F483012

General Info

Members Datasets Scaffolds Average Seq Length
839 400 1678 302

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10021869|Ga0114129_100218696
Length 340
Sequence VKHPEANFSLGASIEVRKRFVEQCHAASRASTGGFSMSIRPVKRLIKSKPTREGAGVHLRRAFGFGNTSEFDPFLLLDDFRNDIPADYLAGFPWHPHRGIETITYVLAGTVEHGDSMGNSGSIAAGDVQWMTAGSGIIHQEMPKGDQAGRMHGFQLWANLPSSLKMTAPAYQEVKAGEIPVATEDDGTNARVVSGKFWGKVGPVRGIAADPIYLDVSVPPGKRRALPVETTRHAFAYVFAGSGKFCNASGPLAVPTEGVGWLETAPPAEADNRSLVLFDRGDEVVVQAGDDGIRFLLVSGKPLEEPVAWYGPIVMNTQEQLRHAFEELQEGTFLKTQAKK

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
5 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
9 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
10 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
11 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
12 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
37 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
38 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
39 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
40 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
41 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
42 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
49 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
50 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
51 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
54 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
58 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
59 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
60 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
75 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
76 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
77 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
78 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
79 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
80 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
81 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
86 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
87 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
88 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
91 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
93 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
94 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
95 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
97 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
98 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
99 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
100 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
101 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
102 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
103 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
104 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
105 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
106 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
107 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
108 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
109 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
110 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
111 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
112 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
113 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
114 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
115 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
116 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
117 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
118 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
119 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
120 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
121 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
122 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
123 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
124 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
125 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
126 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
127 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
128 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
129 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
130 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
131 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
132 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
133 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
134 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
196 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
197 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
201 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
202 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
203 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
204 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
205 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
206 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
207 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
208 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
209 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
212 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
214 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
215 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
216 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
217 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
218 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
219 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
220 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
221 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
222 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
223 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
224 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
225 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
226 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
227 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
228 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
229 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
230 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
231 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
232 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
233 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
234 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
235 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
236 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
237 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
238 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
239 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
240 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
241 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
242 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
243 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
244 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
245 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
246 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
247 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
248 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
249 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
250 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
251 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
252 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
253 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
254 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
255 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
256 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
257 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
258 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
259 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
260 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
261 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
262 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
263 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
264 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
265 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
266 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
267 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
268 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
269 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
270 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
271 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
272 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
273 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
274 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
275 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
276 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
277 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
278 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
279 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
280 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
281 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
282 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
283 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
284 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
285 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
286 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
287 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
288 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
289 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
290 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
291 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
292 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
293 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
294 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
295 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
296 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
297 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
298 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
299 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
300 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
301 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
302 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
303 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
304 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
305 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
306 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
307 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
308 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
309 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
