_102243632 | 192 |
| 343 | 3300013100 | Ga0157373_10004360 | Ga0157373_1000436011 | 192 |
| 344 | 3300013100 | Ga0157373_10011828 | Ga0157373_100118284 | 192 |
| 345 | 3300013100 | Ga0157373_10013694 | Ga0157373_100136942 | 192 |
| 346 | 3300013100 | Ga0157373_10057998 | Ga0157373_100579983 | 192 |
| 347 | 3300013100 | Ga0157373_10099316 | Ga0157373_100993162 | 192 |
| 348 | 3300013100 | Ga0157373_10251251 | Ga0157373_102512512 | 192 |
| 349 | 3300013100 | Ga0157373_10461128 | Ga0157373_104611282 | 192 |
| 350 | 3300013102 | Ga0157371_10012309 | Ga0157371_100123095 | 192 |
| 351 | 3300013102 | Ga0157371_10020425 | Ga0157371_100204255 | 192 |
| 352 | 3300013102 | Ga0157371_10022989 | Ga0157371_100229895 | 192 |
| 353 | 3300013102 | Ga0157371_10029872 | Ga0157371_100298724 | 192 |
| 354 | 3300013102 | Ga0157371_10059351 | Ga0157371_100593514 | 192 |
| 355 | 3300013102 | Ga0157371_10270923 | Ga0157371_102709232 | 192 |
| 356 | 3300013104 | Ga0157370_10007212 | Ga0157370_1000721210 | 192 |
| 357 | 3300013104 | Ga0157370_10009789 | Ga0157370_100097894 | 192 |
| 358 | 3300013104 | Ga0157370_10011801 | Ga0157370_100118018 | 192 |
| 359 | 3300013104 | Ga0157370_10044317 | Ga0157370_100443173 | 192 |
| 360 | 3300013104 | Ga0157370_10047443 | Ga0157370_100474432 | 192 |
| 361 | 3300013104 | Ga0157370_10097411 | Ga0157370_100974112 | 192 |
| 362 | 3300013104 | Ga0157370_10103285 | Ga0157370_101032853 | 192 |
| 363 | 3300013104 | Ga0157370_10107394 | Ga0157370_101073942 | 192 |
| 364 | 3300013104 | Ga0157370_10263870 | Ga0157370_102638701 | 192 |
| 365 | 3300013105 | Ga0157369_10001146 | Ga0157369_1000114619 | 192 |
| 366 | 3300013105 | Ga0157369_10006957 | Ga0157369_1000695711 | 192 |
| 367 | 3300013105 | Ga0157369_10010587 | Ga0157369_100105877 | 192 |
| 368 | 3300013105 | Ga0157369_10018469 | Ga0157369_100184692 | 192 |
| 369 | 3300013105 | Ga0157369_10067314 | Ga0157369_100673142 | 192 |
| 370 | 3300013105 | Ga0157369_10087141 | Ga0157369_100871414 | 192 |
| 371 | 3300013105 | Ga0157369_10575070 | Ga0157369_105750702 | 192 |
| 372 | 3300013306 | Ga0163162_10001591 | Ga0163162_1000159120 | 192 |
| 373 | 3300013306 | Ga0163162_10051171 | Ga0163162_100511715 | 192 |
| 374 | 3300013307 | Ga0157372_10010749 | Ga0157372_100107496 | 192 |
| 375 | 3300013307 | Ga0157372_10033446 | Ga0157372_100334465 | 192 |
| 376 | 3300013307 | Ga0157372_10039362 | Ga0157372_100393624 | 192 |
| 377 | 3300013307 | Ga0157372_10066986 | Ga0157372_100669864 | 192 |
| 378 | 3300013307 | Ga0157372_10147519 | Ga0157372_101475192 | 192 |
| 379 | 3300013307 | Ga0157372_10183051 | Ga0157372_101830512 | 192 |
| 380 | 3300013307 | Ga0157372_10237491 | Ga0157372_102374912 | 192 |
| 381 | 3300013307 | Ga0157372_10370452 | Ga0157372_103704522 | 192 |
| 382 | 3300014497 | Ga0182008_10015782 | Ga0182008_100157824 | 192 |
| 383 | 3300014497 | Ga0182008_10048243 | Ga0182008_100482433 | 192 |
| 384 | 3300014497 | Ga0182008_10062622 | Ga0182008_100626222 | 192 |
| 385 | 3300014497 | Ga0182008_10105886 | Ga0182008_101058862 | 192 |
| 386 | 3300014497 | Ga0182008_10109647 | Ga0182008_101096472 | 192 |
| 387 | 3300014497 | Ga0182008_10305399 | Ga0182008_103053992 | 192 |
| 388 | 3300015261 | Ga0182006_1000061 | Ga0182006_1000061111 | 192 |
| 389 | 3300015261 | Ga0182006_1007237 | Ga0182006_10072374 | 192 |
| 390 | 3300015261 | Ga0182006_1012331 | Ga0182006_10123312 | 192 |
| 391 | 3300015261 | Ga0182006_1037503 | Ga0182006_10375033 | 192 |
| 392 | 3300015262 | Ga0182007_10005804 | Ga0182007_100058047 | 192 |
| 393 | 3300015262 | Ga0182007_10009625 | Ga0182007_100096254 | 192 |
| 394 | 3300015262 | Ga0182007_10011279 | Ga0182007_100112793 | 192 |
| 395 | 3300015265 | Ga0182005_1001560 | Ga0182005_10015606 | 192 |
| 396 | 3300015265 | Ga0182005_1003115 | Ga0182005_10031153 | 192 |
| 397 | 3300015685 | Ga0183369_1004 | Ga0183369_1004438 | 192 |
| 398 | 3300015689 | Ga0183360_10001 | Ga0183360_100012441 | 192 |
| 399 | 3300017792 | Ga0163161_10046760 | Ga0163161_100467603 | 192 |
| 400 | 3300017792 | Ga0163161_10065114 | Ga0163161_100651143 | 192 |
| 401 | 3300020069 | Ga0197907_10080030 | Ga0197907_100800306 | 192 |
| 402 | 3300020069 | Ga0197907_10217144 | Ga0197907_102171443 | 192 |
| 403 | 3300020070 | Ga0206356_10379243 | Ga0206356_103792432 | 192 |
| 404 | 3300020070 | Ga0206356_10546730 | Ga0206356_105467303 | 192 |
| 405 | 3300020075 | Ga0206349_1686371 | Ga0206349_16863712 | 192 |
| 406 | 3300020076 | Ga0206355_1394520 | Ga0206355_13945201 | 192 |
| 407 | 3300020078 | Ga0206352_10220409 | Ga0206352_102204093 | 192 |
