F483012
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 839 | 400 | 1678 | 302 |
Family's Representative Sequence
| Representative Sequence | 3300009147|Ga0114129_10021869|Ga0114129_100218696 |
| Length | 340 |
| Sequence | VKHPEANFSLGASIEVRKRFVEQCHAASRASTGGFSMSIRPVKRLIKSKPTREGAGVHLRRAFGFGNTSEFDPFLLLDDFRNDIPADYLAGFPWHPHRGIETITYVLAGTVEHGDSMGNSGSIAAGDVQWMTAGSGIIHQEMPKGDQAGRMHGFQLWANLPSSLKMTAPAYQEVKAGEIPVATEDDGTNARVVSGKFWGKVGPVRGIAADPIYLDVSVPPGKRRALPVETTRHAFAYVFAGSGKFCNASGPLAVPTEGVGWLETAPPAEADNRSLVLFDRGDEVVVQAGDDGIRFLLVSGKPLEEPVAWYGPIVMNTQEQLRHAFEELQEGTFLKTQAKK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 3 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 4 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 5 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 6 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 7 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 8 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 9 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 10 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 11 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 12 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 13 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 21 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 24 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 47 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 56 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 62 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 64 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 65 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 66 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 67 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 68 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 69 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 70 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 71 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 72 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 73 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 74 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 75 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 77 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 78 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 80 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 82 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 84 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 85 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 86 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 87 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 88 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 89 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 90 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 91 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 93 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 94 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 106 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 119 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 123 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 125 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 126 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 127 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 128 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 129 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 131 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 133 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 196 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 197 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 201 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 202 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 203 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 204 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 205 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 206 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 207 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 208 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 209 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 210 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 211 | 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 212 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 213 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 214 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 215 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 216 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 217 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 218 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 219 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 220 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 221 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 222 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 223 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 224 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 225 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 226 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 227 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 228 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 229 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 230 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 231 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 232 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 233 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 234 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 235 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 236 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 237 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 238 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 239 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 240 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 241 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 242 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 243 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 244 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 245 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 246 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 247 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 248 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 249 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 250 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 251 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 252 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 253 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 254 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 255 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 256 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 257 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 258 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 303 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 304 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 305 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 306 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 307 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 308 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 309 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 310 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 311 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 312 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 313 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 314 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 315 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 316 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 317 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 318 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 319 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 324 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 325 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 331 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 339 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 340 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 341 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 351 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 352 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 353 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 354 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 355 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 356 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 357 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 360 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 361 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 362 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 363 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 364 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 366 | 2510461069 | Rhizobium sp. PDO1-076 | Isolate | Rhizosphere |
| 367 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 368 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 369 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 370 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 371 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 372 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 373 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 374 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 375 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 376 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 377 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 378 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 379 | 2519899620 | Rhizobium sp. Pop5 | Isolate | Nodule |
| 380 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 381 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 382 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 383 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 384 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 385 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 386 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 387 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 388 | 2842395702 | Rhizobium ecuadorense SEMIA 4029 | Isolate | Nodule |
| 389 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 390 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 391 | 3005452660 | Rhizobium grahamii BG7 | Isolate | Unclassified |
| 392 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 393 | 8005246636 | Rhizobium wuzhouense W44 | Isolate | Rhizosphere |
| 394 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 395 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 396 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 397 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 398 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
| 399 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 400 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.35 |
| Metatranscriptomes | 0.48 |
| Isolates | 4.17 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.22 |
| Nodule | 2.5 |
| Rhizoplane | 4.65 |