310 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
311 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
312 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
313 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
314 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
315 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
316 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
317 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
318 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
319 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
320 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
321 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
322 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
323 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
324 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
325 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
326 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
327 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
328 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
329 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
330 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
331 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
332 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
333 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
334 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
335 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
336 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
337 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
338 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
339 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
340 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
341 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
342 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
343 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
344 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
345 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
346 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
347 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
348 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
349 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
350 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
351 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
352 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
353 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
354 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
355 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
356 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
357 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
358 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
359 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
360 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
361 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
362 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
363 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
364 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
365 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
366 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
367 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
368 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
369 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
370 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
371 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
372 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
373 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
374 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
375 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
376 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
377 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
378 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
379 2519899620 Rhizobium sp. Pop5 Isolate Nodule
380 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
381 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
382 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
383 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
384 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
385 2643221599 Rhizobium sp. Root708 Isolate Unclassified
386 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
387 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
388 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
389 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
390 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
391 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
392 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
393 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
394 8005258706 Rhizobium sp. R693 Isolate Nodule
395 8005321885 Rhizobium sp. R72 Isolate Nodule
396 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
397 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
398 8018176218 Rhizobium sp. N122 Isolate Nodule
399 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
400 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.35
Metatranscriptomes 0.48
Isolates 4.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.22
Nodule 2.5
Rhizoplane 4.65
Rhizosphere 87.37
Stem 0
Stem Tuber 0
Unclassified 1.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_10021869 3300009147 Bacteria 9078
2 JGI24034J26672_10000395 3300002239 Bacteria 5672
3 JGI24751J29686_10001448 3300002459 Bacteria 4968
4 JGI25152J39213_1009730 3300002773 Bacteria 2258
5 JGI25152J39213_1023403 3300002773 Bacteria 1052
6 JGI25150J39212_1003414 3300002774 Bacteria 3716
7 JGI25153J46596_10023340 3300003215 Bacteria 2258
8 rootL2_10338356 3300003322 Bacteria 2910
9 Ga0055526_1012325 3300003771 Bacteria 3745
10 Ga0055526_1014518 3300003771 Bacteria 3233
11 Ga0055524_1010939 3300003775 Bacteria 3577
12 Ga0055528_1000564 3300003790 Bacteria 28157
13 JGI25405J52794_10012762 3300003911 Bacteria 1622
14 Ga0065712_10078561 3300005290 Bacteria 3327
15 Ga0065715_10210154 3300005293 Bacteria 1318
16 Ga0065707_10087272 3300005295 Bacteria 5095
17 Ga0065707_10118512 3300005295 Bacteria 2184
18 Ga0070658_10000436 3300005327 Bacteria 36382
19 Ga0070658_10006864 3300005327 Bacteria 9203
20 Ga0070658_10039625 3300005327 Bacteria 3801
21 Ga0070683_100003628 3300005329 Bacteria 12579
22 Ga0070683_100219340 3300005329 Bacteria 1808
23 Ga0070690_100017471 3300005330 Bacteria 4314
24 Ga0070690_100261858 3300005330 Bacteria 1227
25 Ga0070670_100005898 3300005331 Bacteria 10354
26 Ga0070677_10010478 3300005333 Bacteria 3172
27 Ga0068869_100018903 3300005334 Bacteria 4698
28 Ga0068869_100024134 3300005334 Bacteria 4211
29 Ga0068869_100032805 3300005334 Bacteria 3662
30 Ga0068869_100445742 3300005334 Bacteria 1072
31 Ga0070666_10032124 3300005335 Bacteria 3467
32 Ga0070666_10085975 3300005335 Bacteria 2154
33 Ga0070680_100181601 3300005336 Bacteria 1772
34 Ga0070680_100411090 3300005336 Unclassified 1154
35 Ga0068868_100002323 3300005338 Bacteria 13152
36 Ga0068868_100016570 3300005338 Bacteria 5477
37 Ga0068868_100119469 3300005338 Bacteria 2149
38 Ga0070660_100010277 3300005339 Bacteria 6606
39 Ga0070660_100016379 3300005339 Bacteria 5379
40 Ga0070660_100025506 3300005339 Bacteria 4393
41 Ga0070689_100003600 3300005340 Bacteria 10323
42 Ga0070689_100492167 3300005340 Bacteria 1049
43 Ga0070687_100007512 3300005343 Bacteria 4549
44 Ga0070661_100016387 3300005344 Bacteria 5238
45 Ga0070661_100058733 3300005344 Bacteria 2819
46 Ga0070668_100008772 3300005347 Bacteria 7508
47 Ga0070669_100070483 3300005353 Bacteria 2584
48 Ga0070675_100021225 3300005354 Bacteria 5187
49 Ga0070674_100056146 3300005356 Bacteria 2730
50 Ga0070673_100079690 3300005364 Bacteria 2652
51 Ga0070673_100139156 3300005364 Bacteria 2046
52 Ga0070688_100008955 3300005365 Bacteria 5451
53 Ga0070659_100022378 3300005366 Bacteria 4824
54 Ga0070659_100025993 3300005366 Bacteria 4503
55 Ga0070659_100418445 3300005366 Bacteria 1133
56 Ga0070667_100026632 3300005367 Bacteria 4809
57 Ga0070667_100095890 3300005367 Bacteria 2558
58 Ga0070667_100157023 3300005367 Bacteria 2001
59 Ga0070709_10088925 3300005434 Bacteria 2033
60 Ga0070709_10127080 3300005434 Bacteria 1736
61 Ga0070709_10389981 3300005434 Bacteria 1037
62 Ga0070714_100016773 3300005435 Bacteria 5923
63 Ga0070714_100060401 3300005435 Bacteria 3253
64 Ga0070714_100147884 3300005435 Bacteria 2114
65 Ga0070714_100265391 3300005435 Bacteria 1591
66 Ga0070713_100000068 3300005436 Bacteria 66744
67 Ga0070713_100011925 3300005436 Bacteria 6356
68 Ga0070713_100191678 3300005436 Bacteria 1842
69 Ga0070713_100224597 3300005436 Bacteria 1705
70 Ga0070713_100537974 3300005436 Bacteria 1105
71 Ga0070710_10123860 3300005437 Bacteria 1568
72 Ga0070710_10154752 3300005437 Bacteria 1417
73 Ga0070710_10185326 3300005437 Bacteria 1306
74 Ga0070701_10066740 3300005438 Bacteria 1913
75 Ga0070694_100019121 3300005444 Bacteria 4355
76 Ga0070694_100204794 3300005444 Bacteria 1472
77 Ga0070708_100000703 3300005445 Bacteria 25498
78 Ga0070708_100002137 3300005445 Bacteria 15265
79 Ga0070708_100153546 3300005445 Bacteria 2142
80 Ga0070708_100160462 3300005445 Bacteria 2095
81 Ga0070708_100176210 3300005445 Bacteria 1998
82 Ga0070708_100223030 3300005445 Bacteria 1768
83 Ga0070708_100298453 3300005445 Bacteria 1517
84 Ga0070663_100005814 3300005455 Bacteria 7368
85 Ga0070663_100278912 3300005455 Bacteria 1331
86 Ga0070662_100017334 3300005457 Bacteria 4855
87 Ga0070662_100165652 3300005457 Bacteria 1732
88 Ga0070681_10011020 3300005458 Bacteria 8936
89 Ga0070681_10053443 3300005458 Bacteria 4025
90 Ga0070681_10208369 3300005458 Bacteria 1871
91 Ga0068867_100152682 3300005459 Bacteria 1815
92 Ga0070685_10055518 3300005466 Bacteria 2301
93 Ga0070706_100004130 3300005467 Bacteria 14124
94 Ga0070706_100010574 3300005467 Bacteria 8562
95 Ga0070706_100068156 3300005467 Bacteria 3290
96 Ga0070707_100015056 3300005468 Bacteria 7257
97 Ga0070707_100070745 3300005468 Bacteria 3360
98 Ga0070707_100078221 3300005468 Bacteria 3191
99 Ga0070707_100172740 3300005468 Bacteria 2106
100 Ga0070698_100015417 3300005471 Bacteria 8074
101 Ga0070698_100017312 3300005471 Bacteria 7594
102 Ga0070699_100000002 3300005518 Bacteria 423451
103 Ga0070699_100001492 3300005518 Bacteria 21457
104 Ga0070699_100024547 3300005518 Bacteria 5196
105 Ga0070699_100033123 3300005518 Bacteria 4463
106 Ga0070699_100152309 3300005518 Bacteria 2046
107 Ga0070679_100019158 3300005530 Bacteria 6649
108 Ga0070679_100129164 3300005530 Bacteria 2508
109 Ga0070679_100207909 3300005530 Bacteria 1921
110 Ga0070684_100010810 3300005535 Bacteria 7249
111 Ga0070684_100408471 3300005535 Bacteria 1252
112 Ga0070684_100623496 3300005535 Bacteria 1003
113 Ga0070697_100000154 3300005536 Bacteria 55469