| 408 | 3300020078 | Ga0206352_10962774 | Ga0206352_109627741 | 192 |
| 409 | 3300020080 | Ga0206350_10303956 | Ga0206350_103039561 | 192 |
| 410 | 3300020081 | Ga0206354_10121428 | Ga0206354_101214283 | 192 |
| 411 | 3300020081 | Ga0206354_10883312 | Ga0206354_108833128 | 192 |
| 412 | 3300020081 | Ga0206354_11113808 | Ga0206354_111138084 | 192 |
| 413 | 3300020081 | Ga0206354_11431445 | Ga0206354_114314453 | 192 |
| 414 | 3300020082 | Ga0206353_10063786 | Ga0206353_100637862 | 192 |
| 415 | 3300020082 | Ga0206353_11738411 | Ga0206353_117384113 | 192 |
| 416 | 3300020082 | Ga0206353_11944126 | Ga0206353_119441262 | 192 |
| 417 | 3300020082 | Ga0206353_11975562 | Ga0206353_119755622 | 192 |
| 418 | 3300020610 | Ga0154015_1139938 | Ga0154015_11399383 | 192 |
| 419 | 3300020610 | Ga0154015_1183830 | Ga0154015_11838301 | 192 |
| 420 | 3300020610 | Ga0154015_1595600 | Ga0154015_15956003 | 192 |
| 421 | 3300020610 | Ga0154015_1641253 | Ga0154015_16412532 | 192 |
| 422 | 3300022467 | Ga0224712_10037405 | Ga0224712_100374053 | 192 |
| 423 | 3300022467 | Ga0224712_10178530 | Ga0224712_101785302 | 192 |
| 424 | 3300025207 | Ga0209760_100384 | Ga0209760_10038411 | 192 |
| 425 | 3300025224 | Ga0209784_100026 | Ga0209784_100026132 | 192 |
| 426 | 3300025225 | Ga0209566_103460 | Ga0209566_1034602 | 192 |
| 427 | 3300025226 | Ga0209674_101816 | Ga0209674_1018161 | 192 |
| 428 | 3300025228 | Ga0209672_100239 | Ga0209672_1002392 | 192 |
| 429 | 3300025228 | Ga0209672_101232 | Ga0209672_10123210 | 192 |
| 430 | 3300025231 | Ga0207427_100023 | Ga0207427_100023132 | 192 |
| 431 | 3300025231 | Ga0207427_100213 | Ga0207427_10021321 | 192 |
| 432 | 3300025231 | Ga0207427_104431 | Ga0207427_1044313 | 192 |
| 433 | 3300025231 | Ga0207427_106434 | Ga0207427_1064342 | 192 |
| 434 | 3300025233 | Ga0209437_100069 | Ga0209437_100069130 | 192 |
| 435 | 3300025233 | Ga0209437_100194 | Ga0209437_10019492 | 192 |
| 436 | 3300025233 | Ga0209437_100381 | Ga0209437_10038128 | 192 |
| 437 | 3300025233 | Ga0209437_100838 | Ga0209437_1008385 | 192 |
| 438 | 3300025242 | Ga0209258_100059 | Ga0209258_100059132 | 192 |
| 439 | 3300025242 | Ga0209258_100118 | Ga0209258_10011835 | 192 |
| 440 | 3300025242 | Ga0209258_100635 | Ga0209258_10063516 | 192 |
| 441 | 3300025242 | Ga0209258_102018 | Ga0209258_1020182 | 192 |
| 442 | 3300025246 | Ga0209646_1000264 | Ga0209646_100026423 | 192 |
| 443 | 3300025246 | Ga0209646_1001043 | Ga0209646_10010438 | 192 |
| 444 | 3300025246 | Ga0209646_1001117 | Ga0209646_10011177 | 192 |
| 445 | 3300025250 | Ga0209026_1000036 | Ga0209026_1000036121 | 192 |
| 446 | 3300025250 | Ga0209026_1000191 | Ga0209026_100019145 | 192 |
| 447 | 3300025250 | Ga0209026_1000785 | Ga0209026_10007857 | 192 |
| 448 | 3300025250 | Ga0209026_1005549 | Ga0209026_10055494 | 192 |
| 449 | 3300025254 | Ga0209148_1000002 | Ga0209148_10000021634 | 192 |
| 450 | 3300025254 | Ga0209148_1000010 | Ga0209148_1000010131 | 192 |
| 451 | 3300025254 | Ga0209148_1000024 | Ga0209148_1000024320 | 192 |
| 452 | 3300025254 | Ga0209148_1000706 | Ga0209148_100070623 | 192 |
| 453 | 3300025256 | Ga0209759_1000023 | Ga0209759_100002342 | 192 |
| 454 | 3300025256 | Ga0209759_1000779 | Ga0209759_100077914 | 192 |
| 455 | 3300025256 | Ga0209759_1001117 | Ga0209759_100111711 | 192 |
| 456 | 3300025256 | Ga0209759_1014477 | Ga0209759_10144772 | 192 |
| 457 | 3300025258 | Ga0209129_1001844 | Ga0209129_100184410 | 192 |
| 458 | 3300025261 | Ga0209233_1000009 | Ga0209233_10000091040 | 192 |
| 459 | 3300025261 | Ga0209233_1000323 | Ga0209233_100032321 | 192 |
| 460 | 3300025261 | Ga0209233_1014309 | Ga0209233_10143092 | 192 |
| 461 | 3300025261 | Ga0209233_1015779 | Ga0209233_10157792 | 192 |
| 462 | 3300025263 | Ga0209565_1002154 | Ga0209565_10021547 | 192 |
| 463 | 3300025272 | Ga0209455_1000020 | Ga0209455_1000020472 | 192 |
| 464 | 3300025272 | Ga0209455_1000025 | Ga0209455_1000025320 | 192 |
| 465 | 3300025272 | Ga0209455_1000380 | Ga0209455_100038015 | 192 |
| 466 | 3300025272 | Ga0209455_1009394 | Ga0209455_10093942 | 192 |
| 467 | 3300025297 | Ga0209758_1000290 | Ga0209758_100029058 | 192 |
| 468 | 3300025297 | Ga0209758_1021411 | Ga0209758_10214112 | 192 |
| 469 | 3300025302 | Ga0207426_1013399 | Ga0207426_10133993 | 192 |
| 470 | 3300025304 | Ga0209257_1055762 | Ga0209257_10557622 | 192 |
| 471 | 3300025321 | Ga0207656_10004076 | Ga0207656_100040764 | 192 |
| 472 | 3300025900 | Ga0207710_10008401 | Ga0207710_100084014 | 192 |
| 473 | 3300025903 | Ga0207680_10000003 | Ga0207680_10000003282 | 192 |
| 474 | 3300025904 | Ga0207647_10000237 | Ga0207647_1000023720 | 192 |
