F483127

General Info

Members Datasets Scaffolds Average Seq Length
842 314 817 194

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_100330629|Ga0068855_1003306292
Length 230
Sequence MARHPVPILLRHPGLAGQPSCAEPAPTLQTGHSRAAMNEPTSDVDSRDRMLLRRMAAGDHAALETLYRTYHGGLCRFLSRLTRRADLIEEIVNDCFWIAWRKADSFHGDSRVSTWIMGIAYRCGLKALRQRGDEPVDDYALREGRGPSHDPDEDRELRDWLGKGLEHLSADQRVVVELVYGVGNSLDEVAAIMQSPVGTVKARLFHARVKLRNTLPTLAGDSPAQQENKS

Samples

Sample ID Description Type Environment
1 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
2 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
3 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
4 2734482264 Dyella sp. AD052 Isolate Unclassified
5 2738543009 Luteibacter sp. OK325 Isolate Unclassified
6 2739367700 Dyella sp. YR388 Isolate Unclassified
7 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
8 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
9 2818991457 Xanthomonas translucens 569 Isolate Unclassified
10 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
11 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
12 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
13 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
14 2884411467 Dyella sp. AD56 Isolate Rhizosphere
15 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
16 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
17 2928963466 Dyella japonica 1073 Isolate Unclassified
18 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
19 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
20 2941471342 Luteibacter sp. 621 Isolate Unclassified
21 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
22 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
23 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
24 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
25 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
26 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
27 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
28 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
29 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
30 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
31 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
32 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
33 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
34 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
35 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
36 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
37 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
38 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
39 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
40 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
41 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
42 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
43 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
44 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
45 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
46 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
47 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
48 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
49 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
50 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
51 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
52 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
53 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
54 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
55 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
56 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
57 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
58 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
59 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
60 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
61 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
62 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
63 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
64 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
65 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
66 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
67 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
68 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
69 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
70 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
71 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
72 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
73 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
74 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
75 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
76 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
77 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
78 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
79 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
80 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
81 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
82 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
83 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
84 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
85 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
86 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
87 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
88 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
89 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
90 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
91 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
92 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
93 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
94 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
96 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
97 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
98 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
100 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
102 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
103 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
104 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
105 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
106 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
107 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
108 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
109 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
110 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
111 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
112 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
113 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
114 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
115 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
116 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
117 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
118 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
119 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
120 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
124 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
127 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
129 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
130 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
131 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
137 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
138 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
140 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
141 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
142 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
145 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
146 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
147 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
148 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
150 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
151 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
152 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
188 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
189 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
190 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
191 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
192 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
193 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
194 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
195 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
196 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
197 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
198 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
199 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
200 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
201 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
202 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
203 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
204 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
205 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
206 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
207 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
208 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
209 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
210 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
211 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
212 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
213 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
214 3300044536 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA2E Metagenome Unclassified
215 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
216 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
217 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
218 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
219 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
220 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
221 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
222 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
223 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
224 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
225 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
226 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
227 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
228 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
229 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
230 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
231 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
232 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
233 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
234 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
235 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
236 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
237 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
238 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
239 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
240 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
241 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
242 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
243 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
244 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
245 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
246 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
247 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
248 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
249 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
250 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
251 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
252 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
253 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
254 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
255 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
256 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
257 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
258 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
259 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
260 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
261 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
262 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
263 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
264 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
265 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
266 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
267 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
268 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
269 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
270 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
271 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
272 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
273 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
274 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
275 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
276 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
277 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
278 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
279 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
280 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
281 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
282 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
284 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
286 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
292 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
293 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
294 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
295 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
296 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
297 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
298 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
299 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
300 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
302 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
303 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
304 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
305 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
306 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
307 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
308 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
309 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
310 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
311 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
312 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
313 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
314 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.94
Metatranscriptomes 3.09
Isolates 2.97