114 Ga0070697_100000611 3300005536 Bacteria 27144
115 Ga0070697_100006310 3300005536 Bacteria 9175
116 Ga0070697_100013207 3300005536 Bacteria 6474
117 Ga0068853_100030276 3300005539 Bacteria 4571
118 Ga0068853_100033957 3300005539 Bacteria 4327
119 Ga0068853_100046059 3300005539 Bacteria 3738
120 Ga0070672_100061244 3300005543 Bacteria 2966
121 Ga0070686_100033912 3300005544 Bacteria 3140
122 Ga0070686_100070019 3300005544 Bacteria 2293
123 Ga0070686_100192441 3300005544 Bacteria 1457
124 Ga0070686_100353330 3300005544 Bacteria 1105
125 Ga0070695_100000241 3300005545 Bacteria 27145
126 Ga0070696_100001603 3300005546 Bacteria 14828
127 Ga0070693_100000001 3300005547 Bacteria 99999
128 Ga0070693_100037193 3300005547 Bacteria 2712
129 Ga0068855_100005049 3300005563 Bacteria 16107
130 Ga0068855_100011563 3300005563 Bacteria 10660
131 Ga0068855_100059758 3300005563 Bacteria 4459
132 Ga0068855_100124938 3300005563 Bacteria 2942
133 Ga0068855_100191067 3300005563 Bacteria 2309
134 Ga0068855_100260624 3300005563 Bacteria 1931
135 Ga0068855_100713531 3300005563 Bacteria 1072
136 Ga0070664_100065457 3300005564 Bacteria 3101
137 Ga0070664_100101165 3300005564 Bacteria 2506
138 Ga0068857_100002564 3300005577 Bacteria 14880
139 Ga0068857_100155678 3300005577 Bacteria 2072
140 Ga0068854_100019445 3300005578 Bacteria 4577
141 Ga0068854_100026294 3300005578 Bacteria 3999
142 Ga0068856_100014394 3300005614 Bacteria 7646
143 Ga0068856_100018361 3300005614 Bacteria 6778
144 Ga0068856_100050518 3300005614 Bacteria 4099
145 Ga0068856_100062942 3300005614 Bacteria 3664
146 Ga0068856_100173720 3300005614 Bacteria 2167
147 Ga0068852_100009157 3300005616 Bacteria 7333
148 Ga0068852_100020604 3300005616 Bacteria 5245
149 Ga0068859_100047633 3300005617 Bacteria 4307
150 Ga0068859_100153038 3300005617 Bacteria 2382
151 Ga0068859_100477679 3300005617 Bacteria 1342
152 Ga0068864_100085594 3300005618 Bacteria 2772
153 Ga0068864_100137255 3300005618 Bacteria 2203
154 Ga0068861_100157546 3300005719 Bacteria 1870
155 Ga0068861_100512098 3300005719 Bacteria 1087
156 Ga0068851_10022887 3300005834 Bacteria 3049
157 Ga0068870_10001403 3300005840 Bacteria 9723
158 Ga0068858_100006301 3300005842 Bacteria 11552
159 Ga0068858_100031219 3300005842 Bacteria 4947
160 Ga0068862_100007985 3300005844 Bacteria 8755
161 Ga0068862_100022065 3300005844 Bacteria 5326
162 Ga0068862_100238359 3300005844 Bacteria 1653
163 Ga0081455_10003446 3300005937 Bacteria 18181
164 Ga0070717_10006541 3300006028 Bacteria 8579
165 Ga0070717_10009078 3300006028 Bacteria 7465
166 Ga0070717_10016985 3300006028 Bacteria 5653
167 Ga0070717_10018181 3300006028 Bacteria 5485
168 Ga0070717_10020707 3300006028 Bacteria 5179
169 Ga0070717_10049885 3300006028 Bacteria 3437
170 Ga0070717_10071819 3300006028 Bacteria 2888
171 Ga0070717_10093447 3300006028 Bacteria 2543
172 Ga0070717_10110751 3300006028 Bacteria 2342
173 Ga0070717_10198433 3300006028 Bacteria 1757
174 Ga0070717_10209519 3300006028 Bacteria 1710
175 Ga0075365_10000703 3300006038 Bacteria 13456
176 Ga0075363_100039612 3300006048 Bacteria 2481
177 Ga0070715_10017110 3300006163 Bacteria 2739
178 Ga0070715_10051193 3300006163 Bacteria 1776
179 Ga0070716_100001016 3300006173 Bacteria 12286
180 Ga0070716_100010992 3300006173 Bacteria 4554
181 Ga0070716_100011138 3300006173 Bacteria 4526
182 Ga0070716_100207067 3300006173 Bacteria 1308
183 Ga0070716_100393913 3300006173 Bacteria 994
184 Ga0070712_100000283 3300006175 Bacteria 28629
185 Ga0070712_100031917 3300006175 Bacteria 3552
186 Ga0070712_100037660 3300006175 Bacteria 3299
187 Ga0070712_100440397 3300006175 Bacteria 1083
188 Ga0075369_10009433 3300006186 Bacteria 3792
189 Ga0097621_100000636 3300006237 Bacteria 24794
190 Ga0097621_100007637 3300006237 Bacteria 7751
191 Ga0097621_100207105 3300006237 Bacteria 1705
192 Ga0097621_100242139 3300006237 Bacteria 1577
193 Ga0097621_100417300 3300006237 Bacteria 1204
194 Ga0075370_10131609 3300006353 Bacteria 1459
195 Ga0068871_100003144 3300006358 Bacteria 11330
196 Ga0068871_100009581 3300006358 Bacteria 7030
197 Ga0068871_100048745 3300006358 Bacteria 3421
198 Ga0068871_100131569 3300006358 Bacteria 2122
199 Ga0068871_100431734 3300006358 Bacteria 1178
200 Ga0075428_100001111 3300006844 Bacteria 28645
201 Ga0075430_100059190 3300006846 Bacteria 3221
202 Ga0075431_100009788 3300006847 Bacteria 9627
203 Ga0075431_100013464 3300006847 Bacteria 8261
204 Ga0075431_100303384 3300006847 Bacteria 1613
205 Ga0075434_100274047 3300006871 Bacteria 1706
206 Ga0068865_100169941 3300006881 Bacteria 1670
207 Ga0075436_100007096 3300006914 Bacteria 7669
208 Ga0075436_100275580 3300006914 Bacteria 1202
209 Ga0097620_100047633 3300006931 Bacteria 4307
210 Ga0097620_100153046 3300006931 Bacteria 2382
211 Ga0097620_100477675 3300006931 Bacteria 1342
212 Ga0075435_100029466 3300007076 Bacteria 4308
213 Ga0075435_100085881 3300007076 Bacteria 2590
214 Ga0075435_100100996 3300007076 Bacteria 2390
215 Ga0099794_10012765 3300007265 Bacteria 3638
216 Ga0099794_10084771 3300007265 Bacteria 1567
217 Ga0105240_10003524 3300009093 Bacteria 24282
218 Ga0105240_10040280 3300009093 Bacteria 5977
219 Ga0105240_10067711 3300009093 Bacteria 4425
220 Ga0105240_10082835 3300009093 Bacteria 3939
221 Ga0105240_10088483 3300009093 Bacteria 3789
222 Ga0105240_10190509 3300009093 Bacteria 2412
223 Ga0105240_10283048 3300009093 Bacteria 1904
224 Ga0105240_10329008 3300009093 Bacteria 1739
225 Ga0105240_10477773 3300009093 Bacteria 1390
226 Ga0111539_10001049 3300009094 Bacteria 36370
227 Ga0111539_10561622 3300009094 Bacteria 1329
228 Ga0105245_10002615 3300009098 Bacteria 16222
229 Ga0105245_10015459 3300009098 Bacteria 6654
230 Ga0105245_10088178 3300009098 Bacteria 2849
231 Ga0105245_10095813 3300009098 Bacteria 2738
232 Ga0105245_10096048 3300009098 Bacteria 2734
233 Ga0105247_10006087 3300009101 Bacteria 7498
234 Ga0114129_10010346 3300009147 Bacteria 13303
235 Ga0114129_10056624 3300009147 Bacteria 5491
236 Ga0114129_10157785 3300009147 Bacteria 3102
237 Ga0114129_10235570 3300009147 Bacteria 2463
238 Ga0114129_10403523 3300009147 Bacteria 1801
239 Ga0105243_10060212 3300009148 Bacteria 3033
240 Ga0105241_10007751 3300009174 Bacteria 7893
241 Ga0105241_10054775 3300009174 Bacteria 3054
242 Ga0105241_10102911 3300009174 Bacteria 2273
243 Ga0105242_10051708 3300009176 Bacteria 3349
244 Ga0105242_10075750 3300009176 Bacteria 2802
245 Ga0105248_10067771 3300009177 Bacteria 4007
246 Ga0105248_10067870 3300009177 Bacteria 4004
247 Ga0105248_10091809 3300009177 Bacteria 3419
248 Ga0105248_10099340 3300009177 Bacteria 3280
249 Ga0105248_10105475 3300009177 Bacteria 3177
250 Ga0105248_10132428 3300009177 Bacteria 2813
251 Ga0105248_10220072 3300009177 Bacteria 2138
252 Ga0105237_10034990 3300009545 Bacteria 5083
253 Ga0105237_10188531 3300009545 Bacteria 2062
254 Ga0105237_10465764 3300009545 Bacteria 1270
255 Ga0105238_10020563 3300009551 Bacteria 6721
256 Ga0105238_10037755 3300009551 Bacteria 4909
257 Ga0105249_10013389 3300009553 Bacteria 7243
258 Ga0123342_1010346 3300009766 Bacteria 10744
259 Ga0105239_10011126 3300010375 Bacteria 10044
260 Ga0105239_10043696 3300010375 Bacteria 4913
261 Ga0105239_10321878 3300010375 Bacteria 1744
262 Ga0105246_10045000 3300011119 Bacteria 3003
263 Ga0157373_10007427 3300013100 Bacteria 8153
264 Ga0157373_10039563 3300013100 Bacteria 3376
265 Ga0157371_10006699 3300013102 Bacteria 9420
266 Ga0157370_10020660 3300013104 Bacteria 6573
267 Ga0157370_10168838 3300013104 Bacteria 2034
268 Ga0157369_10017310 3300013105 Bacteria 8101
269 Ga0157369_10053879 3300013105 Bacteria 4345
270 Ga0157369_10107252 3300013105 Bacteria 2972
271 Ga0157369_10303204 3300013105 Bacteria 1661
272 Ga0157374_10011586 3300013296 Bacteria 7644
273 Ga0157374_10012444 3300013296 Bacteria 7402
274 Ga0157374_10069910 3300013296 Bacteria 3307
275 Ga0157374_10082445 3300013296 Bacteria 3053
276 Ga0157374_10146847 3300013296 Bacteria 2291
277 Ga0157374_10154552 3300013296 Bacteria 2232
278 Ga0157374_10208470 3300013296 Bacteria 1916
279 Ga0157374_10242422 3300013296 Unclassified 1773
280 Ga0157378_10024126 3300013297 Bacteria 5350
281 Ga0157378_10091691 3300013297 Bacteria 2763
282 Ga0157378_10210096 3300013297 Bacteria 1845
283 Ga0163162_10092712 3300013306 Bacteria 3105
284 Ga0163162_10131133 3300013306 Bacteria 2615
285 Ga0157372_10018667 3300013307 Bacteria 7461
286 Ga0157372_10044056 3300013307 Bacteria 4943
287 Ga0157372_10053523 3300013307 Bacteria 4499
288 Ga0157372_10059662 3300013307 Bacteria 4268
289 Ga0157372_10074783 3300013307 Bacteria 3821
290 Ga0157372_10199010 3300013307 Bacteria 2321
291 Ga0157375_10027706 3300013308 Bacteria 5300
292 Ga0157375_10077423 3300013308 Bacteria 3355
293 Ga0157375_10142829 3300013308 Bacteria 2522
294 Ga0157375_10161700 3300013308 Bacteria 2381
295 Ga0163163_10000003 3300014325 Bacteria 455102
296 Ga0163163_10000442 3300014325 Bacteria 37880
297 Ga0163163_10022494 3300014325 Bacteria 5970
298 Ga0163163_10032102 3300014325 Bacteria 5072
299 Ga0163163_10072349 3300014325 Bacteria 3437
300 Ga0163163_10261269 3300014325 Bacteria 1782
301 Ga0182008_10039094 3300014497 Bacteria 2372
302 Ga0157377_10003684 3300014745 Bacteria 6948
303 Ga0157379_10027492 3300014968 Bacteria 5065
304 Ga0157379_10091553 3300014968 Bacteria 2728
305 Ga0157376_10005928 3300014969 Bacteria 8580
306 Ga0157376_10021679 3300014969 Bacteria 4992
307 Ga0157376_10036856 3300014969 Bacteria 3964
308 Ga0157376_10095512 3300014969 Bacteria 2585
309 Ga0182007_10002588 3300015262 Bacteria 8903
310 Ga0182007_10019401 3300015262 Bacteria 2445
311 Ga0163161_10004345 3300017792 Bacteria 9878
312 Ga0213871_10006971 3300021441 Bacteria 2420
313 Ga0228598_1001381 3300024227 Bacteria 5334
314 Ga0228598_1004994 3300024227 Bacteria 2789
315 Ga0228598_1012969 3300024227 Bacteria 1652
316 Ga0207425_1004391 3300025245 Bacteria 4249
317 Ga0209129_1001686 3300025258 Bacteria 11960
318 Ga0209129_1001949 3300025258 Bacteria 10778
319 Ga0209673_1000135 3300025273 Bacteria 160333
320 Ga0209673_1006097 3300025273 Bacteria 5911
321 Ga0209025_1016800 3300025294 Bacteria 4281
322 Ga0209564_1000138 3300025295 Bacteria 181512
323 Ga0209564_1011683 3300025295 Bacteria 3908
324 Ga0209758_1001640 3300025297 Bacteria 25413
325 Ga0209256_1001423 3300025299 Bacteria 24892
326 Ga0207426_1004269 3300025302 Bacteria 7081
327 Ga0207697_10001953 3300025315 Bacteria 10958
328 Ga0207656_10031155 3300025321 Bacteria 2208
329 Ga0207653_10000864 3300025885 Bacteria 10086
330 Ga0207682_10009574 3300025893 Bacteria 3820
331 Ga0207692_10078362 3300025898 Bacteria 1760
332 Ga0207692_10142166 3300025898 Bacteria 1366
333 Ga0207680_10014593 3300025903 Bacteria 4073
334 Ga0207680_10015402 3300025903 Bacteria 3989
335 Ga0207680_10190778 3300025903 Bacteria 1391
336 Ga0207647_10006231 3300025904 Bacteria 8690
337 Ga0207699_10000689 3300025906 Bacteria 16203