| 475 | 3300025904 | Ga0207647_10001096 | Ga0207647_1000109616 | 192 |
| 476 | 3300025904 | Ga0207647_10003895 | Ga0207647_100038952 | 192 |
| 477 | 3300025904 | Ga0207647_10003907 | Ga0207647_100039074 | 192 |
| 478 | 3300025904 | Ga0207647_10021325 | Ga0207647_100213255 | 192 |
| 479 | 3300025909 | Ga0207705_10000029 | Ga0207705_10000029121 | 192 |
| 480 | 3300025909 | Ga0207705_10000439 | Ga0207705_1000043925 | 192 |
| 481 | 3300025909 | Ga0207705_10000614 | Ga0207705_100006147 | 192 |
| 482 | 3300025909 | Ga0207705_10003279 | Ga0207705_100032793 | 192 |
| 483 | 3300025909 | Ga0207705_10006884 | Ga0207705_100068849 | 192 |
| 484 | 3300025909 | Ga0207705_10046918 | Ga0207705_100469183 | 192 |
| 485 | 3300025912 | Ga0207707_10000018 | Ga0207707_1000001825 | 192 |
| 486 | 3300025912 | Ga0207707_10000036 | Ga0207707_1000003661 | 192 |
| 487 | 3300025912 | Ga0207707_10000042 | Ga0207707_10000042122 | 192 |
| 488 | 3300025912 | Ga0207707_10000049 | Ga0207707_1000004935 | 192 |
| 489 | 3300025912 | Ga0207707_10001192 | Ga0207707_1000119222 | 192 |
| 490 | 3300025912 | Ga0207707_10001753 | Ga0207707_1000175320 | 192 |
| 491 | 3300025912 | Ga0207707_10014212 | Ga0207707_100142123 | 192 |
| 492 | 3300025912 | Ga0207707_10028042 | Ga0207707_100280425 | 192 |
| 493 | 3300025912 | Ga0207707_10028420 | Ga0207707_100284202 | 192 |
| 494 | 3300025912 | Ga0207707_10049094 | Ga0207707_100490944 | 192 |
| 495 | 3300025913 | Ga0207695_10000101 | Ga0207695_10000101201 | 192 |
| 496 | 3300025913 | Ga0207695_10000116 | Ga0207695_10000116210 | 192 |
| 497 | 3300025913 | Ga0207695_10000307 | Ga0207695_1000030744 | 192 |
| 498 | 3300025913 | Ga0207695_10001055 | Ga0207695_1000105528 | 192 |
| 499 | 3300025913 | Ga0207695_10001683 | Ga0207695_1000168323 | 192 |
| 500 | 3300025913 | Ga0207695_10013533 | Ga0207695_100135337 | 192 |
| 501 | 3300025913 | Ga0207695_10018303 | Ga0207695_100183034 | 192 |
| 502 | 3300025913 | Ga0207695_10030863 | Ga0207695_100308634 | 192 |
| 503 | 3300025914 | Ga0207671_10000013 | Ga0207671_1000001369 | 192 |
| 504 | 3300025914 | Ga0207671_10002057 | Ga0207671_1000205715 | 192 |
| 505 | 3300025917 | Ga0207660_10000206 | Ga0207660_1000020622 | 192 |
| 506 | 3300025917 | Ga0207660_10000948 | Ga0207660_100009485 | 192 |
| 507 | 3300025917 | Ga0207660_10001219 | Ga0207660_100012196 | 192 |
| 508 | 3300025917 | Ga0207660_10003795 | Ga0207660_100037953 | 192 |
| 509 | 3300025917 | Ga0207660_10047625 | Ga0207660_100476254 | 192 |
| 510 | 3300025919 | Ga0207657_10006454 | Ga0207657_100064549 | 192 |
| 511 | 3300025919 | Ga0207657_10007522 | Ga0207657_1000752212 | 192 |
| 512 | 3300025919 | Ga0207657_10091368 | Ga0207657_100913682 | 192 |
| 513 | 3300025919 | Ga0207657_10532016 | Ga0207657_105320161 | 192 |
| 514 | 3300025919 | Ga0207657_10554293 | Ga0207657_105542932 | 192 |
| 515 | 3300025920 | Ga0207649_10000219 | Ga0207649_1000021929 | 192 |
| 516 | 3300025920 | Ga0207649_10069089 | Ga0207649_100690892 | 192 |
| 517 | 3300025920 | Ga0207649_10118571 | Ga0207649_101185712 | 192 |
| 518 | 3300025920 | Ga0207649_10167275 | Ga0207649_101672752 | 192 |
| 519 | 3300025921 | Ga0207652_10000014 | Ga0207652_1000001494 | 192 |
| 520 | 3300025921 | Ga0207652_10000099 | Ga0207652_1000009972 | 192 |
| 521 | 3300025921 | Ga0207652_10001601 | Ga0207652_1000160120 | 192 |
| 522 | 3300025921 | Ga0207652_10002446 | Ga0207652_100024469 | 192 |
| 523 | 3300025921 | Ga0207652_10004532 | Ga0207652_100045329 | 192 |
| 524 | 3300025921 | Ga0207652_10069664 | Ga0207652_100696642 | 192 |
| 525 | 3300025921 | Ga0207652_10097407 | Ga0207652_100974072 | 192 |
| 526 | 3300025924 | Ga0207694_10000151 | Ga0207694_1000015159 | 192 |
| 527 | 3300025924 | Ga0207694_10020553 | Ga0207694_100205534 | 192 |
| 528 | 3300025924 | Ga0207694_10114991 | Ga0207694_101149912 | 192 |
| 529 | 3300025924 | Ga0207694_10314550 | Ga0207694_103145502 | 192 |
| 530 | 3300025929 | Ga0207664_10000030 | Ga0207664_1000003092 | 192 |
| 531 | 3300025929 | Ga0207664_10003028 | Ga0207664_100030287 | 192 |
| 532 | 3300025932 | Ga0207690_10000096 | Ga0207690_1000009650 | 192 |
| 533 | 3300025932 | Ga0207690_10002264 | Ga0207690_100022647 | 192 |
| 534 | 3300025932 | Ga0207690_10006491 | Ga0207690_100064918 | 192 |
| 535 | 3300025932 | Ga0207690_10009614 | Ga0207690_100096146 | 192 |
| 536 | 3300025932 | Ga0207690_10017568 | Ga0207690_100175684 | 192 |
| 537 | 3300025932 | Ga0207690_10052709 | Ga0207690_100527093 | 192 |
| 538 | 3300025932 | Ga0207690_10058549 | Ga0207690_100585492 | 192 |
| 539 | 3300025932 | Ga0207690_10694526 | Ga0207690_106945262 | 192 |