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.83
Nodule 0
Rhizoplane 2.61
Rhizosphere 73.04
Stem 0
Stem Tuber 0
Unclassified 11.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1002320 3300001904 Bacteria 3360
2 JGI24741J21665_1034746 3300001915 Bacteria 749
3 JGI24740J21852_10000025 3300001979 Bacteria 49637
4 JGI24740J21852_10011029 3300001979 Bacteria 3456
5 JGI24740J21852_10020598 3300001979 Unclassified 2298
6 JGI24739J22299_10000022 3300001989 Bacteria 45280
7 JGI24739J22299_10001242 3300001989 Bacteria 9588
8 JGI24737J22298_10003356 3300001990 Bacteria 5663
9 JGI24737J22298_10004305 3300001990 Bacteria 4971
10 JGI24735J21928_10009193 3300002067 Bacteria 3178
11 JGI24735J21928_10054048 3300002067 Bacteria 1157
12 JGI24738J21930_10000095 3300002075 Bacteria 20134
13 JGI25156J39149_1004438 3300002705 Bacteria 4273
14 JGI25156J39149_1012740 3300002705 Bacteria 1829
15 JGI25162J39368_1000018 3300002737 Bacteria 277875
16 JGI25162J39368_1000567 3300002737 Bacteria 27104
17 JGI25162J39368_1000594 3300002737 Bacteria 26267
18 JGI25154J39366_1004513 3300002738 Bacteria 2474
19 JGI25157J39369_1000011 3300002741 Bacteria 206831
20 JGI25157J39369_1001115 3300002741 Bacteria 11931
21 JGI25157J39369_1001478 3300002741 Bacteria 8667
22 JGI25157J39369_1001590 3300002741 Bacteria 7978
23 JGI25163J39215_1000291 3300002771 Bacteria 17182
24 JGI25163J39215_1000356 3300002771 Bacteria 15075
25 JGI25164J39214_1000007 3300002772 Bacteria 312507
26 JGI25164J39214_1000198 3300002772 Bacteria 51603
27 JGI25164J39214_1003959 3300002772 Bacteria 1772
28 JGI25152J39213_1001511 3300002773 Bacteria 9902
29 JGI25165J46597_1000029 3300003214 Bacteria 312507
30 JGI25165J46597_1000354 3300003214 Bacteria 51605
31 JGI25153J46596_10001310 3300003215 Bacteria 14890
32 JGI25153J46596_10008411 3300003215 Bacteria 4935
33 rootH2_10115902 3300003320 Bacteria 3922
34 rootL2_10061659 3300003322 Bacteria 5680
35 rootL2_10241063 3300003322 Bacteria 7305
36 rootH1_10111193 3300003323 Bacteria 3323
37 rootH1_10129136 3300003323 Bacteria 4831
38 rootH1_10203752 3300003323 Bacteria 2414
39 Ga0006562J51391_1062436 3300003578 Bacteria 7601
40 Ga0006562J51391_1062438 3300003578 Bacteria 4950
41 Ga0055538_1001241 3300003751 Bacteria 5276
42 Ga0055539_1000706 3300003752 Bacteria 8527
43 Ga0055533_1000373 3300003756 Bacteria 18160
44 Ga0055525_1000059 3300003759 Bacteria 202797
45 Ga0055527_1000050 3300003760 Bacteria 104542
46 Ga0055527_1000128 3300003760 Bacteria 53342
47 Ga0055527_1006447 3300003760 Bacteria 1469
48 Ga0055535_1000025 3300003761 Bacteria 213549
49 Ga0055535_1000119 3300003761 Bacteria 84990
50 Ga0055535_1000287 3300003761 Bacteria 53346
51 Ga0055535_1000295 3300003761 Bacteria 51620
52 Ga0055535_1001844 3300003761 Bacteria 9073
53 Ga0055542_1000024 3300003762 Bacteria 277875
54 Ga0055542_1000057 3300003762 Bacteria 162955
55 Ga0055542_1000082 3300003762 Bacteria 128120
56 Ga0055542_1000119 3300003762 Bacteria 104542
57 Ga0055542_1000180 3300003762 Bacteria 78192
58 Ga0055542_1000311 3300003762 Bacteria 53346
59 Ga0055529_1000029 3300003763 Bacteria 277978
60 Ga0055529_1000049 3300003763 Bacteria 208413
61 Ga0055529_1000329 3300003763 Bacteria 53347
62 Ga0055529_1000514 3300003763 Bacteria 34100
63 Ga0055529_1021040 3300003763 Bacteria 811
64 Ga0055526_1010167 3300003771 Bacteria 4413
65 Ga0055541_1019038 3300003841 Bacteria 837
66 Ga0058692_1000029 3300003856 Bacteria 189475
67 Ga0065165_1000653 3300005262 Bacteria 50050
68 Ga0065165_1002406 3300005262 Bacteria 15970
69 Ga0070658_10006547 3300005327 Bacteria 9447
70 Ga0070658_10082190 3300005327 Bacteria 2647
71 Ga0070683_100575992 3300005329 Bacteria 1077
72 Ga0070670_100453862 3300005331 Bacteria 1136
73 Ga0070666_10000001 3300005335 Bacteria 543080
74 Ga0070680_100000627 3300005336 Bacteria 24578
75 Ga0070680_100001693 3300005336 Bacteria 16162
76 Ga0070682_100000659 3300005337 Bacteria 20965
77 Ga0070682_100001204 3300005337 Bacteria 14746
78 Ga0070682_100015698 3300005337 Bacteria 4392
79 Ga0070682_100020889 3300005337 Bacteria 3859
80 Ga0070682_100119907 3300005337 Bacteria 1764
81 Ga0070660_100004295 3300005339 Bacteria 9844
82 Ga0070660_100193727 3300005339 Bacteria 1647
83 Ga0070660_100340277 3300005339 Bacteria 1234
84 Ga0070660_100425709 3300005339 Bacteria 1099
85 Ga0070689_100002151 3300005340 Bacteria 12768
86 Ga0070691_10011476 3300005341 Bacteria 4047
87 Ga0070661_100002927 3300005344 Bacteria 11769
88 Ga0070661_100004341 3300005344 Bacteria 9783
89 Ga0070661_100011343 3300005344 Bacteria 6210
90 Ga0070661_100019995 3300005344 Bacteria 4772
91 Ga0070661_100070367 3300005344 Bacteria 2573
92 Ga0070661_100139879 3300005344 Bacteria 1824
93 Ga0070661_100357199 3300005344 Bacteria 1147
94 Ga0070692_10006380 3300005345 Bacteria 5120
95 Ga0070692_10050482 3300005345 Bacteria 2160
96 Ga0070692_10136632 3300005345 Bacteria 1383
97 Ga0070668_100255069 3300005347 Bacteria 1457
98 Ga0070668_100553881 3300005347 Bacteria 1001
99 Ga0070669_100028490 3300005353 Unclassified 4023
100 Ga0070688_100007703 3300005365 Bacteria 5816
101 Ga0070659_100001016 3300005366 Bacteria 20566
102 Ga0070659_100044182 3300005366 Bacteria 3487
103 Ga0070659_100100599 3300005366 Bacteria 2326
104 Ga0070659_100283617 3300005366 Bacteria 1378
105 Ga0070659_100326010 3300005366 Bacteria 1284
106 Ga0070667_100286557 3300005367 Bacteria 1480
107 Ga0070714_100000055 3300005435 Bacteria 103321
108 Ga0070714_100001542 3300005435 Bacteria 16793
109 Ga0070711_100458618 3300005439 Bacteria 1044
110 Ga0070663_100013140 3300005455 Bacteria 5265
111 Ga0070663_100016945 3300005455 Bacteria 4743
112 Ga0070663_100049637 3300005455 Bacteria 2981
113 Ga0070663_100059399 3300005455 Bacteria 2748
114 Ga0070663_100096149 3300005455 Bacteria 2203
115 Ga0070663_100142980 3300005455 Bacteria 1828
116 Ga0070663_100380499 3300005455 Bacteria 1149
117 Ga0070663_100419214 3300005455 Bacteria 1098
118 Ga0070663_100611877 3300005455 Bacteria 917
119 Ga0070662_100002882 3300005457 Bacteria 10670
120 Ga0070662_100055312 3300005457 Bacteria 2878
121 Ga0070662_100171934 3300005457 Bacteria 1702
122 Ga0070681_10000076 3300005458 Bacteria 73378
123 Ga0070681_10000082 3300005458 Bacteria 71460
124 Ga0070681_10001769 3300005458 Bacteria 19376
125 Ga0070681_10002020 3300005458 Bacteria 18373
126 Ga0070681_10019691 3300005458 Bacteria 6759
127 Ga0070681_10038625 3300005458 Bacteria 4786
128 Ga0070681_10139828 3300005458 Bacteria 2351
129 Ga0068867_100253558 3300005459 Unclassified 1432
130 Ga0070685_10003104 3300005466 Bacteria 8443
131 Ga0070679_100000150 3300005530 Bacteria 56196
132 Ga0070679_100002690 3300005530 Bacteria 16189
133 Ga0070679_100038896 3300005530 Bacteria 4730
134 Ga0070679_100331383 3300005530 Bacteria 1470
135 Ga0068853_100026573 3300005539 Bacteria 4861
136 Ga0068853_100050144 3300005539 Bacteria 3590
137 Ga0068853_100077903 3300005539 Bacteria 2896
138 Ga0068853_100080474 3300005539 Bacteria 2850
139 Ga0070696_100006301 3300005546 Bacteria 7945
140 Ga0070696_100007828 3300005546 Bacteria 7135
141 Ga0070696_100039568 3300005546 Bacteria 3255
142 Ga0070696_100078297 3300005546 Bacteria 2337
143 Ga0070696_100135184 3300005546 Bacteria 1797
144 Ga0070696_100151582 3300005546 Bacteria 1702
145 Ga0070693_100002312 3300005547 Bacteria 8745
146 Ga0070693_100215864 3300005547 Bacteria 1254
147 Ga0070693_100268260 3300005547 Bacteria 1138
148 Ga0070665_100004680 3300005548 Bacteria 14287
149 Ga0068855_100008081 3300005563 Bacteria 12713
150 Ga0068855_100028324 3300005563 Bacteria 6700
151 Ga0068855_100029024 3300005563 Bacteria 6616
152 Ga0068855_100045182 3300005563 Bacteria 5209
153 Ga0068855_100059762 3300005563 Bacteria 4459
154 Ga0068855_100068677 3300005563 Bacteria 4125
155 Ga0068855_100098070 3300005563 Bacteria 3376
156 Ga0068855_100330629 3300005563 Bacteria 1682
157 Ga0068857_100000491 3300005577 Bacteria 28321
158 Ga0068857_100004884 3300005577 Bacteria 11372
159 Ga0068857_100006493 3300005577 Bacteria 10030
160 Ga0068857_100008883 3300005577 Bacteria 8703
161 Ga0068857_100041984 3300005577 Bacteria 4055
162 Ga0068857_100050181 3300005577 Bacteria 3702
163 Ga0068857_100097524 3300005577 Bacteria 2636
164 Ga0068854_100000046 3300005578 Bacteria 91434
165 Ga0068854_100000553 3300005578 Bacteria 22562
166 Ga0068854_100006463 3300005578 Bacteria 7456
167 Ga0068854_100095604 3300005578 Bacteria 2218
168 Ga0068856_100000455 3300005614 Bacteria 45174
169 Ga0068856_100000920 3300005614 Bacteria 31509
170 Ga0068856_100092872 3300005614 Bacteria 3003
171 Ga0068856_100197240 3300005614 Bacteria 2027
172 Ga0068856_100351172 3300005614 Bacteria 1493
173 Ga0068852_100027789 3300005616 Bacteria 4617
174 Ga0068852_100031022 3300005616 Bacteria 4405
175 Ga0068852_100041326 3300005616 Bacteria 3896
176 Ga0068852_100073063 3300005616 Bacteria 3016
177 Ga0068852_100128436 3300005616 Bacteria 2331
178 Ga0068859_100058280 3300005617 Bacteria 3890
179 Ga0068851_10009883 3300005834 Bacteria 4443
180 Ga0068851_10019857 3300005834 Bacteria 3248
181 Ga0068858_100076311 3300005842 Bacteria 3112
182 Ga0068858_100119741 3300005842 Bacteria 2461
183 Ga0068858_100124197 3300005842 Bacteria 2416
184 Ga0068860_100012176 3300005843 Bacteria 8474
185 Ga0068860_100030058 3300005843 Bacteria 5225
186 Ga0068862_100133895 3300005844 Unclassified 2195
187 Ga0068862_100386074 3300005844 Bacteria 1307
188 Ga0070712_100379513 3300006175 Bacteria 1163
189 Ga0097621_100262196 3300006237 Unclassified 1516
190 Ga0075370_10187359 3300006353 Bacteria 1219
191 Ga0075428_100245945 3300006844 Bacteria 1929
192 Ga0075430_100299149 3300006846 Bacteria 1331
193 Ga0097620_100058280 3300006931 Bacteria 3890
194 Ga0105240_10000034 3300009093 Bacteria 278179
195 Ga0105240_10000115 3300009093 Bacteria 165594
196 Ga0105240_10002188 3300009093 Bacteria 31901
197 Ga0105240_10023081 3300009093 Bacteria 8239
198 Ga0105240_10038777 3300009093 Bacteria 6108
199 Ga0105240_10055731 3300009093 Bacteria 4949
200 Ga0105240_10096528 3300009093 Bacteria 3602
201 Ga0105240_10180600 3300009093 Bacteria 2490
202 Ga0105240_11158244 3300009093 Bacteria 820
203 Ga0111539_10093213 3300009094 Unclassified 3538
204 Ga0105247_10018919 3300009101 Bacteria 4136
205 Ga0105241_10071434 3300009174 Bacteria 2695
206 Ga0105241_10101948 3300009174 Bacteria 2283
207 Ga0105241_10102134 3300009174 Bacteria 2281
208 Ga0105237_10000016 3300009545 Bacteria 256506
209 Ga0105237_10000292 3300009545 Bacteria 69307
210 Ga0105237_10000371 3300009545 Bacteria 63699
211 Ga0105237_10022992 3300009545 Bacteria 6393
212 Ga0105237_10395027 3300009545 Bacteria 1388
213 Ga0105237_10899028 3300009545 Bacteria 892
214 Ga0105238_10000513 3300009551 Bacteria 40634
215 Ga0105238_10004930 3300009551 Bacteria 13211
216 Ga0105238_10014761 3300009551 Bacteria 7899
217 Ga0105238_10114787 3300009551 Bacteria 2672
218 Ga0105238_10222523 3300009551 Bacteria 1864
219 Ga0105238_10484842 3300009551 Bacteria 1236
220 Ga0105239_10000028 3300010375 Bacteria 243470
221 Ga0105239_10022879 3300010375 Bacteria 6889
222 Ga0105239_10224363 3300010375 Bacteria 2107
223 Ga0157314_1000063 3300012500 Bacteria 11461
224 Ga0157373_10004360 3300013100 Bacteria 10659
225 Ga0157373_10011828 3300013100 Bacteria 6411
226 Ga0157373_10013694 3300013100 Bacteria 5946
227 Ga0157373_10057998 3300013100 Bacteria 2745
228 Ga0157373_10099316 3300013100 Bacteria 2048
229 Ga0157373_10251251 3300013100 Bacteria 1251
230 Ga0157373_10461128 3300013100 Bacteria 915
231 Ga0157371_10012309 3300013102 Bacteria 6546
232 Ga0157371_10020425 3300013102 Bacteria 4874
233 Ga0157371_10022989 3300013102 Bacteria 4558
234 Ga0157371_10029872 3300013102 Bacteria 3935
235 Ga0157371_10050082 3300013102 Bacteria 2968
236 Ga0157371_10059351 3300013102 Bacteria 2712
237 Ga0157371_10093988 3300013102 Bacteria 2125
238 Ga0157371_10270923 3300013102 Bacteria 1225
239 Ga0157370_10007212 3300013104 Bacteria 12133
240 Ga0157370_10009789 3300013104 Bacteria 10166
241 Ga0157370_10011801 3300013104 Bacteria 9118
242 Ga0157370_10044317 3300013104 Bacteria 4276
243 Ga0157370_10047443 3300013104 Bacteria 4117
244 Ga0157370_10097411 3300013104 Bacteria 2759
245 Ga0157370_10103285 3300013104 Bacteria 2668
246 Ga0157370_10107394 3300013104 Bacteria 2611
247 Ga0157370_10263870 3300013104 Bacteria 1591
248 Ga0157370_10855558 3300013104 Bacteria 826
249 Ga0157369_10001146 3300013105 Bacteria 33054
250 Ga0157369_10006957 3300013105 Bacteria 13046
251 Ga0157369_10010587 3300013105 Bacteria 10499
252 Ga0157369_10018469 3300013105 Bacteria 7817
253 Ga0157369_10067314 3300013105 Bacteria 3851
254 Ga0157369_10087141 3300013105 Bacteria 3334
255 Ga0157369_10575070 3300013105 Bacteria 1164
256 Ga0163162_10001591 3300013306 Bacteria 21239
257 Ga0163162_10051171 3300013306 Bacteria 4144
258 Ga0157372_10010749 3300013307 Bacteria 9744
259 Ga0157372_10033446 3300013307 Bacteria 5648
260 Ga0157372_10039362 3300013307 Bacteria 5217
261 Ga0157372_10066986 3300013307 Bacteria 4034
262 Ga0157372_10147519 3300013307 Bacteria 2713
263 Ga0157372_10183051 3300013307 Bacteria 2425
264 Ga0157372_10237491 3300013307 Bacteria 2114
265 Ga0157372_10370452 3300013307 Bacteria 1669
266 Ga0182008_10015782 3300014497 Bacteria 3935