| Rhizosphere | 87.37 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.67 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0114129_10021869 | 3300009147 | Bacteria | 9078 |
| 2 | JGI24034J26672_10000395 | 3300002239 | Bacteria | 5672 |
| 3 | JGI24751J29686_10001448 | 3300002459 | Bacteria | 4968 |
| 4 | JGI25152J39213_1009730 | 3300002773 | Bacteria | 2258 |
| 5 | JGI25152J39213_1023403 | 3300002773 | Bacteria | 1052 |
| 6 | JGI25150J39212_1003414 | 3300002774 | Bacteria | 3716 |
| 7 | JGI25153J46596_10023340 | 3300003215 | Bacteria | 2258 |
| 8 | rootL2_10338356 | 3300003322 | Bacteria | 2910 |
| 9 | Ga0055526_1012325 | 3300003771 | Bacteria | 3745 |
| 10 | Ga0055526_1014518 | 3300003771 | Bacteria | 3233 |
| 11 | Ga0055524_1010939 | 3300003775 | Bacteria | 3577 |
| 12 | Ga0055528_1000564 | 3300003790 | Bacteria | 28157 |
| 13 | JGI25405J52794_10012762 | 3300003911 | Bacteria | 1622 |
| 14 | Ga0065712_10078561 | 3300005290 | Bacteria | 3327 |
| 15 | Ga0065715_10210154 | 3300005293 | Bacteria | 1318 |
| 16 | Ga0065707_10087272 | 3300005295 | Bacteria | 5095 |
| 17 | Ga0065707_10118512 | 3300005295 | Bacteria | 2184 |
| 18 | Ga0070658_10000436 | 3300005327 | Bacteria | 36382 |
| 19 | Ga0070658_10006864 | 3300005327 | Bacteria | 9203 |
| 20 | Ga0070658_10039625 | 3300005327 | Bacteria | 3801 |
| 21 | Ga0070683_100003628 | 3300005329 | Bacteria | 12579 |
| 22 | Ga0070683_100219340 | 3300005329 | Bacteria | 1808 |
| 23 | Ga0070690_100017471 | 3300005330 | Bacteria | 4314 |
| 24 | Ga0070690_100261858 | 3300005330 | Bacteria | 1227 |
| 25 | Ga0070670_100005898 | 3300005331 | Bacteria | 10354 |
| 26 | Ga0070677_10010478 | 3300005333 | Bacteria | 3172 |
| 27 | Ga0068869_100018903 | 3300005334 | Bacteria | 4698 |
| 28 | Ga0068869_100024134 | 3300005334 | Bacteria | 4211 |
| 29 | Ga0068869_100032805 | 3300005334 | Bacteria | 3662 |
| 30 | Ga0068869_100445742 | 3300005334 | Bacteria | 1072 |
| 31 | Ga0070666_10032124 | 3300005335 | Bacteria | 3467 |
| 32 | Ga0070666_10085975 | 3300005335 | Bacteria | 2154 |
| 33 | Ga0070680_100181601 | 3300005336 | Bacteria | 1772 |
| 34 | Ga0070680_100411090 | 3300005336 | Unclassified | 1154 |
| 35 | Ga0068868_100002323 | 3300005338 | Bacteria | 13152 |
| 36 | Ga0068868_100016570 | 3300005338 | Bacteria | 5477 |
| 37 | Ga0068868_100119469 | 3300005338 | Bacteria | 2149 |
| 38 | Ga0070660_100010277 | 3300005339 | Bacteria | 6606 |
| 39 | Ga0070660_100016379 | 3300005339 | Bacteria | 5379 |
| 40 | Ga0070660_100025506 | 3300005339 | Bacteria | 4393 |
| 41 | Ga0070689_100003600 | 3300005340 | Bacteria | 10323 |
| 42 | Ga0070689_100492167 | 3300005340 | Bacteria | 1049 |
| 43 | Ga0070687_100007512 | 3300005343 | Bacteria | 4549 |
| 44 | Ga0070661_100016387 | 3300005344 | Bacteria | 5238 |
| 45 | Ga0070661_100058733 | 3300005344 | Bacteria | 2819 |
| 46 | Ga0070668_100008772 | 3300005347 | Bacteria | 7508 |
| 47 | Ga0070669_100070483 | 3300005353 | Bacteria | 2584 |
| 48 | Ga0070675_100021225 | 3300005354 | Bacteria | 5187 |
| 49 | Ga0070674_100056146 | 3300005356 | Bacteria | 2730 |
| 50 | Ga0070673_100079690 | 3300005364 | Bacteria | 2652 |
| 51 | Ga0070673_100139156 | 3300005364 | Bacteria | 2046 |
| 52 | Ga0070688_100008955 | 3300005365 | Bacteria | 5451 |
| 53 | Ga0070659_100022378 | 3300005366 | Bacteria | 4824 |
| 54 | Ga0070659_100025993 | 3300005366 | Bacteria | 4503 |
| 55 | Ga0070659_100418445 | 3300005366 | Bacteria | 1133 |
| 56 | Ga0070667_100026632 | 3300005367 | Bacteria | 4809 |
| 57 | Ga0070667_100095890 | 3300005367 | Bacteria | 2558 |
| 58 | Ga0070667_100157023 | 3300005367 | Bacteria | 2001 |
| 59 | Ga0070709_10088925 | 3300005434 | Bacteria | 2033 |
| 60 | Ga0070709_10127080 | 3300005434 | Bacteria | 1736 |
| 61 | Ga0070709_10389981 | 3300005434 | Bacteria | 1037 |
| 62 | Ga0070714_100016773 | 3300005435 | Bacteria | 5923 |
| 63 | Ga0070714_100060401 | 3300005435 | Bacteria | 3253 |
| 64 | Ga0070714_100147884 | 3300005435 | Bacteria | 2114 |
| 65 | Ga0070714_100265391 | 3300005435 | Bacteria | 1591 |
| 66 | Ga0070713_100000068 | 3300005436 | Bacteria | 66744 |
| 67 | Ga0070713_100011925 | 3300005436 | Bacteria | 6356 |
| 68 | Ga0070713_100191678 | 3300005436 | Bacteria | 1842 |
| 69 | Ga0070713_100224597 | 3300005436 | Bacteria | 1705 |
| 70 | Ga0070713_100537974 | 3300005436 | Bacteria | 1105 |
| 71 | Ga0070710_10123860 | 3300005437 | Bacteria | 1568 |
| 72 | Ga0070710_10154752 | 3300005437 | Bacteria | 1417 |
| 73 | Ga0070710_10185326 | 3300005437 | Bacteria | 1306 |
| 74 | Ga0070701_10066740 | 3300005438 | Bacteria | 1913 |
| 75 | Ga0070694_100019121 | 3300005444 | Bacteria | 4355 |
| 76 | Ga0070694_100204794 | 3300005444 | Bacteria | 1472 |
| 77 | Ga0070708_100000703 | 3300005445 | Bacteria | 25498 |
| 78 | Ga0070708_100002137 | 3300005445 | Bacteria | 15265 |
| 79 | Ga0070708_100153546 | 3300005445 | Bacteria | 2142 |
| 80 | Ga0070708_100160462 | 3300005445 | Bacteria | 2095 |
| 81 | Ga0070708_100176210 | 3300005445 | Bacteria | 1998 |
| 82 | Ga0070708_100223030 | 3300005445 | Bacteria | 1768 |
| 83 | Ga0070708_100298453 | 3300005445 | Bacteria | 1517 |
| 84 | Ga0070663_100005814 | 3300005455 | Bacteria | 7368 |
| 85 | Ga0070663_100278912 | 3300005455 | Bacteria | 1331 |
| 86 | Ga0070662_100017334 | 3300005457 | Bacteria | 4855 |
| 87 | Ga0070662_100165652 | 3300005457 | Bacteria | 1732 |
| 88 | Ga0070681_10011020 | 3300005458 | Bacteria | 8936 |
| 89 | Ga0070681_10053443 | 3300005458 | Bacteria | 4025 |
| 90 | Ga0070681_10208369 | 3300005458 | Bacteria | 1871 |
| 91 | Ga0068867_100152682 | 3300005459 | Bacteria | 1815 |
| 92 | Ga0070685_10055518 | 3300005466 | Bacteria | 2301 |
| 93 | Ga0070706_100004130 | 3300005467 | Bacteria | 14124 |
| 94 | Ga0070706_100010574 | 3300005467 | Bacteria | 8562 |
| 95 | Ga0070706_100068156 | 3300005467 | Bacteria | 3290 |
| 96 | Ga0070707_100015056 | 3300005468 | Bacteria | 7257 |
| 97 | Ga0070707_100070745 | 3300005468 | Bacteria | 3360 |
| 98 | Ga0070707_100078221 | 3300005468 | Bacteria | 3191 |
| 99 | Ga0070707_100172740 | 3300005468 | Bacteria | 2106 |
| 100 | Ga0070698_100015417 | 3300005471 | Bacteria | 8074 |
| 101 | Ga0070698_100017312 | 3300005471 | Bacteria | 7594 |
| 102 | Ga0070699_100000002 | 3300005518 | Bacteria | 423451 |
| 103 | Ga0070699_100001492 | 3300005518 | Bacteria | 21457 |
| 104 | Ga0070699_100024547 | 3300005518 | Bacteria | 5196 |
| 105 | Ga0070699_100033123 | 3300005518 | Bacteria | 4463 |
| 106 | Ga0070699_100152309 | 3300005518 | Bacteria | 2046 |
| 107 | Ga0070679_100019158 | 3300005530 | Bacteria | 6649 |
| 108 | Ga0070679_100129164 | 3300005530 | Bacteria | 2508 |
| 109 | Ga0070679_100207909 | 3300005530 | Bacteria | 1921 |
| 110 | Ga0070684_100010810 | 3300005535 | Bacteria | 7249 |
| 111 | Ga0070684_100408471 | 3300005535 | Bacteria | 1252 |
| 112 | Ga0070684_100623496 | 3300005535 | Bacteria | 1003 |
| 113 | Ga0070697_100000154 | 3300005536 | Bacteria | 55469 |
| 114 | Ga0070697_100000611 | 3300005536 | Bacteria | 27144 |
| 115 | Ga0070697_100006310 | 3300005536 | Bacteria | 9175 |
| 116 | Ga0070697_100013207 | 3300005536 | Bacteria | 6474 |
| 117 | Ga0068853_100030276 | 3300005539 | Bacteria | 4571 |
| 118 | Ga0068853_100033957 | 3300005539 | Bacteria | 4327 |
| 119 | Ga0068853_100046059 | 3300005539 | Bacteria | 3738 |
| 120 | Ga0070672_100061244 | 3300005543 | Bacteria | 2966 |
| 121 | Ga0070686_100033912 | 3300005544 | Bacteria | 3140 |
| 122 | Ga0070686_100070019 | 3300005544 | Bacteria | 2293 |
| 123 | Ga0070686_100192441 | 3300005544 | Bacteria | 1457 |
| 124 | Ga0070686_100353330 | 3300005544 | Bacteria | 1105 |
| 125 | Ga0070695_100000241 | 3300005545 | Bacteria | 27145 |
| 126 | Ga0070696_100001603 | 3300005546 | Bacteria | 14828 |
| 127 | Ga0070693_100000001 | 3300005547 | Bacteria | 99999 |
| 128 | Ga0070693_100037193 | 3300005547 | Bacteria | 2712 |
| 129 | Ga0068855_100005049 | 3300005563 | Bacteria | 16107 |
| 130 | Ga0068855_100011563 | 3300005563 | Bacteria | 10660 |
| 131 | Ga0068855_100059758 | 3300005563 | Bacteria | 4459 |
| 132 | Ga0068855_100124938 | 3300005563 | Bacteria | 2942 |
| 133 | Ga0068855_100191067 | 3300005563 | Bacteria | 2309 |
| 134 | Ga0068855_100260624 | 3300005563 | Bacteria | 1931 |
| 135 | Ga0068855_100713531 | 3300005563 | Bacteria | 1072 |
| 136 | Ga0070664_100065457 | 3300005564 | Bacteria | 3101 |
| 137 | Ga0070664_100101165 | 3300005564 | Bacteria | 2506 |
| 138 | Ga0068857_100002564 | 3300005577 | Bacteria | 14880 |
| 139 | Ga0068857_100155678 | 3300005577 | Bacteria | 2072 |
| 140 | Ga0068854_100019445 | 3300005578 | Bacteria | 4577 |
| 141 | Ga0068854_100026294 | 3300005578 | Bacteria | 3999 |
| 142 | Ga0068856_100014394 | 3300005614 | Bacteria | 7646 |
| 143 | Ga0068856_100018361 | 3300005614 | Bacteria | 6778 |
| 144 | Ga0068856_100050518 | 3300005614 | Bacteria | 4099 |
| 145 | Ga0068856_100062942 | 3300005614 | Bacteria | 3664 |
| 146 | Ga0068856_100173720 | 3300005614 | Bacteria | 2167 |
| 147 | Ga0068852_100009157 | 3300005616 | Bacteria | 7333 |
| 148 | Ga0068852_100020604 | 3300005616 | Bacteria | 5245 |
| 149 | Ga0068859_100047633 | 3300005617 | Bacteria | 4307 |
| 150 | Ga0068859_100153038 | 3300005617 | Bacteria | 2382 |
| 151 | Ga0068859_100477679 | 3300005617 | Bacteria | 1342 |
| 152 | Ga0068864_100085594 | 3300005618 | Bacteria | 2772 |
| 153 | Ga0068864_100137255 | 3300005618 | Bacteria | 2203 |
| 154 | Ga0068861_100157546 | 3300005719 | Bacteria | 1870 |
| 155 | Ga0068861_100512098 | 3300005719 | Bacteria | 1087 |
| 156 | Ga0068851_10022887 | 3300005834 | Bacteria | 3049 |
| 157 | Ga0068870_10001403 | 3300005840 | Bacteria | 9723 |
| 158 | Ga0068858_100006301 | 3300005842 | Bacteria | 11552 |
| 159 | Ga0068858_100031219 | 3300005842 | Bacteria | 4947 |
| 160 | Ga0068862_100007985 | 3300005844 | Bacteria | 8755 |
| 161 | Ga0068862_100022065 | 3300005844 | Bacteria | 5326 |
| 162 | Ga0068862_100238359 | 3300005844 | Bacteria | 1653 |
| 163 | Ga0081455_10003446 | 3300005937 | Bacteria | 18181 |
| 164 | Ga0070717_10006541 | 3300006028 | Bacteria | 8579 |
| 165 | Ga0070717_10009078 | 3300006028 | Bacteria | 7465 |
| 166 | Ga0070717_10016985 | 3300006028 | Bacteria | 5653 |
| 167 | Ga0070717_10018181 | 3300006028 | Bacteria | 5485 |
| 168 | Ga0070717_10020707 | 3300006028 | Bacteria | 5179 |
| 169 | Ga0070717_10049885 | 3300006028 | Bacteria | 3437 |
| 170 | Ga0070717_10071819 | 3300006028 | Bacteria | 2888 |
| 171 | Ga0070717_10093447 | 3300006028 | Bacteria | 2543 |
| 172 | Ga0070717_10110751 | 3300006028 | Bacteria | 2342 |
| 173 | Ga0070717_10198433 | 3300006028 | Bacteria | 1757 |
| 174 | Ga0070717_10209519 | 3300006028 | Bacteria | 1710 |
| 175 | Ga0075365_10000703 | 3300006038 | Bacteria | 13456 |
| 176 | Ga0075363_100039612 | 3300006048 | Bacteria | 2481 |
| 177 | Ga0070715_10017110 | 3300006163 | Bacteria | 2739 |
| 178 | Ga0070715_10051193 | 3300006163 | Bacteria | 1776 |
| 179 | Ga0070716_100001016 | 3300006173 | Bacteria | 12286 |
| 180 | Ga0070716_100010992 | 3300006173 | Bacteria | 4554 |
| 181 | Ga0070716_100011138 | 3300006173 | Bacteria | 4526 |
| 182 | Ga0070716_100207067 | 3300006173 | Bacteria | 1308 |
| 183 | Ga0070716_100393913 | 3300006173 | Bacteria | 994 |
| 184 | Ga0070712_100000283 | 3300006175 | Bacteria | 28629 |
| 185 | Ga0070712_100031917 | 3300006175 | Bacteria | 3552 |
| 186 | Ga0070712_100037660 | 3300006175 | Bacteria | 3299 |
| 187 | Ga0070712_100440397 | 3300006175 | Bacteria | 1083 |
| 188 | Ga0075369_10009433 | 3300006186 | Bacteria | 3792 |
| 189 | Ga0097621_100000636 | 3300006237 | Bacteria | 24794 |