| 540 | 3300025933 | Ga0207706_10003820 | Ga0207706_100038206 | 192 |
| 541 | 3300025933 | Ga0207706_10025734 | Ga0207706_100257344 | 192 |
| 542 | 3300025933 | Ga0207706_10060840 | Ga0207706_100608404 | 192 |
| 543 | 3300025936 | Ga0207670_10000897 | Ga0207670_1000089713 | 192 |
| 544 | 3300025944 | Ga0207661_10006602 | Ga0207661_100066026 | 192 |
| 545 | 3300025944 | Ga0207661_10009873 | Ga0207661_100098735 | 192 |
| 546 | 3300025944 | Ga0207661_10364657 | Ga0207661_103646572 | 192 |
| 547 | 3300025945 | Ga0207679_10010175 | Ga0207679_100101755 | 192 |
| 548 | 3300025945 | Ga0207679_10731834 | Ga0207679_107318342 | 192 |
| 549 | 3300025949 | Ga0207667_10000040 | Ga0207667_10000040132 | 192 |
| 550 | 3300025949 | Ga0207667_10000047 | Ga0207667_1000004797 | 192 |
| 551 | 3300025949 | Ga0207667_10000075 | Ga0207667_1000007556 | 192 |
| 552 | 3300025949 | Ga0207667_10002530 | Ga0207667_1000253013 | 192 |
| 553 | 3300025949 | Ga0207667_10002947 | Ga0207667_1000294712 | 192 |
| 554 | 3300025949 | Ga0207667_10012337 | Ga0207667_100123374 | 192 |
| 555 | 3300025949 | Ga0207667_10013444 | Ga0207667_100134443 | 192 |
| 556 | 3300025949 | Ga0207667_10254442 | Ga0207667_102544422 | 192 |
| 557 | 3300025949 | Ga0207667_10431429 | Ga0207667_104314292 | 192 |
| 558 | 3300025981 | Ga0207640_10000009 | Ga0207640_10000009133 | 192 |
| 559 | 3300025981 | Ga0207640_10000461 | Ga0207640_1000046119 | 192 |
| 560 | 3300025981 | Ga0207640_10000682 | Ga0207640_100006829 | 192 |
| 561 | 3300025981 | Ga0207640_10002087 | Ga0207640_100020875 | 192 |
| 562 | 3300025981 | Ga0207640_10005417 | Ga0207640_100054173 | 192 |
| 563 | 3300025981 | Ga0207640_10079017 | Ga0207640_100790173 | 192 |
| 564 | 3300025981 | Ga0207640_10100430 | Ga0207640_101004302 | 192 |
| 565 | 3300025981 | Ga0207640_10233420 | Ga0207640_102334202 | 192 |
| 566 | 3300025986 | Ga0207658_10117124 | Ga0207658_101171242 | 192 |
| 567 | 3300026035 | Ga0207703_10057954 | Ga0207703_100579543 | 192 |
| 568 | 3300026035 | Ga0207703_10399113 | Ga0207703_103991132 | 192 |
| 569 | 3300026041 | Ga0207639_10000403 | Ga0207639_100004037 | 192 |
| 570 | 3300026041 | Ga0207639_10001846 | Ga0207639_100018465 | 192 |
| 571 | 3300026041 | Ga0207639_10008206 | Ga0207639_100082063 | 192 |
| 572 | 3300026041 | Ga0207639_10352579 | Ga0207639_103525791 | 192 |
| 573 | 3300026041 | Ga0207639_10408235 | Ga0207639_104082352 | 192 |
| 574 | 3300026067 | Ga0207678_10000612 | Ga0207678_1000061220 | 192 |
| 575 | 3300026067 | Ga0207678_10001123 | Ga0207678_1000112313 | 192 |
| 576 | 3300026067 | Ga0207678_10002596 | Ga0207678_100025969 | 192 |
| 577 | 3300026067 | Ga0207678_10017625 | Ga0207678_100176255 | 192 |
| 578 | 3300026067 | Ga0207678_10024508 | Ga0207678_100245084 | 192 |
| 579 | 3300026067 | Ga0207678_10030697 | Ga0207678_100306974 | 192 |
| 580 | 3300026067 | Ga0207678_10042733 | Ga0207678_100427334 | 192 |
| 581 | 3300026067 | Ga0207678_10117295 | Ga0207678_101172952 | 192 |
| 582 | 3300026067 | Ga0207678_10127520 | Ga0207678_101275202 | 192 |
| 583 | 3300026067 | Ga0207678_10180379 | Ga0207678_101803792 | 192 |
| 584 | 3300026067 | Ga0207678_10438790 | Ga0207678_104387902 | 192 |
| 585 | 3300026078 | Ga0207702_10000608 | Ga0207702_1000060820 | 192 |
| 586 | 3300026078 | Ga0207702_10005706 | Ga0207702_100057066 | 192 |
| 587 | 3300026078 | Ga0207702_10275207 | Ga0207702_102752072 | 192 |
| 588 | 3300026089 | Ga0207648_11019481 | Ga0207648_110194811 | 192 |
| 589 | 3300026116 | Ga0207674_10000012 | Ga0207674_1000001263 | 192 |
| 590 | 3300026116 | Ga0207674_10004576 | Ga0207674_100045767 | 192 |
| 591 | 3300026116 | Ga0207674_10009386 | Ga0207674_100093868 | 192 |
| 592 | 3300026116 | Ga0207674_10014417 | Ga0207674_100144176 | 192 |
| 593 | 3300026116 | Ga0207674_10027320 | Ga0207674_100273205 | 192 |
| 594 | 3300026116 | Ga0207674_10129007 | Ga0207674_101290072 | 192 |
| 595 | 3300026142 | Ga0207698_10000152 | Ga0207698_1000015228 | 192 |
| 596 | 3300026142 | Ga0207698_10001073 | Ga0207698_1000107311 | 192 |
| 597 | 3300026142 | Ga0207698_10022815 | Ga0207698_100228153 | 192 |
| 598 | 3300026142 | Ga0207698_10126755 | Ga0207698_101267553 | 192 |
| 599 | 3300028379 | Ga0268266_10000011 | Ga0268266_10000011230 | 192 |
| 600 | 3300028380 | Ga0268265_10074347 | Ga0268265_100743472 | 192 |
| 601 | 3300028380 | Ga0268265_10720434 | Ga0268265_107204341 | 192 |
| 602 | 3300028381 | Ga0268264_10054343 | Ga0268264_100543433 | 192 |
| 603 | 3300028381 | Ga0268264_10069026 | Ga0268264_100690263 | 192 |
| 604 | 3300028794 | Ga0307515_10614803 | Ga0307515_106148031 | 192 |