267 Ga0182008_10048243 3300014497 Bacteria 2115
268 Ga0182008_10062622 3300014497 Bacteria 1833
269 Ga0182008_10105886 3300014497 Bacteria 1391
270 Ga0182008_10109647 3300014497 Bacteria 1368
271 Ga0182008_10305399 3300014497 Bacteria 834
272 Ga0182006_1000061 3300015261 Bacteria 156823
273 Ga0182006_1007237 3300015261 Bacteria 5096
274 Ga0182006_1012331 3300015261 Bacteria 3736
275 Ga0182006_1037503 3300015261 Bacteria 1921
276 Ga0182006_1041976 3300015261 Bacteria 1794
277 Ga0182007_10005804 3300015262 Bacteria 5366
278 Ga0182007_10009625 3300015262 Bacteria 3881
279 Ga0182007_10011279 3300015262 Bacteria 3482
280 Ga0182005_1001560 3300015265 Bacteria 9061
281 Ga0182005_1003115 3300015265 Bacteria 5711
282 Ga0183369_1004 3300015685 Bacteria 539301
283 Ga0183360_10001 3300015689 Bacteria 3943671
284 Ga0163161_10046760 3300017792 Bacteria 3123
285 Ga0163161_10065114 3300017792 Bacteria 2659
286 Ga0197907_10080030 3300020069 Bacteria 6332
287 Ga0197907_10217144 3300020069 Bacteria 1686
288 Ga0206356_10379243 3300020070 Bacteria 2960
289 Ga0206356_10546730 3300020070 Bacteria 4793
290 Ga0206349_1686371 3300020075 Bacteria 1670
291 Ga0206355_1394520 3300020076 Bacteria 1181
292 Ga0206352_10220409 3300020078 Bacteria 2931
293 Ga0206352_10962774 3300020078 Bacteria 1129
294 Ga0206350_10303956 3300020080 Bacteria 1596
295 Ga0206354_10121428 3300020081 Bacteria 4729
296 Ga0206354_10883312 3300020081 Bacteria 13243
297 Ga0206354_11113808 3300020081 Bacteria 3972
298 Ga0206354_11431445 3300020081 Bacteria 1826
299 Ga0206353_10063786 3300020082 Bacteria 9300
300 Ga0206353_11738411 3300020082 Bacteria 1968
301 Ga0206353_11944126 3300020082 Bacteria 4124
302 Ga0206353_11975562 3300020082 Bacteria 892
303 Ga0154015_1139938 3300020610 Bacteria 2708
304 Ga0154015_1183830 3300020610 Bacteria 841
305 Ga0154015_1595600 3300020610 Bacteria 4141
306 Ga0154015_1641253 3300020610 Bacteria 1119
307 Ga0224712_10005613 3300022467 Bacteria 3514
308 Ga0224712_10037405 3300022467 Bacteria 1806
309 Ga0224712_10178530 3300022467 Bacteria 955
310 Ga0209760_100384 3300025207 Bacteria 11402
311 Ga0209784_100026 3300025224 Bacteria 371540
312 Ga0209566_103460 3300025225 Bacteria 2417
313 Ga0209674_100026 3300025226 Bacteria 490631
314 Ga0209674_101816 3300025226 Bacteria 5105
315 Ga0209672_100007 3300025228 Bacteria 959482
316 Ga0209672_100017 3300025228 Bacteria 514236
317 Ga0209672_100239 3300025228 Bacteria 41496
318 Ga0209672_100412 3300025228 Bacteria 25217
319 Ga0209672_101232 3300025228 Bacteria 10326
320 Ga0209563_100074 3300025230 Bacteria 224912
321 Ga0207427_100023 3300025231 Bacteria 439725
322 Ga0207427_100213 3300025231 Bacteria 51669
323 Ga0207427_104431 3300025231 Bacteria 2369
324 Ga0207427_106434 3300025231 Bacteria 1490
325 Ga0209437_100069 3300025233 Bacteria 307733
326 Ga0209437_100194 3300025233 Bacteria 121991
327 Ga0209437_100381 3300025233 Bacteria 43879
328 Ga0209437_100838 3300025233 Bacteria 13401
329 Ga0209258_100017 3300025242 Bacteria 590785
330 Ga0209258_100038 3300025242 Bacteria 398959
331 Ga0209258_100059 3300025242 Bacteria 324934
332 Ga0209258_100118 3300025242 Bacteria 183558
333 Ga0209258_100144 3300025242 Bacteria 163814
334 Ga0209258_100635 3300025242 Bacteria 27631
335 Ga0209258_102018 3300025242 Bacteria 5845
336 Ga0207425_1001356 3300025245 Bacteria 10440
337 Ga0209646_1000264 3300025246 Bacteria 51141
338 Ga0209646_1001043 3300025246 Bacteria 8360
339 Ga0209646_1001117 3300025246 Bacteria 7912
340 Ga0209026_1000036 3300025250 Bacteria 296607
341 Ga0209026_1000044 3300025250 Bacteria 266550
342 Ga0209026_1000191 3300025250 Bacteria 88578
343 Ga0209026_1000785 3300025250 Bacteria 17557
344 Ga0209026_1005549 3300025250 Bacteria 3361
345 Ga0209677_103542 3300025253 Bacteria 4978
346 Ga0209148_1000002 3300025254 Bacteria 2399500
347 Ga0209148_1000009 3300025254 Bacteria 1395625
348 Ga0209148_1000010 3300025254 Bacteria 1265567
349 Ga0209148_1000024 3300025254 Bacteria 669890
350 Ga0209148_1000044 3300025254 Bacteria 458417
351 Ga0209148_1000141 3300025254 Bacteria 163821
352 Ga0209148_1000706 3300025254 Bacteria 26856
353 Ga0209759_1000023 3300025256 Bacteria 321695
354 Ga0209759_1000517 3300025256 Bacteria 41788
355 Ga0209759_1000779 3300025256 Bacteria 26706
356 Ga0209759_1001117 3300025256 Bacteria 17277
357 Ga0209759_1014477 3300025256 Bacteria 2084
358 Ga0209129_1000035 3300025258 Bacteria 329303
359 Ga0209129_1001844 3300025258 Bacteria 11219
360 Ga0209233_1000009 3300025261 Bacteria 1265567
361 Ga0209233_1000323 3300025261 Bacteria 51669
362 Ga0209233_1014309 3300025261 Bacteria 2239
363 Ga0209233_1015779 3300025261 Bacteria 2094
364 Ga0209233_1031104 3300025261 Bacteria 1250
365 Ga0209565_1002154 3300025263 Bacteria 7411
366 Ga0209565_1023712 3300025263 Bacteria 1259
367 Ga0209455_1000010 3300025272 Bacteria 959482
368 Ga0209455_1000020 3300025272 Bacteria 702259
369 Ga0209455_1000025 3300025272 Bacteria 670673
370 Ga0209455_1000032 3300025272 Bacteria 514243
371 Ga0209455_1000380 3300025272 Bacteria 40273
372 Ga0209455_1005134 3300025272 Bacteria 4117
373 Ga0209455_1009394 3300025272 Bacteria 2572
374 Ga0209564_1000024 3300025295 Bacteria 535041
375 Ga0209758_1000066 3300025297 Bacteria 298620
376 Ga0209758_1000290 3300025297 Bacteria 98878
377 Ga0209758_1021411 3300025297 Bacteria 3015
378 Ga0207426_1013399 3300025302 Bacteria 3040
379 Ga0209257_1026233 3300025304 Bacteria 1969
380 Ga0209257_1055762 3300025304 Bacteria 1094
381 Ga0207656_10004076 3300025321 Bacteria 5070
382 Ga0207656_10009850 3300025321 Bacteria 3557
383 Ga0207710_10008401 3300025900 Bacteria 4354
384 Ga0207680_10000003 3300025903 Bacteria 925264
385 Ga0207647_10000237 3300025904 Bacteria 45127
386 Ga0207647_10001096 3300025904 Bacteria 20884
387 Ga0207647_10003895 3300025904 Bacteria 11149
388 Ga0207647_10003907 3300025904 Bacteria 11132
389 Ga0207647_10021325 3300025904 Bacteria 4326
390 Ga0207705_10000029 3300025909 Bacteria 239897
391 Ga0207705_10000439 3300025909 Bacteria 35994
392 Ga0207705_10000614 3300025909 Bacteria 29837
393 Ga0207705_10003279 3300025909 Bacteria 12329
394 Ga0207705_10006884 3300025909 Bacteria 8402
395 Ga0207705_10046918 3300025909 Bacteria 3106
396 Ga0207707_10000018 3300025912 Bacteria 215518
397 Ga0207707_10000036 3300025912 Bacteria 146159
398 Ga0207707_10000042 3300025912 Bacteria 126050
399 Ga0207707_10000049 3300025912 Bacteria 117480
400 Ga0207707_10001192 3300025912 Bacteria 24480
401 Ga0207707_10001753 3300025912 Bacteria 19927
402 Ga0207707_10014212 3300025912 Bacteria 6935
403 Ga0207707_10019535 3300025912 Bacteria 5915
404 Ga0207707_10028042 3300025912 Bacteria 4921
405 Ga0207707_10028420 3300025912 Bacteria 4888
406 Ga0207707_10049094 3300025912 Bacteria 3677
407 Ga0207695_10000101 3300025913 Bacteria 258504
408 Ga0207695_10000116 3300025913 Bacteria 239510
409 Ga0207695_10000307 3300025913 Bacteria 118870
410 Ga0207695_10001055 3300025913 Bacteria 48329
411 Ga0207695_10001683 3300025913 Bacteria 35550
412 Ga0207695_10013533 3300025913 Bacteria 9722
413 Ga0207695_10018303 3300025913 Bacteria 8104
414 Ga0207695_10030863 3300025913 Bacteria 5894
415 Ga0207695_10035270 3300025913 Bacteria 5428
416 Ga0207671_10000013 3300025914 Bacteria 478458
417 Ga0207671_10002057 3300025914 Bacteria 22047
418 Ga0207660_10000206 3300025917 Bacteria 37525
419 Ga0207660_10000948 3300025917 Bacteria 19217
420 Ga0207660_10001219 3300025917 Bacteria 17202
421 Ga0207660_10003795 3300025917 Bacteria 9840
422 Ga0207660_10047625 3300025917 Bacteria 3032
423 Ga0207657_10006454 3300025919 Bacteria 12154
424 Ga0207657_10007522 3300025919 Bacteria 11165
425 Ga0207657_10032347 3300025919 Bacteria 4727
426 Ga0207657_10091368 3300025919 Bacteria 2539
427 Ga0207657_10532016 3300025919 Bacteria 919
428 Ga0207657_10554293 3300025919 Bacteria 899
429 Ga0207649_10000219 3300025920 Bacteria 46974
430 Ga0207649_10069089 3300025920 Bacteria 2248
431 Ga0207649_10118571 3300025920 Bacteria 1781
432 Ga0207649_10167275 3300025920 Bacteria 1528
433 Ga0207652_10000014 3300025921 Bacteria 196569
434 Ga0207652_10000099 3300025921 Bacteria 93755
435 Ga0207652_10001601 3300025921 Bacteria 19926
436 Ga0207652_10002446 3300025921 Bacteria 15682
437 Ga0207652_10004532 3300025921 Bacteria 11278
438 Ga0207652_10069664 3300025921 Bacteria 3054
439 Ga0207652_10097407 3300025921 Bacteria 2592
440 Ga0207681_10037105 3300025923 Unclassified 3220
441 Ga0207694_10000151 3300025924 Bacteria 71870
442 Ga0207694_10020553 3300025924 Bacteria 4997
443 Ga0207694_10114991 3300025924 Bacteria 2143
444 Ga0207694_10314550 3300025924 Bacteria 1291
445 Ga0207664_10000030 3300025929 Bacteria 179903
446 Ga0207664_10003028 3300025929 Bacteria 11174
447 Ga0207690_10000096 3300025932 Bacteria 72704
448 Ga0207690_10002264 3300025932 Bacteria 11741
449 Ga0207690_10004228 3300025932 Bacteria 8484
450 Ga0207690_10006491 3300025932 Bacteria 6935
451 Ga0207690_10009614 3300025932 Bacteria 5740
452 Ga0207690_10017568 3300025932 Bacteria 4371
453 Ga0207690_10052709 3300025932 Bacteria 2726
454 Ga0207690_10058549 3300025932 Bacteria 2606
455 Ga0207690_10694526 3300025932 Bacteria 836
456 Ga0207706_10003820 3300025933 Bacteria 14360
457 Ga0207706_10025734 3300025933 Bacteria 5271
458 Ga0207706_10060840 3300025933 Bacteria 3326
459 Ga0207670_10000897 3300025936 Bacteria 15695
460 Ga0207711_10923001 3300025941 Unclassified 811
461 Ga0207661_10006602 3300025944 Bacteria 8200
462 Ga0207661_10009873 3300025944 Bacteria 6856
463 Ga0207661_10364657 3300025944 Bacteria 1305
464 Ga0207679_10010175 3300025945 Bacteria 6052
465 Ga0207679_10731834 3300025945 Bacteria 899
466 Ga0207667_10000040 3300025949 Bacteria 275827
467 Ga0207667_10000047 3300025949 Bacteria 240471
468 Ga0207667_10000075 3300025949 Bacteria 169836
469 Ga0207667_10002530 3300025949 Bacteria 22759
470 Ga0207667_10002947 3300025949 Bacteria 21120
471 Ga0207667_10012337 3300025949 Bacteria 9857
472 Ga0207667_10013444 3300025949 Bacteria 9368
473 Ga0207667_10254442 3300025949 Bacteria 1797
474 Ga0207667_10431429 3300025949 Bacteria 1340
475 Ga0207640_10000009 3300025981 Bacteria 283101
476 Ga0207640_10000461 3300025981 Bacteria 24827
477 Ga0207640_10000682 3300025981 Bacteria 19736
478 Ga0207640_10002087 3300025981 Bacteria 10754
479 Ga0207640_10005417 3300025981 Bacteria 6958
480 Ga0207640_10079017 3300025981 Bacteria 2241
481 Ga0207640_10100430 3300025981 Bacteria 2027
482 Ga0207640_10233420 3300025981 Bacteria 1417
483 Ga0207658_10117124 3300025986 Bacteria 2117
484 Ga0207703_10057954 3300026035 Bacteria 3160
485 Ga0207703_10278225 3300026035 Bacteria 1519
486 Ga0207703_10399113 3300026035 Bacteria 1275
487 Ga0207639_10000403 3300026041 Bacteria 29844
488 Ga0207639_10001846 3300026041 Bacteria 14260
489 Ga0207639_10008206 3300026041 Bacteria 7148
490 Ga0207639_10352579 3300026041 Bacteria 1314
491 Ga0207639_10408235 3300026041 Bacteria 1225
492 Ga0207678_10000612 3300026067 Bacteria 32677
493 Ga0207678_10001123 3300026067 Bacteria 24559
494 Ga0207678_10002596 3300026067 Bacteria 16458
495 Ga0207678_10017625 3300026067 Bacteria 6268
496 Ga0207678_10024508 3300026067 Bacteria 5271
497 Ga0207678_10030697 3300026067 Bacteria 4692
498 Ga0207678_10042733 3300026067 Bacteria 3924
499 Ga0207678_10117295 3300026067 Bacteria 2271
500 Ga0207678_10127520 3300026067 Bacteria 2170
501 Ga0207678_10129015 3300026067 Bacteria 2156
502 Ga0207678_10180379 3300026067 Bacteria 1803
503 Ga0207678_10438790 3300026067 Bacteria 1134
504 Ga0207678_10538969 3300026067 Bacteria 1020
505 Ga0207702_10000608 3300026078 Bacteria 39599
506 Ga0207702_10002529 3300026078 Bacteria 17222
507 Ga0207702_10005706 3300026078 Bacteria 10855
508 Ga0207702_10275207 3300026078 Bacteria 1589
509 Ga0207648_10274219 3300026089 Unclassified 1507
510 Ga0207648_11019481 3300026089 Bacteria 775
511 Ga0207674_10000012 3300026116 Bacteria 193220
512 Ga0207674_10004576 3300026116 Bacteria 16605
513 Ga0207674_10008336 3300026116 Bacteria 11991
514 Ga0207674_10009386 3300026116 Bacteria 11184
515 Ga0207674_10014417 3300026116 Bacteria 8731
516 Ga0207674_10027320 3300026116 Bacteria 6039
517 Ga0207674_10129007 3300026116 Bacteria 2493
518 Ga0207698_10000152 3300026142 Bacteria 44402
519 Ga0207698_10001073 3300026142 Bacteria 15905
520 Ga0207698_10022815 3300026142 Bacteria 4360
521 Ga0207698_10126755 3300026142 Bacteria 2173
522 Ga0268266_10000011 3300028379 Bacteria 757403
523 Ga0268265_10074347 3300028380 Bacteria 2658
524 Ga0268265_10349700 3300028380 Bacteria 1349
525 Ga0268265_10363697 3300028380 Unclassified 1325
526 Ga0268265_10720434 3300028380 Bacteria 966
527 Ga0268264_10054343 3300028381 Bacteria 3344
528 Ga0268264_10069026 3300028381 Bacteria 2988
529 Ga0307515_10284519 3300028794 Bacteria 1357
530 Ga0307515_10614803 3300028794 Bacteria 698
531 Ga0265338_10390956 3300028800 Bacteria 993
532 Ga0265340_10014712 3300031247 Bacteria 4081
533 Ga0265340_10233119 3300031247 Bacteria 823
534 Ga0265331_10083517 3300031250 Bacteria 1481
535 Ga0307412_10000592 3300031911 Bacteria 21434
536 Ga0307416_100767751 3300032002 Bacteria 1058
537 Ga0307510_10003183 3300033180 Bacteria 19050
538 Ga0307510_10216741 3300033180 Bacteria 1430
539 Ga0395899_0000062 3300037312 Bacteria 211388