| 190 | Ga0097621_100007637 | 3300006237 | Bacteria | 7751 |
| 191 | Ga0097621_100207105 | 3300006237 | Bacteria | 1705 |
| 192 | Ga0097621_100242139 | 3300006237 | Bacteria | 1577 |
| 193 | Ga0097621_100417300 | 3300006237 | Bacteria | 1204 |
| 194 | Ga0075370_10131609 | 3300006353 | Bacteria | 1459 |
| 195 | Ga0068871_100003144 | 3300006358 | Bacteria | 11330 |
| 196 | Ga0068871_100009581 | 3300006358 | Bacteria | 7030 |
| 197 | Ga0068871_100048745 | 3300006358 | Bacteria | 3421 |
| 198 | Ga0068871_100131569 | 3300006358 | Bacteria | 2122 |
| 199 | Ga0068871_100431734 | 3300006358 | Bacteria | 1178 |
| 200 | Ga0075428_100001111 | 3300006844 | Bacteria | 28645 |
| 201 | Ga0075430_100059190 | 3300006846 | Bacteria | 3221 |
| 202 | Ga0075431_100009788 | 3300006847 | Bacteria | 9627 |
| 203 | Ga0075431_100013464 | 3300006847 | Bacteria | 8261 |
| 204 | Ga0075431_100303384 | 3300006847 | Bacteria | 1613 |
| 205 | Ga0075434_100274047 | 3300006871 | Bacteria | 1706 |
| 206 | Ga0068865_100169941 | 3300006881 | Bacteria | 1670 |
| 207 | Ga0075436_100007096 | 3300006914 | Bacteria | 7669 |
| 208 | Ga0075436_100275580 | 3300006914 | Bacteria | 1202 |
| 209 | Ga0097620_100047633 | 3300006931 | Bacteria | 4307 |
| 210 | Ga0097620_100153046 | 3300006931 | Bacteria | 2382 |
| 211 | Ga0097620_100477675 | 3300006931 | Bacteria | 1342 |
| 212 | Ga0075435_100029466 | 3300007076 | Bacteria | 4308 |
| 213 | Ga0075435_100085881 | 3300007076 | Bacteria | 2590 |
| 214 | Ga0075435_100100996 | 3300007076 | Bacteria | 2390 |
| 215 | Ga0099794_10012765 | 3300007265 | Bacteria | 3638 |
| 216 | Ga0099794_10084771 | 3300007265 | Bacteria | 1567 |
| 217 | Ga0105240_10003524 | 3300009093 | Bacteria | 24282 |
| 218 | Ga0105240_10040280 | 3300009093 | Bacteria | 5977 |
| 219 | Ga0105240_10067711 | 3300009093 | Bacteria | 4425 |
| 220 | Ga0105240_10082835 | 3300009093 | Bacteria | 3939 |
| 221 | Ga0105240_10088483 | 3300009093 | Bacteria | 3789 |
| 222 | Ga0105240_10190509 | 3300009093 | Bacteria | 2412 |
| 223 | Ga0105240_10283048 | 3300009093 | Bacteria | 1904 |
| 224 | Ga0105240_10329008 | 3300009093 | Bacteria | 1739 |
| 225 | Ga0105240_10477773 | 3300009093 | Bacteria | 1390 |
| 226 | Ga0111539_10001049 | 3300009094 | Bacteria | 36370 |
| 227 | Ga0111539_10561622 | 3300009094 | Bacteria | 1329 |
| 228 | Ga0105245_10002615 | 3300009098 | Bacteria | 16222 |
| 229 | Ga0105245_10015459 | 3300009098 | Bacteria | 6654 |
| 230 | Ga0105245_10088178 | 3300009098 | Bacteria | 2849 |
| 231 | Ga0105245_10095813 | 3300009098 | Bacteria | 2738 |
| 232 | Ga0105245_10096048 | 3300009098 | Bacteria | 2734 |
| 233 | Ga0105247_10006087 | 3300009101 | Bacteria | 7498 |
| 234 | Ga0114129_10010346 | 3300009147 | Bacteria | 13303 |
| 235 | Ga0114129_10056624 | 3300009147 | Bacteria | 5491 |
| 236 | Ga0114129_10157785 | 3300009147 | Bacteria | 3102 |
| 237 | Ga0114129_10235570 | 3300009147 | Bacteria | 2463 |
| 238 | Ga0114129_10403523 | 3300009147 | Bacteria | 1801 |
| 239 | Ga0105243_10060212 | 3300009148 | Bacteria | 3033 |
| 240 | Ga0105241_10007751 | 3300009174 | Bacteria | 7893 |
| 241 | Ga0105241_10054775 | 3300009174 | Bacteria | 3054 |
| 242 | Ga0105241_10102911 | 3300009174 | Bacteria | 2273 |
| 243 | Ga0105242_10051708 | 3300009176 | Bacteria | 3349 |
| 244 | Ga0105242_10075750 | 3300009176 | Bacteria | 2802 |
| 245 | Ga0105248_10067771 | 3300009177 | Bacteria | 4007 |
| 246 | Ga0105248_10067870 | 3300009177 | Bacteria | 4004 |
| 247 | Ga0105248_10091809 | 3300009177 | Bacteria | 3419 |
| 248 | Ga0105248_10099340 | 3300009177 | Bacteria | 3280 |
| 249 | Ga0105248_10105475 | 3300009177 | Bacteria | 3177 |
| 250 | Ga0105248_10132428 | 3300009177 | Bacteria | 2813 |
| 251 | Ga0105248_10220072 | 3300009177 | Bacteria | 2138 |
| 252 | Ga0105237_10034990 | 3300009545 | Bacteria | 5083 |
| 253 | Ga0105237_10188531 | 3300009545 | Bacteria | 2062 |
| 254 | Ga0105237_10465764 | 3300009545 | Bacteria | 1270 |
| 255 | Ga0105238_10020563 | 3300009551 | Bacteria | 6721 |
| 256 | Ga0105238_10037755 | 3300009551 | Bacteria | 4909 |
| 257 | Ga0105249_10013389 | 3300009553 | Bacteria | 7243 |
| 258 | Ga0123342_1010346 | 3300009766 | Bacteria | 10744 |
| 259 | Ga0105239_10011126 | 3300010375 | Bacteria | 10044 |
| 260 | Ga0105239_10043696 | 3300010375 | Bacteria | 4913 |
| 261 | Ga0105239_10321878 | 3300010375 | Bacteria | 1744 |
| 262 | Ga0105246_10045000 | 3300011119 | Bacteria | 3003 |
| 263 | Ga0157373_10007427 | 3300013100 | Bacteria | 8153 |
| 264 | Ga0157373_10039563 | 3300013100 | Bacteria | 3376 |
| 265 | Ga0157371_10006699 | 3300013102 | Bacteria | 9420 |
| 266 | Ga0157370_10020660 | 3300013104 | Bacteria | 6573 |
| 267 | Ga0157370_10168838 | 3300013104 | Bacteria | 2034 |
| 268 | Ga0157369_10017310 | 3300013105 | Bacteria | 8101 |
| 269 | Ga0157369_10053879 | 3300013105 | Bacteria | 4345 |
| 270 | Ga0157369_10107252 | 3300013105 | Bacteria | 2972 |
| 271 | Ga0157369_10303204 | 3300013105 | Bacteria | 1661 |
| 272 | Ga0157374_10011586 | 3300013296 | Bacteria | 7644 |
| 273 | Ga0157374_10012444 | 3300013296 | Bacteria | 7402 |
| 274 | Ga0157374_10069910 | 3300013296 | Bacteria | 3307 |
| 275 | Ga0157374_10082445 | 3300013296 | Bacteria | 3053 |
| 276 | Ga0157374_10146847 | 3300013296 | Bacteria | 2291 |
| 277 | Ga0157374_10154552 | 3300013296 | Bacteria | 2232 |
| 278 | Ga0157374_10208470 | 3300013296 | Bacteria | 1916 |
| 279 | Ga0157374_10242422 | 3300013296 | Unclassified | 1773 |
| 280 | Ga0157378_10024126 | 3300013297 | Bacteria | 5350 |
| 281 | Ga0157378_10091691 | 3300013297 | Bacteria | 2763 |
| 282 | Ga0157378_10210096 | 3300013297 | Bacteria | 1845 |
| 283 | Ga0163162_10092712 | 3300013306 | Bacteria | 3105 |
| 284 | Ga0163162_10131133 | 3300013306 | Bacteria | 2615 |
| 285 | Ga0157372_10018667 | 3300013307 | Bacteria | 7461 |
| 286 | Ga0157372_10044056 | 3300013307 | Bacteria | 4943 |
| 287 | Ga0157372_10053523 | 3300013307 | Bacteria | 4499 |
| 288 | Ga0157372_10059662 | 3300013307 | Bacteria | 4268 |
| 289 | Ga0157372_10074783 | 3300013307 | Bacteria | 3821 |
| 290 | Ga0157372_10199010 | 3300013307 | Bacteria | 2321 |
| 291 | Ga0157375_10027706 | 3300013308 | Bacteria | 5300 |
| 292 | Ga0157375_10077423 | 3300013308 | Bacteria | 3355 |
| 293 | Ga0157375_10142829 | 3300013308 | Bacteria | 2522 |
| 294 | Ga0157375_10161700 | 3300013308 | Bacteria | 2381 |
| 295 | Ga0163163_10000003 | 3300014325 | Bacteria | 455102 |
| 296 | Ga0163163_10000442 | 3300014325 | Bacteria | 37880 |
| 297 | Ga0163163_10022494 | 3300014325 | Bacteria | 5970 |
| 298 | Ga0163163_10032102 | 3300014325 | Bacteria | 5072 |
| 299 | Ga0163163_10072349 | 3300014325 | Bacteria | 3437 |
| 300 | Ga0163163_10261269 | 3300014325 | Bacteria | 1782 |
| 301 | Ga0182008_10039094 | 3300014497 | Bacteria | 2372 |
| 302 | Ga0157377_10003684 | 3300014745 | Bacteria | 6948 |
| 303 | Ga0157379_10027492 | 3300014968 | Bacteria | 5065 |
| 304 | Ga0157379_10091553 | 3300014968 | Bacteria | 2728 |
| 305 | Ga0157376_10005928 | 3300014969 | Bacteria | 8580 |
| 306 | Ga0157376_10021679 | 3300014969 | Bacteria | 4992 |
| 307 | Ga0157376_10036856 | 3300014969 | Bacteria | 3964 |
| 308 | Ga0157376_10095512 | 3300014969 | Bacteria | 2585 |
| 309 | Ga0182007_10002588 | 3300015262 | Bacteria | 8903 |
| 310 | Ga0182007_10019401 | 3300015262 | Bacteria | 2445 |
| 311 | Ga0163161_10004345 | 3300017792 | Bacteria | 9878 |
| 312 | Ga0213871_10006971 | 3300021441 | Bacteria | 2420 |
| 313 | Ga0228598_1001381 | 3300024227 | Bacteria | 5334 |
| 314 | Ga0228598_1004994 | 3300024227 | Bacteria | 2789 |
| 315 | Ga0228598_1012969 | 3300024227 | Bacteria | 1652 |
| 316 | Ga0207425_1004391 | 3300025245 | Bacteria | 4249 |
| 317 | Ga0209129_1001686 | 3300025258 | Bacteria | 11960 |
| 318 | Ga0209129_1001949 | 3300025258 | Bacteria | 10778 |
| 319 | Ga0209673_1000135 | 3300025273 | Bacteria | 160333 |
| 320 | Ga0209673_1006097 | 3300025273 | Bacteria | 5911 |
| 321 | Ga0209025_1016800 | 3300025294 | Bacteria | 4281 |
| 322 | Ga0209564_1000138 | 3300025295 | Bacteria | 181512 |
| 323 | Ga0209564_1011683 | 3300025295 | Bacteria | 3908 |
| 324 | Ga0209758_1001640 | 3300025297 | Bacteria | 25413 |
| 325 | Ga0209256_1001423 | 3300025299 | Bacteria | 24892 |
| 326 | Ga0207426_1004269 | 3300025302 | Bacteria | 7081 |
| 327 | Ga0207697_10001953 | 3300025315 | Bacteria | 10958 |
| 328 | Ga0207656_10031155 | 3300025321 | Bacteria | 2208 |
| 329 | Ga0207653_10000864 | 3300025885 | Bacteria | 10086 |
| 330 | Ga0207682_10009574 | 3300025893 | Bacteria | 3820 |
| 331 | Ga0207692_10078362 | 3300025898 | Bacteria | 1760 |
| 332 | Ga0207692_10142166 | 3300025898 | Bacteria | 1366 |
| 333 | Ga0207680_10014593 | 3300025903 | Bacteria | 4073 |
| 334 | Ga0207680_10015402 | 3300025903 | Bacteria | 3989 |
| 335 | Ga0207680_10190778 | 3300025903 | Bacteria | 1391 |
| 336 | Ga0207647_10006231 | 3300025904 | Bacteria | 8690 |
| 337 | Ga0207699_10000689 | 3300025906 | Bacteria | 16203 |
| 338 | Ga0207699_10028318 | 3300025906 | Bacteria | 3112 |
| 339 | Ga0207699_10224945 | 3300025906 | Bacteria | 1283 |
| 340 | Ga0207645_10000720 | 3300025907 | Bacteria | 27522 |
| 341 | Ga0207643_10000381 | 3300025908 | Bacteria | 29761 |
| 342 | Ga0207705_10001399 | 3300025909 | Bacteria | 19236 |
| 343 | Ga0207705_10003150 | 3300025909 | Bacteria | 12558 |
| 344 | Ga0207684_10000203 | 3300025910 | Bacteria | 91833 |
| 345 | Ga0207684_10006734 | 3300025910 | Bacteria | 10428 |
| 346 | Ga0207684_10056700 | 3300025910 | Bacteria | 3324 |
| 347 | Ga0207654_10097859 | 3300025911 | Bacteria | 1802 |
| 348 | Ga0207654_10126145 | 3300025911 | Bacteria | 1614 |
| 349 | Ga0207707_10073387 | 3300025912 | Bacteria | 2984 |
| 350 | Ga0207695_10079776 | 3300025913 | Unclassified | 3316 |
| 351 | Ga0207695_10186106 | 3300025913 | Bacteria | 1995 |
| 352 | Ga0207695_10230740 | 3300025913 | Bacteria | 1756 |
| 353 | Ga0207671_10000006 | 3300025914 | Bacteria | 836809 |
| 354 | Ga0207671_10052653 | 3300025914 | Bacteria | 3016 |
| 355 | Ga0207671_10059974 | 3300025914 | Bacteria | 2822 |
| 356 | Ga0207671_10185847 | 3300025914 | Bacteria | 1619 |
| 357 | Ga0207671_10306593 | 3300025914 | Bacteria | 1255 |
| 358 | Ga0207671_10404669 | 3300025914 | Bacteria | 1085 |
| 359 | Ga0207693_10000054 | 3300025915 | Bacteria | 96633 |
| 360 | Ga0207693_10005606 | 3300025915 | Bacteria | 10439 |
| 361 | Ga0207693_10069860 | 3300025915 | Bacteria | 2748 |
| 362 | Ga0207693_10078051 | 3300025915 | Bacteria | 2592 |
| 363 | Ga0207693_10110535 | 3300025915 | Bacteria | 2155 |
| 364 | Ga0207663_10134160 | 3300025916 | Bacteria | 1715 |
| 365 | Ga0207660_10084381 | 3300025917 | Bacteria | 2341 |
| 366 | Ga0207660_10197520 | 3300025917 | Bacteria | 1570 |
| 367 | Ga0207660_10256270 | 3300025917 | Bacteria | 1382 |
| 368 | Ga0207662_10013577 | 3300025918 | Bacteria | 4557 |
| 369 | Ga0207657_10000246 | 3300025919 | Bacteria | 57698 |
| 370 | Ga0207657_10000344 | 3300025919 | Bacteria | 49261 |
| 371 | Ga0207649_10004406 | 3300025920 | Bacteria | 7640 |
| 372 | Ga0207652_10012959 | 3300025921 | Bacteria | 6746 |
| 373 | Ga0207652_10179134 | 3300025921 | Bacteria | 1904 |
| 374 | Ga0207652_10228016 | 3300025921 | Bacteria | 1679 |
| 375 | Ga0207652_10278176 | 3300025921 | Bacteria | 1510 |
| 376 | Ga0207646_10001438 | 3300025922 | Bacteria | 29540 |
| 377 | Ga0207694_10005000 | 3300025924 | Bacteria | 10256 |
| 378 | Ga0207694_10011132 | 3300025924 | Bacteria | 6792 |