| 605 | 3300031911 | Ga0307412_10000592 | Ga0307412_1000059221 | 192 |
| 606 | 3300032002 | Ga0307416_100767751 | Ga0307416_1007677512 | 192 |
| 607 | 3300033180 | Ga0307510_10003183 | Ga0307510_100031839 | 192 |
| 608 | 3300033180 | Ga0307510_10216741 | Ga0307510_102167411 | 192 |
| 609 | 3300037312 | Ga0395899_0018866 | Ga0395899_0018866_3229_3813 | 192 |
| 610 | 3300037312 | Ga0395899_0025640 | Ga0395899_0025640_2584_3168 | 192 |
| 611 | 3300037312 | Ga0395899_0067173 | Ga0395899_0067173_652_1236 | 192 |
| 612 | 3300037312 | Ga0395899_0088006 | Ga0395899_0088006_1096_1680 | 192 |
| 613 | 3300037312 | Ga0395899_0308698 | Ga0395899_0308698_225_809 | 192 |
| 614 | 3300037418 | Ga0395900_0016300 | Ga0395900_0016300_1545_2129 | 192 |
| 615 | 3300037418 | Ga0395900_0036728 | Ga0395900_0036728_533_1117 | 192 |
| 616 | 3300037418 | Ga0395900_0278537 | Ga0395900_0278537_931_1515 | 192 |
| 617 | 3300037418 | Ga0395900_0471676 | Ga0395900_0471676_87_671 | 192 |
| 618 | 3300037466 | Ga0395898_0006775 | Ga0395898_0006775_11513_12097 | 192 |
| 619 | 3300037466 | Ga0395898_0108134 | Ga0395898_0108134_1094_1678 | 192 |
| 620 | 3300037466 | Ga0395898_0211832 | Ga0395898_0211832_365_949 | 192 |
| 621 | 3300037471 | Ga0395905_0408977 | Ga0395905_0408977_537_1121 | 192 |
| 622 | 3300038443 | Ga0395901_0000215 | Ga0395901_0000215_37778_38362 | 192 |
| 623 | 3300038443 | Ga0395901_0002859 | Ga0395901_0002859_10203_10787 | 192 |
| 624 | 3300038443 | Ga0395901_0022178 | Ga0395901_0022178_3955_4539 | 192 |
| 625 | 3300038443 | Ga0395901_0069528 | Ga0395901_0069528_480_1064 | 192 |
| 626 | 3300038443 | Ga0395901_0070487 | Ga0395901_0070487_828_1412 | 192 |
| 627 | 3300038443 | Ga0395901_0131605 | Ga0395901_0131605_1588_2172 | 192 |
| 628 | 3300038443 | Ga0395901_0225936 | Ga0395901_0225936_1166_1750 | 192 |
| 629 | 3300038443 | Ga0395901_0522629 | Ga0395901_0522629_403_987 | 192 |
| 630 | 3300041404 | Ga0439436_0000063 | Ga0439436_0000063_29038_29622 | 192 |
| 631 | 3300041413 | Ga0439465_0001557 | Ga0439465_0001557_700_1284 | 192 |
| 632 | 3300041452 | Ga0451793_0622521 | Ga0451793_0622521_4541_5125 | 192 |
| 633 | 3300041452 | Ga0451793_0733104 | Ga0451793_0733104_315_899 | 192 |
| 634 | 3300041456 | Ga0451795_1375120 | Ga0451795_1375120_57_641 | 192 |
| 635 | 3300041459 | Ga0451800_0901466 | Ga0451800_0901466_788_1372 | 192 |
| 636 | 3300041462 | Ga0451806_170739 | Ga0451806_170739_260_844 | 192 |
| 637 | 3300041463 | Ga0451804_1024051 | Ga0451804_1024051_198_782 | 192 |
| 638 | 3300041486 | Ga0451807_1329070 | Ga0451807_1329070_215_799 | 192 |
| 639 | 3300041491 | Ga0451833_1479516 | Ga0451833_1479516_442_1026 | 192 |
| 640 | 3300042000 | Ga0439437_001853 | Ga0439437_001853_372_956 | 192 |
| 641 | 3300042004 | Ga0439445_0008323 | Ga0439445_0008323_150_734 | 192 |
| 642 | 3300042006 | Ga0439432_010194 | Ga0439432_010194_1856_2440 | 192 |
| 643 | 3300042184 | Ga0450908_000063 | Ga0450908_000063_3117_3716 | 192 |
| 644 | 3300042438 | Ga0439459_0000678 | Ga0439459_0000678_115_699 | 192 |
| 645 | 3300042438 | Ga0439459_0022160 | Ga0439459_0022160_404_988 | 192 |
| 646 | 3300044658 | Ga0466972_0043646 | Ga0466972_0043646_1396_1980 | 192 |
| 647 | 3300044672 | Ga0466982_0000008 | Ga0466982_0000008_164783_165367 | 192 |
| 648 | 3300044672 | Ga0466982_0002390 | Ga0466982_0002390_6540_7136 | 192 |
| 649 | 3300044684 | Ga0466966_0016192 | Ga0466966_0016192_663_1247 | 192 |
| 650 | 3300044693 | Ga0466961_0173436 | Ga0466961_0173436_277_861 | 192 |
| 651 | 3300044706 | Ga0466964_0037442 | Ga0466964_0037442_1007_1591 | 192 |
| 652 | 3300044719 | Ga0466971_0040583 | Ga0466971_0040583_1139_1723 | 192 |
| 653 | 3300044735 | Ga0466968_0050108 | Ga0466968_0050108_556_1140 | 192 |
| 654 | 3300044765 | Ga0466970_0018568 | Ga0466970_0018568_727_1311 | 192 |
| 655 | 3300044842 | Ga0466957_0039415 | Ga0466957_0039415_1552_2148 | 192 |
| 656 | 3300044901 | Ga0466960_0020456 | Ga0466960_0020456_1219_1803 | 192 |
| 657 | 3300045836 | Ga0466958_0134176 | Ga0466958_0134176_657_1241 | 192 |
| 658 | 3300046452 | Ga0495617_000114 | Ga0495617_000114_28117_28701 | 192 |
| 659 | 3300046452 | Ga0495617_000412 | Ga0495617_000412_8935_9519 | 192 |
| 660 | 3300046460 | Ga0495638_0000063 | Ga0495638_0000063_182566_183150 | 192 |
| 661 | 3300046460 | Ga0495638_0000065 | Ga0495638_0000065_102383_102967 | 192 |
| 662 | 3300046460 | Ga0495638_0000135 | Ga0495638_0000135_27427_28011 | 192 |
| 663 | 3300046460 | Ga0495638_0000148 | Ga0495638_0000148_77450_78034 | 192 |
| 664 | 3300046460 | Ga0495638_0011938 | Ga0495638_0011938_3320_3904 | 192 |