338 Ga0207699_10028318 3300025906 Bacteria 3112
339 Ga0207699_10224945 3300025906 Bacteria 1283
340 Ga0207645_10000720 3300025907 Bacteria 27522
341 Ga0207643_10000381 3300025908 Bacteria 29761
342 Ga0207705_10001399 3300025909 Bacteria 19236
343 Ga0207705_10003150 3300025909 Bacteria 12558
344 Ga0207684_10000203 3300025910 Bacteria 91833
345 Ga0207684_10006734 3300025910 Bacteria 10428
346 Ga0207684_10056700 3300025910 Bacteria 3324
347 Ga0207654_10097859 3300025911 Bacteria 1802
348 Ga0207654_10126145 3300025911 Bacteria 1614
349 Ga0207707_10073387 3300025912 Bacteria 2984
350 Ga0207695_10079776 3300025913 Unclassified 3316
351 Ga0207695_10186106 3300025913 Bacteria 1995
352 Ga0207695_10230740 3300025913 Bacteria 1756
353 Ga0207671_10000006 3300025914 Bacteria 836809
354 Ga0207671_10052653 3300025914 Bacteria 3016
355 Ga0207671_10059974 3300025914 Bacteria 2822
356 Ga0207671_10185847 3300025914 Bacteria 1619
357 Ga0207671_10306593 3300025914 Bacteria 1255
358 Ga0207671_10404669 3300025914 Bacteria 1085
359 Ga0207693_10000054 3300025915 Bacteria 96633
360 Ga0207693_10005606 3300025915 Bacteria 10439
361 Ga0207693_10069860 3300025915 Bacteria 2748
362 Ga0207693_10078051 3300025915 Bacteria 2592
363 Ga0207693_10110535 3300025915 Bacteria 2155
364 Ga0207663_10134160 3300025916 Bacteria 1715
365 Ga0207660_10084381 3300025917 Bacteria 2341
366 Ga0207660_10197520 3300025917 Bacteria 1570
367 Ga0207660_10256270 3300025917 Bacteria 1382
368 Ga0207662_10013577 3300025918 Bacteria 4557
369 Ga0207657_10000246 3300025919 Bacteria 57698
370 Ga0207657_10000344 3300025919 Bacteria 49261
371 Ga0207649_10004406 3300025920 Bacteria 7640
372 Ga0207652_10012959 3300025921 Bacteria 6746
373 Ga0207652_10179134 3300025921 Bacteria 1904
374 Ga0207652_10228016 3300025921 Bacteria 1679
375 Ga0207652_10278176 3300025921 Bacteria 1510
376 Ga0207646_10001438 3300025922 Bacteria 29540
377 Ga0207694_10005000 3300025924 Bacteria 10256
378 Ga0207694_10011132 3300025924 Bacteria 6792
379 Ga0207694_10161434 3300025924 Bacteria 1810
380 Ga0207694_10196842 3300025924 Bacteria 1639
381 Ga0207694_10352530 3300025924 Bacteria 1218
382 Ga0207650_10000098 3300025925 Bacteria 115403
383 Ga0207687_10001671 3300025927 Bacteria 15303
384 Ga0207687_10089760 3300025927 Bacteria 2238
385 Ga0207700_10000927 3300025928 Bacteria 16845
386 Ga0207700_10001471 3300025928 Bacteria 13350
387 Ga0207700_10009225 3300025928 Bacteria 6152
388 Ga0207700_10050905 3300025928 Bacteria 3088
389 Ga0207700_10116859 3300025928 Bacteria 2156
390 Ga0207700_10309168 3300025928 Bacteria 1367
391 Ga0207700_10381150 3300025928 Bacteria 1233
392 Ga0207664_10034898 3300025929 Bacteria 3877
393 Ga0207664_10095843 3300025929 Bacteria 2441
394 Ga0207664_10238747 3300025929 Bacteria 1582
395 Ga0207664_10432019 3300025929 Bacteria 1174
396 Ga0207664_10463040 3300025929 Bacteria 1132
397 Ga0207644_10010814 3300025931 Bacteria 6023
398 Ga0207690_10019647 3300025932 Bacteria 4163
399 Ga0207690_10237864 3300025932 Bacteria 1401
400 Ga0207706_10001532 3300025933 Bacteria 22934
401 Ga0207706_10018416 3300025933 Bacteria 6284
402 Ga0207686_10108340 3300025934 Bacteria 1869
403 Ga0207686_10459376 3300025934 Bacteria 981
404 Ga0207670_10006804 3300025936 Bacteria 6359
405 Ga0207670_10013827 3300025936 Bacteria 4774
406 Ga0207669_10029158 3300025937 Bacteria 3048
407 Ga0207704_10043027 3300025938 Bacteria 2663
408 Ga0207665_10001266 3300025939 Bacteria 17044
409 Ga0207665_10026998 3300025939 Bacteria 3792
410 Ga0207665_10076572 3300025939 Bacteria 2294
411 Ga0207665_10121928 3300025939 Bacteria 1842
412 Ga0207691_10000038 3300025940 Bacteria 107867
413 Ga0207691_10060899 3300025940 Bacteria 3429
414 Ga0207711_10010790 3300025941 Bacteria 7593
415 Ga0207711_10092312 3300025941 Bacteria 2664
416 Ga0207711_10100621 3300025941 Bacteria 2557
417 Ga0207711_10380271 3300025941 Bacteria 1310
418 Ga0207689_10000632 3300025942 Bacteria 33593
419 Ga0207689_10003881 3300025942 Bacteria 13622
420 Ga0207689_10033321 3300025942 Bacteria 4281
421 Ga0207689_10043033 3300025942 Bacteria 3734
422 Ga0207661_10002817 3300025944 Bacteria 12010
423 Ga0207661_10136543 3300025944 Bacteria 2107
424 Ga0207661_10155197 3300025944 Bacteria 1982
425 Ga0207661_10232305 3300025944 Bacteria 1634
426 Ga0207679_10000078 3300025945 Bacteria 86272
427 Ga0207679_10018813 3300025945 Bacteria 4634
428 Ga0207679_10166515 3300025945 Bacteria 1810
429 Ga0207667_10005939 3300025949 Bacteria 14866
430 Ga0207667_10026055 3300025949 Bacteria 6394
431 Ga0207667_10201616 3300025949 Bacteria 2041
432 Ga0207667_10360371 3300025949 Bacteria 1483
433 Ga0207667_10375223 3300025949 Bacteria 1449
434 Ga0207651_10011928 3300025960 Bacteria 4887
435 Ga0207651_10024197 3300025960 Bacteria 3752
436 Ga0207651_10110410 3300025960 Bacteria 2063
437 Ga0207712_10084185 3300025961 Bacteria 2323
438 Ga0207668_10014150 3300025972 Bacteria 4934
439 Ga0207668_10133589 3300025972 Bacteria 1898
440 Ga0207640_10069540 3300025981 Bacteria 2364
441 Ga0207640_10164201 3300025981 Bacteria 1647
442 Ga0207658_10010579 3300025986 Bacteria 6269
443 Ga0207658_10025386 3300025986 Bacteria 4149
444 Ga0207677_10038875 3300026023 Bacteria 3123
445 Ga0207677_10109184 3300026023 Bacteria 2056
446 Ga0207677_10172428 3300026023 Bacteria 1693
447 Ga0207703_10064742 3300026035 Bacteria 3001
448 Ga0207703_10387877 3300026035 Bacteria 1293
449 Ga0207639_10005525 3300026041 Bacteria 8543
450 Ga0207639_10027905 3300026041 Bacteria 4116
451 Ga0207639_10029332 3300026041 Bacteria 4026
452 Ga0207678_10000348 3300026067 Bacteria 41968
453 Ga0207678_10062434 3300026067 Bacteria 3202
454 Ga0207678_10181777 3300026067 Bacteria 1796
455 Ga0207702_10143061 3300026078 Bacteria 2167
456 Ga0207702_10286407 3300026078 Bacteria 1559
457 Ga0207641_10000021 3300026088 Bacteria 279851
458 Ga0207641_10040038 3300026088 Bacteria 3921
459 Ga0207641_10066356 3300026088 Bacteria 3089
460 Ga0207648_10000703 3300026089 Bacteria 37521
461 Ga0207648_10014082 3300026089 Bacteria 7399
462 Ga0207648_10034905 3300026089 Bacteria 4434
463 Ga0207676_10000262 3300026095 Bacteria 45744
464 Ga0207676_10179843 3300026095 Bacteria 1851
465 Ga0207674_10000386 3300026116 Bacteria 57404
466 Ga0207674_10040973 3300026116 Bacteria 4793
467 Ga0207674_10176731 3300026116 Bacteria 2087
468 Ga0207674_10581240 3300026116 Bacteria 1082
469 Ga0207675_100006514 3300026118 Bacteria 11050
470 Ga0207675_100269475 3300026118 Bacteria 1652
471 Ga0207683_10000045 3300026121 Bacteria 89294
472 Ga0207683_10027391 3300026121 Bacteria 4924
473 Ga0207683_10111548 3300026121 Bacteria 2449
474 Ga0207698_10037698 3300026142 Bacteria 3564
475 Ga0209588_1028182 3300027671 Bacteria 1788
476 Ga0207428_10039787 3300027907 Bacteria 3817
477 Ga0265354_1002157 3300028016 Bacteria 2521
478 Ga0268266_10007297 3300028379 Bacteria 9995
479 Ga0268266_10045322 3300028379 Bacteria 3762
480 Ga0268266_10306086 3300028379 Bacteria 1484
481 Ga0268265_10007057 3300028380 Bacteria 7596
482 Ga0268265_10089839 3300028380 Bacteria 2452
483 Ga0268264_10037698 3300028381 Bacteria 3986
484 Ga0265337_1001373 3300028556 Bacteria 11976
485 Ga0265319_1006216 3300028563 Bacteria 5563
486 Ga0265334_10034209 3300028573 Bacteria 2018
487 Ga0265323_10018655 3300028653 Bacteria 2682
488 Ga0265323_10018865 3300028653 Bacteria 2665
489 Ga0265322_10017956 3300028654 Bacteria 2036
490 Ga0265336_10000507 3300028666 Bacteria 22737
491 Ga0307515_10000277 3300028794 Bacteria 125765
492 Ga0265338_10002794 3300028800 Bacteria 25522
493 Ga0265338_10002935 3300028800 Bacteria 24739
494 Ga0265338_10004483 3300028800 Bacteria 18827
495 Ga0265338_10016778 3300028800 Bacteria 7934
496 Ga0265338_10028532 3300028800 Bacteria 5563
497 Ga0265338_10041537 3300028800 Bacteria 4300
498 Ga0265338_10050628 3300028800 Bacteria 3752
499 Ga0265338_10064288 3300028800 Bacteria 3192
500 Ga0265338_10169984 3300028800 Bacteria 1673
501 Ga0265324_10006000 3300029957 Bacteria 5145
502 Ga0265762_1000129 3300030760 Bacteria 11439
503 Ga0265770_1001133 3300030878 Bacteria 3677
504 Ga0265765_1000923 3300030879 Bacteria 2578
505 Ga0265760_10007969 3300031090 Bacteria 3025
506 Ga0265328_10007524 3300031239 Bacteria 4536
507 Ga0265320_10000443 3300031240 Bacteria 32427
508 Ga0265320_10045144 3300031240 Bacteria 2166
509 Ga0265325_10071857 3300031241 Bacteria 1735
510 Ga0265340_10121060 3300031247 Bacteria 1204
511 Ga0265339_10048655 3300031249 Bacteria 2324
512 Ga0265316_10007238 3300031344 Bacteria 10479
513 Ga0265316_10098812 3300031344 Bacteria 2221
514 Ga0307513_10056058 3300031456 Bacteria 4211
515 Ga0307513_10097050 3300031456 Bacteria 2983
516 Ga0265313_10012488 3300031595 Bacteria 5178
517 Ga0265314_10064457 3300031711 Bacteria 2480
518 Ga0265342_10014674 3300031712 Bacteria 5192
519 Ga0316576_10041742 3300031727 Bacteria 3305
520 Ga0316576_10229412 3300031727 Bacteria 1396
521 Ga0373926_0001709 3300035083 Bacteria 6800
522 Ga0373926_0059066 3300035083 Unclassified 1395
523 Ga0373934_0002139 3300035086 Bacteria 7261
524 Ga0373934_0069520 3300035086 Bacteria 1407
525 Ga0373944_0009873 3300035089 Bacteria 2595
526 Ga0373923_0031920 3300035111 Bacteria 2125
527 Ga0373936_0005493 3300035113 Bacteria 4782
528 Ga0373936_0037604 3300035113 Bacteria 1933
529 Ga0373945_0005619 3300035116 Bacteria 4021
530 Ga0373945_0011448 3300035116 Bacteria 2934
531 Ga0373953_0002457 3300035117 Bacteria 5607
532 Ga0373954_0006207 3300035118 Bacteria 5209
533 Ga0373954_0045115 3300035118 Bacteria 2059
534 Ga0373954_0091029 3300035118 Bacteria 1465
535 Ga0373956_0060782 3300035119 Bacteria 1711
536 Ga0373956_0087419 3300035119 Bacteria 1435
537 Ga0373943_0058937 3300035170 Bacteria 1912
538 Ga0373955_0000879 3300035172 Bacteria 12892
539 Ga0373955_0139805 3300035172 Bacteria 1419
540 Ga0373955_0178406 3300035172 Bacteria 1260
541 Ga0373924_0000277 3300035410 Bacteria 15788
542 Ga0373924_0081256 3300035410 Bacteria 1379
543 Ga0373931_0054160 3300035691 Bacteria 2143
544 Ga0373935_0012623 3300035692 Bacteria 5082
545 Ga0373935_0025464 3300035692 Bacteria 3646
546 Ga0373935_0067926 3300035692 Bacteria 2293
547 Ga0373935_0122895 3300035692 Bacteria 1736
548 Ga0373935_0180746 3300035692 Bacteria 1448
549 Ga0373927_0001563 3300035695 Bacteria 17150
550 Ga0373927_0017340 3300035695 Bacteria 4740
551 Ga0373927_0022869 3300035695 Bacteria 4095
552 Ga0373927_0037625 3300035695 Bacteria 3144
553 Ga0373927_0041537 3300035695 Bacteria 2983
554 Ga0373927_0059600 3300035695 Bacteria 2469
555 Ga0373927_0075354 3300035695 Bacteria 2185
556 Ga0373933_0001231 3300035724 Bacteria 15131
557 Ga0373933_0014608 3300035724 Bacteria 4371
558 Ga0373933_0206523 3300035724 Bacteria 1258
559 Ga0373947_0004886 3300035725 Bacteria 7844
560 Ga0373947_0011757 3300035725 Bacteria 5015
561 Ga0373947_0017321 3300035725 Bacteria 4144
562 Ga0373947_0026711 3300035725 Bacteria 3376
563 Ga0373947_0027023 3300035725 Bacteria 3357
564 Ga0373947_0027754 3300035725 Bacteria 3314