540 Ga0395899_0018866 3300037312 Bacteria 5241
541 Ga0395899_0025640 3300037312 Bacteria 4450
542 Ga0395899_0067173 3300037312 Bacteria 2631
543 Ga0395899_0088006 3300037312 Bacteria 2253
544 Ga0395899_0308698 3300037312 Bacteria 1068
545 Ga0395900_0000039 3300037418 Bacteria 248722
546 Ga0395900_0016300 3300037418 Bacteria 7575
547 Ga0395900_0036728 3300037418 Bacteria 5050
548 Ga0395900_0278537 3300037418 Bacteria 1665
549 Ga0395900_0471676 3300037418 Bacteria 1208
550 Ga0395898_0000140 3300037466 Bacteria 190587
551 Ga0395898_0006775 3300037466 Bacteria 12200
552 Ga0395898_0108134 3300037466 Bacteria 2666
553 Ga0395898_0211832 3300037466 Bacteria 1848
554 Ga0395905_0252157 3300037471 Bacteria 1648
555 Ga0395905_0408977 3300037471 Bacteria 1252
556 Ga0395901_0000215 3300038443 Bacteria 72912
557 Ga0395901_0002859 3300038443 Bacteria 17439
558 Ga0395901_0022178 3300038443 Bacteria 6506
559 Ga0395901_0069528 3300038443 Bacteria 3667
560 Ga0395901_0070487 3300038443 Bacteria 3642
561 Ga0395901_0131605 3300038443 Bacteria 2629
562 Ga0395901_0225936 3300038443 Bacteria 1955
563 Ga0395901_0522629 3300038443 Bacteria 1205
564 Ga0439436_0000063 3300041404 Bacteria 29794
565 Ga0439465_0001557 3300041413 Bacteria 7457
566 Ga0451793_0622521 3300041452 Bacteria 6672
567 Ga0451793_0733104 3300041452 Bacteria 1033
568 Ga0451795_1375120 3300041456 Bacteria 874
569 Ga0451800_0901466 3300041459 Bacteria 1660
570 Ga0451806_170739 3300041462 Bacteria 1595
571 Ga0451804_1024051 3300041463 Bacteria 1514
572 Ga0451807_1329070 3300041486 Bacteria 1604
573 Ga0451833_1479516 3300041491 Bacteria 1060
574 Ga0451839_1292742 3300041496 Bacteria 816
575 Ga0439437_001853 3300042000 Bacteria 2243
576 Ga0439445_0008323 3300042004 Bacteria 2425
577 Ga0439432_010194 3300042006 Bacteria 3262
578 Ga0450908_000063 3300042184 Bacteria 21431
579 Ga0439459_0000678 3300042438 Bacteria 4650
580 Ga0439459_0022160 3300042438 Bacteria 1227
581 Ga0466988_0162073 3300044536 Bacteria 1297
582 Ga0466969_0002237 3300044656 Bacteria 10334
583 Ga0466969_0075315 3300044656 Bacteria 1617
584 Ga0466972_0043646 3300044658 Bacteria 2176
585 Ga0466982_0000008 3300044672 Bacteria 240089
586 Ga0466982_0002390 3300044672 Bacteria 7610
587 Ga0466965_0002578 3300044683 Bacteria 7745
588 Ga0466966_0002292 3300044684 Bacteria 12471
589 Ga0466966_0015333 3300044684 Bacteria 5067
590 Ga0466966_0016192 3300044684 Bacteria 4930
591 Ga0466961_0002335 3300044693 Bacteria 11788
592 Ga0466961_0002655 3300044693 Bacteria 11099
593 Ga0466961_0003660 3300044693 Bacteria 9582
594 Ga0466961_0094923 3300044693 Bacteria 1881
595 Ga0466961_0173436 3300044693 Bacteria 1341
596 Ga0466961_0227073 3300044693 Bacteria 1149
597 Ga0466963_0093523 3300044694 Bacteria 2050
598 Ga0466964_0037442 3300044706 Bacteria 1948
599 Ga0466971_0013101 3300044719 Bacteria 3636
600 Ga0466971_0040583 3300044719 Bacteria 2090
601 Ga0466971_0316907 3300044719 Bacteria 751
602 Ga0466968_0050108 3300044735 Bacteria 1780
603 Ga0466970_0000163 3300044765 Bacteria 31774
604 Ga0466970_0018568 3300044765 Bacteria 3601
605 Ga0466970_0479993 3300044765 Bacteria 714
606 Ga0466957_0035438 3300044842 Bacteria 2994
607 Ga0466957_0039415 3300044842 Bacteria 2850
608 Ga0466960_0020456 3300044901 Bacteria 2931
609 Ga0466959_0000383 3300045049 Bacteria 26156
610 Ga0466959_0008445 3300045049 Bacteria 7283
611 Ga0466959_0026648 3300045049 Bacteria 4284
612 Ga0466958_0006626 3300045836 Bacteria 6315
613 Ga0466958_0016066 3300045836 Bacteria 4305
614 Ga0466958_0097079 3300045836 Bacteria 1828
615 Ga0466958_0134176 3300045836 Bacteria 1556
616 Ga0466967_0345550 3300045976 Bacteria 1439
617 Ga0495617_000114 3300046452 Bacteria 56455
618 Ga0495617_000412 3300046452 Bacteria 23404
619 Ga0495638_0000063 3300046460 Bacteria 185733
620 Ga0495638_0000065 3300046460 Bacteria 170849
621 Ga0495638_0000135 3300046460 Bacteria 118223
622 Ga0495638_0000148 3300046460 Bacteria 110710
623 Ga0495638_0011938 3300046460 Bacteria 5971
624 Ga0495650_0000078 3300046471 Bacteria 245487
625 Ga0495650_0000222 3300046471 Bacteria 118200
626 Ga0495650_0001488 3300046471 Bacteria 22356
627 Ga0495650_0010026 3300046471 Bacteria 5330
628 Ga0495605_0204633 3300046474 Bacteria 859
629 Ga0495584_0001381 3300046491 Bacteria 14631
630 Ga0495585_0000063 3300046492 Bacteria 109530
631 Ga0495585_0003226 3300046492 Bacteria 11126
632 Ga0495607_0000029 3300046501 Bacteria 155005
633 Ga0495607_0000100 3300046501 Bacteria 91570
634 Ga0495607_0004039 3300046501 Bacteria 11006
635 Ga0495606_0000351 3300046507 Bacteria 78808
636 Ga0495606_0000427 3300046507 Bacteria 70054
637 Ga0495606_0001737 3300046507 Bacteria 27992
638 Ga0495606_0028699 3300046507 Bacteria 3920
639 Ga0495606_0071954 3300046507 Bacteria 2175
640 Ga0495606_0225441 3300046507 Bacteria 1053
641 Ga0495610_0002695 3300046512 Bacteria 14636
642 Ga0495610_0085140 3300046512 Bacteria 1443
643 Ga0495616_0000183 3300046513 Bacteria 53040
644 Ga0495616_0014578 3300046513 Bacteria 4395
645 Ga0495620_0000090 3300046515 Bacteria 73605
646 Ga0495620_0019009 3300046515 Bacteria 3390
647 Ga0495631_0000055 3300046518 Bacteria 69950
648 Ga0495631_0000458 3300046518 Bacteria 27678
649 Ga0495632_0008465 3300046519 Bacteria 6312
650 Ga0495632_0024202 3300046519 Bacteria 3230
651 Ga0495637_0005939 3300046520 Bacteria 6174
652 Ga0495648_0000324 3300046524 Bacteria 53060
653 Ga0495648_0009773 3300046524 Bacteria 7386
654 Ga0495609_0004473 3300046538 Bacteria 7638
655 Ga0495633_0009082 3300046558 Bacteria 5526
656 Ga0495668_0002335 3300046616 Bacteria 15798
657 Ga0495611_0000003 3300046648 Bacteria 395679
658 Ga0495611_0000018 3300046648 Bacteria 126654
659 Ga0495625_0000019 3300046660 Bacteria 298330
660 Ga0495625_0021104 3300046660 Bacteria 5020
661 Ga0495625_0104538 3300046660 Bacteria 1941
662 Ga0495625_0116267 3300046660 Bacteria 1824
663 Ga0495625_0123154 3300046660 Bacteria 1762
664 Ga0495661_0001253 3300046665 Bacteria 21924
665 Ga0495661_0240530 3300046665 Bacteria 929
666 Ga0495670_0000081 3300046691 Bacteria 42730
667 Ga0495670_0000602 3300046691 Bacteria 17157
668 Ga0495670_0028808 3300046691 Bacteria 2753
669 Ga0495671_0000611 3300046692 Bacteria 26141
670 Ga0495649_0003118 3300046694 Bacteria 11354
671 Ga0495649_0078981 3300046694 Bacteria 1760
672 Ga0495589_0000018 3300046794 Bacteria 204851
673 Ga0495660_0000164 3300046810 Bacteria 71324
674 Ga0495660_0000223 3300046810 Bacteria 56336
675 Ga0495683_0001383 3300047323 Bacteria 16072
676 Ga0495679_000017 3300047446 Bacteria 263230
677 Ga0495673_0000004 3300047469 Bacteria 1354526
678 Ga0495673_0000133 3300047469 Bacteria 137275
679 Ga0495673_0000318 3300047469 Bacteria 62287
680 Ga0495673_0018718 3300047469 Bacteria 3486
681 Ga0495686_0000033 3300047472 Bacteria 342031
682 Ga0495686_0000527 3300047472 Bacteria 55036
683 Ga0495686_0003732 3300047472 Bacteria 12988
684 Ga0495686_0008030 3300047472 Bacteria 7823
685 Ga0495686_0066483 3300047472 Bacteria 2227
686 Ga0496100_0000781 3300048903 Bacteria 15174
687 Ga0496100_0119632 3300048903 Bacteria 1840
688 Ga0496101_0009582 3300048904 Bacteria 6370
689 Ga0496101_0084238 3300048904 Bacteria 2354
690 Ga0496102_0166073 3300048905 Bacteria 2077
691 Ga0496102_0251893 3300048905 Bacteria 1665
692 Ga0496105_0000292 3300048908 Bacteria 33006
693 Ga0496106_0052036 3300048909 Bacteria 3088
694 Ga0496106_0122965 3300048909 Bacteria 2030
695 Ga0496107_0024465 3300048910 Bacteria 4272
696 Ga0496107_0290366 3300048910 Bacteria 1217
697 Ga0496107_0332135 3300048910 Bacteria 1131
698 Ga0496115_0000072 3300048918 Bacteria 91408
699 Ga0496115_0004358 3300048918 Bacteria 10242
700 Ga0496115_0095944 3300048918 Bacteria 2427
701 Ga0496116_0088552 3300048919 Bacteria 1891
702 Ga0496117_0012299 3300048920 Bacteria 7564
703 Ga0496117_0026259 3300048920 Bacteria 4561
704 Ga0496117_0027636 3300048920 Bacteria 4414
705 Ga0496117_0083089 3300048920 Bacteria 2095
706 Ga0496118_0000865 3300048921 Bacteria 47971
707 Ga0496118_0001698 3300048921 Bacteria 32205
708 Ga0496118_0003419 3300048921 Bacteria 20039
709 Ga0496118_0007498 3300048921 Bacteria 11541
710 Ga0496119_0000030 3300048922 Bacteria 240167
711 Ga0496119_0002030 3300048922 Bacteria 22904
712 Ga0496119_0260519 3300048922 Bacteria 870
713 Ga0496120_0000015 3300048923 Bacteria 310795
714 Ga0496120_0000033 3300048923 Bacteria 218355
715 Ga0496120_0225709 3300048923 Bacteria 892
716 Ga0496121_0000063 3300048924 Bacteria 273080
717 Ga0496121_0000109 3300048924 Bacteria 187307
718 Ga0496121_0000633 3300048924 Bacteria 65667
719 Ga0496121_0000922 3300048924 Bacteria 53157
720 Ga0496121_0002272 3300048924 Bacteria 29909
721 Ga0496121_0018889 3300048924 Bacteria 6920
722 Ga0496121_0059446 3300048924 Bacteria 3151
723 Ga0496121_0065660 3300048924 Bacteria 2951
724 Ga0496121_0108098 3300048924 Bacteria 2128
725 Ga0496121_0131212 3300048924 Bacteria 1875
726 Ga0496121_0251492 3300048924 Bacteria 1225
727 Ga0496121_0263927 3300048924 Bacteria 1187
728 Ga0496122_0006000 3300048925 Bacteria 14189
729 Ga0496122_0025750 3300048925 Bacteria 5096
730 Ga0496122_0073026 3300048925 Bacteria 2435
731 Ga0496123_0005505 3300048926 Bacteria 12731
732 Ga0496123_0030269 3300048926 Bacteria 3965
733 Ga0496123_0192713 3300048926 Bacteria 1053
734 Ga0496124_0000763 3300048927 Bacteria 52572
735 Ga0496124_0005424 3300048927 Bacteria 14354
736 Ga0496124_0095312 3300048927 Bacteria 2419
737 Ga0496125_0000044 3300048928 Bacteria 296762
738 Ga0496125_0001166 3300048928 Bacteria 39790
739 Ga0496126_0001457 3300048929 Bacteria 36967
740 Ga0496126_0004543 3300048929 Bacteria 16500
741 Ga0496126_0007800 3300048929 Bacteria 11669
742 Ga0496126_0050859 3300048929 Bacteria 3775
743 Ga0496126_0096004 3300048929 Bacteria 2599
744 Ga0496126_0378631 3300048929 Bacteria 1152
745 Ga0496126_0490696 3300048929 Bacteria 983
746 Ga0495678_000152 3300049459 Bacteria 83891
747 Ga0495678_033497 3300049459 Bacteria 2120
748 Ga0495682_0003681 3300049460 Bacteria 6759
749 Ga0495682_0004504 3300049460 Bacteria 5944
750 Ga0495682_0008410 3300049460 Bacteria 4063
751 Ga0501298_023967 3300049521 Bacteria 1160
752 Ga0501032_0063381 3300049569 Bacteria 2475
753 Ga0501033_0147609 3300049570 Bacteria 1698
754 Ga0501034_0351593 3300049571 Bacteria 1402
755 Ga0501036_0023361 3300049572 Bacteria 5208
756 Ga0501037_0030992 3300049573 Bacteria 3949
757 Ga0501037_0089240 3300049573 Bacteria 2231
758 Ga0501037_0113767 3300049573 Bacteria 1948
759 Ga0501037_0145832 3300049573 Bacteria 1693
760 Ga0501038_0008320 3300049574 Bacteria 9548
761 Ga0501038_0195290 3300049574 Bacteria 1627
762 Ga0501038_0252901 3300049574 Bacteria 1395
763 Ga0501043_0097426 3300049579 Bacteria 2312
764 Ga0501043_0374305 3300049579 Bacteria 1079
765 Ga0501046_0253963 3300049580 Bacteria 1293
766 Ga0501046_0352865 3300049580 Bacteria 1068
767 Ga0501047_0078755 3300049581 Bacteria 3169
768 Ga0501047_0150264 3300049581 Bacteria 2205
769 Ga0501047_0301893 3300049581 Bacteria 1443
770 Ga0501047_0323984 3300049581 Bacteria 1380
771 Ga0501069_0054954 3300049585 Bacteria 2217
772 Ga0501070_0006571 3300049586 Bacteria 9896
773 Ga0501070_0025227 3300049586 Bacteria 4984
774 Ga0501070_0033602 3300049586 Bacteria 4293
775 Ga0501070_0155144 3300049586 Bacteria 1888
776 Ga0501070_0166670 3300049586 Bacteria 1815
777 Ga0501070_0376082 3300049586 Bacteria 1151
778 Ga0501070_0447998 3300049586 Bacteria 1041
779 Ga0501070_0672590 3300049586 Bacteria 820
780 Ga0501071_0000682 3300049587 Bacteria 17738
781 Ga0501071_0732020 3300049587 Bacteria 762
782 Ga0501073_0003157 3300049589 Bacteria 12356
783 Ga0501073_0125095 3300049589 Bacteria 1782
784 Ga0501074_0000064 3300049590 Bacteria 50638
785 Ga0501074_0015297 3300049590 Bacteria 5576
786 Ga0501077_0028303 3300049593 Bacteria 3561
787 Ga0501199_008637 3300049650 Bacteria 1070
788 Ga0501079_0090092 3300049741 Bacteria 2376
789 Ga0501079_0455174 3300049741 Bacteria 1005
790 Ga0501079_0506862 3300049741 Bacteria 949
791 Ga0501080_0000816 3300049742 Bacteria 25408
792 Ga0501080_0022292 3300049742 Bacteria 5866
793 Ga0501080_0081299 3300049742 Bacteria 3010
794 Ga0501080_0618270 3300049742 Bacteria 960
795 Ga0501035_0001993 3300049822 Bacteria 20407
796 Ga0501035_0026002 3300049822 Bacteria 5361
797 Ga0501035_0049805 3300049822 Bacteria 3754
798 Ga0501035_0171146 3300049822 Bacteria 1876
799 Ga0501035_0197599 3300049822 Bacteria 1726
800 Ga0501044_0005303 3300049823 Bacteria 14336
801 Ga0501044_0019098 3300049823 Bacteria 7338
802 Ga0501044_0021274 3300049823 Bacteria 6924
803 Ga0501044_0167382 3300049823 Bacteria 2171
804 nmdc:mga07m45_49751_c1 3300050496 Bacteria 2360
805 nmdc:mga08y16_225864_c1 3300050511 Unclassified 1937
806 Ga0500643_000029 3300053087 Bacteria 211149
807 Ga0500643_002345 3300053087 Bacteria 9893
808 Ga0500646_0053849 3300053090 Bacteria 1167
809 Ga0500555_000260 3300053103 Bacteria 23244
810 Ga0500597_000371 3300053120 Bacteria 9331
811 Ga0500633_0000233 3300053160 Bacteria 7951
812 Ga0500634_0006547 3300053161 Bacteria 5650
813 Ga0500645_000287 3300053730 Bacteria 36290
814 Ga0466962_0001068 3300061719 Bacteria 12599
815 Ga0466962_0009173 3300061719 Bacteria 4738
816 Ga0466962_0011240 3300061719 Bacteria 4310
817 Ga0466962_0068530 3300061719 Bacteria 1694

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005345 Ga0070692_10136632 Ga0070692_101366322 167
2 3300005844 Ga0068862_100386074 Ga0068862_1003860742 175
3 3300006844 Ga0075428_100245945 Ga0075428_1002459452 175
4 3300006846 Ga0075430_100299149 Ga0075430_1002991492 175
5 3300028380 Ga0268265_10349700 Ga0268265_103497002 175
6 3300005353 Ga0070669_100028490 Ga0070669_1000284903 176
7 3300005459 Ga0068867_100253558 Ga0068867_1002535582 176
8 3300005844 Ga0068862_100133895 Ga0068862_1001338952 176
9 3300009094 Ga0111539_10093213 Ga0111539_100932133 176
10 3300025923 Ga0207681_10037105 Ga0207681_100371053 176
11 3300025941 Ga0207711_10923001 Ga0207711_109230011 176
12 3300026089 Ga0207648_10274219 Ga0207648_102742192 176
13 3300028380 Ga0268265_10363697 Ga0268265_103636972 176
14 3300050511 nmdc:mga08y16_225864_c1 nmdc:mga08y16_225864_c1_1149_1766 176
15 3300001979 JGI24740J21852_10011029 JGI24740J21852_100110293 178
16 3300001979 JGI24740J21852_10020598 JGI24740J21852_100205981 178
17 3300001989 JGI24739J22299_10001242 JGI24739J22299_100012429 178
18 3300001990 JGI24737J22298_10004305 JGI24737J22298_100043054 178
19 3300002067 JGI24735J21928_10009193 JGI24735J21928_100091935 178
20 3300005455 Ga0070663_100059399 Ga0070663_1000593994 178
21 3300005563 Ga0068855_100045182 Ga0068855_1000451825 178
22 3300005577 Ga0068857_100004884 Ga0068857_1000048845 178
23 3300005834 Ga0068851_10019857 Ga0068851_100198572 178
24 3300005842 Ga0068858_100119741 Ga0068858_1001197413 178
25 3300009093 Ga0105240_10038777 Ga0105240_100387779 178
26 3300009174 Ga0105241_10101948 Ga0105241_101019485 178
27 3300009545 Ga0105237_10000292 Ga0105237_1000029247 178
28 3300012500 Ga0157314_1000063 Ga0157314_100006317 178
29 3300022467 Ga0224712_10005613 Ga0224712_100056136 178
30 3300025321 Ga0207656_10009850 Ga0207656_100098506 178
31 3300025913 Ga0207695_10035270 Ga0207695_100352705 178
32 3300026035 Ga0207703_10278225 Ga0207703_102782253 178
33 3300026067 Ga0207678_10129015 Ga0207678_101290152 178
34 3300026116 Ga0207674_10008336 Ga0207674_1000833613 178
35 3300048924 Ga0496121_0018889 Ga0496121_0018889_2815_3375 178
36 3300006353 Ga0075370_10187359 Ga0075370_101873592 186
37 3300037471 Ga0395905_0252157 Ga0395905_0252157_274_861 186
38 3300041496 Ga0451839_1292742 Ga0451839_1292742_120_746 186
39 3300050496 nmdc:mga07m45_49751_c1 nmdc:mga07m45_49751_c1_1316_1915 186
40 3300002773 JGI25152J39213_1001511 JGI25152J39213_10015117 187
41 3300003215 JGI25153J46596_10001310 JGI25153J46596_100013106 187
42 3300003323 rootH1_10129136 rootH1_101291364 187
43 3300003771 Ga0055526_1010167 Ga0055526_10101673 187
44 3300025245 Ga0207425_1001356 Ga0207425_10013563 187
45 3300025258 Ga0209129_1000035 Ga0209129_1000035164 187
46 3300025261 Ga0209233_1031104 Ga0209233_10311042 187
47 3300025263 Ga0209565_1023712 Ga0209565_10237122 187
48 3300025295 Ga0209564_1000024 Ga0209564_1000024358 187
49 3300025297 Ga0209758_1000066 Ga0209758_1000066154 187
50 3300025304 Ga0209257_1026233 Ga0209257_10262333 187
51 3300028794 Ga0307515_10284519 Ga0307515_102845192 188
52 iso_pu_bacteria 2818991440 2819566072 188
53 iso_pu_bacteria 2884338543 2884339229 188
54 iso_pu_bacteria 2904463128 2904466343 188
55 iso_pu_bacteria 2941471342 2941475496 188
56 3300013102 Ga0157371_10093988 Ga0157371_100939882 189
57 3300013104 Ga0157370_10855558 Ga0157370_108555581 189
58 3300049569 Ga0501032_0063381 Ga0501032_0063381_1561_2145 189
59 3300049570 Ga0501033_0147609 Ga0501033_0147609_461_1045 189
60 3300049573 Ga0501037_0089240 Ga0501037_0089240_1133_1717 189
61 3300049574 Ga0501038_0008320 Ga0501038_0008320_8262_8846 189
62 3300049581 Ga0501047_0323984 Ga0501047_0323984_509_1093 189
63 3300049586 Ga0501070_0155144 Ga0501070_0155144_1123_1707 189
64 3300049587 Ga0501071_0732020 Ga0501071_0732020_67_651 189
65 3300049822 Ga0501035_0026002 Ga0501035_0026002_4046_4630 189
66 3300049823 Ga0501044_0019098 Ga0501044_0019098_5443_6027 189
67 iso_pu_bacteria 8021622325 8021623531 189
68 iso_pu_bacteria 8021626552 8021629023 189
69 iso_pu_bacteria 8021648035 8021649925 189
70 3300006237 Ga0097621_100262196 Ga0097621_1002621961 190
71 iso_pu_bacteria 2593339238 2595447477 190
72 iso_pu_bacteria 2643221562 2643831214 190
73 iso_pu_bacteria 2718218334 2721025889 190
74 iso_pu_bacteria 2734482264 2735834147 190
75 iso_pu_bacteria 2738543009 2739225557 190
76 iso_pu_bacteria 2739367700 2739730451 190
77 iso_pu_bacteria 2818991457 2819663931 190
78 iso_pu_bacteria 2842914999 2842915480 190
79 iso_pu_bacteria 2842918807 2842920555 190
80 iso_pu_bacteria 2852684882 2852685697 190
81 iso_pu_bacteria 2884411467 2884413088 190
82 iso_pu_bacteria 2919130084 2919131837 190
83 iso_pu_bacteria 2928963466 2928964486 190
84 iso_pu_bacteria 2929195423 2929197792 190
85 iso_pu_bacteria 2939611941 2939613603 190
86 iso_pu_bacteria 2941489479 2941489770 190
87 3300002705 JGI25156J39149_1012740 JGI25156J39149_10127402 191
88 3300002741 JGI25157J39369_1001478 JGI25157J39369_10014782 191
89 3300003752 Ga0055539_1000706 Ga0055539_10007066 191
90 3300003756 Ga0055533_1000373 Ga0055533_10003737 191
91 3300003759 Ga0055525_1000059 Ga0055525_100005957 191
92 3300003760 Ga0055527_1000050 Ga0055527_100005058 191
93 3300003760 Ga0055527_1000128 Ga0055527_100012821 191
94 3300003761 Ga0055535_1000119 Ga0055535_100011939 191
95 3300003761 Ga0055535_1000287 Ga0055535_100028727 191
96 3300003761 Ga0055535_1001844 Ga0055535_10018448 191
97 3300003762 Ga0055542_1000057 Ga0055542_100005765 191
98 3300003762 Ga0055542_1000119 Ga0055542_100011958 191
99 3300003762 Ga0055542_1000311 Ga0055542_100031127 191
100 3300003763 Ga0055529_1000329 Ga0055529_100032921 191
101 3300003763 Ga0055529_1000514 Ga0055529_10005143 191
102 3300005337 Ga0070682_100000659 Ga0070682_10000065910 191
103 3300005339 Ga0070660_100004295 Ga0070660_1000042954 191
104 3300005366 Ga0070659_100001016 Ga0070659_10000101610 191
105 3300005455 Ga0070663_100380499 Ga0070663_1003804992 191
106 3300005458 Ga0070681_10038625 Ga0070681_100386255 191
107 3300005614 Ga0068856_100000455 Ga0068856_10000045526 191
108 3300013102 Ga0157371_10050082 Ga0157371_100500823 191
109 3300015261 Ga0182006_1041976 Ga0182006_10419763 191
110 3300025226 Ga0209674_100026 Ga0209674_100026161 191
111 3300025228 Ga0209672_100007 Ga0209672_100007762 191
112 3300025228 Ga0209672_100017 Ga0209672_100017292 191
113 3300025228 Ga0209672_100412 Ga0209672_10041220 191
114 3300025230 Ga0209563_100074 Ga0209563_100074115 191
115 3300025242 Ga0209258_100017 Ga0209258_10001758 191
116 3300025242 Ga0209258_100038 Ga0209258_10003820 191
117 3300025242 Ga0209258_100144 Ga0209258_10014474 191
118 3300025250 Ga0209026_1000044 Ga0209026_1000044131 191
119 3300025253 Ga0209677_103542 Ga0209677_1035423 191
120 3300025254 Ga0209148_1000009 Ga0209148_1000009920 191
121 3300025254 Ga0209148_1000044 Ga0209148_100004458 191
122 3300025254 Ga0209148_1000141 Ga0209148_100014163 191
123 3300025256 Ga0209759_1000517 Ga0209759_10005172 191
124 3300025272 Ga0209455_1000010 Ga0209455_1000010762 191
125 3300025272 Ga0209455_1000032 Ga0209455_1000032292 191
126 3300025272 Ga0209455_1005134 Ga0209455_10051343 191
127 3300025912 Ga0207707_10019535 Ga0207707_100195352 191
128 3300025919 Ga0207657_10032347 Ga0207657_100323474 191
129 3300025932 Ga0207690_10004228 Ga0207690_100042287 191
130 3300026067 Ga0207678_10538969 Ga0207678_105389692 191
131 3300026078 Ga0207702_10002529 Ga0207702_100025294 191
132 3300028800 Ga0265338_10390956 Ga0265338_103909562 191
133 3300031247 Ga0265340_10014712 Ga0265340_100147123 191
134 3300031247 Ga0265340_10233119 Ga0265340_102331192 191
135 3300031250 Ga0265331_10083517 Ga0265331_100835172 191
136 3300037312 Ga0395899_0000062 Ga0395899_0000062_200275_200856 191
137 3300037418 Ga0395900_0000039 Ga0395900_0000039_92364_92945 191
138 3300037466 Ga0395898_0000140 Ga0395898_0000140_10490_11071 191
139 3300044536 Ga0466988_0162073 Ga0466988_0162073_244_834 191
140 3300044656 Ga0466969_0002237 Ga0466969_0002237_4776_5366 191
141 3300044656 Ga0466969_0075315 Ga0466969_0075315_1008_1589 191
142 3300044683 Ga0466965_0002578 Ga0466965_0002578_2679_3260 191
143 3300044684 Ga0466966_0002292 Ga0466966_0002292_11862_12443 191
144 3300044684 Ga0466966_0015333 Ga0466966_0015333_4466_5056 191
145 3300044693 Ga0466961_0002335 Ga0466961_0002335_1627_2208 191
146 3300044693 Ga0466961_0002655 Ga0466961_0002655_5495_6085 191
147 3300044693 Ga0466961_0003660 Ga0466961_0003660_4259_4840 191
148 3300044693 Ga0466961_0094923 Ga0466961_0094923_258_839 191
149 3300044693 Ga0466961_0227073 Ga0466961_0227073_29_610 191
150 3300044694 Ga0466963_0093523 Ga0466963_0093523_144_725 191
151 3300044719 Ga0466971_0013101 Ga0466971_0013101_1093_1674 191
152 3300044719 Ga0466971_0316907 Ga0466971_0316907_15_596 191
153 3300044765 Ga0466970_0000163 Ga0466970_0000163_23218_23799 191
154 3300044765 Ga0466970_0479993 Ga0466970_0479993_105_686 191
155 3300044842 Ga0466957_0035438 Ga0466957_0035438_1211_1792 191
156 3300045049 Ga0466959_0000383 Ga0466959_0000383_3898_4479 191
157 3300045049 Ga0466959_0008445 Ga0466959_0008445_297_878 191
158 3300045049 Ga0466959_0026648 Ga0466959_0026648_2216_2797 191
159 3300045836 Ga0466958_0006626 Ga0466958_0006626_1049_1630 191
160 3300045836 Ga0466958_0016066 Ga0466958_0016066_2723_3304 191
161 3300045836 Ga0466958_0097079 Ga0466958_0097079_568_1149 191
162 3300045976 Ga0466967_0345550 Ga0466967_0345550_640_1221 191
163 3300049521 Ga0501298_023967 Ga0501298_023967_424_1017 191
164 3300049650 Ga0501199_008637 Ga0501199_008637_11_604 191
165 3300061719 Ga0466962_0001068 Ga0466962_0001068_11312_11893 191
166 3300061719 Ga0466962_0011240 Ga0466962_0011240_2283_2873 191
167 3300061719 Ga0466962_0068530 Ga0466962_0068530_1020_1601 191
168 iso_pu_bacteria 2747842501 2748015665 191
169 3300001904 JGI24736J21556_1002320 JGI24736J21556_10023201 192
170 3300001915 JGI24741J21665_1034746 JGI24741J21665_10347461 192
171 3300001979 JGI24740J21852_10000025 JGI24740J21852_1000002534 192
172 3300001989 JGI24739J22299_10000022 JGI24739J22299_1000002229 192
173 3300001990 JGI24737J22298_10003356 JGI24737J22298_100033565 192
174 3300002067 JGI24735J21928_10054048 JGI24735J21928_100540482 192
175 3300002075 JGI24738J21930_10000095 JGI24738J21930_1000009510 192
176 3300002705 JGI25156J39149_1004438 JGI25156J39149_10044382 192
177 3300002737 JGI25162J39368_1000018 JGI25162J39368_1000018143 192
178 3300002737 JGI25162J39368_1000567 JGI25162J39368_10005679 192
179 3300002737 JGI25162J39368_1000594 JGI25162J39368_100059426 192
180 3300002738 JGI25154J39366_1004513 JGI25154J39366_10045133 192
181 3300002741 JGI25157J39369_1000011 JGI25157J39369_100001145 192
182 3300002741 JGI25157J39369_1001115 JGI25157J39369_10011157 192
183 3300002741 JGI25157J39369_1001590 JGI25157J39369_10015904 192
184 3300002771 JGI25163J39215_1000291 JGI25163J39215_100029112 192
185 3300002771 JGI25163J39215_1000356 JGI25163J39215_100035613 192
186 3300002772 JGI25164J39214_1000007 JGI25164J39214_1000007143 192
187 3300002772 JGI25164J39214_1000198 JGI25164J39214_100019829 192
188 3300002772 JGI25164J39214_1003959 JGI25164J39214_10039593 192
189 3300003214 JGI25165J46597_1000029 JGI25165J46597_1000029144 192
190 3300003214 JGI25165J46597_1000354 JGI25165J46597_100035429 192
191 3300003215 JGI25153J46596_10008411 JGI25153J46596_100084114 192
192 3300003320 rootH2_10115902 rootH2_101159021 192
193 3300003322 rootL2_10061659 rootL2_100616593 192
194 3300003322 rootL2_10241063 rootL2_102410633 192
195 3300003323 rootH1_10111193 rootH1_101111933 192
196 3300003323 rootH1_10203752 rootH1_102037525 192
197 3300003578 Ga0006562J51391_1062436 Ga0006562J51391_10624365 192
198 3300003578 Ga0006562J51391_1062438 Ga0006562J51391_10624383 192
199 3300003751 Ga0055538_1001241 Ga0055538_10012414 192
200 3300003760 Ga0055527_1006447 Ga0055527_10064471 192
201 3300003761 Ga0055535_1000025 Ga0055535_100002549 192
202 3300003761 Ga0055535_1000295 Ga0055535_100029526 192
203 3300003762 Ga0055542_1000024 Ga0055542_1000024143 192
204 3300003762 Ga0055542_1000082 Ga0055542_100008223 192
205 3300003762 Ga0055542_1000180 Ga0055542_10001809 192
206 3300003763 Ga0055529_1000029 Ga0055529_1000029143 192
207 3300003763 Ga0055529_1000049 Ga0055529_100004955 192
208 3300003763 Ga0055529_1021040 Ga0055529_10210402 192
209 3300003841 Ga0055541_1019038 Ga0055541_10190381 192
210 3300003856 Ga0058692_1000029 Ga0058692_1000029107 192
211 3300005262 Ga0065165_1000653 Ga0065165_10006538 192
212 3300005262 Ga0065165_1002406 Ga0065165_10024065 192
213 3300005327 Ga0070658_10006547 Ga0070658_100065474 192
214 3300005327 Ga0070658_10082190 Ga0070658_100821902 192
215 3300005329 Ga0070683_100575992 Ga0070683_1005759922 192
216 3300005331 Ga0070670_100453862 Ga0070670_1004538622 192
217 3300005335 Ga0070666_10000001 Ga0070666_10000001234 192