| 665 | 3300046471 | Ga0495650_0000078 | Ga0495650_0000078_109349_109933 | 192 |
| 666 | 3300046471 | Ga0495650_0000222 | Ga0495650_0000222_45839_46423 | 192 |
| 667 | 3300046471 | Ga0495650_0001488 | Ga0495650_0001488_331_915 | 192 |
| 668 | 3300046471 | Ga0495650_0010026 | Ga0495650_0010026_3438_4022 | 192 |
| 669 | 3300046474 | Ga0495605_0204633 | Ga0495605_0204633_119_703 | 192 |
| 670 | 3300046491 | Ga0495584_0001381 | Ga0495584_0001381_6416_7000 | 192 |
| 671 | 3300046492 | Ga0495585_0000063 | Ga0495585_0000063_27344_27928 | 192 |
| 672 | 3300046492 | Ga0495585_0003226 | Ga0495585_0003226_1254_1838 | 192 |
| 673 | 3300046501 | Ga0495607_0000029 | Ga0495607_0000029_110572_111156 | 192 |
| 674 | 3300046501 | Ga0495607_0000100 | Ga0495607_0000100_46401_46985 | 192 |
| 675 | 3300046501 | Ga0495607_0004039 | Ga0495607_0004039_4033_4617 | 192 |
| 676 | 3300046507 | Ga0495606_0000351 | Ga0495606_0000351_33461_34045 | 192 |
| 677 | 3300046507 | Ga0495606_0000427 | Ga0495606_0000427_44385_44969 | 192 |
| 678 | 3300046507 | Ga0495606_0001737 | Ga0495606_0001737_20493_21077 | 192 |
| 679 | 3300046507 | Ga0495606_0028699 | Ga0495606_0028699_2693_3277 | 192 |
| 680 | 3300046507 | Ga0495606_0071954 | Ga0495606_0071954_139_723 | 192 |
| 681 | 3300046507 | Ga0495606_0225441 | Ga0495606_0225441_280_864 | 192 |
| 682 | 3300046512 | Ga0495610_0002695 | Ga0495610_0002695_11206_11790 | 192 |
| 683 | 3300046512 | Ga0495610_0085140 | Ga0495610_0085140_280_864 | 192 |
| 684 | 3300046513 | Ga0495616_0000183 | Ga0495616_0000183_27326_27910 | 192 |
| 685 | 3300046513 | Ga0495616_0014578 | Ga0495616_0014578_619_1203 | 192 |
| 686 | 3300046515 | Ga0495620_0000090 | Ga0495620_0000090_45071_45655 | 192 |
| 687 | 3300046515 | Ga0495620_0019009 | Ga0495620_0019009_215_799 | 192 |
| 688 | 3300046518 | Ga0495631_0000055 | Ga0495631_0000055_27488_28072 | 192 |
| 689 | 3300046518 | Ga0495631_0000458 | Ga0495631_0000458_25055_25639 | 192 |
| 690 | 3300046519 | Ga0495632_0008465 | Ga0495632_0008465_1495_2079 | 192 |
| 691 | 3300046519 | Ga0495632_0024202 | Ga0495632_0024202_1825_2409 | 192 |
| 692 | 3300046520 | Ga0495637_0005939 | Ga0495637_0005939_937_1521 | 192 |
| 693 | 3300046524 | Ga0495648_0000324 | Ga0495648_0000324_25135_25719 | 192 |
| 694 | 3300046524 | Ga0495648_0009773 | Ga0495648_0009773_3050_3634 | 192 |
| 695 | 3300046538 | Ga0495609_0004473 | Ga0495609_0004473_3735_4319 | 192 |
| 696 | 3300046558 | Ga0495633_0009082 | Ga0495633_0009082_2788_3372 | 192 |
| 697 | 3300046616 | Ga0495668_0002335 | Ga0495668_0002335_14867_15451 | 192 |
| 698 | 3300046648 | Ga0495611_0000003 | Ga0495611_0000003_148429_149013 | 192 |
| 699 | 3300046648 | Ga0495611_0000018 | Ga0495611_0000018_98971_99555 | 192 |
| 700 | 3300046660 | Ga0495625_0000019 | Ga0495625_0000019_157637_158221 | 192 |
| 701 | 3300046660 | Ga0495625_0021104 | Ga0495625_0021104_408_992 | 192 |
| 702 | 3300046660 | Ga0495625_0104538 | Ga0495625_0104538_1224_1808 | 192 |
| 703 | 3300046660 | Ga0495625_0116267 | Ga0495625_0116267_88_672 | 192 |
| 704 | 3300046660 | Ga0495625_0123154 | Ga0495625_0123154_898_1482 | 192 |
| 705 | 3300046665 | Ga0495661_0001253 | Ga0495661_0001253_20003_20587 | 192 |
| 706 | 3300046665 | Ga0495661_0240530 | Ga0495661_0240530_107_691 | 192 |
| 707 | 3300046691 | Ga0495670_0000081 | Ga0495670_0000081_1939_2523 | 192 |
| 708 | 3300046691 | Ga0495670_0000602 | Ga0495670_0000602_11823_12407 | 192 |
| 709 | 3300046691 | Ga0495670_0028808 | Ga0495670_0028808_1373_1957 | 192 |
| 710 | 3300046692 | Ga0495671_0000611 | Ga0495671_0000611_6685_7269 | 192 |
| 711 | 3300046694 | Ga0495649_0003118 | Ga0495649_0003118_4791_5375 | 192 |
| 712 | 3300046694 | Ga0495649_0078981 | Ga0495649_0078981_894_1478 | 192 |
| 713 | 3300046794 | Ga0495589_0000018 | Ga0495589_0000018_87179_87763 | 192 |
| 714 | 3300046810 | Ga0495660_0000164 | Ga0495660_0000164_45175_45759 | 192 |
| 715 | 3300046810 | Ga0495660_0000223 | Ga0495660_0000223_47492_48076 | 192 |
| 716 | 3300047323 | Ga0495683_0001383 | Ga0495683_0001383_6212_6796 | 192 |
| 717 | 3300047446 | Ga0495679_000017 | Ga0495679_000017_114200_114784 | 192 |
| 718 | 3300047469 | Ga0495673_0000004 | Ga0495673_0000004_815683_816267 | 192 |
| 719 | 3300047469 | Ga0495673_0000133 | Ga0495673_0000133_25639_26223 | 192 |
| 720 | 3300047469 | Ga0495673_0000318 | Ga0495673_0000318_36664_37248 | 192 |
| 721 | 3300047469 | Ga0495673_0018718 | Ga0495673_0018718_927_1511 | 192 |
| 722 | 3300047472 | Ga0495686_0000033 | Ga0495686_0000033_306307_306885 | 192 |
| 723 | 3300047472 | Ga0495686_0000527 | Ga0495686_0000527_9280_9864 | 192 |