565 Ga0373937_0000399 3300036401 Bacteria 40554
566 Ga0373937_0000562 3300036401 Bacteria 32919
567 Ga0373937_0011271 3300036401 Bacteria 7839
568 Ga0373937_0022798 3300036401 Bacteria 5633
569 Ga0373937_0046836 3300036401 Bacteria 3955
570 Ga0373937_0046887 3300036401 Bacteria 3953
571 Ga0373937_0050295 3300036401 Bacteria 3817
572 Ga0373937_0251616 3300036401 Bacteria 1666
573 Ga0373937_0665406 3300036401 Bacteria 987
574 Ga0373937_0714047 3300036401 Bacteria 949
575 Ga0373925_0008191 3300037068 Bacteria 7606
576 Ga0373925_0009252 3300037068 Bacteria 7172
577 Ga0373925_0022011 3300037068 Bacteria 4646
578 Ga0373925_0025058 3300037068 Bacteria 4356
579 Ga0373925_0031656 3300037068 Bacteria 3888
580 Ga0373925_0091366 3300037068 Bacteria 2328
581 Ga0373925_0213366 3300037068 Bacteria 1538
582 Ga0373925_0236469 3300037068 Bacteria 1462
583 Ga0373925_0244620 3300037068 Bacteria 1437
584 Ga0395905_0010636 3300037471 Bacteria 8927
585 Ga0395901_0491192 3300038443 Bacteria 1251
586 Ga0436365_0127076 3300039437 Bacteria 1254
587 Ga0436360_0226257 3300039438 Bacteria 2663
588 Ga0436363_1615544 3300039450 Bacteria 1148
589 Ga0451787_735581 3300041441 Bacteria 2953
590 Ga0451789_0291302 3300041443 Bacteria 1778
591 Ga0451833_0450416 3300041491 Bacteria 2287
592 Ga0451839_0046361 3300041496 Bacteria 2264
593 Ga0451849_0536283 3300041505 Bacteria 1859
594 Ga0439451_029917 3300042009 Bacteria 1096
595 Ga0451577_0029041 3300042876 Bacteria 5000
596 Ga0453684_0547731 3300044712 Bacteria 1275
597 Ga0466968_0177718 3300044735 Bacteria 989
598 Ga0451576_0075180 3300045051 Bacteria 3515
599 Ga0451576_0125581 3300045051 Bacteria 2673
600 Ga0451576_0345407 3300045051 Bacteria 1558
601 Ga0451576_0377881 3300045051 Bacteria 1485
602 Ga0451576_0696071 3300045051 Bacteria 1068
603 Ga0495592_0108714 3300046454 Bacteria 1965
604 Ga0495629_0314836 3300046459 Bacteria 1070
605 Ga0495638_0000715 3300046460 Bacteria 35779
606 Ga0495638_0011305 3300046460 Bacteria 6151
607 Ga0495638_0012384 3300046460 Bacteria 5847
608 Ga0495653_0079462 3300046463 Bacteria 2429
609 Ga0495580_0004655 3300046472 Bacteria 11509
610 Ga0495580_0005446 3300046472 Bacteria 10518
611 Ga0495580_0010142 3300046472 Bacteria 7360
612 Ga0495580_0018605 3300046472 Bacteria 5171
613 Ga0495580_0023134 3300046472 Bacteria 4566
614 Ga0495580_0071903 3300046472 Bacteria 2416
615 Ga0495580_0088529 3300046472 Bacteria 2156
616 Ga0495580_0142458 3300046472 Bacteria 1661
617 Ga0495580_0293190 3300046472 Bacteria 1109
618 Ga0495580_0353870 3300046472 Bacteria 994
619 Ga0495582_0039307 3300046473 Bacteria 2605
620 Ga0495582_0039623 3300046473 Bacteria 2594
621 Ga0495582_0094361 3300046473 Bacteria 1670
622 Ga0495639_0027637 3300046475 Bacteria 2512
623 Ga0495639_0049242 3300046475 Bacteria 1912
624 Ga0495662_0117200 3300046476 Bacteria 1306
625 Ga0495664_0011235 3300046477 Bacteria 5044
626 Ga0495664_0227642 3300046477 Bacteria 1128
627 Ga0495585_0003214 3300046492 Bacteria 11151
628 Ga0495585_0022498 3300046492 Bacteria 3618
629 Ga0495583_0004726 3300046506 Bacteria 9579
630 Ga0495608_0104592 3300046511 Bacteria 1823
631 Ga0495618_0079166 3300046514 Bacteria 2096
632 Ga0495628_0022008 3300046516 Bacteria 5239
633 Ga0495630_0000049 3300046517 Bacteria 97884
634 Ga0495630_0073008 3300046517 Bacteria 2583
635 Ga0495630_0165101 3300046517 Bacteria 1686
636 Ga0495666_0027726 3300046526 Bacteria 2788
637 Ga0495666_0133010 3300046526 Bacteria 1162
638 Ga0495652_0084508 3300046529 Bacteria 2610
639 Ga0495652_0145792 3300046529 Bacteria 1856
640 Ga0495652_0329658 3300046529 Bacteria 1100
641 Ga0495665_0039556 3300046531 Bacteria 2511
642 Ga0495665_0085009 3300046531 Bacteria 1663
643 Ga0495640_0135727 3300046533 Bacteria 1589
644 Ga0495586_0000185 3300046535 Bacteria 41119
645 Ga0495586_0003014 3300046535 Bacteria 9086
646 Ga0495587_0001610 3300046536 Bacteria 15021
647 Ga0495587_0011531 3300046536 Bacteria 5596
648 Ga0495645_0048856 3300046543 Bacteria 3081
649 Ga0495667_0005219 3300046559 Bacteria 8779
650 Ga0495656_0012529 3300046615 Bacteria 3132
651 Ga0495668_0043285 3300046616 Bacteria 2505
652 Ga0495634_0025259 3300046642 Bacteria 4160
653 Ga0495625_0019852 3300046660 Bacteria 5200
654 Ga0495635_0121578 3300046663 Bacteria 1781
655 Ga0495657_0011006 3300046675 Bacteria 6785
656 Ga0495657_0152685 3300046675 Bacteria 1433
657 Ga0495599_0007344 3300046678 Bacteria 6681
658 Ga0495599_0018343 3300046678 Bacteria 4361
659 Ga0495623_0065114 3300046679 Bacteria 2280
660 Ga0495646_0143710 3300046680 Bacteria 1332
661 Ga0495613_0005499 3300046689 Bacteria 9519
662 Ga0495613_0080635 3300046689 Bacteria 2365
663 Ga0495600_0020919 3300046809 Bacteria 4187
664 Ga0495581_0030614 3300047315 Bacteria 3118
665 Ga0495581_0034054 3300047315 Bacteria 2947
666 Ga0495581_0150107 3300047315 Bacteria 1361
667 Ga0495604_0001432 3300047317 Bacteria 19579
668 Ga0495604_0133014 3300047317 Bacteria 1786
669 Ga0495674_0000493 3300047319 Bacteria 36004
670 Ga0495674_0001188 3300047319 Bacteria 25172
671 Ga0495674_0023765 3300047319 Bacteria 5644
672 Ga0495674_0025311 3300047319 Bacteria 5443
673 Ga0495674_0068769 3300047319 Bacteria 3064
674 Ga0495674_0129577 3300047319 Bacteria 2126
675 Ga0495674_0227252 3300047319 Bacteria 1541
676 Ga0495674_0270630 3300047319 Bacteria 1394
677 Ga0495674_0469147 3300047319 Bacteria 1010
678 Ga0495672_0019867 3300047320 Bacteria 4418
679 Ga0495676_0016796 3300047321 Bacteria 6483
680 Ga0495680_0007982 3300047322 Bacteria 9649
681 Ga0495680_0057143 3300047322 Bacteria 3019
682 Ga0495680_0237479 3300047322 Bacteria 1296
683 Ga0495675_0001712 3300047444 Bacteria 13143
684 Ga0495675_0049662 3300047444 Bacteria 2666
685 Ga0495684_0002933 3300047471 Bacteria 13438
686 Ga0495684_0022325 3300047471 Bacteria 4871
687 Ga0495684_0063970 3300047471 Bacteria 2796
688 Ga0495684_0119922 3300047471 Bacteria 1982
689 Ga0495684_0134481 3300047471 Unclassified 1856
690 Ga0495684_0297023 3300047471 Bacteria 1161
691 Ga0495686_0003077 3300047472 Bacteria 14761
692 Ga0495686_0020539 3300047472 Bacteria 4402
693 Ga0495602_0001032 3300048088 Bacteria 27135
694 Ga0496100_0023628 3300048903 Bacteria 3737
695 Ga0496101_0002913 3300048904 Bacteria 10523
696 Ga0496101_0057984 3300048904 Bacteria 2803
697 Ga0496102_0449979 3300048905 Bacteria 1208
698 Ga0496104_0033304 3300048907 Bacteria 4799
699 Ga0496104_0041388 3300048907 Bacteria 4320
700 Ga0496104_0175278 3300048907 Bacteria 2055
701 Ga0496105_0001470 3300048908 Bacteria 16624
702 Ga0496105_0014250 3300048908 Bacteria 6326
703 Ga0496106_0174854 3300048909 Bacteria 1703
704 Ga0496107_0121997 3300048910 Bacteria 1920
705 Ga0496107_0122641 3300048910 Bacteria 1915
706 Ga0496108_0002036 3300048911 Bacteria 16200
707 Ga0496108_0083903 3300048911 Bacteria 2703
708 Ga0496109_0000019 3300048912 Bacteria 190096
709 Ga0496109_0000457 3300048912 Bacteria 35038
710 Ga0496109_0074722 3300048912 Bacteria 3116
711 Ga0496110_0002056 3300048913 Bacteria 15001
712 Ga0496110_0139210 3300048913 Bacteria 2194
713 Ga0496110_0272513 3300048913 Bacteria 1541
714 Ga0496110_0500448 3300048913 Bacteria 1106
715 Ga0496111_0007259 3300048914 Bacteria 7251
716 Ga0496111_0012258 3300048914 Bacteria 5799
717 Ga0496111_0015763 3300048914 Bacteria 5198
718 Ga0496112_0000348 3300048915 Bacteria 30151
719 Ga0496112_0000470 3300048915 Bacteria 26936
720 Ga0496112_0009277 3300048915 Bacteria 8846
721 Ga0496112_0051680 3300048915 Bacteria 4031
722 Ga0496112_0171599 3300048915 Bacteria 2134
723 Ga0496113_0000454 3300048916 Bacteria 19915
724 Ga0496113_0042063 3300048916 Bacteria 3374
725 Ga0496113_0199612 3300048916 Bacteria 1590
726 Ga0496114_0000210 3300048917 Bacteria 42500
727 Ga0496114_0013981 3300048917 Bacteria 6434
728 Ga0496114_0246998 3300048917 Bacteria 1570
729 Ga0496115_0025942 3300048918 Bacteria 4568
730 Ga0496115_0274239 3300048918 Bacteria 1385
731 Ga0496118_0005583 3300048921 Bacteria 14229
732 Ga0496121_0215620 3300048924 Bacteria 1356
733 Ga0501031_0050703 3300049568 Bacteria 2703
734 Ga0501032_0006273 3300049569 Bacteria 8756
735 Ga0501033_0002685 3300049570 Bacteria 14934
736 Ga0501033_0222612 3300049570 Bacteria 1342
737 Ga0501034_0142069 3300049571 Unclassified 2379
738 Ga0501036_0067931 3300049572 Bacteria 3016
739 Ga0501037_0214257 3300049573 Bacteria 1357
740 Ga0501038_0005288 3300049574 Bacteria 12004
741 Ga0501038_0052067 3300049574 Bacteria 3530
742 Ga0501039_0020344 3300049575 Bacteria 5087
743 Ga0501039_0031287 3300049575 Unclassified 4102
744 Ga0501040_0003343 3300049576 Bacteria 10364
745 Ga0501040_0299484 3300049576 Bacteria 1150
746 Ga0501041_0020203 3300049577 Bacteria 3979
747 Ga0501042_0311908 3300049578 Bacteria 1136
748 Ga0501043_0000825 3300049579 Bacteria 27474
749 Ga0501046_0002552 3300049580 Bacteria 17036
750 Ga0501046_0039671 3300049580 Bacteria 3769
751 Ga0501047_0109990 3300049581 Bacteria 2638
752 Ga0501048_0030557 3300049582 Unclassified 3897
753 Ga0501068_0002862 3300049584 Bacteria 9183
754 Ga0501069_0002761 3300049585 Bacteria 8973
755 Ga0501070_0006919 3300049586 Bacteria 9652
756 Ga0501071_0047023 3300049587 Bacteria 3100
757 Ga0501072_0002347 3300049588 Bacteria 14193
758 Ga0501072_0063625 3300049588 Bacteria 2910
759 Ga0501072_0147083 3300049588 Bacteria 1879
760 Ga0501074_0009107 3300049590 Bacteria 7210
761 Ga0501075_0067591 3300049591 Bacteria 2698
762 Ga0501076_0021872 3300049592 Bacteria 4910
763 Ga0501076_0152440 3300049592 Unclassified 1880
764 Ga0501077_0037815 3300049593 Unclassified 3073
765 Ga0501077_0207434 3300049593 Bacteria 1245
766 Ga0501079_0003870 3300049741 Bacteria 11041
767 Ga0501079_0038105 3300049741 Unclassified 3708
768 Ga0501080_0091170 3300049742 Bacteria 2831
769 Ga0501081_0010992 3300049743 Bacteria 5917
770 Ga0501083_0091396 3300049744 Bacteria 2009
771 Ga0501035_0001858 3300049822 Bacteria 21271
772 Ga0501035_0034493 3300049822 Bacteria 4597
773 Ga0501044_0039118 3300049823 Unclassified 4949
774 Ga0501045_0007251 3300049824 Bacteria 7698
775 nmdc:mga05p37_18432_c1 3300050507 Bacteria 8431
776 nmdc:mga05p37_187951_c1 3300050507 Bacteria 2510
777 nmdc:mga05p37_252050_c1 3300050507 Bacteria 2117
778 nmdc:mga05p37_356512_c1 3300050507 Bacteria 1721
779 nmdc:mga05p37_77564_c1 3300050507 Bacteria 4090
780 nmdc:mga0qj67_46895_c1 3300050509 Bacteria 3412
781 nmdc:mga06r32_44927_c2 3300050510 Bacteria 3916
782 nmdc:mga06r32_52436_c1 3300050510 Bacteria 3907
783 nmdc:mga06r32_662755_c1 3300050510 Bacteria 1011
784 nmdc:mga06r32_72948_c1 3300050510 Bacteria 3324
785 nmdc:mga08y16_174463_c1 3300050511 Bacteria 2232
786 nmdc:mga08y16_3729_c1 3300050511 Bacteria 15864
787 nmdc:mga0n895_632532_c1 3300050512 Bacteria 1070
788 nmdc:mga0rr50_2064_c1 3300050513 Bacteria 11209
789 nmdc:mga0rr50_241866_c1 3300050513 Bacteria 1496
790 nmdc:mga0rr50_26506_c1 3300050513 Bacteria 4045
791 nmdc:mga08x19_279259_c1 3300050514 Bacteria 1157
792 nmdc:mga08x19_7752_c1 3300050514 Bacteria 6377
793 Ga0495601_0004545 3300053077 Bacteria 8018
794 Ga0495601_0245176 3300053077 Unclassified 1170
795 Ga0495595_0099244 3300053084 Bacteria 1404
796 Ga0500555_010345 3300053103 Bacteria 2674
797 Ga0500608_027331 3300053122 Bacteria 2689
798 Ga0500618_013846 3300053125 Bacteria 2074
799 Ga0500568_0003011 3300053139 Bacteria 9633
800 Ga0501084_0009514 3300054114 Bacteria 8041
801 Ga0501084_0110094 3300054114 Bacteria 2314
802 Ga0501082_0012726 3300060353 Bacteria 7231
803 Ga0501082_0027687 3300060353 Unclassified 4878
804 Ga0530510_0049366 3300061734 Bacteria 3041
805 2510838994 2510461069 Bacteria 5505000
806 2510897307 2510461076 Bacteria 8618824
807 2511185767 2510917028 Bacteria 6185411
808 2513634058 2513237093 Bacteria 7545552
809 2513707426 2513237103 Bacteria 7647401
810 2513866523 2513237138 Bacteria 7368160
811 2514022186 2513237162 Bacteria 7468464
812 2515633925 2515154113 Bacteria 7807172
813 2515641256 2515154114 Bacteria 7848616
814 2515659739 2515154116 Bacteria 7552979
815 2517038619 2516653077 Bacteria 7555578
816 2517097662 2517093000 Bacteria 7412387
817 2517409094 2517287029 Bacteria 6905599
818 2520375810 2519899620 Bacteria 6499161
819 2530648205 2529292951 Bacteria 6916614
820 2535514722 2534681796 Bacteria 7146037
821 2585232424 2582581299 Bacteria 6518058
822 2585398940 2582581867 Bacteria 7184437
823 2585818939 2585427590 Bacteria 6824633
824 2644004565 2643221599 Bacteria 6292121
825 2644196924 2643221634 Bacteria 6705461
826 2842219265 2842217011 Bacteria 7497767
827 2842397694 2842395702 Bacteria 6780583
828 2923556332 2923556063 Bacteria 6793593
829 3005410785 3005409236 Bacteria 7188837
830 3005456518 3005452660 Bacteria 5889319
831 639646225 639633055 Bacteria 7751309
832 8005247753 8005246636 Bacteria 4933972
833 8005261312 8005258706 Bacteria 6184835
834 8005322663 8005321885 Bacteria 5795980
835 8005543392 8005542996 Bacteria 7077758
836 8005699699 8005695170 Bacteria 6912330
837 8018181911 8018176218 Bacteria 6896178
838 8046774293 8046767195 Bacteria 7547379
839 8057879034 8057874678 Bacteria 7494653
840 Ga0114129_10021869
841 JGI24034J26672_10000395
842 JGI24751J29686_10001448
843 JGI25152J39213_1009730
844 JGI25152J39213_1023403
845 JGI25150J39212_1003414
846 JGI25153J46596_10023340
847 rootL2_10338356
848 Ga0055526_1012325
849 Ga0055526_1014518
850 Ga0055524_1010939
851 Ga0055528_1000564
852 JGI25405J52794_10012762
853 Ga0065712_10078561
854 Ga0065715_10210154
855 Ga0065707_10087272
856 Ga0065707_10118512
857 Ga0070658_10000436
858 Ga0070658_10006864
859 Ga0070658_10039625
860 Ga0070683_100003628
861 Ga0070683_100219340
862 Ga0070690_100017471
863 Ga0070690_100261858
864 Ga0070670_100005898
865 Ga0070677_10010478
866 Ga0068869_100018903
867 Ga0068869_100024134
868 Ga0068869_100032805
869 Ga0068869_100445742
870 Ga0070666_10032124
871 Ga0070666_10085975
872 Ga0070680_100181601
873 Ga0070680_100411090
874 Ga0068868_100002323
875 Ga0068868_100016570
876 Ga0068868_100119469
877 Ga0070660_100010277
878 Ga0070660_100016379
879 Ga0070660_100025506
880 Ga0070689_100003600
881 Ga0070689_100492167
882 Ga0070687_100007512
883 Ga0070661_100016387
884 Ga0070661_100058733
885 Ga0070668_100008772
886 Ga0070669_100070483
887 Ga0070675_100021225
888 Ga0070674_100056146
889 Ga0070673_100079690
890 Ga0070673_100139156
891 Ga0070688_100008955
892 Ga0070659_100022378
893 Ga0070659_100025993
894 Ga0070659_100418445
895 Ga0070667_100026632
896 Ga0070667_100095890
897 Ga0070667_100157023
898 Ga0070709_10088925
899 Ga0070709_10127080
900 Ga0070709_10389981
901 Ga0070714_100016773
902 Ga0070714_100060401
903 Ga0070714_100147884
904 Ga0070714_100265391
905 Ga0070713_100000068
906 Ga0070713_100011925
907 Ga0070713_100191678
908 Ga0070713_100224597
909 Ga0070713_100537974
910 Ga0070710_10123860
911 Ga0070710_10154752
912 Ga0070710_10185326
913 Ga0070701_10066740
914 Ga0070694_100019121
915 Ga0070694_100204794
916 Ga0070708_100000703
917 Ga0070708_100002137
918 Ga0070708_100153546
919 Ga0070708_100160462
920 Ga0070708_100176210
921 Ga0070708_100223030
922 Ga0070708_100298453
923 Ga0070663_100005814
924 Ga0070663_100278912
925 Ga0070662_100017334
926 Ga0070662_100165652
927 Ga0070681_10011020
928 Ga0070681_10053443
929 Ga0070681_10208369
930 Ga0068867_100152682
931 Ga0070685_10055518
932 Ga0070706_100004130
933 Ga0070706_100010574
934 Ga0070706_100068156
935 Ga0070707_100015056
936 Ga0070707_100070745
937 Ga0070707_100078221
938 Ga0070707_100172740
939 Ga0070698_100015417
940 Ga0070698_100017312
941 Ga0070699_100000002
942 Ga0070699_100001492
943 Ga0070699_100024547
944 Ga0070699_100033123
945 Ga0070699_100152309
946 Ga0070679_100019158
947 Ga0070679_100129164
948 Ga0070679_100207909
949 Ga0070684_100010810
950 Ga0070684_100408471
951 Ga0070684_100623496
952 Ga0070697_100000154
953 Ga0070697_100000611
954 Ga0070697_100006310
955 Ga0070697_100013207
956 Ga0068853_100030276
957 Ga0068853_100033957
958 Ga0068853_100046059
959 Ga0070672_100061244
960 Ga0070686_100033912
961 Ga0070686_100070019
962 Ga0070686_100192441
963 Ga0070686_100353330
964 Ga0070695_100000241
965 Ga0070696_100001603
966 Ga0070693_100000001
967 Ga0070693_100037193
968 Ga0068855_100005049
969 Ga0068855_100011563
970 Ga0068855_100059758
971 Ga0068855_100124938
972 Ga0068855_100191067
973 Ga0068855_100260624
974 Ga0068855_100713531
975 Ga0070664_100065457
976 Ga0070664_100101165
977 Ga0068857_100002564
978 Ga0068857_100155678
979 Ga0068854_100019445
980 Ga0068854_100026294
981 Ga0068856_100014394
982 Ga0068856_100018361
983 Ga0068856_100050518
984 Ga0068856_100062942
985 Ga0068856_100173720
986 Ga0068852_100009157
987 Ga0068852_100020604
988 Ga0068859_100047633
989 Ga0068859_100153038
990 Ga0068859_100477679
991 Ga0068864_100085594
992 Ga0068864_100137255
993 Ga0068861_100157546
994 Ga0068861_100512098
995 Ga0068851_10022887
996 Ga0068870_10001403
997 Ga0068858_100006301
998 Ga0068858_100031219
999 Ga0068862_100007985
1000 Ga0068862_100022065
1001 Ga0068862_100238359
1002 Ga0081455_10003446
1003 Ga0070717_10006541
1004 Ga0070717_10009078
1005 Ga0070717_10016985
1006 Ga0070717_10018181
1007 Ga0070717_10020707
1008 Ga0070717_10049885
1009 Ga0070717_10071819
1010 Ga0070717_10093447
1011 Ga0070717_10110751
1012 Ga0070717_10198433
1013 Ga0070717_10209519
1014 Ga0075365_10000703
1015 Ga0075363_100039612
1016 Ga0070715_10017110
1017 Ga0070715_10051193
1018 Ga0070716_100001016
1019 Ga0070716_100010992
1020 Ga0070716_100011138
1021 Ga0070716_100207067
1022 Ga0070716_100393913
1023 Ga0070712_100000283
1024 Ga0070712_100031917
1025 Ga0070712_100037660
1026 Ga0070712_100440397
1027 Ga0075369_10009433
1028 Ga0097621_100000636
1029 Ga0097621_100007637
1030 Ga0097621_100207105
1031 Ga0097621_100242139
1032 Ga0097621_100417300
1033 Ga0075370_10131609
1034 Ga0068871_100003144
1035 Ga0068871_100009581
1036 Ga0068871_100048745
1037 Ga0068871_100131569
1038 Ga0068871_100431734
1039 Ga0075428_100001111
1040 Ga0075430_100059190
1041 Ga0075431_100009788
1042 Ga0075431_100013464
1043 Ga0075431_100303384
1044 Ga0075434_100274047
1045 Ga0068865_100169941
1046 Ga0075436_100007096
1047 Ga0075436_100275580
1048 Ga0097620_100047633
1049 Ga0097620_100153046
1050 Ga0097620_100477675
1051 Ga0075435_100029466
1052 Ga0075435_100085881
1053 Ga0075435_100100996
1054 Ga0099794_10012765
1055 Ga0099794_10084771
1056 Ga0105240_10003524
1057 Ga0105240_10040280
1058 Ga0105240_10067711
1059 Ga0105240_10082835
1060 Ga0105240_10088483
1061 Ga0105240_10190509
1062 Ga0105240_10283048
1063 Ga0105240_10329008
1064 Ga0105240_10477773
1065 Ga0111539_10001049
1066 Ga0111539_10561622
1067 Ga0105245_10002615
1068 Ga0105245_10015459
1069 Ga0105245_10088178
1070 Ga0105245_10095813
1071 Ga0105245_10096048
1072 Ga0105247_10006087
1073 Ga0114129_10010346
1074 Ga0114129_10056624
1075 Ga0114129_10157785
1076 Ga0114129_10235570
1077 Ga0114129_10403523
1078 Ga0105243_10060212
1079 Ga0105241_10007751
1080 Ga0105241_10054775
1081 Ga0105241_10102911
1082 Ga0105242_10051708
1083 Ga0105242_10075750
1084 Ga0105248_10067771
1085 Ga0105248_10067870
1086 Ga0105248_10091809
1087 Ga0105248_10099340
1088 Ga0105248_10105475
1089 Ga0105248_10132428
1090 Ga0105248_10220072
1091 Ga0105237_10034990
1092 Ga0105237_10188531
1093 Ga0105237_10465764
1094 Ga0105238_10020563
1095 Ga0105238_10037755
1096 Ga0105249_10013389
1097 Ga0123342_1010346
1098 Ga0105239_10011126
1099 Ga0105239_10043696
1100 Ga0105239_10321878
1101 Ga0105246_10045000
1102 Ga0157373_10007427
1103 Ga0157373_10039563
1104 Ga0157371_10006699
1105 Ga0157370_10020660
1106 Ga0157370_10168838
1107 Ga0157369_10017310
1108 Ga0157369_10053879
1109 Ga0157369_10107252
1110 Ga0157369_10303204
1111 Ga0157374_10011586
1112 Ga0157374_10012444
1113 Ga0157374_10069910
1114 Ga0157374_10082445
1115 Ga0157374_10146847
1116 Ga0157374_10154552
1117 Ga0157374_10208470
1118 Ga0157374_10242422
1119 Ga0157378_10024126
1120 Ga0157378_10091691
1121 Ga0157378_10210096
1122 Ga0163162_10092712
1123 Ga0163162_10131133
1124 Ga0157372_10018667
1125 Ga0157372_10044056
1126 Ga0157372_10053523
1127 Ga0157372_10059662
1128 Ga0157372_10074783
1129 Ga0157372_10199010
1130 Ga0157375_10027706
1131 Ga0157375_10077423
1132 Ga0157375_10142829
1133 Ga0157375_10161700
1134 Ga0163163_10000003
1135 Ga0163163_10000442
1136 Ga0163163_10022494
1137 Ga0163163_10032102
1138 Ga0163163_10072349
1139 Ga0163163_10261269
1140 Ga0182008_10039094
1141 Ga0157377_10003684
1142 Ga0157379_10027492
1143 Ga0157379_10091553
1144 Ga0157376_10005928
1145 Ga0157376_10021679
1146 Ga0157376_10036856
1147 Ga0157376_10095512
1148 Ga0182007_10002588
1149 Ga0182007_10019401
1150 Ga0163161_10004345
1151 Ga0213871_10006971
1152 Ga0228598_1001381
1153 Ga0228598_1004994
1154 Ga0228598_1012969
1155 Ga0207425_1004391
1156 Ga0209129_1001686
1157 Ga0209129_1001949
1158 Ga0209673_1000135
1159 Ga0209673_1006097
1160 Ga0209025_1016800
1161 Ga0209564_1000138
1162 Ga0209564_1011683
1163 Ga0209758_1001640
1164 Ga0209256_1001423
1165 Ga0207426_1004269
1166 Ga0207697_10001953
1167 Ga0207656_10031155
1168 Ga0207653_10000864
1169 Ga0207682_10009574
1170 Ga0207692_10078362
1171 Ga0207692_10142166
1172 Ga0207680_10014593
1173 Ga0207680_10015402
1174 Ga0207680_10190778
1175 Ga0207647_10006231
1176 Ga0207699_10000689
1177 Ga0207699_10028318
1178 Ga0207699_10224945
1179 Ga0207645_10000720
1180 Ga0207643_10000381
1181 Ga0207705_10001399
1182 Ga0207705_10003150
1183 Ga0207684_10000203
1184 Ga0207684_10006734
1185 Ga0207684_10056700
1186 Ga0207654_10097859
1187 Ga0207654_10126145
1188 Ga0207707_10073387
1189 Ga0207695_10079776
1190 Ga0207695_10186106
1191 Ga0207695_10230740
1192 Ga0207671_10000006
1193 Ga0207671_10052653
1194 Ga0207671_10059974
1195 Ga0207671_10185847
1196 Ga0207671_10306593
1197 Ga0207671_10404669
1198 Ga0207693_10000054
1199 Ga0207693_10005606
1200 Ga0207693_10069860
1201 Ga0207693_10078051
1202 Ga0207693_10110535
1203 Ga0207663_10134160
1204 Ga0207660_10084381
1205 Ga0207660_10197520
1206 Ga0207660_10256270
1207 Ga0207662_10013577
1208 Ga0207657_10000246
1209 Ga0207657_10000344
1210 Ga0207649_10004406
1211 Ga0207652_10012959
1212 Ga0207652_10179134
1213 Ga0207652_10228016
1214 Ga0207652_10278176
1215 Ga0207646_10001438
1216 Ga0207694_10005000
1217 Ga0207694_10011132
1218 Ga0207694_10161434
1219 Ga0207694_10196842
1220 Ga0207694_10352530
1221 Ga0207650_10000098
1222 Ga0207687_10001671
1223 Ga0207687_10089760
1224 Ga0207700_10000927
1225 Ga0207700_10001471
1226 Ga0207700_10009225
1227 Ga0207700_10050905
1228 Ga0207700_10116859
1229 Ga0207700_10309168
1230 Ga0207700_10381150
1231 Ga0207664_10034898
1232 Ga0207664_10095843
1233 Ga0207664_10238747
1234 Ga0207664_10432019
1235 Ga0207664_10463040
1236 Ga0207644_10010814
1237 Ga0207690_10019647
1238 Ga0207690_10237864
1239 Ga0207706_10001532
1240 Ga0207706_10018416
1241 Ga0207686_10108340
1242 Ga0207686_10459376
1243 Ga0207670_10006804
1244 Ga0207670_10013827
1245 Ga0207669_10029158
1246 Ga0207704_10043027
1247 Ga0207665_10001266
1248 Ga0207665_10026998
1249 Ga0207665_10076572
1250 Ga0207665_10121928
1251 Ga0207691_10000038
1252 Ga0207691_10060899
1253 Ga0207711_10010790
1254 Ga0207711_10092312
1255 Ga0207711_10100621
1256 Ga0207711_10380271
1257 Ga0207689_10000632
1258 Ga0207689_10003881
1259 Ga0207689_10033321
1260 Ga0207689_10043033
1261 Ga0207661_10002817
1262 Ga0207661_10136543
1263 Ga0207661_10155197
1264 Ga0207661_10232305
1265 Ga0207679_10000078
1266 Ga0207679_10018813
1267 Ga0207679_10166515
1268 Ga0207667_10005939
1269 Ga0207667_10026055
1270 Ga0207667_10201616
1271 Ga0207667_10360371
1272 Ga0207667_10375223
1273 Ga0207651_10011928
1274 Ga0207651_10024197
1275 Ga0207651_10110410
1276 Ga0207712_10084185
1277 Ga0207668_10014150
1278 Ga0207668_10133589
1279 Ga0207640_10069540
1280 Ga0207640_10164201
1281 Ga0207658_10010579
1282 Ga0207658_10025386
1283 Ga0207677_10038875
1284 Ga0207677_10109184
1285 Ga0207677_10172428
1286 Ga0207703_10064742
1287 Ga0207703_10387877
1288 Ga0207639_10005525
1289 Ga0207639_10027905
1290 Ga0207639_10029332
1291 Ga0207678_10000348
1292 Ga0207678_10062434
1293 Ga0207678_10181777
1294 Ga0207702_10143061
1295 Ga0207702_10286407
1296 Ga0207641_10000021
1297 Ga0207641_10040038
1298 Ga0207641_10066356
1299 Ga0207648_10000703
1300 Ga0207648_10014082
1301 Ga0207648_10034905
1302 Ga0207676_10000262
1303 Ga0207676_10179843
1304 Ga0207674_10000386
1305 Ga0207674_10040973
1306 Ga0207674_10176731
1307 Ga0207674_10581240
1308 Ga0207675_100006514
1309 Ga0207675_100269475
1310 Ga0207683_10000045
1311 Ga0207683_10027391
1312 Ga0207683_10111548
1313 Ga0207698_10037698
1314 Ga0209588_1028182
1315 Ga0207428_10039787
1316 Ga0265354_1002157
1317 Ga0268266_10007297
1318 Ga0268266_10045322
1319 Ga0268266_10306086
1320 Ga0268265_10007057
1321 Ga0268265_10089839
1322 Ga0268264_10037698
1323 Ga0265337_1001373
1324 Ga0265319_1006216
1325 Ga0265334_10034209
1326 Ga0265323_10018655
1327 Ga0265323_10018865
1328 Ga0265322_10017956
1329 Ga0265336_10000507
1330 Ga0307515_10000277
1331 Ga0265338_10002794
1332 Ga0265338_10002935
1333 Ga0265338_10004483
1334 Ga0265338_10016778
1335 Ga0265338_10028532
1336 Ga0265338_10041537
1337 Ga0265338_10050628
1338 Ga0265338_10064288
1339 Ga0265338_10169984
1340 Ga0265324_10006000
1341 Ga0265762_1000129
1342 Ga0265770_1001133
1343 Ga0265765_1000923
1344 Ga0265760_10007969
1345 Ga0265328_10007524
1346 Ga0265320_10000443
1347 Ga0265320_10045144
1348 Ga0265325_10071857
1349 Ga0265340_10121060
1350 Ga0265339_10048655
1351 Ga0265316_10007238
1352 Ga0265316_10098812
1353 Ga0307513_10056058
1354 Ga0307513_10097050
1355 Ga0265313_10012488
1356 Ga0265314_10064457
1357 Ga0265342_10014674
1358 Ga0316576_10041742
1359 Ga0316576_10229412
1360 Ga0373926_0001709
1361 Ga0373926_0059066
1362 Ga0373934_0002139
1363 Ga0373934_0069520
1364 Ga0373944_0009873
1365 Ga0373923_0031920
1366 Ga0373936_0005493
1367 Ga0373936_0037604
1368 Ga0373945_0005619
1369 Ga0373945_0011448
1370 Ga0373953_0002457
1371 Ga0373954_0006207
1372 Ga0373954_0045115
1373 Ga0373954_0091029
1374 Ga0373956_0060782
1375 Ga0373956_0087419
1376 Ga0373943_0058937
1377 Ga0373955_0000879
1378 Ga0373955_0139805
1379 Ga0373955_0178406
1380 Ga0373924_0000277
1381 Ga0373924_0081256
1382 Ga0373931_0054160
1383 Ga0373935_0012623
1384 Ga0373935_0025464
1385 Ga0373935_0067926
1386 Ga0373935_0122895
1387 Ga0373935_0180746
1388 Ga0373927_0001563
1389 Ga0373927_0017340
1390 Ga0373927_0022869
1391 Ga0373927_0037625
1392 Ga0373927_0041537
1393 Ga0373927_0059600
1394 Ga0373927_0075354
1395 Ga0373933_0001231
1396 Ga0373933_0014608
1397 Ga0373933_0206523
1398 Ga0373947_0004886
1399 Ga0373947_0011757
1400 Ga0373947_0017321
1401 Ga0373947_0026711
1402 Ga0373947_0027023
1403 Ga0373947_0027754
1404 Ga0373937_0000399
1405 Ga0373937_0000562
1406 Ga0373937_0011271
1407 Ga0373937_0022798
1408 Ga0373937_0046836
1409 Ga0373937_0046887
1410 Ga0373937_0050295
1411 Ga0373937_0251616
1412 Ga0373937_0665406
1413 Ga0373937_0714047
1414 Ga0373925_0008191
1415 Ga0373925_0009252
1416 Ga0373925_0022011
1417 Ga0373925_0025058
1418 Ga0373925_0031656
1419 Ga0373925_0091366
1420 Ga0373925_0213366
1421 Ga0373925_0236469
1422 Ga0373925_0244620
1423 Ga0395905_0010636
1424 Ga0395901_0491192
1425 Ga0436365_0127076
1426 Ga0436360_0226257
1427 Ga0436363_1615544
1428 Ga0451787_735581
1429 Ga0451789_0291302
1430 Ga0451833_0450416
1431 Ga0451839_0046361
1432 Ga0451849_0536283
1433 Ga0439451_029917
1434 Ga0451577_0029041
1435 Ga0453684_0547731
1436 Ga0466968_0177718
1437 Ga0451576_0075180
1438 Ga0451576_0125581
1439 Ga0451576_0345407
1440 Ga0451576_0377881
1441 Ga0451576_0696071
1442 Ga0495592_0108714
1443 Ga0495629_0314836
1444 Ga0495638_0000715
1445 Ga0495638_0011305
1446 Ga0495638_0012384
1447 Ga0495653_0079462
1448 Ga0495580_0004655
1449 Ga0495580_0005446
1450 Ga0495580_0010142
1451 Ga0495580_0018605
1452 Ga0495580_0023134
1453 Ga0495580_0071903
1454 Ga0495580_0088529
1455 Ga0495580_0142458
1456 Ga0495580_0293190
1457 Ga0495580_0353870
1458 Ga0495582_0039307
1459 Ga0495582_0039623
1460 Ga0495582_0094361
1461 Ga0495639_0027637
1462 Ga0495639_0049242
1463 Ga0495662_0117200
1464 Ga0495664_0011235
1465 Ga0495664_0227642
1466 Ga0495585_0003214
1467 Ga0495585_0022498
1468 Ga0495583_0004726
1469 Ga0495608_0104592
1470 Ga0495618_0079166
1471 Ga0495628_0022008
1472 Ga0495630_0000049
1473 Ga0495630_0073008
1474 Ga0495630_0165101
1475 Ga0495666_0027726
1476 Ga0495666_0133010
1477 Ga0495652_0084508
1478 Ga0495652_0145792
1479 Ga0495652_0329658
1480 Ga0495665_0039556
1481 Ga0495665_0085009
1482 Ga0495640_0135727
1483 Ga0495586_0000185
1484 Ga0495586_0003014
1485 Ga0495587_0001610
1486 Ga0495587_0011531
1487 Ga0495645_0048856
1488 Ga0495667_0005219
1489 Ga0495656_0012529
1490 Ga0495668_0043285
1491 Ga0495634_0025259
1492 Ga0495625_0019852
1493 Ga0495635_0121578
1494 Ga0495657_0011006
1495 Ga0495657_0152685
1496 Ga0495599_0007344
1497 Ga0495599_0018343
1498 Ga0495623_0065114
1499 Ga0495646_0143710
1500 Ga0495613_0005499
1501 Ga0495613_0080635
1502 Ga0495600_0020919
1503 Ga0495581_0030614
1504 Ga0495581_0034054
1505 Ga0495581_0150107
1506 Ga0495604_0001432
1507 Ga0495604_0133014
1508 Ga0495674_0000493
1509 Ga0495674_0001188
1510 Ga0495674_0023765
1511 Ga0495674_0025311
1512 Ga0495674_0068769
1513 Ga0495674_0129577
1514 Ga0495674_0227252
1515 Ga0495674_0270630
1516 Ga0495674_0469147
1517 Ga0495672_0019867
1518 Ga0495676_0016796
1519 Ga0495680_0007982
1520 Ga0495680_0057143
1521 Ga0495680_0237479
1522 Ga0495675_0001712
1523 Ga0495675_0049662
1524 Ga0495684_0002933
1525 Ga0495684_0022325
1526 Ga0495684_0063970
1527 Ga0495684_0119922
1528 Ga0495684_0134481
1529 Ga0495684_0297023
1530 Ga0495686_0003077
1531 Ga0495686_0020539
1532 Ga0495602_0001032
1533 Ga0496100_0023628
1534 Ga0496101_0002913
1535 Ga0496101_0057984
1536 Ga0496102_0449979
1537 Ga0496104_0033304
1538 Ga0496104_0041388
1539 Ga0496104_0175278
1540 Ga0496105_0001470
1541 Ga0496105_0014250
1542 Ga0496106_0174854
1543 Ga0496107_0121997
1544 Ga0496107_0122641
1545 Ga0496108_0002036
1546 Ga0496108_0083903
1547 Ga0496109_0000019
1548 Ga0496109_0000457
1549 Ga0496109_0074722
1550 Ga0496110_0002056
1551 Ga0496110_0139210
1552 Ga0496110_0272513
1553 Ga0496110_0500448
1554 Ga0496111_0007259
1555 Ga0496111_0012258
1556 Ga0496111_0015763
1557 Ga0496112_0000348
1558 Ga0496112_0000470
1559 Ga0496112_0009277
1560 Ga0496112_0051680
1561 Ga0496112_0171599
1562 Ga0496113_0000454
1563 Ga0496113_0042063
1564 Ga0496113_0199612
1565 Ga0496114_0000210
1566 Ga0496114_0013981
1567 Ga0496114_0246998
1568 Ga0496115_0025942
1569 Ga0496115_0274239
1570 Ga0496118_0005583
1571 Ga0496121_0215620
1572 Ga0501031_0050703
1573 Ga0501032_0006273
1574 Ga0501033_0002685
1575 Ga0501033_0222612
1576 Ga0501034_0142069
1577 Ga0501036_0067931
1578 Ga0501037_0214257
1579 Ga0501038_0005288
1580 Ga0501038_0052067
1581 Ga0501039_0020344
1582 Ga0501039_0031287
1583 Ga0501040_0003343
1584 Ga0501040_0299484
1585 Ga0501041_0020203
1586 Ga0501042_0311908
1587 Ga0501043_0000825
1588 Ga0501046_0002552
1589 Ga0501046_0039671
1590 Ga0501047_0109990
1591 Ga0501048_0030557
1592 Ga0501068_0002862
1593 Ga0501069_0002761
1594 Ga0501070_0006919
1595 Ga0501071_0047023
1596 Ga0501072_0002347
1597 Ga0501072_0063625
1598 Ga0501072_0147083
1599 Ga0501074_0009107
1600 Ga0501075_0067591
1601 Ga0501076_0021872
1602 Ga0501076_0152440
1603 Ga0501077_0037815
1604 Ga0501077_0207434
1605 Ga0501079_0003870
1606 Ga0501079_0038105
1607 Ga0501080_0091170
1608 Ga0501081_0010992
1609 Ga0501083_0091396
1610 Ga0501035_0001858
1611 Ga0501035_0034493
1612 Ga0501044_0039118
1613 Ga0501045_0007251
1614 nmdc:mga05p37_18432_c1
1615 nmdc:mga05p37_187951_c1
1616 nmdc:mga05p37_252050_c1
1617 nmdc:mga05p37_356512_c1
1618 nmdc:mga05p37_77564_c1
1619 nmdc:mga0qj67_46895_c1
1620 nmdc:mga06r32_44927_c2
1621 nmdc:mga06r32_52436_c1
1622 nmdc:mga06r32_662755_c1
1623 nmdc:mga06r32_72948_c1
1624 nmdc:mga08y16_174463_c1
1625 nmdc:mga08y16_3729_c1
1626 nmdc:mga0n895_632532_c1
1627 nmdc:mga0rr50_2064_c1
1628 nmdc:mga0rr50_241866_c1
1629 nmdc:mga0rr50_26506_c1
1630 nmdc:mga08x19_279259_c1
1631 nmdc:mga08x19_7752_c1
1632 Ga0495601_0004545
1633 Ga0495601_0245176
1634 Ga0495595_0099244
1635 Ga0500555_010345
1636 Ga0500608_027331
1637 Ga0500618_013846
1638 Ga0500568_0003011
1639 Ga0501084_0009514
1640 Ga0501084_0110094
1641 Ga0501082_0012726
1642 Ga0501082_0027687
1643 Ga0530510_0049366
1644 2510838994
1645 2510897307
1646 2511185767
1647 2513634058
1648 2513707426
1649 2513866523
1650 2514022186
1651 2515633925
1652 2515641256
1653 2515659739
1654 2517038619
1655 2517097662
1656 2517409094
1657 2520375810
1658 2530648205
1659 2535514722
1660 2585232424
1661 2585398940
1662 2585818939
1663 2644004565
1664 2644196924
1665 2842219265
1666 2842397694
1667 2923556332
1668 3005410785
1669 3005456518
1670 639646225
1671 8005247753
1672 8005261312
1673 8005322663
1674 8005543392
1675 8005699699
1676 8018181911
1677 8046774293
1678 8057879034

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02678

Pirin

Pirin

56

158

0.94

PF05726

Pirin_C

Pirin C-terminal cupin domain

213

334

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
5jct-assembly1.cif.gz_A crystal structure of human pirin in complex with a chemical probe pyrrolidine 24 0.9065 4 303
4hlt-assembly1.cif.gz_A crystal structure of ferric e32v pirin 0.9027 3 303
7tfq-assembly1.cif.gz_A crystal structure of the pirin family protein redox-sensitive bicupin yhak bound to copper ion from yersinia pestis 0.8993 5 295
6d0g-assembly1.cif.gz_A 1.78 angstrom resolution crystal structure of quercetin 2,3-dioxygenase from acinetobacter baumannii 0.889 8 295
6d0p-assembly4.cif.gz_D 1.88 angstrom resolution crystal structure of quercetin 2,3-dioxygenase from acinetobacter baumannii 0.8881 3 298
ID Description Score Start End Superfamily
af_Q54UY3_11_140_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9463 10 138 2.60.120.10
af_C0P2Q1_61_325_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9459 13 297 2.60.120.10
af_Q557H8_87_213_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9414 17 143 2.60.120.10
af_I1KYF4_44_139_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9378 35 135 2.60.120.10
af_Q557H8_87_213_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9343 17 143 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A6P0DVR8-F1-model_v4 Pirin family protein 0.9953 69 207
AF-A0A2V9MJW3-F1-model_v4 Pirin N-terminal domain-containing protein 0.9939 1 195 GO:0046872
AF-A0A4Q3GWX5-F1-model_v4 Pirin family protein 0.9918 1 168 GO:0046872
AF-A0A5C7TYR7-F1-model_v4 deleted 0.9888 1 161
AF-A0A521A0J8-F1-model_v4 Pirin family protein 0.9881 4 146

Map