218 3300005336 Ga0070680_100000627 Ga0070680_1000006276 192
219 3300005336 Ga0070680_100001693 Ga0070680_10000169318 192
220 3300005337 Ga0070682_100001204 Ga0070682_1000012048 192
221 3300005337 Ga0070682_100015698 Ga0070682_1000156983 192
222 3300005337 Ga0070682_100020889 Ga0070682_1000208894 192
223 3300005337 Ga0070682_100119907 Ga0070682_1001199072 192
224 3300005339 Ga0070660_100193727 Ga0070660_1001937272 192
225 3300005339 Ga0070660_100340277 Ga0070660_1003402772 192
226 3300005339 Ga0070660_100425709 Ga0070660_1004257092 192
227 3300005340 Ga0070689_100002151 Ga0070689_10000215112 192
228 3300005341 Ga0070691_10011476 Ga0070691_100114763 192
229 3300005344 Ga0070661_100002927 Ga0070661_1000029278 192
230 3300005344 Ga0070661_100004341 Ga0070661_1000043414 192
231 3300005344 Ga0070661_100011343 Ga0070661_1000113438 192
232 3300005344 Ga0070661_100019995 Ga0070661_1000199953 192
233 3300005344 Ga0070661_100070367 Ga0070661_1000703673 192
234 3300005344 Ga0070661_100139879 Ga0070661_1001398792 192
235 3300005344 Ga0070661_100357199 Ga0070661_1003571991 192
236 3300005345 Ga0070692_10006380 Ga0070692_100063803 192
237 3300005345 Ga0070692_10050482 Ga0070692_100504823 192
238 3300005347 Ga0070668_100255069 Ga0070668_1002550692 192
239 3300005347 Ga0070668_100553881 Ga0070668_1005538812 192
240 3300005365 Ga0070688_100007703 Ga0070688_1000077032 192
241 3300005366 Ga0070659_100044182 Ga0070659_1000441822 192
242 3300005366 Ga0070659_100100599 Ga0070659_1001005994 192
243 3300005366 Ga0070659_100283617 Ga0070659_1002836172 192
244 3300005366 Ga0070659_100326010 Ga0070659_1003260101 192
245 3300005367 Ga0070667_100286557 Ga0070667_1002865572 192
246 3300005435 Ga0070714_100000055 Ga0070714_10000005568 192
247 3300005435 Ga0070714_100001542 Ga0070714_1000015427 192
248 3300005439 Ga0070711_100458618 Ga0070711_1004586182 192
249 3300005455 Ga0070663_100013140 Ga0070663_1000131405 192
250 3300005455 Ga0070663_100016945 Ga0070663_1000169455 192
251 3300005455 Ga0070663_100049637 Ga0070663_1000496373 192
252 3300005455 Ga0070663_100096149 Ga0070663_1000961492 192
253 3300005455 Ga0070663_100142980 Ga0070663_1001429802 192
254 3300005455 Ga0070663_100419214 Ga0070663_1004192142 192
255 3300005455 Ga0070663_100611877 Ga0070663_1006118771 192
256 3300005457 Ga0070662_100002882 Ga0070662_1000028827 192
257 3300005457 Ga0070662_100055312 Ga0070662_1000553124 192
258 3300005457 Ga0070662_100171934 Ga0070662_1001719342 192
259 3300005458 Ga0070681_10000076 Ga0070681_1000007635 192
260 3300005458 Ga0070681_10000082 Ga0070681_1000008216 192
261 3300005458 Ga0070681_10001769 Ga0070681_100017693 192
262 3300005458 Ga0070681_10002020 Ga0070681_100020206 192
263 3300005458 Ga0070681_10019691 Ga0070681_100196918 192
264 3300005458 Ga0070681_10139828 Ga0070681_101398283 192
265 3300005466 Ga0070685_10003104 Ga0070685_100031047 192
266 3300005530 Ga0070679_100000150 Ga0070679_10000015014 192
267 3300005530 Ga0070679_100002690 Ga0070679_10000269018 192
268 3300005530 Ga0070679_100038896 Ga0070679_1000388963 192
269 3300005530 Ga0070679_100331383 Ga0070679_1003313831 192
270 3300005539 Ga0068853_100026573 Ga0068853_1000265733 192
271 3300005539 Ga0068853_100050144 Ga0068853_1000501443 192
272 3300005539 Ga0068853_100077903 Ga0068853_1000779033 192
273 3300005539 Ga0068853_100080474 Ga0068853_1000804741 192
274 3300005546 Ga0070696_100006301 Ga0070696_1000063018 192
275 3300005546 Ga0070696_100007828 Ga0070696_1000078285 192
276 3300005546 Ga0070696_100039568 Ga0070696_1000395683 192
277 3300005546 Ga0070696_100078297 Ga0070696_1000782972 192
278 3300005546 Ga0070696_100135184 Ga0070696_1001351843 192
279 3300005546 Ga0070696_100151582 Ga0070696_1001515822 192
280 3300005547 Ga0070693_100002312 Ga0070693_1000023126 192
281 3300005547 Ga0070693_100215864 Ga0070693_1002158642 192
282 3300005547 Ga0070693_100268260 Ga0070693_1002682601 192
283 3300005548 Ga0070665_100004680 Ga0070665_1000046804 192
284 3300005563 Ga0068855_100008081 Ga0068855_1000080818 192
285 3300005563 Ga0068855_100028324 Ga0068855_1000283243 192
286 3300005563 Ga0068855_100029024 Ga0068855_1000290242 192
287 3300005563 Ga0068855_100059762 Ga0068855_1000597623 192
288 3300005563 Ga0068855_100068677 Ga0068855_1000686773 192
289 3300005563 Ga0068855_100098070 Ga0068855_1000980703 192
290 3300005563 Ga0068855_100330629 Ga0068855_1003306292 192
291 3300005577 Ga0068857_100000491 Ga0068857_10000049116 192
292 3300005577 Ga0068857_100006493 Ga0068857_10000649310 192
293 3300005577 Ga0068857_100008883 Ga0068857_1000088837 192
294 3300005577 Ga0068857_100041984 Ga0068857_1000419842 192
295 3300005577 Ga0068857_100050181 Ga0068857_1000501813 192
296 3300005577 Ga0068857_100097524 Ga0068857_1000975243 192
297 3300005578 Ga0068854_100000046 Ga0068854_10000004666 192
298 3300005578 Ga0068854_100000553 Ga0068854_1000005533 192
299 3300005578 Ga0068854_100006463 Ga0068854_1000064633 192
300 3300005578 Ga0068854_100095604 Ga0068854_1000956042 192
301 3300005614 Ga0068856_100000920 Ga0068856_1000009209 192
302 3300005614 Ga0068856_100092872 Ga0068856_1000928722 192
303 3300005614 Ga0068856_100197240 Ga0068856_1001972403 192
304 3300005614 Ga0068856_100351172 Ga0068856_1003511722 192
305 3300005616 Ga0068852_100027789 Ga0068852_1000277894 192
306 3300005616 Ga0068852_100031022 Ga0068852_1000310224 192
307 3300005616 Ga0068852_100041326 Ga0068852_1000413263 192
308 3300005616 Ga0068852_100073063 Ga0068852_1000730633 192
309 3300005616 Ga0068852_100128436 Ga0068852_1001284363 192
310 3300005617 Ga0068859_100058280 Ga0068859_1000582804 192
311 3300005834 Ga0068851_10009883 Ga0068851_100098832 192
312 3300005842 Ga0068858_100076311 Ga0068858_1000763114 192
313 3300005842 Ga0068858_100124197 Ga0068858_1001241973 192
314 3300005843 Ga0068860_100012176 Ga0068860_1000121763 192
315 3300005843 Ga0068860_100030058 Ga0068860_1000300583 192
316 3300006175 Ga0070712_100379513 Ga0070712_1003795132 192
317 3300006931 Ga0097620_100058280 Ga0097620_1000582803 192
318 3300009093 Ga0105240_10000034 Ga0105240_1000003455 192
319 3300009093 Ga0105240_10000115 Ga0105240_1000011522 192
320 3300009093 Ga0105240_10002188 Ga0105240_1000218810 192
321 3300009093 Ga0105240_10023081 Ga0105240_100230817 192
322 3300009093 Ga0105240_10055731 Ga0105240_100557314 192
323 3300009093 Ga0105240_10096528 Ga0105240_100965283 192
324 3300009093 Ga0105240_10180600 Ga0105240_101806003 192
325 3300009093 Ga0105240_11158244 Ga0105240_111582441 192
326 3300009101 Ga0105247_10018919 Ga0105247_100189192 192
327 3300009174 Ga0105241_10071434 Ga0105241_100714343 192
328 3300009174 Ga0105241_10102134 Ga0105241_101021343 192
329 3300009545 Ga0105237_10000016 Ga0105237_1000001657 192
330 3300009545 Ga0105237_10000371 Ga0105237_1000037140 192
331 3300009545 Ga0105237_10022992 Ga0105237_100229925 192
332 3300009545 Ga0105237_10395027 Ga0105237_103950272 192
333 3300009545 Ga0105237_10899028 Ga0105237_108990282 192
334 3300009551 Ga0105238_10000513 Ga0105238_1000051331 192
335 3300009551 Ga0105238_10004930 Ga0105238_100049306 192
336 3300009551 Ga0105238_10014761 Ga0105238_100147613 192
337 3300009551 Ga0105238_10114787 Ga0105238_101147874 192
338 3300009551 Ga0105238_10222523 Ga0105238_102225234 192
339 3300009551 Ga0105238_10484842 Ga0105238_104848422 192
340 3300010375 Ga0105239_10000028 Ga0105239_10000028186 192
341 3300010375 Ga0105239_10022879 Ga0105239_100228796 192
342 3300010375 Ga0105239_10224363 Ga0105239_102243632 192
343 3300013100 Ga0157373_10004360 Ga0157373_1000436011 192
344 3300013100 Ga0157373_10011828 Ga0157373_100118284 192
345 3300013100 Ga0157373_10013694 Ga0157373_100136942 192
346 3300013100 Ga0157373_10057998 Ga0157373_100579983 192
347 3300013100 Ga0157373_10099316 Ga0157373_100993162 192
348 3300013100 Ga0157373_10251251 Ga0157373_102512512 192
349 3300013100 Ga0157373_10461128 Ga0157373_104611282 192
350 3300013102 Ga0157371_10012309 Ga0157371_100123095 192
351 3300013102 Ga0157371_10020425 Ga0157371_100204255 192
352 3300013102 Ga0157371_10022989 Ga0157371_100229895 192
353 3300013102 Ga0157371_10029872 Ga0157371_100298724 192
354 3300013102 Ga0157371_10059351 Ga0157371_100593514 192
355 3300013102 Ga0157371_10270923 Ga0157371_102709232 192
356 3300013104 Ga0157370_10007212 Ga0157370_1000721210 192
357 3300013104 Ga0157370_10009789 Ga0157370_100097894 192
358 3300013104 Ga0157370_10011801 Ga0157370_100118018 192
359 3300013104 Ga0157370_10044317 Ga0157370_100443173 192
360 3300013104 Ga0157370_10047443 Ga0157370_100474432 192
361 3300013104 Ga0157370_10097411 Ga0157370_100974112 192
362 3300013104 Ga0157370_10103285 Ga0157370_101032853 192
363 3300013104 Ga0157370_10107394 Ga0157370_101073942 192
364 3300013104 Ga0157370_10263870 Ga0157370_102638701 192
365 3300013105 Ga0157369_10001146 Ga0157369_1000114619 192
366 3300013105 Ga0157369_10006957 Ga0157369_1000695711 192
367 3300013105 Ga0157369_10010587 Ga0157369_100105877 192
368 3300013105 Ga0157369_10018469 Ga0157369_100184692 192
369 3300013105 Ga0157369_10067314 Ga0157369_100673142 192
370 3300013105 Ga0157369_10087141 Ga0157369_100871414 192
371 3300013105 Ga0157369_10575070 Ga0157369_105750702 192
372 3300013306 Ga0163162_10001591 Ga0163162_1000159120 192
373 3300013306 Ga0163162_10051171 Ga0163162_100511715 192
374 3300013307 Ga0157372_10010749 Ga0157372_100107496 192
375 3300013307 Ga0157372_10033446 Ga0157372_100334465 192
376 3300013307 Ga0157372_10039362 Ga0157372_100393624 192
377 3300013307 Ga0157372_10066986 Ga0157372_100669864 192
378 3300013307 Ga0157372_10147519 Ga0157372_101475192 192
379 3300013307 Ga0157372_10183051 Ga0157372_101830512 192
380 3300013307 Ga0157372_10237491 Ga0157372_102374912 192
381 3300013307 Ga0157372_10370452 Ga0157372_103704522 192
382 3300014497 Ga0182008_10015782 Ga0182008_100157824 192
383 3300014497 Ga0182008_10048243 Ga0182008_100482433 192
384 3300014497 Ga0182008_10062622 Ga0182008_100626222 192
385 3300014497 Ga0182008_10105886 Ga0182008_101058862 192
386 3300014497 Ga0182008_10109647 Ga0182008_101096472 192
387 3300014497 Ga0182008_10305399 Ga0182008_103053992 192
388 3300015261 Ga0182006_1000061 Ga0182006_1000061111 192
389 3300015261 Ga0182006_1007237 Ga0182006_10072374 192
390 3300015261 Ga0182006_1012331 Ga0182006_10123312 192
391 3300015261 Ga0182006_1037503 Ga0182006_10375033 192
392 3300015262 Ga0182007_10005804 Ga0182007_100058047 192
393 3300015262 Ga0182007_10009625 Ga0182007_100096254 192
394 3300015262 Ga0182007_10011279 Ga0182007_100112793 192
395 3300015265 Ga0182005_1001560 Ga0182005_10015606 192
396 3300015265 Ga0182005_1003115 Ga0182005_10031153 192
397 3300015685 Ga0183369_1004 Ga0183369_1004438 192
398 3300015689 Ga0183360_10001 Ga0183360_100012441 192
399 3300017792 Ga0163161_10046760 Ga0163161_100467603 192
400 3300017792 Ga0163161_10065114 Ga0163161_100651143 192
401 3300020069 Ga0197907_10080030 Ga0197907_100800306 192
402 3300020069 Ga0197907_10217144 Ga0197907_102171443 192
403 3300020070 Ga0206356_10379243 Ga0206356_103792432 192
404 3300020070 Ga0206356_10546730 Ga0206356_105467303 192
405 3300020075 Ga0206349_1686371 Ga0206349_16863712 192
406 3300020076 Ga0206355_1394520 Ga0206355_13945201 192
407 3300020078 Ga0206352_10220409 Ga0206352_102204093 192
408 3300020078 Ga0206352_10962774 Ga0206352_109627741 192
409 3300020080 Ga0206350_10303956 Ga0206350_103039561 192
410 3300020081 Ga0206354_10121428 Ga0206354_101214283 192
411 3300020081 Ga0206354_10883312 Ga0206354_108833128 192
412 3300020081 Ga0206354_11113808 Ga0206354_111138084 192
413 3300020081 Ga0206354_11431445 Ga0206354_114314453 192
414 3300020082 Ga0206353_10063786 Ga0206353_100637862 192
415 3300020082 Ga0206353_11738411 Ga0206353_117384113 192
416 3300020082 Ga0206353_11944126 Ga0206353_119441262 192
417 3300020082 Ga0206353_11975562 Ga0206353_119755622 192
418 3300020610 Ga0154015_1139938 Ga0154015_11399383 192
419 3300020610 Ga0154015_1183830 Ga0154015_11838301 192
420 3300020610 Ga0154015_1595600 Ga0154015_15956003 192
421 3300020610 Ga0154015_1641253 Ga0154015_16412532 192
422 3300022467 Ga0224712_10037405 Ga0224712_100374053 192
423 3300022467 Ga0224712_10178530 Ga0224712_101785302 192
424 3300025207 Ga0209760_100384 Ga0209760_10038411 192
425 3300025224 Ga0209784_100026 Ga0209784_100026132 192
426 3300025225 Ga0209566_103460 Ga0209566_1034602 192
427 3300025226 Ga0209674_101816 Ga0209674_1018161 192
428 3300025228 Ga0209672_100239 Ga0209672_1002392 192
429 3300025228 Ga0209672_101232 Ga0209672_10123210 192
430 3300025231 Ga0207427_100023 Ga0207427_100023132 192
431 3300025231 Ga0207427_100213 Ga0207427_10021321 192
432 3300025231 Ga0207427_104431 Ga0207427_1044313 192
433 3300025231 Ga0207427_106434 Ga0207427_1064342 192
434 3300025233 Ga0209437_100069 Ga0209437_100069130 192
435 3300025233 Ga0209437_100194 Ga0209437_10019492 192
436 3300025233 Ga0209437_100381 Ga0209437_10038128 192
437 3300025233 Ga0209437_100838 Ga0209437_1008385 192
438 3300025242 Ga0209258_100059 Ga0209258_100059132 192
439 3300025242 Ga0209258_100118 Ga0209258_10011835 192
440 3300025242 Ga0209258_100635 Ga0209258_10063516 192
441 3300025242 Ga0209258_102018 Ga0209258_1020182 192
442 3300025246 Ga0209646_1000264 Ga0209646_100026423 192
443 3300025246 Ga0209646_1001043 Ga0209646_10010438 192
444 3300025246 Ga0209646_1001117 Ga0209646_10011177 192
445 3300025250 Ga0209026_1000036 Ga0209026_1000036121 192
446 3300025250 Ga0209026_1000191 Ga0209026_100019145 192
447 3300025250 Ga0209026_1000785 Ga0209026_10007857 192
448 3300025250 Ga0209026_1005549 Ga0209026_10055494 192
449 3300025254 Ga0209148_1000002 Ga0209148_10000021634 192
450 3300025254 Ga0209148_1000010 Ga0209148_1000010131 192
451 3300025254 Ga0209148_1000024 Ga0209148_1000024320 192
452 3300025254 Ga0209148_1000706 Ga0209148_100070623 192
453 3300025256 Ga0209759_1000023 Ga0209759_100002342 192
454 3300025256 Ga0209759_1000779 Ga0209759_100077914 192
455 3300025256 Ga0209759_1001117 Ga0209759_100111711 192
456 3300025256 Ga0209759_1014477 Ga0209759_10144772 192
457 3300025258 Ga0209129_1001844 Ga0209129_100184410 192
458 3300025261 Ga0209233_1000009 Ga0209233_10000091040 192
459 3300025261 Ga0209233_1000323 Ga0209233_100032321 192
460 3300025261 Ga0209233_1014309 Ga0209233_10143092 192
461 3300025261 Ga0209233_1015779 Ga0209233_10157792 192
462 3300025263 Ga0209565_1002154 Ga0209565_10021547 192
463 3300025272 Ga0209455_1000020 Ga0209455_1000020472 192
464 3300025272 Ga0209455_1000025 Ga0209455_1000025320 192
465 3300025272 Ga0209455_1000380 Ga0209455_100038015 192
466 3300025272 Ga0209455_1009394 Ga0209455_10093942 192
467 3300025297 Ga0209758_1000290 Ga0209758_100029058 192
468 3300025297 Ga0209758_1021411 Ga0209758_10214112 192
469 3300025302 Ga0207426_1013399 Ga0207426_10133993 192
470 3300025304 Ga0209257_1055762 Ga0209257_10557622 192
471 3300025321 Ga0207656_10004076 Ga0207656_100040764 192
472 3300025900 Ga0207710_10008401 Ga0207710_100084014 192
473 3300025903 Ga0207680_10000003 Ga0207680_10000003282 192
474 3300025904 Ga0207647_10000237 Ga0207647_1000023720 192
475 3300025904 Ga0207647_10001096 Ga0207647_1000109616 192
476 3300025904 Ga0207647_10003895 Ga0207647_100038952 192
477 3300025904 Ga0207647_10003907 Ga0207647_100039074 192
478 3300025904 Ga0207647_10021325 Ga0207647_100213255 192
479 3300025909 Ga0207705_10000029 Ga0207705_10000029121 192
480 3300025909 Ga0207705_10000439 Ga0207705_1000043925 192
481 3300025909 Ga0207705_10000614 Ga0207705_100006147 192
482 3300025909 Ga0207705_10003279 Ga0207705_100032793 192
483 3300025909 Ga0207705_10006884 Ga0207705_100068849 192
484 3300025909 Ga0207705_10046918 Ga0207705_100469183 192
485 3300025912 Ga0207707_10000018 Ga0207707_1000001825 192
486 3300025912 Ga0207707_10000036 Ga0207707_1000003661 192
487 3300025912 Ga0207707_10000042 Ga0207707_10000042122 192
488 3300025912 Ga0207707_10000049 Ga0207707_1000004935 192
489 3300025912 Ga0207707_10001192 Ga0207707_1000119222 192
490 3300025912 Ga0207707_10001753 Ga0207707_1000175320 192
491 3300025912 Ga0207707_10014212 Ga0207707_100142123 192
492 3300025912 Ga0207707_10028042 Ga0207707_100280425 192
493 3300025912 Ga0207707_10028420 Ga0207707_100284202 192
494 3300025912 Ga0207707_10049094 Ga0207707_100490944 192
495 3300025913 Ga0207695_10000101 Ga0207695_10000101201 192
496 3300025913 Ga0207695_10000116 Ga0207695_10000116210 192
497 3300025913 Ga0207695_10000307 Ga0207695_1000030744 192
498 3300025913 Ga0207695_10001055 Ga0207695_1000105528 192
499 3300025913 Ga0207695_10001683 Ga0207695_1000168323 192
500 3300025913 Ga0207695_10013533 Ga0207695_100135337 192
501 3300025913 Ga0207695_10018303 Ga0207695_100183034 192
502 3300025913 Ga0207695_10030863 Ga0207695_100308634 192
503 3300025914 Ga0207671_10000013 Ga0207671_1000001369 192
504 3300025914 Ga0207671_10002057 Ga0207671_1000205715 192
505 3300025917 Ga0207660_10000206 Ga0207660_1000020622 192
506 3300025917 Ga0207660_10000948 Ga0207660_100009485 192
507 3300025917 Ga0207660_10001219 Ga0207660_100012196 192
508 3300025917 Ga0207660_10003795 Ga0207660_100037953 192
509 3300025917 Ga0207660_10047625 Ga0207660_100476254 192
510 3300025919 Ga0207657_10006454 Ga0207657_100064549 192
511 3300025919 Ga0207657_10007522 Ga0207657_1000752212 192
512 3300025919 Ga0207657_10091368 Ga0207657_100913682 192
513 3300025919 Ga0207657_10532016 Ga0207657_105320161 192
514 3300025919 Ga0207657_10554293 Ga0207657_105542932 192
515 3300025920 Ga0207649_10000219 Ga0207649_1000021929 192
516 3300025920 Ga0207649_10069089 Ga0207649_100690892 192
517 3300025920 Ga0207649_10118571 Ga0207649_101185712 192
518 3300025920 Ga0207649_10167275 Ga0207649_101672752 192
519 3300025921 Ga0207652_10000014 Ga0207652_1000001494 192
520 3300025921 Ga0207652_10000099 Ga0207652_1000009972 192
521 3300025921 Ga0207652_10001601 Ga0207652_1000160120 192
522 3300025921 Ga0207652_10002446 Ga0207652_100024469 192
523 3300025921 Ga0207652_10004532 Ga0207652_100045329 192
524 3300025921 Ga0207652_10069664 Ga0207652_100696642 192
525 3300025921 Ga0207652_10097407 Ga0207652_100974072 192
526 3300025924 Ga0207694_10000151 Ga0207694_1000015159 192
527 3300025924 Ga0207694_10020553 Ga0207694_100205534 192
528 3300025924 Ga0207694_10114991 Ga0207694_101149912 192
529 3300025924 Ga0207694_10314550 Ga0207694_103145502 192
530 3300025929 Ga0207664_10000030 Ga0207664_1000003092 192
531 3300025929 Ga0207664_10003028 Ga0207664_100030287 192
532 3300025932 Ga0207690_10000096 Ga0207690_1000009650 192
533 3300025932 Ga0207690_10002264 Ga0207690_100022647 192
534 3300025932 Ga0207690_10006491 Ga0207690_100064918 192
535 3300025932 Ga0207690_10009614 Ga0207690_100096146 192
536 3300025932 Ga0207690_10017568 Ga0207690_100175684 192
537 3300025932 Ga0207690_10052709 Ga0207690_100527093 192
538 3300025932 Ga0207690_10058549 Ga0207690_100585492 192
539 3300025932 Ga0207690_10694526 Ga0207690_106945262 192
540 3300025933 Ga0207706_10003820 Ga0207706_100038206 192
541 3300025933 Ga0207706_10025734 Ga0207706_100257344 192
542 3300025933 Ga0207706_10060840 Ga0207706_100608404 192
543 3300025936 Ga0207670_10000897 Ga0207670_1000089713 192
544 3300025944 Ga0207661_10006602 Ga0207661_100066026 192
545 3300025944 Ga0207661_10009873 Ga0207661_100098735 192
546 3300025944 Ga0207661_10364657 Ga0207661_103646572 192
547 3300025945 Ga0207679_10010175 Ga0207679_100101755 192
548 3300025945 Ga0207679_10731834 Ga0207679_107318342 192
549 3300025949 Ga0207667_10000040 Ga0207667_10000040132 192
550 3300025949 Ga0207667_10000047 Ga0207667_1000004797 192
551 3300025949 Ga0207667_10000075 Ga0207667_1000007556 192
552 3300025949 Ga0207667_10002530 Ga0207667_1000253013 192
553 3300025949 Ga0207667_10002947 Ga0207667_1000294712 192
554 3300025949 Ga0207667_10012337 Ga0207667_100123374 192
555 3300025949 Ga0207667_10013444 Ga0207667_100134443 192
556 3300025949 Ga0207667_10254442 Ga0207667_102544422 192
557 3300025949 Ga0207667_10431429 Ga0207667_104314292 192
558 3300025981 Ga0207640_10000009 Ga0207640_10000009133 192
559 3300025981 Ga0207640_10000461 Ga0207640_1000046119 192
560 3300025981 Ga0207640_10000682 Ga0207640_100006829 192
561 3300025981 Ga0207640_10002087 Ga0207640_100020875 192
562 3300025981 Ga0207640_10005417 Ga0207640_100054173 192
563 3300025981 Ga0207640_10079017 Ga0207640_100790173 192
564 3300025981 Ga0207640_10100430 Ga0207640_101004302 192
565 3300025981 Ga0207640_10233420 Ga0207640_102334202 192
566 3300025986 Ga0207658_10117124 Ga0207658_101171242 192
567 3300026035 Ga0207703_10057954 Ga0207703_100579543 192
568 3300026035 Ga0207703_10399113 Ga0207703_103991132 192
569 3300026041 Ga0207639_10000403 Ga0207639_100004037 192
570 3300026041 Ga0207639_10001846 Ga0207639_100018465 192
571 3300026041 Ga0207639_10008206 Ga0207639_100082063 192
572 3300026041 Ga0207639_10352579 Ga0207639_103525791 192
573 3300026041 Ga0207639_10408235 Ga0207639_104082352 192
574 3300026067 Ga0207678_10000612 Ga0207678_1000061220 192
575 3300026067 Ga0207678_10001123 Ga0207678_1000112313 192
576 3300026067 Ga0207678_10002596 Ga0207678_100025969 192
577 3300026067 Ga0207678_10017625 Ga0207678_100176255 192
578 3300026067 Ga0207678_10024508 Ga0207678_100245084 192
579 3300026067 Ga0207678_10030697 Ga0207678_100306974 192
580 3300026067 Ga0207678_10042733 Ga0207678_100427334 192
581 3300026067 Ga0207678_10117295 Ga0207678_101172952 192
582 3300026067 Ga0207678_10127520 Ga0207678_101275202 192
583 3300026067 Ga0207678_10180379 Ga0207678_101803792 192
584 3300026067 Ga0207678_10438790 Ga0207678_104387902 192
585 3300026078 Ga0207702_10000608 Ga0207702_1000060820 192
586 3300026078 Ga0207702_10005706 Ga0207702_100057066 192
587 3300026078 Ga0207702_10275207 Ga0207702_102752072 192
588 3300026089 Ga0207648_11019481 Ga0207648_110194811 192
589 3300026116 Ga0207674_10000012 Ga0207674_1000001263 192
590 3300026116 Ga0207674_10004576 Ga0207674_100045767 192
591 3300026116 Ga0207674_10009386 Ga0207674_100093868 192
592 3300026116 Ga0207674_10014417 Ga0207674_100144176 192
593 3300026116 Ga0207674_10027320 Ga0207674_100273205 192
594 3300026116 Ga0207674_10129007 Ga0207674_101290072 192
595 3300026142 Ga0207698_10000152 Ga0207698_1000015228 192
596 3300026142 Ga0207698_10001073 Ga0207698_1000107311 192
597 3300026142 Ga0207698_10022815 Ga0207698_100228153 192
598 3300026142 Ga0207698_10126755 Ga0207698_101267553 192
599 3300028379 Ga0268266_10000011 Ga0268266_10000011230 192
600 3300028380 Ga0268265_10074347 Ga0268265_100743472 192
601 3300028380 Ga0268265_10720434 Ga0268265_107204341 192
602 3300028381 Ga0268264_10054343 Ga0268264_100543433 192
603 3300028381 Ga0268264_10069026 Ga0268264_100690263 192
604 3300028794 Ga0307515_10614803 Ga0307515_106148031 192
605 3300031911 Ga0307412_10000592 Ga0307412_1000059221 192
606 3300032002 Ga0307416_100767751 Ga0307416_1007677512 192
607 3300033180 Ga0307510_10003183 Ga0307510_100031839 192
608 3300033180 Ga0307510_10216741 Ga0307510_102167411 192
609 3300037312 Ga0395899_0018866 Ga0395899_0018866_3229_3813 192
610 3300037312 Ga0395899_0025640 Ga0395899_0025640_2584_3168 192
611 3300037312 Ga0395899_0067173 Ga0395899_0067173_652_1236 192
612 3300037312 Ga0395899_0088006 Ga0395899_0088006_1096_1680 192
613 3300037312 Ga0395899_0308698 Ga0395899_0308698_225_809 192
614 3300037418 Ga0395900_0016300 Ga0395900_0016300_1545_2129 192
615 3300037418 Ga0395900_0036728 Ga0395900_0036728_533_1117 192
616 3300037418 Ga0395900_0278537 Ga0395900_0278537_931_1515 192
617 3300037418 Ga0395900_0471676 Ga0395900_0471676_87_671 192
618 3300037466 Ga0395898_0006775 Ga0395898_0006775_11513_12097 192
619 3300037466 Ga0395898_0108134 Ga0395898_0108134_1094_1678 192
620 3300037466 Ga0395898_0211832 Ga0395898_0211832_365_949 192
621 3300037471 Ga0395905_0408977 Ga0395905_0408977_537_1121 192
622 3300038443 Ga0395901_0000215 Ga0395901_0000215_37778_38362 192
623 3300038443 Ga0395901_0002859 Ga0395901_0002859_10203_10787 192
624 3300038443 Ga0395901_0022178 Ga0395901_0022178_3955_4539 192
625 3300038443 Ga0395901_0069528 Ga0395901_0069528_480_1064 192
626 3300038443 Ga0395901_0070487 Ga0395901_0070487_828_1412 192
627 3300038443 Ga0395901_0131605 Ga0395901_0131605_1588_2172 192
628 3300038443 Ga0395901_0225936 Ga0395901_0225936_1166_1750 192
629 3300038443 Ga0395901_0522629 Ga0395901_0522629_403_987 192
630 3300041404 Ga0439436_0000063 Ga0439436_0000063_29038_29622 192
631 3300041413 Ga0439465_0001557 Ga0439465_0001557_700_1284 192
632 3300041452 Ga0451793_0622521 Ga0451793_0622521_4541_5125 192
633 3300041452 Ga0451793_0733104 Ga0451793_0733104_315_899 192
634 3300041456 Ga0451795_1375120 Ga0451795_1375120_57_641 192
635 3300041459 Ga0451800_0901466 Ga0451800_0901466_788_1372 192
636 3300041462 Ga0451806_170739 Ga0451806_170739_260_844 192
637 3300041463 Ga0451804_1024051 Ga0451804_1024051_198_782 192
638 3300041486 Ga0451807_1329070 Ga0451807_1329070_215_799 192
639 3300041491 Ga0451833_1479516 Ga0451833_1479516_442_1026 192
640 3300042000 Ga0439437_001853 Ga0439437_001853_372_956 192
641 3300042004 Ga0439445_0008323 Ga0439445_0008323_150_734 192
642 3300042006 Ga0439432_010194 Ga0439432_010194_1856_2440 192
643 3300042184 Ga0450908_000063 Ga0450908_000063_3117_3716 192
644 3300042438 Ga0439459_0000678 Ga0439459_0000678_115_699 192
645 3300042438 Ga0439459_0022160 Ga0439459_0022160_404_988 192
646 3300044658 Ga0466972_0043646 Ga0466972_0043646_1396_1980 192
647 3300044672 Ga0466982_0000008 Ga0466982_0000008_164783_165367 192
648 3300044672 Ga0466982_0002390 Ga0466982_0002390_6540_7136 192
649 3300044684 Ga0466966_0016192 Ga0466966_0016192_663_1247 192
650 3300044693 Ga0466961_0173436 Ga0466961_0173436_277_861 192
651 3300044706 Ga0466964_0037442 Ga0466964_0037442_1007_1591 192
652 3300044719 Ga0466971_0040583 Ga0466971_0040583_1139_1723 192
653 3300044735 Ga0466968_0050108 Ga0466968_0050108_556_1140 192
654 3300044765 Ga0466970_0018568 Ga0466970_0018568_727_1311 192
655 3300044842 Ga0466957_0039415 Ga0466957_0039415_1552_2148 192
656 3300044901 Ga0466960_0020456 Ga0466960_0020456_1219_1803 192
657 3300045836 Ga0466958_0134176 Ga0466958_0134176_657_1241 192
658 3300046452 Ga0495617_000114 Ga0495617_000114_28117_28701 192
659 3300046452 Ga0495617_000412 Ga0495617_000412_8935_9519 192
660 3300046460 Ga0495638_0000063 Ga0495638_0000063_182566_183150 192
661 3300046460 Ga0495638_0000065 Ga0495638_0000065_102383_102967 192
662 3300046460 Ga0495638_0000135 Ga0495638_0000135_27427_28011 192
663 3300046460 Ga0495638_0000148 Ga0495638_0000148_77450_78034 192
664 3300046460 Ga0495638_0011938 Ga0495638_0011938_3320_3904 192
665 3300046471 Ga0495650_0000078 Ga0495650_0000078_109349_109933 192
666 3300046471 Ga0495650_0000222 Ga0495650_0000222_45839_46423 192
667 3300046471 Ga0495650_0001488 Ga0495650_0001488_331_915 192
668 3300046471 Ga0495650_0010026 Ga0495650_0010026_3438_4022 192
669 3300046474 Ga0495605_0204633 Ga0495605_0204633_119_703 192
670 3300046491 Ga0495584_0001381 Ga0495584_0001381_6416_7000 192
671 3300046492 Ga0495585_0000063 Ga0495585_0000063_27344_27928 192
672 3300046492 Ga0495585_0003226 Ga0495585_0003226_1254_1838 192
673 3300046501 Ga0495607_0000029 Ga0495607_0000029_110572_111156 192
674 3300046501 Ga0495607_0000100 Ga0495607_0000100_46401_46985 192
675 3300046501 Ga0495607_0004039 Ga0495607_0004039_4033_4617 192
676 3300046507 Ga0495606_0000351 Ga0495606_0000351_33461_34045 192
677 3300046507 Ga0495606_0000427 Ga0495606_0000427_44385_44969 192
678 3300046507 Ga0495606_0001737 Ga0495606_0001737_20493_21077 192
679 3300046507 Ga0495606_0028699 Ga0495606_0028699_2693_3277 192
680 3300046507 Ga0495606_0071954 Ga0495606_0071954_139_723 192
681 3300046507 Ga0495606_0225441 Ga0495606_0225441_280_864 192
682 3300046512 Ga0495610_0002695 Ga0495610_0002695_11206_11790 192
683 3300046512 Ga0495610_0085140 Ga0495610_0085140_280_864 192
684 3300046513 Ga0495616_0000183 Ga0495616_0000183_27326_27910 192
685 3300046513 Ga0495616_0014578 Ga0495616_0014578_619_1203 192
686 3300046515 Ga0495620_0000090 Ga0495620_0000090_45071_45655 192
687 3300046515 Ga0495620_0019009 Ga0495620_0019009_215_799 192
688 3300046518 Ga0495631_0000055 Ga0495631_0000055_27488_28072 192
689 3300046518 Ga0495631_0000458 Ga0495631_0000458_25055_25639 192
690 3300046519 Ga0495632_0008465 Ga0495632_0008465_1495_2079 192
691 3300046519 Ga0495632_0024202 Ga0495632_0024202_1825_2409 192
692 3300046520 Ga0495637_0005939 Ga0495637_0005939_937_1521 192
693 3300046524 Ga0495648_0000324 Ga0495648_0000324_25135_25719 192
694 3300046524 Ga0495648_0009773 Ga0495648_0009773_3050_3634 192
695 3300046538 Ga0495609_0004473 Ga0495609_0004473_3735_4319 192
696 3300046558 Ga0495633_0009082 Ga0495633_0009082_2788_3372 192
697 3300046616 Ga0495668_0002335 Ga0495668_0002335_14867_15451 192
698 3300046648 Ga0495611_0000003 Ga0495611_0000003_148429_149013 192
699 3300046648 Ga0495611_0000018 Ga0495611_0000018_98971_99555 192
700 3300046660 Ga0495625_0000019 Ga0495625_0000019_157637_158221 192
701 3300046660 Ga0495625_0021104 Ga0495625_0021104_408_992 192
702 3300046660 Ga0495625_0104538 Ga0495625_0104538_1224_1808 192
703 3300046660 Ga0495625_0116267 Ga0495625_0116267_88_672 192
704 3300046660 Ga0495625_0123154 Ga0495625_0123154_898_1482 192
705 3300046665 Ga0495661_0001253 Ga0495661_0001253_20003_20587 192
706 3300046665 Ga0495661_0240530 Ga0495661_0240530_107_691 192
707 3300046691 Ga0495670_0000081 Ga0495670_0000081_1939_2523 192
708 3300046691 Ga0495670_0000602 Ga0495670_0000602_11823_12407 192
709 3300046691 Ga0495670_0028808 Ga0495670_0028808_1373_1957 192
710 3300046692 Ga0495671_0000611 Ga0495671_0000611_6685_7269 192
711 3300046694 Ga0495649_0003118 Ga0495649_0003118_4791_5375 192
712 3300046694 Ga0495649_0078981 Ga0495649_0078981_894_1478 192
713 3300046794 Ga0495589_0000018 Ga0495589_0000018_87179_87763 192
714 3300046810 Ga0495660_0000164 Ga0495660_0000164_45175_45759 192
715 3300046810 Ga0495660_0000223 Ga0495660_0000223_47492_48076 192
716 3300047323 Ga0495683_0001383 Ga0495683_0001383_6212_6796 192
717 3300047446 Ga0495679_000017 Ga0495679_000017_114200_114784 192
718 3300047469 Ga0495673_0000004 Ga0495673_0000004_815683_816267 192
719 3300047469 Ga0495673_0000133 Ga0495673_0000133_25639_26223 192
720 3300047469 Ga0495673_0000318 Ga0495673_0000318_36664_37248 192
721 3300047469 Ga0495673_0018718 Ga0495673_0018718_927_1511 192
722 3300047472 Ga0495686_0000033 Ga0495686_0000033_306307_306885 192
723 3300047472 Ga0495686_0000527 Ga0495686_0000527_9280_9864 192
724 3300047472 Ga0495686_0003732 Ga0495686_0003732_10476_11060 192
725 3300047472 Ga0495686_0008030 Ga0495686_0008030_6710_7294 192
726 3300047472 Ga0495686_0066483 Ga0495686_0066483_665_1249 192
727 3300048903 Ga0496100_0000781 Ga0496100_0000781_9052_9636 192
728 3300048903 Ga0496100_0119632 Ga0496100_0119632_485_1069 192
729 3300048904 Ga0496101_0009582 Ga0496101_0009582_1224_1808 192
730 3300048904 Ga0496101_0084238 Ga0496101_0084238_450_1034 192
731 3300048905 Ga0496102_0166073 Ga0496102_0166073_352_936 192
732 3300048905 Ga0496102_0251893 Ga0496102_0251893_472_1050 192
733 3300048908 Ga0496105_0000292 Ga0496105_0000292_9667_10251 192
734 3300048909 Ga0496106_0052036 Ga0496106_0052036_42_626 192
735 3300048909 Ga0496106_0122965 Ga0496106_0122965_350_934 192
736 3300048910 Ga0496107_0024465 Ga0496107_0024465_2877_3461 192
737 3300048910 Ga0496107_0290366 Ga0496107_0290366_562_1146 192
738 3300048910 Ga0496107_0332135 Ga0496107_0332135_89_673 192
739 3300048918 Ga0496115_0000072 Ga0496115_0000072_29682_30266 192
740 3300048918 Ga0496115_0004358 Ga0496115_0004358_5151_5735 192
741 3300048918 Ga0496115_0095944 Ga0496115_0095944_1429_2013 192
742 3300048919 Ga0496116_0088552 Ga0496116_0088552_579_1163 192
743 3300048920 Ga0496117_0012299 Ga0496117_0012299_2232_2816 192
744 3300048920 Ga0496117_0026259 Ga0496117_0026259_63_647 192
745 3300048920 Ga0496117_0027636 Ga0496117_0027636_3432_4010 192
746 3300048920 Ga0496117_0083089 Ga0496117_0083089_730_1308 192
747 3300048921 Ga0496118_0000865 Ga0496118_0000865_25882_26460 192
748 3300048921 Ga0496118_0001698 Ga0496118_0001698_6532_7116 192
749 3300048921 Ga0496118_0003419 Ga0496118_0003419_12857_13441 192
750 3300048921 Ga0496118_0007498 Ga0496118_0007498_10927_11505 192
751 3300048922 Ga0496119_0000030 Ga0496119_0000030_42801_43385 192
752 3300048922 Ga0496119_0002030 Ga0496119_0002030_707_1291 192
753 3300048922 Ga0496119_0260519 Ga0496119_0260519_247_831 192
754 3300048923 Ga0496120_0000015 Ga0496120_0000015_155832_156416 192
755 3300048923 Ga0496120_0000033 Ga0496120_0000033_196791_197375 192
756 3300048923 Ga0496120_0225709 Ga0496120_0225709_10_594 192
757 3300048924 Ga0496121_0000063 Ga0496121_0000063_168279_168863 192
758 3300048924 Ga0496121_0000109 Ga0496121_0000109_147848_148426 192
759 3300048924 Ga0496121_0000633 Ga0496121_0000633_18692_19276 192
760 3300048924 Ga0496121_0000922 Ga0496121_0000922_25002_25586 192
761 3300048924 Ga0496121_0002272 Ga0496121_0002272_4815_5399 192
762 3300048924 Ga0496121_0059446 Ga0496121_0059446_2092_2676 192
763 3300048924 Ga0496121_0065660 Ga0496121_0065660_1510_2094 192
764 3300048924 Ga0496121_0108098 Ga0496121_0108098_652_1236 192
765 3300048924 Ga0496121_0131212 Ga0496121_0131212_1135_1719 192
766 3300048924 Ga0496121_0251492 Ga0496121_0251492_599_1183 192
767 3300048924 Ga0496121_0263927 Ga0496121_0263927_523_1107 192
768 3300048925 Ga0496122_0006000 Ga0496122_0006000_12906_13490 192
769 3300048925 Ga0496122_0025750 Ga0496122_0025750_1583_2167 192
770 3300048925 Ga0496122_0073026 Ga0496122_0073026_350_928 192
771 3300048926 Ga0496123_0005505 Ga0496123_0005505_173_757 192
772 3300048926 Ga0496123_0030269 Ga0496123_0030269_2301_2885 192
773 3300048926 Ga0496123_0192713 Ga0496123_0192713_450_1034 192
774 3300048927 Ga0496124_0000763 Ga0496124_0000763_11480_12064 192
775 3300048927 Ga0496124_0005424 Ga0496124_0005424_11482_12066 192
776 3300048927 Ga0496124_0095312 Ga0496124_0095312_522_1106 192
777 3300048928 Ga0496125_0000044 Ga0496125_0000044_98641_99225 192
778 3300048928 Ga0496125_0001166 Ga0496125_0001166_38424_39002 192
779 3300048929 Ga0496126_0001457 Ga0496126_0001457_29763_30347 192
780 3300048929 Ga0496126_0004543 Ga0496126_0004543_14263_14841 192
781 3300048929 Ga0496126_0007800 Ga0496126_0007800_4955_5539 192
782 3300048929 Ga0496126_0050859 Ga0496126_0050859_1266_1850 192
783 3300048929 Ga0496126_0096004 Ga0496126_0096004_1140_1724 192
784 3300048929 Ga0496126_0378631 Ga0496126_0378631_512_1096 192
785 3300048929 Ga0496126_0490696 Ga0496126_0490696_224_808 192
786 3300049459 Ga0495678_000152 Ga0495678_000152_74984_75568 192
787 3300049459 Ga0495678_033497 Ga0495678_033497_832_1416 192
788 3300049460 Ga0495682_0003681 Ga0495682_0003681_914_1498 192
789 3300049460 Ga0495682_0004504 Ga0495682_0004504_2118_2702 192
790 3300049460 Ga0495682_0008410 Ga0495682_0008410_2118_2702 192
791 3300049571 Ga0501034_0351593 Ga0501034_0351593_631_1215 192
792 3300049572 Ga0501036_0023361 Ga0501036_0023361_2058_2645 192
793 3300049573 Ga0501037_0030992 Ga0501037_0030992_1405_2010 192
794 3300049573 Ga0501037_0113767 Ga0501037_0113767_103_690 192
795 3300049573 Ga0501037_0145832 Ga0501037_0145832_197_781 192
796 3300049574 Ga0501038_0195290 Ga0501038_0195290_759_1346 192
797 3300049574 Ga0501038_0252901 Ga0501038_0252901_255_839 192
798 3300049579 Ga0501043_0097426 Ga0501043_0097426_83_670 192
799 3300049579 Ga0501043_0374305 Ga0501043_0374305_208_792 192
800 3300049580 Ga0501046_0253963 Ga0501046_0253963_537_1151 192
801 3300049580 Ga0501046_0352865 Ga0501046_0352865_273_860 192
802 3300049581 Ga0501047_0078755 Ga0501047_0078755_1110_1724 192
803 3300049581 Ga0501047_0150264 Ga0501047_0150264_671_1276 192
804 3300049581 Ga0501047_0301893 Ga0501047_0301893_305_892 192
805 3300049585 Ga0501069_0054954 Ga0501069_0054954_1419_2024 192
806 3300049586 Ga0501070_0006571 Ga0501070_0006571_2209_2814 192
807 3300049586 Ga0501070_0025227 Ga0501070_0025227_1899_2483 192
808 3300049586 Ga0501070_0033602 Ga0501070_0033602_966_1622 192
809 3300049586 Ga0501070_0166670 Ga0501070_0166670_462_1046 192
810 3300049586 Ga0501070_0376082 Ga0501070_0376082_145_732 192
811 3300049586 Ga0501070_0447998 Ga0501070_0447998_412_996 192
812 3300049586 Ga0501070_0672590 Ga0501070_0672590_29_613 192
813 3300049587 Ga0501071_0000682 Ga0501071_0000682_15156_15761 192
814 3300049589 Ga0501073_0003157 Ga0501073_0003157_6890_7495 192
815 3300049589 Ga0501073_0125095 Ga0501073_0125095_892_1476 192
816 3300049590 Ga0501074_0000064 Ga0501074_0000064_26838_27443 192
817 3300049590 Ga0501074_0015297 Ga0501074_0015297_2244_2828 192
818 3300049593 Ga0501077_0028303 Ga0501077_0028303_2893_3549 192
819 3300049741 Ga0501079_0090092 Ga0501079_0090092_303_908 192
820 3300049741 Ga0501079_0455174 Ga0501079_0455174_138_722 192
821 3300049741 Ga0501079_0506862 Ga0501079_0506862_175_759 192
822 3300049742 Ga0501080_0000816 Ga0501080_0000816_4497_5102 192
823 3300049742 Ga0501080_0022292 Ga0501080_0022292_2518_3102 192
824 3300049742 Ga0501080_0081299 Ga0501080_0081299_23_607 192
825 3300049742 Ga0501080_0618270 Ga0501080_0618270_23_607 192
826 3300049822 Ga0501035_0001993 Ga0501035_0001993_3205_3789 192
827 3300049822 Ga0501035_0049805 Ga0501035_0049805_2336_2920 192
828 3300049822 Ga0501035_0171146 Ga0501035_0171146_775_1380 192
829 3300049822 Ga0501035_0197599 Ga0501035_0197599_664_1251 192
830 3300049823 Ga0501044_0005303 Ga0501044_0005303_5072_5677 192
831 3300049823 Ga0501044_0021274 Ga0501044_0021274_2881_3465 192
832 3300049823 Ga0501044_0167382 Ga0501044_0167382_612_1196 192
833 3300053087 Ga0500643_000029 Ga0500643_000029_148885_149469 192
834 3300053087 Ga0500643_002345 Ga0500643_002345_7301_7885 192
835 3300053090 Ga0500646_0053849 Ga0500646_0053849_547_1131 192
836 3300053103 Ga0500555_000260 Ga0500555_000260_21023_21607 192
837 3300053120 Ga0500597_000371 Ga0500597_000371_5617_6201 192
838 3300053160 Ga0500633_0000233 Ga0500633_0000233_2719_3303 192
839 3300053161 Ga0500634_0006547 Ga0500634_0006547_2852_3436 192
840 3300053730 Ga0500645_000287 Ga0500645_000287_24505_25089 192
841 3300061719 Ga0466962_0009173 Ga0466962_0009173_1006_1590 192
842 iso_pu_bacteria 2953994433 2953995840 192

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04542

Sigma70_r2

Sigma-70 region 2

66

134

0.97

PF04545

Sigma70_r4

Sigma-70, region 4

164

213

0.97

PF08281

Sigma70_r4_2

Sigma-70, region 4

158

211

0.94

PF07638

Sigma70_ECF

ECF sigma factor

46

217

0.79

Feature Viewer

pLDDT pTM Quality
85.8 0.49 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map