| 724 | 3300047472 | Ga0495686_0003732 | Ga0495686_0003732_10476_11060 | 192 |
| 725 | 3300047472 | Ga0495686_0008030 | Ga0495686_0008030_6710_7294 | 192 |
| 726 | 3300047472 | Ga0495686_0066483 | Ga0495686_0066483_665_1249 | 192 |
| 727 | 3300048903 | Ga0496100_0000781 | Ga0496100_0000781_9052_9636 | 192 |
| 728 | 3300048903 | Ga0496100_0119632 | Ga0496100_0119632_485_1069 | 192 |
| 729 | 3300048904 | Ga0496101_0009582 | Ga0496101_0009582_1224_1808 | 192 |
| 730 | 3300048904 | Ga0496101_0084238 | Ga0496101_0084238_450_1034 | 192 |
| 731 | 3300048905 | Ga0496102_0166073 | Ga0496102_0166073_352_936 | 192 |
| 732 | 3300048905 | Ga0496102_0251893 | Ga0496102_0251893_472_1050 | 192 |
| 733 | 3300048908 | Ga0496105_0000292 | Ga0496105_0000292_9667_10251 | 192 |
| 734 | 3300048909 | Ga0496106_0052036 | Ga0496106_0052036_42_626 | 192 |
| 735 | 3300048909 | Ga0496106_0122965 | Ga0496106_0122965_350_934 | 192 |
| 736 | 3300048910 | Ga0496107_0024465 | Ga0496107_0024465_2877_3461 | 192 |
| 737 | 3300048910 | Ga0496107_0290366 | Ga0496107_0290366_562_1146 | 192 |
| 738 | 3300048910 | Ga0496107_0332135 | Ga0496107_0332135_89_673 | 192 |
| 739 | 3300048918 | Ga0496115_0000072 | Ga0496115_0000072_29682_30266 | 192 |
| 740 | 3300048918 | Ga0496115_0004358 | Ga0496115_0004358_5151_5735 | 192 |
| 741 | 3300048918 | Ga0496115_0095944 | Ga0496115_0095944_1429_2013 | 192 |
| 742 | 3300048919 | Ga0496116_0088552 | Ga0496116_0088552_579_1163 | 192 |
| 743 | 3300048920 | Ga0496117_0012299 | Ga0496117_0012299_2232_2816 | 192 |
| 744 | 3300048920 | Ga0496117_0026259 | Ga0496117_0026259_63_647 | 192 |
| 745 | 3300048920 | Ga0496117_0027636 | Ga0496117_0027636_3432_4010 | 192 |
| 746 | 3300048920 | Ga0496117_0083089 | Ga0496117_0083089_730_1308 | 192 |
| 747 | 3300048921 | Ga0496118_0000865 | Ga0496118_0000865_25882_26460 | 192 |
| 748 | 3300048921 | Ga0496118_0001698 | Ga0496118_0001698_6532_7116 | 192 |
| 749 | 3300048921 | Ga0496118_0003419 | Ga0496118_0003419_12857_13441 | 192 |
| 750 | 3300048921 | Ga0496118_0007498 | Ga0496118_0007498_10927_11505 | 192 |
| 751 | 3300048922 | Ga0496119_0000030 | Ga0496119_0000030_42801_43385 | 192 |
| 752 | 3300048922 | Ga0496119_0002030 | Ga0496119_0002030_707_1291 | 192 |
| 753 | 3300048922 | Ga0496119_0260519 | Ga0496119_0260519_247_831 | 192 |
| 754 | 3300048923 | Ga0496120_0000015 | Ga0496120_0000015_155832_156416 | 192 |
| 755 | 3300048923 | Ga0496120_0000033 | Ga0496120_0000033_196791_197375 | 192 |
| 756 | 3300048923 | Ga0496120_0225709 | Ga0496120_0225709_10_594 | 192 |
| 757 | 3300048924 | Ga0496121_0000063 | Ga0496121_0000063_168279_168863 | 192 |
| 758 | 3300048924 | Ga0496121_0000109 | Ga0496121_0000109_147848_148426 | 192 |
| 759 | 3300048924 | Ga0496121_0000633 | Ga0496121_0000633_18692_19276 | 192 |
| 760 | 3300048924 | Ga0496121_0000922 | Ga0496121_0000922_25002_25586 | 192 |
| 761 | 3300048924 | Ga0496121_0002272 | Ga0496121_0002272_4815_5399 | 192 |
| 762 | 3300048924 | Ga0496121_0059446 | Ga0496121_0059446_2092_2676 | 192 |
| 763 | 3300048924 | Ga0496121_0065660 | Ga0496121_0065660_1510_2094 | 192 |
| 764 | 3300048924 | Ga0496121_0108098 | Ga0496121_0108098_652_1236 | 192 |
| 765 | 3300048924 | Ga0496121_0131212 | Ga0496121_0131212_1135_1719 | 192 |
| 766 | 3300048924 | Ga0496121_0251492 | Ga0496121_0251492_599_1183 | 192 |
| 767 | 3300048924 | Ga0496121_0263927 | Ga0496121_0263927_523_1107 | 192 |
| 768 | 3300048925 | Ga0496122_0006000 | Ga0496122_0006000_12906_13490 | 192 |
| 769 | 3300048925 | Ga0496122_0025750 | Ga0496122_0025750_1583_2167 | 192 |
| 770 | 3300048925 | Ga0496122_0073026 | Ga0496122_0073026_350_928 | 192 |
| 771 | 3300048926 | Ga0496123_0005505 | Ga0496123_0005505_173_757 | 192 |
| 772 | 3300048926 | Ga0496123_0030269 | Ga0496123_0030269_2301_2885 | 192 |
| 773 | 3300048926 | Ga0496123_0192713 | Ga0496123_0192713_450_1034 | 192 |
| 774 | 3300048927 | Ga0496124_0000763 | Ga0496124_0000763_11480_12064 | 192 |
| 775 | 3300048927 | Ga0496124_0005424 | Ga0496124_0005424_11482_12066 | 192 |
| 776 | 3300048927 | Ga0496124_0095312 | Ga0496124_0095312_522_1106 | 192 |
| 777 | 3300048928 | Ga0496125_0000044 | Ga0496125_0000044_98641_99225 | 192 |
| 778 | 3300048928 | Ga0496125_0001166 | Ga0496125_0001166_38424_39002 | 192 |
| 779 | 3300048929 | Ga0496126_0001457 | Ga0496126_0001457_29763_30347 | 192 |
| 780 | 3300048929 | Ga0496126_0004543 | Ga0496126_0004543_14263_14841 | 192 |
| 781 | 3300048929 | Ga0496126_0007800 | Ga0496126_0007800_4955_5539 | 192 |
| 782 | 3300048929 | Ga0496126_0050859 | Ga0496126_0050859_1266_1850 | 192 |