| 379 | Ga0207694_10161434 | 3300025924 | Bacteria | 1810 |
| 380 | Ga0207694_10196842 | 3300025924 | Bacteria | 1639 |
| 381 | Ga0207694_10352530 | 3300025924 | Bacteria | 1218 |
| 382 | Ga0207650_10000098 | 3300025925 | Bacteria | 115403 |
| 383 | Ga0207687_10001671 | 3300025927 | Bacteria | 15303 |
| 384 | Ga0207687_10089760 | 3300025927 | Bacteria | 2238 |
| 385 | Ga0207700_10000927 | 3300025928 | Bacteria | 16845 |
| 386 | Ga0207700_10001471 | 3300025928 | Bacteria | 13350 |
| 387 | Ga0207700_10009225 | 3300025928 | Bacteria | 6152 |
| 388 | Ga0207700_10050905 | 3300025928 | Bacteria | 3088 |
| 389 | Ga0207700_10116859 | 3300025928 | Bacteria | 2156 |
| 390 | Ga0207700_10309168 | 3300025928 | Bacteria | 1367 |
| 391 | Ga0207700_10381150 | 3300025928 | Bacteria | 1233 |
| 392 | Ga0207664_10034898 | 3300025929 | Bacteria | 3877 |
| 393 | Ga0207664_10095843 | 3300025929 | Bacteria | 2441 |
| 394 | Ga0207664_10238747 | 3300025929 | Bacteria | 1582 |
| 395 | Ga0207664_10432019 | 3300025929 | Bacteria | 1174 |
| 396 | Ga0207664_10463040 | 3300025929 | Bacteria | 1132 |
| 397 | Ga0207644_10010814 | 3300025931 | Bacteria | 6023 |
| 398 | Ga0207690_10019647 | 3300025932 | Bacteria | 4163 |
| 399 | Ga0207690_10237864 | 3300025932 | Bacteria | 1401 |
| 400 | Ga0207706_10001532 | 3300025933 | Bacteria | 22934 |
| 401 | Ga0207706_10018416 | 3300025933 | Bacteria | 6284 |
| 402 | Ga0207686_10108340 | 3300025934 | Bacteria | 1869 |
| 403 | Ga0207686_10459376 | 3300025934 | Bacteria | 981 |
| 404 | Ga0207670_10006804 | 3300025936 | Bacteria | 6359 |
| 405 | Ga0207670_10013827 | 3300025936 | Bacteria | 4774 |
| 406 | Ga0207669_10029158 | 3300025937 | Bacteria | 3048 |
| 407 | Ga0207704_10043027 | 3300025938 | Bacteria | 2663 |
| 408 | Ga0207665_10001266 | 3300025939 | Bacteria | 17044 |
| 409 | Ga0207665_10026998 | 3300025939 | Bacteria | 3792 |
| 410 | Ga0207665_10076572 | 3300025939 | Bacteria | 2294 |
| 411 | Ga0207665_10121928 | 3300025939 | Bacteria | 1842 |
| 412 | Ga0207691_10000038 | 3300025940 | Bacteria | 107867 |
| 413 | Ga0207691_10060899 | 3300025940 | Bacteria | 3429 |
| 414 | Ga0207711_10010790 | 3300025941 | Bacteria | 7593 |
| 415 | Ga0207711_10092312 | 3300025941 | Bacteria | 2664 |
| 416 | Ga0207711_10100621 | 3300025941 | Bacteria | 2557 |
| 417 | Ga0207711_10380271 | 3300025941 | Bacteria | 1310 |
| 418 | Ga0207689_10000632 | 3300025942 | Bacteria | 33593 |
| 419 | Ga0207689_10003881 | 3300025942 | Bacteria | 13622 |
| 420 | Ga0207689_10033321 | 3300025942 | Bacteria | 4281 |
| 421 | Ga0207689_10043033 | 3300025942 | Bacteria | 3734 |
| 422 | Ga0207661_10002817 | 3300025944 | Bacteria | 12010 |
| 423 | Ga0207661_10136543 | 3300025944 | Bacteria | 2107 |
| 424 | Ga0207661_10155197 | 3300025944 | Bacteria | 1982 |
| 425 | Ga0207661_10232305 | 3300025944 | Bacteria | 1634 |
| 426 | Ga0207679_10000078 | 3300025945 | Bacteria | 86272 |
| 427 | Ga0207679_10018813 | 3300025945 | Bacteria | 4634 |
| 428 | Ga0207679_10166515 | 3300025945 | Bacteria | 1810 |
| 429 | Ga0207667_10005939 | 3300025949 | Bacteria | 14866 |
| 430 | Ga0207667_10026055 | 3300025949 | Bacteria | 6394 |
| 431 | Ga0207667_10201616 | 3300025949 | Bacteria | 2041 |
| 432 | Ga0207667_10360371 | 3300025949 | Bacteria | 1483 |
| 433 | Ga0207667_10375223 | 3300025949 | Bacteria | 1449 |
| 434 | Ga0207651_10011928 | 3300025960 | Bacteria | 4887 |
| 435 | Ga0207651_10024197 | 3300025960 | Bacteria | 3752 |
| 436 | Ga0207651_10110410 | 3300025960 | Bacteria | 2063 |
| 437 | Ga0207712_10084185 | 3300025961 | Bacteria | 2323 |
| 438 | Ga0207668_10014150 | 3300025972 | Bacteria | 4934 |
| 439 | Ga0207668_10133589 | 3300025972 | Bacteria | 1898 |
| 440 | Ga0207640_10069540 | 3300025981 | Bacteria | 2364 |
| 441 | Ga0207640_10164201 | 3300025981 | Bacteria | 1647 |
| 442 | Ga0207658_10010579 | 3300025986 | Bacteria | 6269 |
| 443 | Ga0207658_10025386 | 3300025986 | Bacteria | 4149 |
| 444 | Ga0207677_10038875 | 3300026023 | Bacteria | 3123 |
| 445 | Ga0207677_10109184 | 3300026023 | Bacteria | 2056 |
| 446 | Ga0207677_10172428 | 3300026023 | Bacteria | 1693 |
| 447 | Ga0207703_10064742 | 3300026035 | Bacteria | 3001 |
| 448 | Ga0207703_10387877 | 3300026035 | Bacteria | 1293 |
| 449 | Ga0207639_10005525 | 3300026041 | Bacteria | 8543 |
| 450 | Ga0207639_10027905 | 3300026041 | Bacteria | 4116 |
| 451 | Ga0207639_10029332 | 3300026041 | Bacteria | 4026 |
| 452 | Ga0207678_10000348 | 3300026067 | Bacteria | 41968 |
| 453 | Ga0207678_10062434 | 3300026067 | Bacteria | 3202 |
| 454 | Ga0207678_10181777 | 3300026067 | Bacteria | 1796 |
| 455 | Ga0207702_10143061 | 3300026078 | Bacteria | 2167 |
| 456 | Ga0207702_10286407 | 3300026078 | Bacteria | 1559 |
| 457 | Ga0207641_10000021 | 3300026088 | Bacteria | 279851 |
| 458 | Ga0207641_10040038 | 3300026088 | Bacteria | 3921 |
| 459 | Ga0207641_10066356 | 3300026088 | Bacteria | 3089 |
| 460 | Ga0207648_10000703 | 3300026089 | Bacteria | 37521 |
| 461 | Ga0207648_10014082 | 3300026089 | Bacteria | 7399 |
| 462 | Ga0207648_10034905 | 3300026089 | Bacteria | 4434 |
| 463 | Ga0207676_10000262 | 3300026095 | Bacteria | 45744 |
| 464 | Ga0207676_10179843 | 3300026095 | Bacteria | 1851 |
| 465 | Ga0207674_10000386 | 3300026116 | Bacteria | 57404 |
| 466 | Ga0207674_10040973 | 3300026116 | Bacteria | 4793 |
| 467 | Ga0207674_10176731 | 3300026116 | Bacteria | 2087 |
| 468 | Ga0207674_10581240 | 3300026116 | Bacteria | 1082 |
| 469 | Ga0207675_100006514 | 3300026118 | Bacteria | 11050 |
| 470 | Ga0207675_100269475 | 3300026118 | Bacteria | 1652 |
| 471 | Ga0207683_10000045 | 3300026121 | Bacteria | 89294 |
| 472 | Ga0207683_10027391 | 3300026121 | Bacteria | 4924 |
| 473 | Ga0207683_10111548 | 3300026121 | Bacteria | 2449 |
| 474 | Ga0207698_10037698 | 3300026142 | Bacteria | 3564 |
| 475 | Ga0209588_1028182 | 3300027671 | Bacteria | 1788 |
| 476 | Ga0207428_10039787 | 3300027907 | Bacteria | 3817 |
| 477 | Ga0265354_1002157 | 3300028016 | Bacteria | 2521 |
| 478 | Ga0268266_10007297 | 3300028379 | Bacteria | 9995 |
| 479 | Ga0268266_10045322 | 3300028379 | Bacteria | 3762 |
| 480 | Ga0268266_10306086 | 3300028379 | Bacteria | 1484 |
| 481 | Ga0268265_10007057 | 3300028380 | Bacteria | 7596 |
| 482 | Ga0268265_10089839 | 3300028380 | Bacteria | 2452 |
| 483 | Ga0268264_10037698 | 3300028381 | Bacteria | 3986 |
| 484 | Ga0265337_1001373 | 3300028556 | Bacteria | 11976 |
| 485 | Ga0265319_1006216 | 3300028563 | Bacteria | 5563 |
| 486 | Ga0265334_10034209 | 3300028573 | Bacteria | 2018 |
| 487 | Ga0265323_10018655 | 3300028653 | Bacteria | 2682 |
| 488 | Ga0265323_10018865 | 3300028653 | Bacteria | 2665 |
| 489 | Ga0265322_10017956 | 3300028654 | Bacteria | 2036 |
| 490 | Ga0265336_10000507 | 3300028666 | Bacteria | 22737 |
| 491 | Ga0307515_10000277 | 3300028794 | Bacteria | 125765 |
| 492 | Ga0265338_10002794 | 3300028800 | Bacteria | 25522 |
| 493 | Ga0265338_10002935 | 3300028800 | Bacteria | 24739 |
| 494 | Ga0265338_10004483 | 3300028800 | Bacteria | 18827 |
| 495 | Ga0265338_10016778 | 3300028800 | Bacteria | 7934 |
| 496 | Ga0265338_10028532 | 3300028800 | Bacteria | 5563 |
| 497 | Ga0265338_10041537 | 3300028800 | Bacteria | 4300 |
| 498 | Ga0265338_10050628 | 3300028800 | Bacteria | 3752 |
| 499 | Ga0265338_10064288 | 3300028800 | Bacteria | 3192 |
| 500 | Ga0265338_10169984 | 3300028800 | Bacteria | 1673 |
| 501 | Ga0265324_10006000 | 3300029957 | Bacteria | 5145 |
| 502 | Ga0265762_1000129 | 3300030760 | Bacteria | 11439 |
| 503 | Ga0265770_1001133 | 3300030878 | Bacteria | 3677 |
| 504 | Ga0265765_1000923 | 3300030879 | Bacteria | 2578 |
| 505 | Ga0265760_10007969 | 3300031090 | Bacteria | 3025 |
| 506 | Ga0265328_10007524 | 3300031239 | Bacteria | 4536 |
| 507 | Ga0265320_10000443 | 3300031240 | Bacteria | 32427 |
| 508 | Ga0265320_10045144 | 3300031240 | Bacteria | 2166 |
| 509 | Ga0265325_10071857 | 3300031241 | Bacteria | 1735 |
| 510 | Ga0265340_10121060 | 3300031247 | Bacteria | 1204 |
| 511 | Ga0265339_10048655 | 3300031249 | Bacteria | 2324 |
| 512 | Ga0265316_10007238 | 3300031344 | Bacteria | 10479 |
| 513 | Ga0265316_10098812 | 3300031344 | Bacteria | 2221 |
| 514 | Ga0307513_10056058 | 3300031456 | Bacteria | 4211 |
| 515 | Ga0307513_10097050 | 3300031456 | Bacteria | 2983 |
| 516 | Ga0265313_10012488 | 3300031595 | Bacteria | 5178 |
| 517 | Ga0265314_10064457 | 3300031711 | Bacteria | 2480 |
| 518 | Ga0265342_10014674 | 3300031712 | Bacteria | 5192 |
| 519 | Ga0316576_10041742 | 3300031727 | Bacteria | 3305 |
| 520 | Ga0316576_10229412 | 3300031727 | Bacteria | 1396 |
| 521 | Ga0373926_0001709 | 3300035083 | Bacteria | 6800 |
| 522 | Ga0373926_0059066 | 3300035083 | Unclassified | 1395 |
| 523 | Ga0373934_0002139 | 3300035086 | Bacteria | 7261 |
| 524 | Ga0373934_0069520 | 3300035086 | Bacteria | 1407 |
| 525 | Ga0373944_0009873 | 3300035089 | Bacteria | 2595 |
| 526 | Ga0373923_0031920 | 3300035111 | Bacteria | 2125 |
| 527 | Ga0373936_0005493 | 3300035113 | Bacteria | 4782 |
| 528 | Ga0373936_0037604 | 3300035113 | Bacteria | 1933 |
| 529 | Ga0373945_0005619 | 3300035116 | Bacteria | 4021 |
| 530 | Ga0373945_0011448 | 3300035116 | Bacteria | 2934 |
| 531 | Ga0373953_0002457 | 3300035117 | Bacteria | 5607 |
| 532 | Ga0373954_0006207 | 3300035118 | Bacteria | 5209 |
| 533 | Ga0373954_0045115 | 3300035118 | Bacteria | 2059 |
| 534 | Ga0373954_0091029 | 3300035118 | Bacteria | 1465 |
| 535 | Ga0373956_0060782 | 3300035119 | Bacteria | 1711 |
| 536 | Ga0373956_0087419 | 3300035119 | Bacteria | 1435 |
| 537 | Ga0373943_0058937 | 3300035170 | Bacteria | 1912 |
| 538 | Ga0373955_0000879 | 3300035172 | Bacteria | 12892 |
| 539 | Ga0373955_0139805 | 3300035172 | Bacteria | 1419 |
| 540 | Ga0373955_0178406 | 3300035172 | Bacteria | 1260 |
| 541 | Ga0373924_0000277 | 3300035410 | Bacteria | 15788 |
| 542 | Ga0373924_0081256 | 3300035410 | Bacteria | 1379 |
| 543 | Ga0373931_0054160 | 3300035691 | Bacteria | 2143 |
| 544 | Ga0373935_0012623 | 3300035692 | Bacteria | 5082 |
| 545 | Ga0373935_0025464 | 3300035692 | Bacteria | 3646 |
| 546 | Ga0373935_0067926 | 3300035692 | Bacteria | 2293 |
| 547 | Ga0373935_0122895 | 3300035692 | Bacteria | 1736 |
| 548 | Ga0373935_0180746 | 3300035692 | Bacteria | 1448 |
| 549 | Ga0373927_0001563 | 3300035695 | Bacteria | 17150 |
| 550 | Ga0373927_0017340 | 3300035695 | Bacteria | 4740 |
| 551 | Ga0373927_0022869 | 3300035695 | Bacteria | 4095 |
| 552 | Ga0373927_0037625 | 3300035695 | Bacteria | 3144 |
| 553 | Ga0373927_0041537 | 3300035695 | Bacteria | 2983 |
| 554 | Ga0373927_0059600 | 3300035695 | Bacteria | 2469 |
| 555 | Ga0373927_0075354 | 3300035695 | Bacteria | 2185 |
| 556 | Ga0373933_0001231 | 3300035724 | Bacteria | 15131 |
| 557 | Ga0373933_0014608 | 3300035724 | Bacteria | 4371 |
| 558 | Ga0373933_0206523 | 3300035724 | Bacteria | 1258 |
| 559 | Ga0373947_0004886 | 3300035725 | Bacteria | 7844 |
| 560 | Ga0373947_0011757 | 3300035725 | Bacteria | 5015 |
| 561 | Ga0373947_0017321 | 3300035725 | Bacteria | 4144 |
| 562 | Ga0373947_0026711 | 3300035725 | Bacteria | 3376 |
| 563 | Ga0373947_0027023 | 3300035725 | Bacteria | 3357 |
| 564 | Ga0373947_0027754 | 3300035725 | Bacteria | 3314 |
| 565 | Ga0373937_0000399 | 3300036401 | Bacteria | 40554 |
| 566 | Ga0373937_0000562 | 3300036401 | Bacteria | 32919 |
| 567 | Ga0373937_0011271 | 3300036401 | Bacteria | 7839 |
| 568 | Ga0373937_0022798 | 3300036401 | Bacteria | 5633 |
| 569 | Ga0373937_0046836 | 3300036401 | Bacteria | 3955 |
| 570 | Ga0373937_0046887 | 3300036401 | Bacteria | 3953 |
| 571 | Ga0373937_0050295 | 3300036401 | Bacteria | 3817 |
| 572 | Ga0373937_0251616 | 3300036401 | Bacteria | 1666 |
| 573 | Ga0373937_0665406 | 3300036401 | Bacteria | 987 |
| 574 | Ga0373937_0714047 | 3300036401 | Bacteria | 949 |
| 575 | Ga0373925_0008191 | 3300037068 | Bacteria | 7606 |
| 576 | Ga0373925_0009252 | 3300037068 | Bacteria | 7172 |
| 577 | Ga0373925_0022011 | 3300037068 | Bacteria | 4646 |
| 578 | Ga0373925_0025058 | 3300037068 | Bacteria | 4356 |
| 579 | Ga0373925_0031656 | 3300037068 | Bacteria | 3888 |
| 580 | Ga0373925_0091366 | 3300037068 | Bacteria | 2328 |
| 581 | Ga0373925_0213366 | 3300037068 | Bacteria | 1538 |
| 582 | Ga0373925_0236469 | 3300037068 | Bacteria | 1462 |
| 583 | Ga0373925_0244620 | 3300037068 | Bacteria | 1437 |
| 584 | Ga0395905_0010636 | 3300037471 | Bacteria | 8927 |
| 585 | Ga0395901_0491192 | 3300038443 | Bacteria | 1251 |
| 586 | Ga0436365_0127076 | 3300039437 | Bacteria | 1254 |
| 587 | Ga0436360_0226257 | 3300039438 | Bacteria | 2663 |
| 588 | Ga0436363_1615544 | 3300039450 | Bacteria | 1148 |
| 589 | Ga0451787_735581 | 3300041441 | Bacteria | 2953 |
| 590 | Ga0451789_0291302 | 3300041443 | Bacteria | 1778 |
| 591 | Ga0451833_0450416 | 3300041491 | Bacteria | 2287 |
| 592 | Ga0451839_0046361 | 3300041496 | Bacteria | 2264 |
| 593 | Ga0451849_0536283 | 3300041505 | Bacteria | 1859 |
| 594 | Ga0439451_029917 | 3300042009 | Bacteria | 1096 |
| 595 | Ga0451577_0029041 | 3300042876 | Bacteria | 5000 |
| 596 | Ga0453684_0547731 | 3300044712 | Bacteria | 1275 |
| 597 | Ga0466968_0177718 | 3300044735 | Bacteria | 989 |
| 598 | Ga0451576_0075180 | 3300045051 | Bacteria | 3515 |
| 599 | Ga0451576_0125581 | 3300045051 | Bacteria | 2673 |
| 600 | Ga0451576_0345407 | 3300045051 | Bacteria | 1558 |
| 601 | Ga0451576_0377881 | 3300045051 | Bacteria | 1485 |
| 602 | Ga0451576_0696071 | 3300045051 | Bacteria | 1068 |
| 603 | Ga0495592_0108714 | 3300046454 | Bacteria | 1965 |
| 604 | Ga0495629_0314836 | 3300046459 | Bacteria | 1070 |
| 605 | Ga0495638_0000715 | 3300046460 | Bacteria | 35779 |
| 606 | Ga0495638_0011305 | 3300046460 | Bacteria | 6151 |
| 607 | Ga0495638_0012384 | 3300046460 | Bacteria | 5847 |
| 608 | Ga0495653_0079462 | 3300046463 | Bacteria | 2429 |
| 609 | Ga0495580_0004655 | 3300046472 | Bacteria | 11509 |
| 610 | Ga0495580_0005446 | 3300046472 | Bacteria | 10518 |
| 611 | Ga0495580_0010142 | 3300046472 | Bacteria | 7360 |
| 612 | Ga0495580_0018605 | 3300046472 | Bacteria | 5171 |
| 613 | Ga0495580_0023134 | 3300046472 | Bacteria | 4566 |
| 614 | Ga0495580_0071903 | 3300046472 | Bacteria | 2416 |
| 615 | Ga0495580_0088529 | 3300046472 | Bacteria | 2156 |
| 616 | Ga0495580_0142458 | 3300046472 | Bacteria | 1661 |
| 617 | Ga0495580_0293190 | 3300046472 | Bacteria | 1109 |
| 618 | Ga0495580_0353870 | 3300046472 | Bacteria | 994 |
| 619 | Ga0495582_0039307 | 3300046473 | Bacteria | 2605 |
| 620 | Ga0495582_0039623 | 3300046473 | Bacteria | 2594 |
| 621 | Ga0495582_0094361 | 3300046473 | Bacteria | 1670 |
| 622 | Ga0495639_0027637 | 3300046475 | Bacteria | 2512 |
| 623 | Ga0495639_0049242 | 3300046475 | Bacteria | 1912 |
| 624 | Ga0495662_0117200 | 3300046476 | Bacteria | 1306 |
| 625 | Ga0495664_0011235 | 3300046477 | Bacteria | 5044 |
| 626 | Ga0495664_0227642 | 3300046477 | Bacteria | 1128 |
| 627 | Ga0495585_0003214 | 3300046492 | Bacteria | 11151 |
| 628 | Ga0495585_0022498 | 3300046492 | Bacteria | 3618 |
| 629 | Ga0495583_0004726 | 3300046506 | Bacteria | 9579 |
| 630 | Ga0495608_0104592 | 3300046511 | Bacteria | 1823 |
| 631 | Ga0495618_0079166 | 3300046514 | Bacteria | 2096 |
| 632 | Ga0495628_0022008 | 3300046516 | Bacteria | 5239 |
| 633 | Ga0495630_0000049 | 3300046517 | Bacteria | 97884 |
| 634 | Ga0495630_0073008 | 3300046517 | Bacteria | 2583 |
| 635 | Ga0495630_0165101 | 3300046517 | Bacteria | 1686 |
| 636 | Ga0495666_0027726 | 3300046526 | Bacteria | 2788 |
| 637 | Ga0495666_0133010 | 3300046526 | Bacteria | 1162 |
| 638 | Ga0495652_0084508 | 3300046529 | Bacteria | 2610 |
| 639 | Ga0495652_0145792 | 3300046529 | Bacteria | 1856 |
| 640 | Ga0495652_0329658 | 3300046529 | Bacteria | 1100 |
| 641 | Ga0495665_0039556 | 3300046531 | Bacteria | 2511 |
| 642 | Ga0495665_0085009 | 3300046531 | Bacteria | 1663 |
| 643 | Ga0495640_0135727 | 3300046533 | Bacteria | 1589 |
| 644 | Ga0495586_0000185 | 3300046535 | Bacteria | 41119 |
| 645 | Ga0495586_0003014 | 3300046535 | Bacteria | 9086 |
| 646 | Ga0495587_0001610 | 3300046536 | Bacteria | 15021 |
| 647 | Ga0495587_0011531 | 3300046536 | Bacteria | 5596 |
| 648 | Ga0495645_0048856 | 3300046543 | Bacteria | 3081 |
| 649 | Ga0495667_0005219 | 3300046559 | Bacteria | 8779 |
| 650 | Ga0495656_0012529 | 3300046615 | Bacteria | 3132 |
| 651 | Ga0495668_0043285 | 3300046616 | Bacteria | 2505 |
| 652 | Ga0495634_0025259 | 3300046642 | Bacteria | 4160 |
| 653 | Ga0495625_0019852 | 3300046660 | Bacteria | 5200 |
| 654 | Ga0495635_0121578 | 3300046663 | Bacteria | 1781 |
| 655 | Ga0495657_0011006 | 3300046675 | Bacteria | 6785 |
| 656 | Ga0495657_0152685 | 3300046675 | Bacteria | 1433 |
| 657 | Ga0495599_0007344 | 3300046678 | Bacteria | 6681 |
| 658 | Ga0495599_0018343 | 3300046678 | Bacteria | 4361 |
| 659 | Ga0495623_0065114 | 3300046679 | Bacteria | 2280 |
| 660 | Ga0495646_0143710 | 3300046680 | Bacteria | 1332 |
| 661 | Ga0495613_0005499 | 3300046689 | Bacteria | 9519 |
| 662 | Ga0495613_0080635 | 3300046689 | Bacteria | 2365 |
| 663 | Ga0495600_0020919 | 3300046809 | Bacteria | 4187 |
| 664 | Ga0495581_0030614 | 3300047315 | Bacteria | 3118 |
| 665 | Ga0495581_0034054 | 3300047315 | Bacteria | 2947 |
| 666 | Ga0495581_0150107 | 3300047315 | Bacteria | 1361 |
| 667 | Ga0495604_0001432 | 3300047317 | Bacteria | 19579 |
| 668 | Ga0495604_0133014 | 3300047317 | Bacteria | 1786 |
| 669 | Ga0495674_0000493 | 3300047319 | Bacteria | 36004 |
| 670 | Ga0495674_0001188 | 3300047319 | Bacteria | 25172 |
| 671 | Ga0495674_0023765 | 3300047319 | Bacteria | 5644 |
| 672 | Ga0495674_0025311 | 3300047319 | Bacteria | 5443 |
| 673 | Ga0495674_0068769 | 3300047319 | Bacteria | 3064 |
| 674 | Ga0495674_0129577 | 3300047319 | Bacteria | 2126 |
| 675 | Ga0495674_0227252 | 3300047319 | Bacteria | 1541 |
| 676 | Ga0495674_0270630 | 3300047319 | Bacteria | 1394 |
| 677 | Ga0495674_0469147 | 3300047319 | Bacteria | 1010 |
| 678 | Ga0495672_0019867 | 3300047320 | Bacteria | 4418 |
| 679 | Ga0495676_0016796 | 3300047321 | Bacteria | 6483 |
| 680 | Ga0495680_0007982 | 3300047322 | Bacteria | 9649 |
| 681 | Ga0495680_0057143 | 3300047322 | Bacteria | 3019 |
| 682 | Ga0495680_0237479 | 3300047322 | Bacteria | 1296 |
| 683 | Ga0495675_0001712 | 3300047444 | Bacteria | 13143 |
| 684 | Ga0495675_0049662 | 3300047444 | Bacteria | 2666 |
| 685 | Ga0495684_0002933 | 3300047471 | Bacteria | 13438 |
| 686 | Ga0495684_0022325 | 3300047471 | Bacteria | 4871 |
| 687 | Ga0495684_0063970 | 3300047471 | Bacteria | 2796 |
| 688 | Ga0495684_0119922 | 3300047471 | Bacteria | 1982 |
| 689 | Ga0495684_0134481 | 3300047471 | Unclassified | 1856 |
| 690 | Ga0495684_0297023 | 3300047471 | Bacteria | 1161 |
| 691 | Ga0495686_0003077 | 3300047472 | Bacteria | 14761 |
| 692 | Ga0495686_0020539 | 3300047472 | Bacteria | 4402 |
| 693 | Ga0495602_0001032 | 3300048088 | Bacteria | 27135 |
| 694 | Ga0496100_0023628 | 3300048903 | Bacteria | 3737 |
| 695 | Ga0496101_0002913 | 3300048904 | Bacteria | 10523 |
| 696 | Ga0496101_0057984 | 3300048904 | Bacteria | 2803 |
| 697 | Ga0496102_0449979 | 3300048905 | Bacteria | 1208 |
| 698 | Ga0496104_0033304 | 3300048907 | Bacteria | 4799 |
| 699 | Ga0496104_0041388 | 3300048907 | Bacteria | 4320 |
| 700 | Ga0496104_0175278 | 3300048907 | Bacteria | 2055 |
| 701 | Ga0496105_0001470 | 3300048908 | Bacteria | 16624 |
| 702 | Ga0496105_0014250 | 3300048908 | Bacteria | 6326 |
| 703 | Ga0496106_0174854 | 3300048909 | Bacteria | 1703 |
| 704 | Ga0496107_0121997 | 3300048910 | Bacteria | 1920 |
| 705 | Ga0496107_0122641 | 3300048910 | Bacteria | 1915 |
| 706 | Ga0496108_0002036 | 3300048911 | Bacteria | 16200 |
| 707 | Ga0496108_0083903 | 3300048911 | Bacteria | 2703 |
| 708 | Ga0496109_0000019 | 3300048912 | Bacteria | 190096 |
| 709 | Ga0496109_0000457 | 3300048912 | Bacteria | 35038 |
| 710 | Ga0496109_0074722 | 3300048912 | Bacteria | 3116 |
| 711 | Ga0496110_0002056 | 3300048913 | Bacteria | 15001 |
| 712 | Ga0496110_0139210 | 3300048913 | Bacteria | 2194 |
| 713 | Ga0496110_0272513 | 3300048913 | Bacteria | 1541 |
| 714 | Ga0496110_0500448 | 3300048913 | Bacteria | 1106 |
| 715 | Ga0496111_0007259 | 3300048914 | Bacteria | 7251 |
| 716 | Ga0496111_0012258 | 3300048914 | Bacteria | 5799 |
| 717 | Ga0496111_0015763 | 3300048914 | Bacteria | 5198 |
| 718 | Ga0496112_0000348 | 3300048915 | Bacteria | 30151 |
| 719 | Ga0496112_0000470 | 3300048915 | Bacteria | 26936 |
| 720 | Ga0496112_0009277 | 3300048915 | Bacteria | 8846 |
| 721 | Ga0496112_0051680 | 3300048915 | Bacteria | 4031 |
| 722 | Ga0496112_0171599 | 3300048915 | Bacteria | 2134 |
| 723 | Ga0496113_0000454 | 3300048916 | Bacteria | 19915 |
| 724 | Ga0496113_0042063 | 3300048916 | Bacteria | 3374 |
| 725 | Ga0496113_0199612 | 3300048916 | Bacteria | 1590 |
| 726 | Ga0496114_0000210 | 3300048917 | Bacteria | 42500 |
| 727 | Ga0496114_0013981 | 3300048917 | Bacteria | 6434 |
| 728 | Ga0496114_0246998 | 3300048917 | Bacteria | 1570 |
| 729 | Ga0496115_0025942 | 3300048918 | Bacteria | 4568 |
| 730 | Ga0496115_0274239 | 3300048918 | Bacteria | 1385 |
| 731 | Ga0496118_0005583 | 3300048921 | Bacteria | 14229 |
| 732 | Ga0496121_0215620 | 3300048924 | Bacteria | 1356 |
| 733 | Ga0501031_0050703 | 3300049568 | Bacteria | 2703 |
| 734 | Ga0501032_0006273 | 3300049569 | Bacteria | 8756 |
| 735 | Ga0501033_0002685 | 3300049570 | Bacteria | 14934 |
| 736 | Ga0501033_0222612 | 3300049570 | Bacteria | 1342 |
| 737 | Ga0501034_0142069 | 3300049571 | Unclassified | 2379 |
| 738 | Ga0501036_0067931 | 3300049572 | Bacteria | 3016 |
| 739 | Ga0501037_0214257 | 3300049573 | Bacteria | 1357 |
| 740 | Ga0501038_0005288 | 3300049574 | Bacteria | 12004 |
| 741 | Ga0501038_0052067 | 3300049574 | Bacteria | 3530 |
| 742 | Ga0501039_0020344 | 3300049575 | Bacteria | 5087 |
| 743 | Ga0501039_0031287 | 3300049575 | Unclassified | 4102 |
| 744 | Ga0501040_0003343 | 3300049576 | Bacteria | 10364 |
| 745 | Ga0501040_0299484 | 3300049576 | Bacteria | 1150 |
| 746 | Ga0501041_0020203 | 3300049577 | Bacteria | 3979 |
| 747 | Ga0501042_0311908 | 3300049578 | Bacteria | 1136 |
| 748 | Ga0501043_0000825 | 3300049579 | Bacteria | 27474 |
| 749 | Ga0501046_0002552 | 3300049580 | Bacteria | 17036 |
| 750 | Ga0501046_0039671 | 3300049580 | Bacteria | 3769 |
| 751 | Ga0501047_0109990 | 3300049581 | Bacteria | 2638 |
| 752 | Ga0501048_0030557 | 3300049582 | Unclassified | 3897 |
| 753 | Ga0501068_0002862 | 3300049584 | Bacteria | 9183 |
| 754 | Ga0501069_0002761 | 3300049585 | Bacteria | 8973 |
| 755 | Ga0501070_0006919 | 3300049586 | Bacteria | 9652 |
| 756 | Ga0501071_0047023 | 3300049587 | Bacteria | 3100 |
| 757 | Ga0501072_0002347 | 3300049588 | Bacteria | 14193 |
| 758 | Ga0501072_0063625 | 3300049588 | Bacteria | 2910 |
| 759 | Ga0501072_0147083 | 3300049588 | Bacteria | 1879 |
| 760 | Ga0501074_0009107 | 3300049590 | Bacteria | 7210 |
| 761 | Ga0501075_0067591 | 3300049591 | Bacteria | 2698 |
| 762 | Ga0501076_0021872 | 3300049592 | Bacteria | 4910 |
| 763 | Ga0501076_0152440 | 3300049592 | Unclassified | 1880 |
| 764 | Ga0501077_0037815 | 3300049593 | Unclassified | 3073 |
| 765 | Ga0501077_0207434 | 3300049593 | Bacteria | 1245 |
| 766 | Ga0501079_0003870 | 3300049741 | Bacteria | 11041 |
| 767 | Ga0501079_0038105 | 3300049741 | Unclassified | 3708 |
| 768 | Ga0501080_0091170 | 3300049742 | Bacteria | 2831 |
| 769 | Ga0501081_0010992 | 3300049743 | Bacteria | 5917 |
| 770 | Ga0501083_0091396 | 3300049744 | Bacteria | 2009 |
| 771 | Ga0501035_0001858 | 3300049822 | Bacteria | 21271 |
| 772 | Ga0501035_0034493 | 3300049822 | Bacteria | 4597 |
| 773 | Ga0501044_0039118 | 3300049823 | Unclassified | 4949 |
| 774 | Ga0501045_0007251 | 3300049824 | Bacteria | 7698 |
| 775 | nmdc:mga05p37_18432_c1 | 3300050507 | Bacteria | 8431 |
| 776 | nmdc:mga05p37_187951_c1 | 3300050507 | Bacteria | 2510 |
| 777 | nmdc:mga05p37_252050_c1 | 3300050507 | Bacteria | 2117 |
| 778 | nmdc:mga05p37_356512_c1 | 3300050507 | Bacteria | 1721 |
| 779 | nmdc:mga05p37_77564_c1 | 3300050507 | Bacteria | 4090 |
| 780 | nmdc:mga0qj67_46895_c1 | 3300050509 | Bacteria | 3412 |
| 781 | nmdc:mga06r32_44927_c2 | 3300050510 | Bacteria | 3916 |
| 782 | nmdc:mga06r32_52436_c1 | 3300050510 | Bacteria | 3907 |
| 783 | nmdc:mga06r32_662755_c1 | 3300050510 | Bacteria | 1011 |
| 784 | nmdc:mga06r32_72948_c1 | 3300050510 | Bacteria | 3324 |
| 785 | nmdc:mga08y16_174463_c1 | 3300050511 | Bacteria | 2232 |
| 786 | nmdc:mga08y16_3729_c1 | 3300050511 | Bacteria | 15864 |
| 787 | nmdc:mga0n895_632532_c1 | 3300050512 | Bacteria | 1070 |
| 788 | nmdc:mga0rr50_2064_c1 | 3300050513 | Bacteria | 11209 |
| 789 | nmdc:mga0rr50_241866_c1 | 3300050513 | Bacteria | 1496 |
| 790 | nmdc:mga0rr50_26506_c1 | 3300050513 | Bacteria | 4045 |
| 791 | nmdc:mga08x19_279259_c1 | 3300050514 | Bacteria | 1157 |
| 792 | nmdc:mga08x19_7752_c1 | 3300050514 | Bacteria | 6377 |
| 793 | Ga0495601_0004545 | 3300053077 | Bacteria | 8018 |
| 794 | Ga0495601_0245176 | 3300053077 | Unclassified | 1170 |
| 795 | Ga0495595_0099244 | 3300053084 | Bacteria | 1404 |
| 796 | Ga0500555_010345 | 3300053103 | Bacteria | 2674 |
| 797 | Ga0500608_027331 | 3300053122 | Bacteria | 2689 |
| 798 | Ga0500618_013846 | 3300053125 | Bacteria | 2074 |
| 799 | Ga0500568_0003011 | 3300053139 | Bacteria | 9633 |
| 800 | Ga0501084_0009514 | 3300054114 | Bacteria | 8041 |
| 801 | Ga0501084_0110094 | 3300054114 | Bacteria | 2314 |
| 802 | Ga0501082_0012726 | 3300060353 | Bacteria | 7231 |
| 803 | Ga0501082_0027687 | 3300060353 | Unclassified | 4878 |
| 804 | Ga0530510_0049366 | 3300061734 | Bacteria | 3041 |
| 805 | 2510838994 | 2510461069 | Bacteria | 5505000 |
| 806 | 2510897307 | 2510461076 | Bacteria | 8618824 |
| 807 | 2511185767 | 2510917028 | Bacteria | 6185411 |
| 808 | 2513634058 | 2513237093 | Bacteria | 7545552 |
| 809 | 2513707426 | 2513237103 | Bacteria | 7647401 |
| 810 | 2513866523 | 2513237138 | Bacteria | 7368160 |
| 811 | 2514022186 | 2513237162 | Bacteria | 7468464 |
| 812 | 2515633925 | 2515154113 | Bacteria | 7807172 |
| 813 | 2515641256 | 2515154114 | Bacteria | 7848616 |
| 814 | 2515659739 | 2515154116 | Bacteria | 7552979 |
| 815 | 2517038619 | 2516653077 | Bacteria | 7555578 |
| 816 | 2517097662 | 2517093000 | Bacteria | 7412387 |
| 817 | 2517409094 | 2517287029 | Bacteria | 6905599 |
| 818 | 2520375810 | 2519899620 | Bacteria | 6499161 |
| 819 | 2530648205 | 2529292951 | Bacteria | 6916614 |
| 820 | 2535514722 | 2534681796 | Bacteria | 7146037 |
| 821 | 2585232424 | 2582581299 | Bacteria | 6518058 |
| 822 | 2585398940 | 2582581867 | Bacteria | 7184437 |
| 823 | 2585818939 | 2585427590 | Bacteria | 6824633 |
| 824 | 2644004565 | 2643221599 | Bacteria | 6292121 |
| 825 | 2644196924 | 2643221634 | Bacteria | 6705461 |
| 826 | 2842219265 | 2842217011 | Bacteria | 7497767 |
| 827 | 2842397694 | 2842395702 | Bacteria | 6780583 |
| 828 | 2923556332 | 2923556063 | Bacteria | 6793593 |
| 829 | 3005410785 | 3005409236 | Bacteria | 7188837 |
| 830 | 3005456518 | 3005452660 | Bacteria | 5889319 |
| 831 | 639646225 | 639633055 | Bacteria | 7751309 |
| 832 | 8005247753 | 8005246636 | Bacteria | 4933972 |
| 833 | 8005261312 | 8005258706 | Bacteria | 6184835 |
| 834 | 8005322663 | 8005321885 | Bacteria | 5795980 |
| 835 | 8005543392 | 8005542996 | Bacteria | 7077758 |
| 836 | 8005699699 | 8005695170 | Bacteria | 6912330 |
| 837 | 8018181911 | 8018176218 | Bacteria | 6896178 |
| 838 | 8046774293 | 8046767195 | Bacteria | 7547379 |
| 839 | 8057879034 | 8057874678 | Bacteria | 7494653 |
| 840 | Ga0114129_10021869 | |||
| 841 | JGI24034J26672_10000395 | |||
| 842 | JGI24751J29686_10001448 | |||
| 843 | JGI25152J39213_1009730 | |||
| 844 | JGI25152J39213_1023403 | |||
| 845 | JGI25150J39212_1003414 | |||
| 846 | JGI25153J46596_10023340 | |||
| 847 | rootL2_10338356 | |||
| 848 | Ga0055526_1012325 | |||
| 849 | Ga0055526_1014518 | |||
| 850 | Ga0055524_1010939 | |||
| 851 | Ga0055528_1000564 | |||
| 852 | JGI25405J52794_10012762 | |||
| 853 | Ga0065712_10078561 | |||
| 854 | Ga0065715_10210154 | |||
| 855 | Ga0065707_10087272 | |||
| 856 | Ga0065707_10118512 | |||
| 857 | Ga0070658_10000436 | |||
| 858 | Ga0070658_10006864 | |||
| 859 | Ga0070658_10039625 | |||
| 860 | Ga0070683_100003628 | |||
| 861 | Ga0070683_100219340 | |||
| 862 | Ga0070690_100017471 | |||
| 863 | Ga0070690_100261858 | |||
| 864 | Ga0070670_100005898 | |||
| 865 | Ga0070677_10010478 | |||
| 866 | Ga0068869_100018903 | |||
| 867 | Ga0068869_100024134 | |||
| 868 | Ga0068869_100032805 | |||
| 869 | Ga0068869_100445742 | |||
| 870 | Ga0070666_10032124 | |||
| 871 | Ga0070666_10085975 | |||
| 872 | Ga0070680_100181601 | |||
| 873 | Ga0070680_100411090 | |||
| 874 | Ga0068868_100002323 | |||
| 875 | Ga0068868_100016570 | |||
| 876 | Ga0068868_100119469 | |||
| 877 | Ga0070660_100010277 | |||
| 878 | Ga0070660_100016379 | |||
| 879 | Ga0070660_100025506 | |||
| 880 | Ga0070689_100003600 | |||
| 881 | Ga0070689_100492167 | |||
| 882 | Ga0070687_100007512 | |||
| 883 | Ga0070661_100016387 | |||
| 884 | Ga0070661_100058733 | |||
| 885 | Ga0070668_100008772 | |||
| 886 | Ga0070669_100070483 | |||
| 887 | Ga0070675_100021225 | |||
| 888 | Ga0070674_100056146 | |||
| 889 | Ga0070673_100079690 | |||
| 890 | Ga0070673_100139156 | |||
| 891 | Ga0070688_100008955 | |||
| 892 | Ga0070659_100022378 | |||
| 893 | Ga0070659_100025993 | |||
| 894 | Ga0070659_100418445 | |||
| 895 | Ga0070667_100026632 | |||
| 896 | Ga0070667_100095890 | |||
| 897 | Ga0070667_100157023 | |||
| 898 | Ga0070709_10088925 | |||
| 899 | Ga0070709_10127080 | |||
| 900 | Ga0070709_10389981 | |||
| 901 | Ga0070714_100016773 | |||
| 902 | Ga0070714_100060401 | |||
| 903 | Ga0070714_100147884 | |||
| 904 | Ga0070714_100265391 | |||
| 905 | Ga0070713_100000068 | |||
| 906 | Ga0070713_100011925 | |||
| 907 | Ga0070713_100191678 | |||
| 908 | Ga0070713_100224597 | |||
| 909 | Ga0070713_100537974 | |||
| 910 | Ga0070710_10123860 | |||
| 911 | Ga0070710_10154752 | |||
| 912 | Ga0070710_10185326 | |||
| 913 | Ga0070701_10066740 | |||
| 914 | Ga0070694_100019121 | |||
| 915 | Ga0070694_100204794 | |||
| 916 | Ga0070708_100000703 | |||
| 917 | Ga0070708_100002137 | |||
| 918 | Ga0070708_100153546 | |||
| 919 | Ga0070708_100160462 | |||
| 920 | Ga0070708_100176210 | |||
| 921 | Ga0070708_100223030 | |||
| 922 | Ga0070708_100298453 | |||
| 923 | Ga0070663_100005814 | |||
| 924 | Ga0070663_100278912 | |||
| 925 | Ga0070662_100017334 | |||
| 926 | Ga0070662_100165652 | |||
| 927 | Ga0070681_10011020 | |||
| 928 | Ga0070681_10053443 | |||
| 929 | Ga0070681_10208369 | |||
| 930 | Ga0068867_100152682 | |||
| 931 | Ga0070685_10055518 | |||
| 932 | Ga0070706_100004130 | |||
| 933 | Ga0070706_100010574 | |||
| 934 | Ga0070706_100068156 | |||
| 935 | Ga0070707_100015056 | |||
| 936 | Ga0070707_100070745 | |||
| 937 | Ga0070707_100078221 | |||
| 938 | Ga0070707_100172740 | |||
| 939 | Ga0070698_100015417 | |||
| 940 | Ga0070698_100017312 | |||
| 941 | Ga0070699_100000002 | |||
| 942 | Ga0070699_100001492 | |||
| 943 | Ga0070699_100024547 | |||
| 944 | Ga0070699_100033123 | |||
| 945 | Ga0070699_100152309 | |||
| 946 | Ga0070679_100019158 | |||
| 947 | Ga0070679_100129164 | |||
| 948 | Ga0070679_100207909 | |||
| 949 | Ga0070684_100010810 | |||
| 950 | Ga0070684_100408471 | |||
| 951 | Ga0070684_100623496 | |||
| 952 | Ga0070697_100000154 | |||
| 953 | Ga0070697_100000611 | |||
| 954 | Ga0070697_100006310 | |||
| 955 | Ga0070697_100013207 | |||
| 956 | Ga0068853_100030276 | |||
| 957 | Ga0068853_100033957 | |||
| 958 | Ga0068853_100046059 | |||
| 959 | Ga0070672_100061244 | |||
| 960 | Ga0070686_100033912 | |||
| 961 | Ga0070686_100070019 | |||
| 962 | Ga0070686_100192441 | |||
| 963 | Ga0070686_100353330 | |||
| 964 | Ga0070695_100000241 | |||
| 965 | Ga0070696_100001603 | |||
| 966 | Ga0070693_100000001 | |||
| 967 | Ga0070693_100037193 | |||
| 968 | Ga0068855_100005049 | |||
| 969 | Ga0068855_100011563 | |||
| 970 | Ga0068855_100059758 | |||
| 971 | Ga0068855_100124938 | |||
| 972 | Ga0068855_100191067 | |||
| 973 | Ga0068855_100260624 | |||
| 974 | Ga0068855_100713531 | |||
| 975 | Ga0070664_100065457 | |||
| 976 | Ga0070664_100101165 | |||
| 977 | Ga0068857_100002564 | |||
| 978 | Ga0068857_100155678 | |||
| 979 | Ga0068854_100019445 | |||
| 980 | Ga0068854_100026294 | |||
| 981 | Ga0068856_100014394 | |||
| 982 | Ga0068856_100018361 | |||
| 983 | Ga0068856_100050518 | |||
| 984 | Ga0068856_100062942 | |||
| 985 | Ga0068856_100173720 | |||
| 986 | Ga0068852_100009157 | |||
| 987 | Ga0068852_100020604 | |||
| 988 | Ga0068859_100047633 | |||
| 989 | Ga0068859_100153038 | |||
| 990 | Ga0068859_100477679 | |||
| 991 | Ga0068864_100085594 | |||
| 992 | Ga0068864_100137255 | |||
| 993 | Ga0068861_100157546 | |||
| 994 | Ga0068861_100512098 | |||
| 995 | Ga0068851_10022887 | |||
| 996 | Ga0068870_10001403 | |||
| 997 | Ga0068858_100006301 | |||
| 998 | Ga0068858_100031219 | |||
| 999 | Ga0068862_100007985 | |||
| 1000 | Ga0068862_100022065 | |||
| 1001 | Ga0068862_100238359 | |||
| 1002 | Ga0081455_10003446 | |||
| 1003 | Ga0070717_10006541 | |||
| 1004 | Ga0070717_10009078 | |||
| 1005 | Ga0070717_10016985 | |||
| 1006 | Ga0070717_10018181 | |||
| 1007 | Ga0070717_10020707 | |||
| 1008 | Ga0070717_10049885 | |||
| 1009 | Ga0070717_10071819 | |||
| 1010 | Ga0070717_10093447 | |||
| 1011 | Ga0070717_10110751 | |||
| 1012 | Ga0070717_10198433 | |||
| 1013 | Ga0070717_10209519 | |||
| 1014 | Ga0075365_10000703 | |||
| 1015 | Ga0075363_100039612 | |||
| 1016 | Ga0070715_10017110 | |||
| 1017 | Ga0070715_10051193 | |||
| 1018 | Ga0070716_100001016 | |||
| 1019 | Ga0070716_100010992 | |||
| 1020 | Ga0070716_100011138 | |||
| 1021 | Ga0070716_100207067 | |||
| 1022 | Ga0070716_100393913 | |||
| 1023 | Ga0070712_100000283 | |||
| 1024 | Ga0070712_100031917 | |||
| 1025 | Ga0070712_100037660 | |||
| 1026 | Ga0070712_100440397 | |||
| 1027 | Ga0075369_10009433 | |||
| 1028 | Ga0097621_100000636 | |||
| 1029 | Ga0097621_100007637 | |||
| 1030 | Ga0097621_100207105 | |||
| 1031 | Ga0097621_100242139 | |||
| 1032 | Ga0097621_100417300 | |||
| 1033 | Ga0075370_10131609 | |||
| 1034 | Ga0068871_100003144 | |||
| 1035 | Ga0068871_100009581 | |||
| 1036 | Ga0068871_100048745 | |||
| 1037 | Ga0068871_100131569 | |||
| 1038 | Ga0068871_100431734 | |||
| 1039 | Ga0075428_100001111 | |||
| 1040 | Ga0075430_100059190 | |||
| 1041 | Ga0075431_100009788 | |||
| 1042 | Ga0075431_100013464 | |||
| 1043 | Ga0075431_100303384 | |||
| 1044 | Ga0075434_100274047 | |||
| 1045 | Ga0068865_100169941 | |||
| 1046 | Ga0075436_100007096 | |||
| 1047 | Ga0075436_100275580 | |||
| 1048 | Ga0097620_100047633 | |||
| 1049 | Ga0097620_100153046 | |||
| 1050 | Ga0097620_100477675 | |||
| 1051 | Ga0075435_100029466 | |||
| 1052 | Ga0075435_100085881 | |||
| 1053 | Ga0075435_100100996 | |||
| 1054 | Ga0099794_10012765 | |||
| 1055 | Ga0099794_10084771 | |||
| 1056 | Ga0105240_10003524 | |||
| 1057 | Ga0105240_10040280 | |||
| 1058 | Ga0105240_10067711 | |||
| 1059 | Ga0105240_10082835 | |||
| 1060 | Ga0105240_10088483 | |||
| 1061 | Ga0105240_10190509 | |||
| 1062 | Ga0105240_10283048 | |||
| 1063 | Ga0105240_10329008 | |||
| 1064 | Ga0105240_10477773 | |||
| 1065 | Ga0111539_10001049 | |||
| 1066 | Ga0111539_10561622 | |||
| 1067 | Ga0105245_10002615 | |||
| 1068 | Ga0105245_10015459 | |||
| 1069 | Ga0105245_10088178 | |||
| 1070 | Ga0105245_10095813 | |||
| 1071 | Ga0105245_10096048 | |||
| 1072 | Ga0105247_10006087 | |||
| 1073 | Ga0114129_10010346 | |||
| 1074 | Ga0114129_10056624 | |||
| 1075 | Ga0114129_10157785 | |||
| 1076 | Ga0114129_10235570 | |||
| 1077 | Ga0114129_10403523 | |||
| 1078 | Ga0105243_10060212 | |||
| 1079 | Ga0105241_10007751 | |||
| 1080 | Ga0105241_10054775 | |||
| 1081 | Ga0105241_10102911 | |||
| 1082 | Ga0105242_10051708 | |||
| 1083 | Ga0105242_10075750 | |||
| 1084 | Ga0105248_10067771 | |||
| 1085 | Ga0105248_10067870 | |||
| 1086 | Ga0105248_10091809 | |||
| 1087 | Ga0105248_10099340 | |||
| 1088 | Ga0105248_10105475 | |||
| 1089 | Ga0105248_10132428 | |||
| 1090 | Ga0105248_10220072 | |||
| 1091 | Ga0105237_10034990 | |||
| 1092 | Ga0105237_10188531 | |||
| 1093 | Ga0105237_10465764 | |||
| 1094 | Ga0105238_10020563 | |||
| 1095 | Ga0105238_10037755 | |||
| 1096 | Ga0105249_10013389 | |||
| 1097 | Ga0123342_1010346 | |||
| 1098 | Ga0105239_10011126 | |||
| 1099 | Ga0105239_10043696 | |||
| 1100 | Ga0105239_10321878 | |||
| 1101 | Ga0105246_10045000 | |||
| 1102 | Ga0157373_10007427 | |||
| 1103 | Ga0157373_10039563 | |||
| 1104 | Ga0157371_10006699 | |||
| 1105 | Ga0157370_10020660 | |||
| 1106 | Ga0157370_10168838 | |||
| 1107 | Ga0157369_10017310 | |||
| 1108 | Ga0157369_10053879 | |||
| 1109 | Ga0157369_10107252 | |||
| 1110 | Ga0157369_10303204 | |||
| 1111 | Ga0157374_10011586 | |||
| 1112 | Ga0157374_10012444 | |||
| 1113 | Ga0157374_10069910 | |||
| 1114 | Ga0157374_10082445 | |||
| 1115 | Ga0157374_10146847 | |||
| 1116 | Ga0157374_10154552 | |||
| 1117 | Ga0157374_10208470 | |||
| 1118 | Ga0157374_10242422 | |||
| 1119 | Ga0157378_10024126 | |||
| 1120 | Ga0157378_10091691 | |||
| 1121 | Ga0157378_10210096 | |||
| 1122 | Ga0163162_10092712 | |||
| 1123 | Ga0163162_10131133 | |||
| 1124 | Ga0157372_10018667 | |||
| 1125 | Ga0157372_10044056 | |||
| 1126 | Ga0157372_10053523 | |||
| 1127 | Ga0157372_10059662 | |||
| 1128 | Ga0157372_10074783 | |||
| 1129 | Ga0157372_10199010 | |||
| 1130 | Ga0157375_10027706 | |||
| 1131 | Ga0157375_10077423 | |||
| 1132 | Ga0157375_10142829 | |||
| 1133 | Ga0157375_10161700 | |||
| 1134 | Ga0163163_10000003 | |||
| 1135 | Ga0163163_10000442 | |||
| 1136 | Ga0163163_10022494 | |||
| 1137 | Ga0163163_10032102 | |||
| 1138 | Ga0163163_10072349 | |||
| 1139 | Ga0163163_10261269 | |||
| 1140 | Ga0182008_10039094 | |||
| 1141 | Ga0157377_10003684 | |||
| 1142 | Ga0157379_10027492 | |||
| 1143 | Ga0157379_10091553 | |||
| 1144 | Ga0157376_10005928 | |||
| 1145 | Ga0157376_10021679 | |||
| 1146 | Ga0157376_10036856 | |||
| 1147 | Ga0157376_10095512 | |||
| 1148 | Ga0182007_10002588 | |||
| 1149 | Ga0182007_10019401 | |||
| 1150 | Ga0163161_10004345 | |||
| 1151 | Ga0213871_10006971 | |||
| 1152 | Ga0228598_1001381 | |||
| 1153 | Ga0228598_1004994 | |||
| 1154 | Ga0228598_1012969 | |||
| 1155 | Ga0207425_1004391 | |||
| 1156 | Ga0209129_1001686 | |||
| 1157 | Ga0209129_1001949 | |||
| 1158 | Ga0209673_1000135 | |||
| 1159 | Ga0209673_1006097 | |||
| 1160 | Ga0209025_1016800 | |||
| 1161 | Ga0209564_1000138 | |||
| 1162 | Ga0209564_1011683 | |||
| 1163 | Ga0209758_1001640 | |||
| 1164 | Ga0209256_1001423 | |||
| 1165 | Ga0207426_1004269 | |||
| 1166 | Ga0207697_10001953 | |||
| 1167 | Ga0207656_10031155 | |||
| 1168 | Ga0207653_10000864 | |||
| 1169 | Ga0207682_10009574 | |||
| 1170 | Ga0207692_10078362 | |||
| 1171 | Ga0207692_10142166 | |||
| 1172 | Ga0207680_10014593 | |||
| 1173 | Ga0207680_10015402 | |||
| 1174 | Ga0207680_10190778 | |||
| 1175 | Ga0207647_10006231 | |||
| 1176 | Ga0207699_10000689 | |||
| 1177 | Ga0207699_10028318 | |||
| 1178 | Ga0207699_10224945 | |||
| 1179 | Ga0207645_10000720 | |||
| 1180 | Ga0207643_10000381 | |||
| 1181 | Ga0207705_10001399 | |||
| 1182 | Ga0207705_10003150 | |||
| 1183 | Ga0207684_10000203 | |||
| 1184 | Ga0207684_10006734 | |||
| 1185 | Ga0207684_10056700 | |||
| 1186 | Ga0207654_10097859 | |||
| 1187 | Ga0207654_10126145 | |||
| 1188 | Ga0207707_10073387 | |||
| 1189 | Ga0207695_10079776 | |||
| 1190 | Ga0207695_10186106 | |||
| 1191 | Ga0207695_10230740 | |||
| 1192 | Ga0207671_10000006 | |||
| 1193 | Ga0207671_10052653 | |||
| 1194 | Ga0207671_10059974 | |||
| 1195 | Ga0207671_10185847 | |||
| 1196 | Ga0207671_10306593 | |||
| 1197 | Ga0207671_10404669 | |||
| 1198 | Ga0207693_10000054 | |||
| 1199 | Ga0207693_10005606 | |||
| 1200 | Ga0207693_10069860 | |||
| 1201 | Ga0207693_10078051 | |||
| 1202 | Ga0207693_10110535 | |||
| 1203 | Ga0207663_10134160 | |||
| 1204 | Ga0207660_10084381 | |||
| 1205 | Ga0207660_10197520 | |||
| 1206 | Ga0207660_10256270 | |||
| 1207 | Ga0207662_10013577 | |||
| 1208 | Ga0207657_10000246 | |||
| 1209 | Ga0207657_10000344 | |||
| 1210 | Ga0207649_10004406 | |||
| 1211 | Ga0207652_10012959 | |||
| 1212 | Ga0207652_10179134 | |||
| 1213 | Ga0207652_10228016 | |||
| 1214 | Ga0207652_10278176 | |||
| 1215 | Ga0207646_10001438 | |||
| 1216 | Ga0207694_10005000 | |||
| 1217 | Ga0207694_10011132 | |||
| 1218 | Ga0207694_10161434 | |||
| 1219 | Ga0207694_10196842 | |||
| 1220 | Ga0207694_10352530 | |||
| 1221 | Ga0207650_10000098 | |||
| 1222 | Ga0207687_10001671 | |||
| 1223 | Ga0207687_10089760 | |||
| 1224 | Ga0207700_10000927 | |||
| 1225 | Ga0207700_10001471 | |||
| 1226 | Ga0207700_10009225 | |||
| 1227 | Ga0207700_10050905 | |||
| 1228 | Ga0207700_10116859 | |||
| 1229 | Ga0207700_10309168 | |||
| 1230 | Ga0207700_10381150 | |||
| 1231 | Ga0207664_10034898 | |||
| 1232 | Ga0207664_10095843 | |||
| 1233 | Ga0207664_10238747 | |||
| 1234 | Ga0207664_10432019 | |||
| 1235 | Ga0207664_10463040 | |||
| 1236 | Ga0207644_10010814 | |||
| 1237 | Ga0207690_10019647 | |||
| 1238 | Ga0207690_10237864 | |||
| 1239 | Ga0207706_10001532 | |||
| 1240 | Ga0207706_10018416 | |||
| 1241 | Ga0207686_10108340 | |||
| 1242 | Ga0207686_10459376 | |||
| 1243 | Ga0207670_10006804 | |||
| 1244 | Ga0207670_10013827 | |||
| 1245 | Ga0207669_10029158 | |||
| 1246 | Ga0207704_10043027 | |||
| 1247 | Ga0207665_10001266 | |||
| 1248 | Ga0207665_10026998 | |||
| 1249 | Ga0207665_10076572 | |||
| 1250 | Ga0207665_10121928 | |||
| 1251 | Ga0207691_10000038 | |||
| 1252 | Ga0207691_10060899 | |||
| 1253 | Ga0207711_10010790 | |||
| 1254 | Ga0207711_10092312 | |||
| 1255 | Ga0207711_10100621 | |||
| 1256 | Ga0207711_10380271 | |||
| 1257 | Ga0207689_10000632 | |||
| 1258 | Ga0207689_10003881 | |||
| 1259 | Ga0207689_10033321 | |||
| 1260 | Ga0207689_10043033 | |||
| 1261 | Ga0207661_10002817 | |||
| 1262 | Ga0207661_10136543 | |||
| 1263 | Ga0207661_10155197 | |||
| 1264 | Ga0207661_10232305 | |||
| 1265 | Ga0207679_10000078 | |||
| 1266 | Ga0207679_10018813 | |||
| 1267 | Ga0207679_10166515 | |||
| 1268 | Ga0207667_10005939 | |||
| 1269 | Ga0207667_10026055 | |||
| 1270 | Ga0207667_10201616 | |||
| 1271 | Ga0207667_10360371 | |||
| 1272 | Ga0207667_10375223 | |||
| 1273 | Ga0207651_10011928 | |||
| 1274 | Ga0207651_10024197 | |||
| 1275 | Ga0207651_10110410 | |||
| 1276 | Ga0207712_10084185 | |||
| 1277 | Ga0207668_10014150 | |||
| 1278 | Ga0207668_10133589 | |||
| 1279 | Ga0207640_10069540 | |||
| 1280 | Ga0207640_10164201 | |||
| 1281 | Ga0207658_10010579 | |||
| 1282 | Ga0207658_10025386 | |||
| 1283 | Ga0207677_10038875 | |||
| 1284 | Ga0207677_10109184 | |||
| 1285 | Ga0207677_10172428 | |||
| 1286 | Ga0207703_10064742 | |||
| 1287 | Ga0207703_10387877 | |||
| 1288 | Ga0207639_10005525 | |||
| 1289 | Ga0207639_10027905 | |||
| 1290 | Ga0207639_10029332 | |||
| 1291 | Ga0207678_10000348 | |||
| 1292 | Ga0207678_10062434 | |||
| 1293 | Ga0207678_10181777 | |||
| 1294 | Ga0207702_10143061 | |||
| 1295 | Ga0207702_10286407 | |||
| 1296 | Ga0207641_10000021 | |||
| 1297 | Ga0207641_10040038 | |||
| 1298 | Ga0207641_10066356 | |||
| 1299 | Ga0207648_10000703 | |||
| 1300 | Ga0207648_10014082 | |||
| 1301 | Ga0207648_10034905 | |||
| 1302 | Ga0207676_10000262 | |||
| 1303 | Ga0207676_10179843 | |||
| 1304 | Ga0207674_10000386 | |||
| 1305 | Ga0207674_10040973 | |||
| 1306 | Ga0207674_10176731 | |||
| 1307 | Ga0207674_10581240 | |||
| 1308 | Ga0207675_100006514 | |||
| 1309 | Ga0207675_100269475 | |||
| 1310 | Ga0207683_10000045 | |||
| 1311 | Ga0207683_10027391 | |||
| 1312 | Ga0207683_10111548 | |||
| 1313 | Ga0207698_10037698 | |||
| 1314 | Ga0209588_1028182 | |||
| 1315 | Ga0207428_10039787 | |||
| 1316 | Ga0265354_1002157 | |||
| 1317 | Ga0268266_10007297 | |||
| 1318 | Ga0268266_10045322 | |||
| 1319 | Ga0268266_10306086 | |||
| 1320 | Ga0268265_10007057 | |||
| 1321 | Ga0268265_10089839 | |||
| 1322 | Ga0268264_10037698 | |||
| 1323 | Ga0265337_1001373 | |||
| 1324 | Ga0265319_1006216 | |||
| 1325 | Ga0265334_10034209 | |||
| 1326 | Ga0265323_10018655 | |||
| 1327 | Ga0265323_10018865 | |||
| 1328 | Ga0265322_10017956 | |||
| 1329 | Ga0265336_10000507 | |||
| 1330 | Ga0307515_10000277 | |||
| 1331 | Ga0265338_10002794 | |||
| 1332 | Ga0265338_10002935 | |||
| 1333 | Ga0265338_10004483 | |||
| 1334 | Ga0265338_10016778 | |||
| 1335 | Ga0265338_10028532 | |||
| 1336 | Ga0265338_10041537 | |||
| 1337 | Ga0265338_10050628 | |||
| 1338 | Ga0265338_10064288 | |||
| 1339 | Ga0265338_10169984 | |||
| 1340 | Ga0265324_10006000 | |||
| 1341 | Ga0265762_1000129 | |||
| 1342 | Ga0265770_1001133 | |||
| 1343 | Ga0265765_1000923 | |||
| 1344 | Ga0265760_10007969 | |||
| 1345 | Ga0265328_10007524 | |||
| 1346 | Ga0265320_10000443 | |||
| 1347 | Ga0265320_10045144 | |||
| 1348 | Ga0265325_10071857 | |||
| 1349 | Ga0265340_10121060 | |||
| 1350 | Ga0265339_10048655 | |||
| 1351 | Ga0265316_10007238 | |||
| 1352 | Ga0265316_10098812 | |||
| 1353 | Ga0307513_10056058 | |||
| 1354 | Ga0307513_10097050 | |||
| 1355 | Ga0265313_10012488 | |||
| 1356 | Ga0265314_10064457 | |||
| 1357 | Ga0265342_10014674 | |||
| 1358 | Ga0316576_10041742 | |||
| 1359 | Ga0316576_10229412 | |||
| 1360 | Ga0373926_0001709 | |||
| 1361 | Ga0373926_0059066 | |||
| 1362 | Ga0373934_0002139 | |||
| 1363 | Ga0373934_0069520 | |||
| 1364 | Ga0373944_0009873 | |||
| 1365 | Ga0373923_0031920 | |||
| 1366 | Ga0373936_0005493 | |||
| 1367 | Ga0373936_0037604 | |||
| 1368 | Ga0373945_0005619 | |||
| 1369 | Ga0373945_0011448 | |||
| 1370 | Ga0373953_0002457 | |||
| 1371 | Ga0373954_0006207 | |||
| 1372 | Ga0373954_0045115 | |||
| 1373 | Ga0373954_0091029 | |||
| 1374 | Ga0373956_0060782 | |||
| 1375 | Ga0373956_0087419 | |||
| 1376 | Ga0373943_0058937 | |||
| 1377 | Ga0373955_0000879 | |||
| 1378 | Ga0373955_0139805 | |||
| 1379 | Ga0373955_0178406 | |||
| 1380 | Ga0373924_0000277 | |||
| 1381 | Ga0373924_0081256 | |||
| 1382 | Ga0373931_0054160 | |||
| 1383 | Ga0373935_0012623 | |||
| 1384 | Ga0373935_0025464 | |||
| 1385 | Ga0373935_0067926 | |||
| 1386 | Ga0373935_0122895 | |||
| 1387 | Ga0373935_0180746 | |||
| 1388 | Ga0373927_0001563 | |||
| 1389 | Ga0373927_0017340 | |||
| 1390 | Ga0373927_0022869 | |||
| 1391 | Ga0373927_0037625 | |||
| 1392 | Ga0373927_0041537 | |||
| 1393 | Ga0373927_0059600 | |||
| 1394 | Ga0373927_0075354 | |||
| 1395 | Ga0373933_0001231 | |||
| 1396 | Ga0373933_0014608 | |||
| 1397 | Ga0373933_0206523 | |||
| 1398 | Ga0373947_0004886 | |||
| 1399 | Ga0373947_0011757 | |||
| 1400 | Ga0373947_0017321 | |||
| 1401 | Ga0373947_0026711 | |||
| 1402 | Ga0373947_0027023 | |||
| 1403 | Ga0373947_0027754 | |||
| 1404 | Ga0373937_0000399 | |||
| 1405 | Ga0373937_0000562 | |||
| 1406 | Ga0373937_0011271 | |||
| 1407 | Ga0373937_0022798 | |||
| 1408 | Ga0373937_0046836 | |||
| 1409 | Ga0373937_0046887 | |||
| 1410 | Ga0373937_0050295 | |||
| 1411 | Ga0373937_0251616 | |||
| 1412 | Ga0373937_0665406 | |||
| 1413 | Ga0373937_0714047 | |||
| 1414 | Ga0373925_0008191 | |||
| 1415 | Ga0373925_0009252 | |||
| 1416 | Ga0373925_0022011 | |||
| 1417 | Ga0373925_0025058 | |||
| 1418 | Ga0373925_0031656 | |||
| 1419 | Ga0373925_0091366 | |||
| 1420 | Ga0373925_0213366 | |||
| 1421 | Ga0373925_0236469 | |||
| 1422 | Ga0373925_0244620 | |||
| 1423 | Ga0395905_0010636 | |||
| 1424 | Ga0395901_0491192 | |||
| 1425 | Ga0436365_0127076 | |||
| 1426 | Ga0436360_0226257 | |||
| 1427 | Ga0436363_1615544 | |||
| 1428 | Ga0451787_735581 | |||
| 1429 | Ga0451789_0291302 | |||
| 1430 | Ga0451833_0450416 | |||
| 1431 | Ga0451839_0046361 | |||
| 1432 | Ga0451849_0536283 | |||
| 1433 | Ga0439451_029917 | |||
| 1434 | Ga0451577_0029041 | |||
| 1435 | Ga0453684_0547731 | |||
| 1436 | Ga0466968_0177718 | |||
| 1437 | Ga0451576_0075180 | |||
| 1438 | Ga0451576_0125581 | |||
| 1439 | Ga0451576_0345407 | |||
| 1440 | Ga0451576_0377881 | |||
| 1441 | Ga0451576_0696071 | |||
| 1442 | Ga0495592_0108714 | |||
| 1443 | Ga0495629_0314836 | |||
| 1444 | Ga0495638_0000715 | |||
| 1445 | Ga0495638_0011305 | |||
| 1446 | Ga0495638_0012384 | |||
| 1447 | Ga0495653_0079462 | |||
| 1448 | Ga0495580_0004655 | |||
| 1449 | Ga0495580_0005446 | |||
| 1450 | Ga0495580_0010142 | |||
| 1451 | Ga0495580_0018605 | |||
| 1452 | Ga0495580_0023134 | |||
| 1453 | Ga0495580_0071903 | |||
| 1454 | Ga0495580_0088529 | |||
| 1455 | Ga0495580_0142458 | |||
| 1456 | Ga0495580_0293190 | |||
| 1457 | Ga0495580_0353870 | |||
| 1458 | Ga0495582_0039307 | |||
| 1459 | Ga0495582_0039623 | |||
| 1460 | Ga0495582_0094361 | |||
| 1461 | Ga0495639_0027637 | |||
| 1462 | Ga0495639_0049242 | |||
| 1463 | Ga0495662_0117200 | |||
| 1464 | Ga0495664_0011235 | |||
| 1465 | Ga0495664_0227642 | |||
| 1466 | Ga0495585_0003214 | |||
| 1467 | Ga0495585_0022498 | |||
| 1468 | Ga0495583_0004726 | |||
| 1469 | Ga0495608_0104592 | |||
| 1470 | Ga0495618_0079166 | |||
| 1471 | Ga0495628_0022008 | |||
| 1472 | Ga0495630_0000049 | |||
| 1473 | Ga0495630_0073008 | |||
| 1474 | Ga0495630_0165101 | |||
| 1475 | Ga0495666_0027726 | |||
| 1476 | Ga0495666_0133010 | |||
| 1477 | Ga0495652_0084508 | |||
| 1478 | Ga0495652_0145792 | |||
| 1479 | Ga0495652_0329658 | |||
| 1480 | Ga0495665_0039556 | |||
| 1481 | Ga0495665_0085009 | |||
| 1482 | Ga0495640_0135727 | |||
| 1483 | Ga0495586_0000185 | |||
| 1484 | Ga0495586_0003014 | |||
| 1485 | Ga0495587_0001610 | |||
| 1486 | Ga0495587_0011531 | |||
| 1487 | Ga0495645_0048856 | |||
| 1488 | Ga0495667_0005219 | |||
| 1489 | Ga0495656_0012529 | |||
| 1490 | Ga0495668_0043285 | |||
| 1491 | Ga0495634_0025259 | |||
| 1492 | Ga0495625_0019852 | |||
| 1493 | Ga0495635_0121578 | |||
| 1494 | Ga0495657_0011006 | |||
| 1495 | Ga0495657_0152685 | |||
| 1496 | Ga0495599_0007344 | |||
| 1497 | Ga0495599_0018343 | |||
| 1498 | Ga0495623_0065114 | |||
| 1499 | Ga0495646_0143710 | |||
| 1500 | Ga0495613_0005499 | |||
| 1501 | Ga0495613_0080635 | |||
| 1502 | Ga0495600_0020919 | |||
| 1503 | Ga0495581_0030614 | |||
| 1504 | Ga0495581_0034054 | |||
| 1505 | Ga0495581_0150107 | |||
| 1506 | Ga0495604_0001432 | |||
| 1507 | Ga0495604_0133014 | |||
| 1508 | Ga0495674_0000493 | |||
| 1509 | Ga0495674_0001188 | |||
| 1510 | Ga0495674_0023765 | |||
| 1511 | Ga0495674_0025311 | |||
| 1512 | Ga0495674_0068769 | |||
| 1513 | Ga0495674_0129577 | |||
| 1514 | Ga0495674_0227252 | |||
| 1515 | Ga0495674_0270630 | |||
| 1516 | Ga0495674_0469147 | |||
| 1517 | Ga0495672_0019867 | |||
| 1518 | Ga0495676_0016796 | |||
| 1519 | Ga0495680_0007982 | |||
| 1520 | Ga0495680_0057143 | |||
| 1521 | Ga0495680_0237479 | |||
| 1522 | Ga0495675_0001712 | |||
| 1523 | Ga0495675_0049662 | |||
| 1524 | Ga0495684_0002933 | |||
| 1525 | Ga0495684_0022325 | |||
| 1526 | Ga0495684_0063970 | |||
| 1527 | Ga0495684_0119922 | |||
| 1528 | Ga0495684_0134481 | |||
| 1529 | Ga0495684_0297023 | |||
| 1530 | Ga0495686_0003077 | |||
| 1531 | Ga0495686_0020539 | |||
| 1532 | Ga0495602_0001032 | |||
| 1533 | Ga0496100_0023628 | |||
| 1534 | Ga0496101_0002913 | |||
| 1535 | Ga0496101_0057984 | |||
| 1536 | Ga0496102_0449979 | |||
| 1537 | Ga0496104_0033304 | |||
| 1538 | Ga0496104_0041388 | |||
| 1539 | Ga0496104_0175278 | |||
| 1540 | Ga0496105_0001470 | |||
| 1541 | Ga0496105_0014250 | |||
| 1542 | Ga0496106_0174854 | |||
| 1543 | Ga0496107_0121997 | |||
| 1544 | Ga0496107_0122641 | |||
| 1545 | Ga0496108_0002036 | |||
| 1546 | Ga0496108_0083903 | |||
| 1547 | Ga0496109_0000019 | |||
| 1548 | Ga0496109_0000457 | |||
| 1549 | Ga0496109_0074722 | |||
| 1550 | Ga0496110_0002056 | |||
| 1551 | Ga0496110_0139210 | |||
| 1552 | Ga0496110_0272513 | |||
| 1553 | Ga0496110_0500448 | |||
| 1554 | Ga0496111_0007259 | |||
| 1555 | Ga0496111_0012258 | |||
| 1556 | Ga0496111_0015763 | |||
| 1557 | Ga0496112_0000348 | |||
| 1558 | Ga0496112_0000470 | |||
| 1559 | Ga0496112_0009277 | |||
| 1560 | Ga0496112_0051680 | |||
| 1561 | Ga0496112_0171599 | |||
| 1562 | Ga0496113_0000454 | |||
| 1563 | Ga0496113_0042063 | |||
| 1564 | Ga0496113_0199612 | |||
| 1565 | Ga0496114_0000210 | |||
| 1566 | Ga0496114_0013981 | |||
| 1567 | Ga0496114_0246998 | |||
| 1568 | Ga0496115_0025942 | |||
| 1569 | Ga0496115_0274239 | |||
| 1570 | Ga0496118_0005583 | |||
| 1571 | Ga0496121_0215620 | |||
| 1572 | Ga0501031_0050703 | |||
| 1573 | Ga0501032_0006273 | |||
| 1574 | Ga0501033_0002685 | |||
| 1575 | Ga0501033_0222612 | |||
| 1576 | Ga0501034_0142069 | |||
| 1577 | Ga0501036_0067931 | |||
| 1578 | Ga0501037_0214257 | |||
| 1579 | Ga0501038_0005288 | |||
| 1580 | Ga0501038_0052067 | |||
| 1581 | Ga0501039_0020344 | |||
| 1582 | Ga0501039_0031287 | |||
| 1583 | Ga0501040_0003343 | |||
| 1584 | Ga0501040_0299484 | |||
| 1585 | Ga0501041_0020203 | |||
| 1586 | Ga0501042_0311908 | |||
| 1587 | Ga0501043_0000825 | |||
| 1588 | Ga0501046_0002552 | |||
| 1589 | Ga0501046_0039671 | |||
| 1590 | Ga0501047_0109990 | |||
| 1591 | Ga0501048_0030557 | |||
| 1592 | Ga0501068_0002862 | |||
| 1593 | Ga0501069_0002761 | |||
| 1594 | Ga0501070_0006919 | |||
| 1595 | Ga0501071_0047023 | |||
| 1596 | Ga0501072_0002347 | |||
| 1597 | Ga0501072_0063625 | |||
| 1598 | Ga0501072_0147083 | |||
| 1599 | Ga0501074_0009107 | |||
| 1600 | Ga0501075_0067591 | |||
| 1601 | Ga0501076_0021872 | |||
| 1602 | Ga0501076_0152440 | |||
| 1603 | Ga0501077_0037815 | |||
| 1604 | Ga0501077_0207434 | |||
| 1605 | Ga0501079_0003870 | |||
| 1606 | Ga0501079_0038105 | |||
| 1607 | Ga0501080_0091170 | |||
| 1608 | Ga0501081_0010992 | |||
| 1609 | Ga0501083_0091396 | |||
| 1610 | Ga0501035_0001858 | |||
| 1611 | Ga0501035_0034493 | |||
| 1612 | Ga0501044_0039118 | |||
| 1613 | Ga0501045_0007251 | |||
| 1614 | nmdc:mga05p37_18432_c1 | |||
| 1615 | nmdc:mga05p37_187951_c1 | |||
| 1616 | nmdc:mga05p37_252050_c1 | |||
| 1617 | nmdc:mga05p37_356512_c1 | |||
| 1618 | nmdc:mga05p37_77564_c1 | |||
| 1619 | nmdc:mga0qj67_46895_c1 | |||
| 1620 | nmdc:mga06r32_44927_c2 | |||
| 1621 | nmdc:mga06r32_52436_c1 | |||
| 1622 | nmdc:mga06r32_662755_c1 | |||
| 1623 | nmdc:mga06r32_72948_c1 | |||
| 1624 | nmdc:mga08y16_174463_c1 | |||
| 1625 | nmdc:mga08y16_3729_c1 | |||
| 1626 | nmdc:mga0n895_632532_c1 | |||
| 1627 | nmdc:mga0rr50_2064_c1 | |||
| 1628 | nmdc:mga0rr50_241866_c1 | |||
| 1629 | nmdc:mga0rr50_26506_c1 | |||
| 1630 | nmdc:mga08x19_279259_c1 | |||
| 1631 | nmdc:mga08x19_7752_c1 | |||
| 1632 | Ga0495601_0004545 | |||
| 1633 | Ga0495601_0245176 | |||
| 1634 | Ga0495595_0099244 | |||
| 1635 | Ga0500555_010345 | |||
| 1636 | Ga0500608_027331 | |||
| 1637 | Ga0500618_013846 | |||
| 1638 | Ga0500568_0003011 | |||
| 1639 | Ga0501084_0009514 | |||
| 1640 | Ga0501084_0110094 | |||
| 1641 | Ga0501082_0012726 | |||
| 1642 | Ga0501082_0027687 | |||
| 1643 | Ga0530510_0049366 | |||
| 1644 | 2510838994 | |||
| 1645 | 2510897307 | |||
| 1646 | 2511185767 | |||
| 1647 | 2513634058 | |||
| 1648 | 2513707426 | |||
| 1649 | 2513866523 | |||
| 1650 | 2514022186 | |||
| 1651 | 2515633925 | |||
| 1652 | 2515641256 | |||
| 1653 | 2515659739 | |||
| 1654 | 2517038619 | |||
| 1655 | 2517097662 | |||
| 1656 | 2517409094 | |||
| 1657 | 2520375810 | |||
| 1658 | 2530648205 | |||
| 1659 | 2535514722 | |||
| 1660 | 2585232424 | |||
| 1661 | 2585398940 | |||
| 1662 | 2585818939 | |||
| 1663 | 2644004565 | |||
| 1664 | 2644196924 | |||
| 1665 | 2842219265 | |||
| 1666 | 2842397694 | |||
| 1667 | 2923556332 | |||
| 1668 | 3005410785 | |||
| 1669 | 3005456518 | |||
| 1670 | 639646225 | |||
| 1671 | 8005247753 | |||
| 1672 | 8005261312 | |||
| 1673 | 8005322663 | |||
| 1674 | 8005543392 | |||
| 1675 | 8005699699 | |||
| 1676 | 8018181911 | |||
| 1677 | 8046774293 | |||
| 1678 | 8057879034 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5jct-assembly1.cif.gz_A | crystal structure of human pirin in complex with a chemical probe pyrrolidine 24 | 0.9065 | 4 | 303 |
| 4hlt-assembly1.cif.gz_A | crystal structure of ferric e32v pirin | 0.9027 | 3 | 303 |
| 7tfq-assembly1.cif.gz_A | crystal structure of the pirin family protein redox-sensitive bicupin yhak bound to copper ion from yersinia pestis | 0.8993 | 5 | 295 |
| 6d0g-assembly1.cif.gz_A | 1.78 angstrom resolution crystal structure of quercetin 2,3-dioxygenase from acinetobacter baumannii | 0.889 | 8 | 295 |
| 6d0p-assembly4.cif.gz_D | 1.88 angstrom resolution crystal structure of quercetin 2,3-dioxygenase from acinetobacter baumannii | 0.8881 | 3 | 298 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q54UY3_11_140_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9463 | 10 | 138 | 2.60.120.10 |
| af_C0P2Q1_61_325_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9459 | 13 | 297 | 2.60.120.10 |
| af_Q557H8_87_213_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9414 | 17 | 143 | 2.60.120.10 |
| af_I1KYF4_44_139_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9378 | 35 | 135 | 2.60.120.10 |
| af_Q557H8_87_213_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9343 | 17 | 143 | 2.60.120.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6P0DVR8-F1-model_v4 | Pirin family protein | 0.9953 | 69 | 207 |
|
| AF-A0A2V9MJW3-F1-model_v4 | Pirin N-terminal domain-containing protein | 0.9939 | 1 | 195 |
GO:0046872
|
| AF-A0A4Q3GWX5-F1-model_v4 | Pirin family protein | 0.9918 | 1 | 168 |
GO:0046872
|
| AF-A0A5C7TYR7-F1-model_v4 | deleted | 0.9888 | 1 | 161 |
|
| AF-A0A521A0J8-F1-model_v4 | Pirin family protein | 0.9881 | 4 | 146 |
|