| 783 | 3300048929 | Ga0496126_0096004 | Ga0496126_0096004_1140_1724 | 192 |
| 784 | 3300048929 | Ga0496126_0378631 | Ga0496126_0378631_512_1096 | 192 |
| 785 | 3300048929 | Ga0496126_0490696 | Ga0496126_0490696_224_808 | 192 |
| 786 | 3300049459 | Ga0495678_000152 | Ga0495678_000152_74984_75568 | 192 |
| 787 | 3300049459 | Ga0495678_033497 | Ga0495678_033497_832_1416 | 192 |
| 788 | 3300049460 | Ga0495682_0003681 | Ga0495682_0003681_914_1498 | 192 |
| 789 | 3300049460 | Ga0495682_0004504 | Ga0495682_0004504_2118_2702 | 192 |
| 790 | 3300049460 | Ga0495682_0008410 | Ga0495682_0008410_2118_2702 | 192 |
| 791 | 3300049571 | Ga0501034_0351593 | Ga0501034_0351593_631_1215 | 192 |
| 792 | 3300049572 | Ga0501036_0023361 | Ga0501036_0023361_2058_2645 | 192 |
| 793 | 3300049573 | Ga0501037_0030992 | Ga0501037_0030992_1405_2010 | 192 |
| 794 | 3300049573 | Ga0501037_0113767 | Ga0501037_0113767_103_690 | 192 |
| 795 | 3300049573 | Ga0501037_0145832 | Ga0501037_0145832_197_781 | 192 |
| 796 | 3300049574 | Ga0501038_0195290 | Ga0501038_0195290_759_1346 | 192 |
| 797 | 3300049574 | Ga0501038_0252901 | Ga0501038_0252901_255_839 | 192 |
| 798 | 3300049579 | Ga0501043_0097426 | Ga0501043_0097426_83_670 | 192 |
| 799 | 3300049579 | Ga0501043_0374305 | Ga0501043_0374305_208_792 | 192 |
| 800 | 3300049580 | Ga0501046_0253963 | Ga0501046_0253963_537_1151 | 192 |
| 801 | 3300049580 | Ga0501046_0352865 | Ga0501046_0352865_273_860 | 192 |
| 802 | 3300049581 | Ga0501047_0078755 | Ga0501047_0078755_1110_1724 | 192 |
| 803 | 3300049581 | Ga0501047_0150264 | Ga0501047_0150264_671_1276 | 192 |
| 804 | 3300049581 | Ga0501047_0301893 | Ga0501047_0301893_305_892 | 192 |
| 805 | 3300049585 | Ga0501069_0054954 | Ga0501069_0054954_1419_2024 | 192 |
| 806 | 3300049586 | Ga0501070_0006571 | Ga0501070_0006571_2209_2814 | 192 |
| 807 | 3300049586 | Ga0501070_0025227 | Ga0501070_0025227_1899_2483 | 192 |
| 808 | 3300049586 | Ga0501070_0033602 | Ga0501070_0033602_966_1622 | 192 |
| 809 | 3300049586 | Ga0501070_0166670 | Ga0501070_0166670_462_1046 | 192 |
| 810 | 3300049586 | Ga0501070_0376082 | Ga0501070_0376082_145_732 | 192 |
| 811 | 3300049586 | Ga0501070_0447998 | Ga0501070_0447998_412_996 | 192 |
| 812 | 3300049586 | Ga0501070_0672590 | Ga0501070_0672590_29_613 | 192 |
| 813 | 3300049587 | Ga0501071_0000682 | Ga0501071_0000682_15156_15761 | 192 |
| 814 | 3300049589 | Ga0501073_0003157 | Ga0501073_0003157_6890_7495 | 192 |
| 815 | 3300049589 | Ga0501073_0125095 | Ga0501073_0125095_892_1476 | 192 |
| 816 | 3300049590 | Ga0501074_0000064 | Ga0501074_0000064_26838_27443 | 192 |
| 817 | 3300049590 | Ga0501074_0015297 | Ga0501074_0015297_2244_2828 | 192 |
| 818 | 3300049593 | Ga0501077_0028303 | Ga0501077_0028303_2893_3549 | 192 |
| 819 | 3300049741 | Ga0501079_0090092 | Ga0501079_0090092_303_908 | 192 |
| 820 | 3300049741 | Ga0501079_0455174 | Ga0501079_0455174_138_722 | 192 |
| 821 | 3300049741 | Ga0501079_0506862 | Ga0501079_0506862_175_759 | 192 |
| 822 | 3300049742 | Ga0501080_0000816 | Ga0501080_0000816_4497_5102 | 192 |
| 823 | 3300049742 | Ga0501080_0022292 | Ga0501080_0022292_2518_3102 | 192 |
| 824 | 3300049742 | Ga0501080_0081299 | Ga0501080_0081299_23_607 | 192 |
| 825 | 3300049742 | Ga0501080_0618270 | Ga0501080_0618270_23_607 | 192 |
| 826 | 3300049822 | Ga0501035_0001993 | Ga0501035_0001993_3205_3789 | 192 |
| 827 | 3300049822 | Ga0501035_0049805 | Ga0501035_0049805_2336_2920 | 192 |
| 828 | 3300049822 | Ga0501035_0171146 | Ga0501035_0171146_775_1380 | 192 |
| 829 | 3300049822 | Ga0501035_0197599 | Ga0501035_0197599_664_1251 | 192 |
| 830 | 3300049823 | Ga0501044_0005303 | Ga0501044_0005303_5072_5677 | 192 |
| 831 | 3300049823 | Ga0501044_0021274 | Ga0501044_0021274_2881_3465 | 192 |
| 832 | 3300049823 | Ga0501044_0167382 | Ga0501044_0167382_612_1196 | 192 |
| 833 | 3300053087 | Ga0500643_000029 | Ga0500643_000029_148885_149469 | 192 |
| 834 | 3300053087 | Ga0500643_002345 | Ga0500643_002345_7301_7885 | 192 |
| 835 | 3300053090 | Ga0500646_0053849 | Ga0500646_0053849_547_1131 | 192 |
| 836 | 3300053103 | Ga0500555_000260 | Ga0500555_000260_21023_21607 | 192 |
| 837 | 3300053120 | Ga0500597_000371 | Ga0500597_000371_5617_6201 | 192 |
| 838 | 3300053160 | Ga0500633_0000233 | Ga0500633_0000233_2719_3303 | 192 |
| 839 | 3300053161 | Ga0500634_0006547 | Ga0500634_0006547_2852_3436 | 192 |
| 840 | 3300053730 | Ga0500645_000287 | Ga0500645_000287_24505_25089 | 192 |
| 841 | 3300061719 | Ga0466962_0009173 | Ga0466962_0009173_1006_1590 | 192 |
| 842 | iso_pu_bacteria | 2953994433 | 2953995840 | 192 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar