F483007
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 839 | 374 | 839 | 106 |
Family's Representative Sequence
| Representative Sequence | 3300005341|Ga0070691_10580119|Ga0070691_105801191 |
| Length | 104 |
| Sequence | MYAVIKTGGKQYKVASGDVILVEKIEGDAGASITLAEVLMIGDGANITVGAPTVKGSSVAAEVVDQVKADKVIIFKKNRRHNYRRKNGHRQKLTELKITGISAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 6 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 7 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 8 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 9 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 10 | 3300003308 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 11 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 12 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 13 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 14 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 15 | 3300004785 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 16 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 17 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 18 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 19 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 20 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 21 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 27 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 31 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 44 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 61 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 62 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 67 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 68 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 70 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 72 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 78 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 80 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 81 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 82 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 84 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 85 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 86 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 87 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 88 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 89 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 90 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 91 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 92 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 93 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 94 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 95 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 96 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 98 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 99 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 100 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 102 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 103 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 104 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 105 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 106 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 107 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 108 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 109 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 110 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 112 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300012490 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 | Metagenome | Rhizosphere |
| 130 | 3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Metagenome | Rhizosphere |
| 131 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 132 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 133 | 3300013043 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 134 | 3300013044 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 135 | 3300013045 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 136 | 3300013052 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 137 | 3300013059 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 138 | 3300013062 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 139 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 151 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 155 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 156 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 158 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 159 | 3300020071 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 160 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 161 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 162 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 163 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 164 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 165 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 166 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 167 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 168 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 169 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 170 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 233 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 237 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 238 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 239 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 240 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 241 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 242 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 243 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 244 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 245 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 246 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 247 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 248 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 249 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 250 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 251 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 252 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 253 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 254 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 255 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 256 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 257 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 258 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 259 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 260 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 261 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 262 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 263 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 264 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 265 | 3300042118 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 | Metagenome | Rhizosphere |
| 266 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 267 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 268 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 269 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 270 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 271 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 272 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 273 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 274 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 275 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 276 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 277 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 278 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 279 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 280 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 281 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 282 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 283 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 284 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 293 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 294 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 295 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 296 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 297 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 298 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 299 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 300 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 301 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 302 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 303 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 304 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 305 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 306 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 307 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 308 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 309 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 310 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 311 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 312 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 313 | 3300049552 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 314 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 315 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 317 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 319 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 330 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 331 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 333 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 334 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 335 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 336 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 337 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 338 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 339 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 340 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 341 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 343 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 344 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 345 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 346 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 347 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 348 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 349 | 3300059509 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 350 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 351 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 352 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 353 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 354 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 355 | 3300059607 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 356 | 3300059625 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 357 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 358 | 3300059627 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 359 | 3300059628 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 360 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 361 | 3300059631 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 362 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 363 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 364 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 365 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 366 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 367 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 368 | 3300059650 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 69R_SD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 369 | 3300059654 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 370 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 371 | 3300059659 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 157R_AD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 372 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 373 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 374 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 82.72 |
| Metatranscriptomes | 17.28 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.12 |
| Nodule | 0 |
| Rhizoplane | 6.2 |
| Rhizosphere | 91.18 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.5 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24741J21665_1025334 | 3300001915 | Bacteria | 907 |
| 2 | JGI24740J21852_10102749 | 3300001979 | Bacteria | 726 |
| 3 | JGI24739J22299_10239451 | 3300001989 | Bacteria | 531 |
| 4 | JGI24737J22298_10067221 | 3300001990 | Bacteria | 1073 |
| 5 | JGI24737J22298_10266325 | 3300001990 | Bacteria | 507 |
| 6 | JGI24743J22301_10010175 | 3300001991 | Bacteria | 1675 |
| 7 | JGI24743J22301_10143490 | 3300001991 | Bacteria | 532 |
| 8 | JGI24735J21928_10088130 | 3300002067 | Bacteria | 889 |
| 9 | JGI24735J21928_10094505 | 3300002067 | Bacteria | 858 |
| 10 | JGI24735J21928_10099704 | 3300002067 | Bacteria | 834 |
| 11 | JGI24735J21928_10150729 | 3300002067 | Bacteria | 671 |
| 12 | JGI24735J21928_10179578 | 3300002067 | Bacteria | 613 |
| 13 | JGI24738J21930_10036034 | 3300002075 | Bacteria | 1007 |
| 14 | JGI24033J26618_1016950 | 3300002155 | Bacteria | 909 |
| 15 | JGI24751J29686_10008749 | 3300002459 | Bacteria | 2075 |
| 16 | Ga0006777J48905_1069915 | 3300003308 | Bacteria | 749 |
| 17 | Ga0007409J51694_1061986 | 3300003575 | Bacteria | 657 |
| 18 | Ga0007409J51694_1108460 | 3300003575 | Bacteria | 683 |
| 19 | Ga0007429J51699_1018112 | 3300003579 | Bacteria | 728 |
| 20 | JGI25404J52841_10125115 | 3300003659 | Bacteria | 542 |
| 21 | Ga0032354_1058136 | 3300003693 | Bacteria | 636 |
| 22 | Ga0058858_1228152 | 3300004785 | Bacteria | 761 |
| 23 | Ga0058859_11241572 | 3300004798 | Bacteria | 678 |
| 24 | Ga0058859_11702261 | 3300004798 | Bacteria | 510 |
| 25 | Ga0058863_10038017 | 3300004799 | Bacteria | 583 |
| 26 | Ga0058863_10049759 | 3300004799 | Bacteria | 627 |
| 27 | Ga0058863_11784877 | 3300004799 | Bacteria | 898 |
| 28 | Ga0058863_11912344 | 3300004799 | Bacteria | 590 |
| 29 | Ga0058861_10170916 | 3300004800 | Bacteria | 602 |
| 30 | Ga0058860_10051072 | 3300004801 | Bacteria | 741 |
| 31 | Ga0058860_11926006 | 3300004801 | Bacteria | 535 |
| 32 | Ga0058860_12151711 | 3300004801 | Bacteria | 837 |
| 33 | Ga0058862_10038154 | 3300004803 | Bacteria | 881 |
| 34 | Ga0058862_10059979 | 3300004803 | Bacteria | 587 |
| 35 | Ga0070658_10002776 | 3300005327 | Bacteria | 14551 |
| 36 | Ga0070658_10017448 | 3300005327 | Bacteria | 5744 |
| 37 | Ga0070658_10236294 | 3300005327 | Bacteria | 1548 |
| 38 | Ga0070658_10994130 | 3300005327 | Bacteria | 730 |
| 39 | Ga0070676_10061366 | 3300005328 | Bacteria | 2235 |
| 40 | Ga0070683_100249062 | 3300005329 | Bacteria | 1690 |
| 41 | Ga0070683_100477399 | 3300005329 | Bacteria | 1190 |
| 42 | Ga0070683_101413057 | 3300005329 | Bacteria | 669 |
| 43 | Ga0070690_100311378 | 3300005330 | Bacteria | 1132 |
| 44 | Ga0070677_10604200 | 3300005333 | Bacteria | 608 |
| 45 | Ga0068869_100014640 | 3300005334 | Bacteria | 5244 |
| 46 | Ga0068869_100115301 | 3300005334 | Bacteria | 2048 |
| 47 | Ga0070666_10239457 | 3300005335 | Bacteria | 1283 |
| 48 | Ga0070680_100000403 | 3300005336 | Bacteria | 29539 |
| 49 | Ga0070680_100102565 | 3300005336 | Bacteria | 2376 |
| 50 | Ga0070682_100009318 | 3300005337 | Bacteria | 5558 |
| 51 | Ga0070682_100250965 | 3300005337 | Bacteria | 1275 |
| 52 | Ga0070682_100570786 | 3300005337 | Bacteria | 888 |
| 53 | Ga0070682_100779688 | 3300005337 | Bacteria | 775 |
| 54 | Ga0070682_101669639 | 3300005337 | Bacteria | 553 |
| 55 | Ga0068868_100010973 | 3300005338 | Bacteria | 6581 |
| 56 | Ga0068868_100336562 | 3300005338 | Bacteria | 1289 |
| 57 | Ga0070660_100042679 | 3300005339 | Bacteria | 3463 |
| 58 | Ga0070660_100415482 | 3300005339 | Bacteria | 1113 |
| 59 | Ga0070660_101093654 | 3300005339 | Bacteria | 675 |
| 60 | Ga0070689_100037765 | 3300005340 | Bacteria | 3694 |
| 61 | Ga0070689_100379023 | 3300005340 | Bacteria | 1192 |
| 62 | Ga0070691_10002288 | 3300005341 | Bacteria | 8483 |
| 63 | Ga0070691_10347568 | 3300005341 | Bacteria | 822 |
| 64 | Ga0070691_10580119 | 3300005341 | Bacteria | 659 |
| 65 | Ga0070687_100394995 | 3300005343 | Bacteria | 905 |
| 66 | Ga0070661_100067572 | 3300005344 | Bacteria | 2627 |
| 67 | Ga0070661_100476130 | 3300005344 | Bacteria | 996 |
| 68 | Ga0070661_101184025 | 3300005344 | Bacteria | 639 |
| 69 | Ga0070692_10001141 | 3300005345 | Bacteria | 9321 |
| 70 | Ga0070692_10367576 | 3300005345 | Bacteria | 898 |
| 71 | Ga0070668_100440273 | 3300005347 | Bacteria | 1119 |
| 72 | Ga0070669_100136030 | 3300005353 | Bacteria | 1890 |
| 73 | Ga0070669_100592761 | 3300005353 | Bacteria | 928 |
| 74 | Ga0070675_100190937 | 3300005354 | Bacteria | 1775 |
| 75 | Ga0070675_100426515 | 3300005354 | Bacteria | 1186 |
| 76 | Ga0070671_100022196 | 3300005355 | Bacteria | 5185 |
| 77 | Ga0070671_100066003 | 3300005355 | Bacteria | 3015 |
| 78 | Ga0070674_100243236 | 3300005356 | Bacteria | 1410 |
| 79 | Ga0070674_101087106 | 3300005356 | Bacteria | 706 |
| 80 | Ga0070673_100045389 | 3300005364 | Bacteria | 3408 |
| 81 | Ga0070673_101692251 | 3300005364 | Bacteria | 598 |
| 82 | Ga0070688_100124063 | 3300005365 | Bacteria | 1734 |
| 83 | Ga0070659_100073970 | 3300005366 | Bacteria | 2713 |
| 84 | Ga0070659_101297416 | 3300005366 | Bacteria | 645 |
| 85 | Ga0070667_100181210 | 3300005367 | Bacteria | 1863 |
| 86 | Ga0070703_10020264 | 3300005406 | Bacteria | 1934 |
| 87 | Ga0070709_10082413 | 3300005434 | Bacteria | 2101 |
| 88 | Ga0070709_10204350 | 3300005434 | Bacteria | 1401 |
| 89 | Ga0070714_100039499 | 3300005435 | Bacteria | 3974 |
| 90 | Ga0070714_100196267 | 3300005435 | Bacteria | 1844 |
| 91 | Ga0070714_100702659 | 3300005435 | Bacteria | 976 |
| 92 | Ga0070714_100759449 | 3300005435 | Bacteria | 938 |
| 93 | Ga0070713_100003681 | 3300005436 | Bacteria | 10146 |
| 94 | Ga0070713_100063954 | 3300005436 | Bacteria | 3086 |
| 95 | Ga0070713_100193100 | 3300005436 | Bacteria | 1836 |
| 96 | Ga0070710_10087279 | 3300005437 | Bacteria | 1833 |
| 97 | Ga0070701_11063369 | 3300005438 | Bacteria | 568 |
| 98 | Ga0070711_100063662 | 3300005439 | Bacteria | 2575 |
| 99 | Ga0070711_100467443 | 3300005439 | Bacteria | 1035 |
| 100 | Ga0070705_100779847 | 3300005440 | Bacteria | 758 |
| 101 | Ga0070700_100015218 | 3300005441 | Bacteria | 4359 |
| 102 | Ga0070694_100451973 | 3300005444 | Bacteria | 1014 |
| 103 | Ga0070708_101382832 | 3300005445 | Bacteria | 657 |
| 104 | Ga0070708_101856206 | 3300005445 | Bacteria | 559 |
| 105 | Ga0070663_100022899 | 3300005455 | Bacteria | 4181 |
| 106 | Ga0070663_100255275 | 3300005455 | Bacteria | 1389 |
| 107 | Ga0070663_100476598 | 3300005455 | Bacteria | 1032 |
| 108 | Ga0070678_100036827 | 3300005456 | Bacteria | 3428 |
| 109 | Ga0070678_100047642 | 3300005456 | Bacteria | 3081 |
| 110 | Ga0070662_100473929 | 3300005457 | Bacteria | 1041 |
| 111 | Ga0070662_100807909 | 3300005457 | Bacteria | 797 |
| 112 | Ga0070662_101544972 | 3300005457 | Bacteria | 573 |
| 113 | Ga0070681_10032811 | 3300005458 | Bacteria | 5213 |
| 114 | Ga0070681_10066114 | 3300005458 | Bacteria | 3584 |
| 115 | Ga0070681_11138170 | 3300005458 | Bacteria | 702 |
| 116 | Ga0068867_102103651 | 3300005459 | Bacteria | 535 |
| 117 | Ga0068867_102351593 | 3300005459 | Bacteria | 507 |
| 118 | Ga0070685_10047048 | 3300005466 | Bacteria | 2479 |
| 119 | Ga0070706_100304029 | 3300005467 | Bacteria | 1488 |
| 120 | Ga0070707_100467645 | 3300005468 | Bacteria | 1222 |
| 121 | Ga0070699_100596772 | 3300005518 | Bacteria | 1007 |
| 122 | Ga0070679_100000591 | 3300005530 | Bacteria | 30747 |
| 123 | Ga0070679_100189316 | 3300005530 | Bacteria | 2027 |
| 124 | Ga0070679_100669321 | 3300005530 | Bacteria | 981 |
| 125 | Ga0070679_100974609 | 3300005530 | Bacteria | 792 |
| 126 | Ga0070684_100357105 | 3300005535 | Bacteria | 1345 |
| 127 | Ga0070684_102323874 | 3300005535 | Bacteria | 505 |
| 128 | Ga0070697_100121856 | 3300005536 | Bacteria | 2182 |
| 129 | Ga0068853_100052946 | 3300005539 | Bacteria | 3495 |
| 130 | Ga0068853_100063236 | 3300005539 | Bacteria | 3205 |
| 131 | Ga0068853_102408943 | 3300005539 | Bacteria | 510 |
| 132 | Ga0070672_100116896 | 3300005543 | Bacteria | 2179 |
| 133 | Ga0070672_100908966 | 3300005543 | Bacteria | 778 |
| 134 | Ga0070686_100147763 | 3300005544 | Bacteria | 1643 |
| 135 | Ga0070686_100501870 | 3300005544 | Bacteria | 941 |
| 136 | Ga0070695_100147064 | 3300005545 | Bacteria | 1640 |
| 137 | Ga0070696_100044500 | 3300005546 | Bacteria | 3073 |
| 138 | Ga0070693_100045268 | 3300005547 | Bacteria | 2493 |
| 139 | Ga0070693_100209279 | 3300005547 | Bacteria | 1272 |
| 140 | Ga0070665_100055530 | 3300005548 | Bacteria | 3971 |
| 141 | Ga0070665_100282904 | 3300005548 | Bacteria | 1660 |
| 142 | Ga0070704_100119640 | 3300005549 | Bacteria | 2020 |
| 143 | Ga0068855_100056300 | 3300005563 | Bacteria | 4615 |
| 144 | Ga0068855_100061160 | 3300005563 | Bacteria | 4401 |
| 145 | Ga0068855_100101198 | 3300005563 | Bacteria | 3317 |
| 146 | Ga0068855_100785786 | 3300005563 | Bacteria | 1013 |
| 147 | Ga0068855_101946628 | 3300005563 | Bacteria | 595 |
| 148 | Ga0070664_100683268 | 3300005564 | Bacteria | 955 |
| 149 | Ga0068857_101079557 | 3300005577 | Bacteria | 775 |
| 150 | Ga0068854_100102323 | 3300005578 | Bacteria | 2149 |
| 151 | Ga0068854_100190576 | 3300005578 | Bacteria | 1606 |
| 152 | Ga0068856_100520717 | 3300005614 | Bacteria | 1210 |
| 153 | Ga0068856_100683982 | 3300005614 | Bacteria | 1046 |
| 154 | Ga0068856_101083455 | 3300005614 | Bacteria | 819 |
| 155 | Ga0070702_100000310 | 3300005615 | Bacteria | 16830 |
| 156 | Ga0070702_100025843 | 3300005615 | Bacteria | 3150 |
| 157 | Ga0068852_100007126 | 3300005616 | Bacteria | 8147 |
| 158 | Ga0068852_100058031 | 3300005616 | Bacteria | 3350 |
| 159 | Ga0068852_100581584 | 3300005616 | Bacteria | 1123 |
| 160 | Ga0068852_101197733 | 3300005616 | Bacteria | 780 |
| 161 | Ga0068859_100009699 | 3300005617 | Bacteria | 9721 |
| 162 | Ga0068859_100216754 | 3300005617 | Bacteria | 2002 |
| 163 | Ga0068859_100278093 | 3300005617 | Bacteria | 1766 |
| 164 | Ga0068864_100148152 | 3300005618 | Bacteria | 2123 |
| 165 | Ga0068864_101321867 | 3300005618 | Bacteria | 721 |
| 166 | Ga0068866_10424985 | 3300005718 | Bacteria | 863 |
| 167 | Ga0068861_100009878 | 3300005719 | Bacteria | 6602 |
| 168 | Ga0068851_10093763 | 3300005834 | Bacteria | 1585 |
| 169 | Ga0068851_10141320 | 3300005834 | Bacteria | 1309 |
| 170 | Ga0068870_10031322 | 3300005840 | Bacteria | 2694 |
| 171 | Ga0068870_10096807 | 3300005840 | Bacteria | 1660 |
| 172 | Ga0068863_100056137 | 3300005841 | Bacteria | 3728 |
| 173 | Ga0068858_100061566 | 3300005842 | Bacteria | 3470 |
| 174 | Ga0068860_100086873 | 3300005843 | Bacteria | 2977 |
| 175 | Ga0068860_100447135 | 3300005843 | Bacteria | 1285 |
| 176 | Ga0068862_101137353 | 3300005844 | Bacteria | 777 |
| 177 | Ga0081455_10003134 | 3300005937 | Bacteria | 19237 |
| 178 | Ga0081455_10226092 | 3300005937 | Bacteria | 1384 |
| 179 | Ga0081455_10438380 | 3300005937 | Bacteria | 896 |
| 180 | Ga0081455_10540138 | 3300005937 | Bacteria | 773 |
| 181 | Ga0081540_1057314 | 3300005983 | Bacteria | 1885 |
| 182 | Ga0081540_1124755 | 3300005983 | Bacteria | 1062 |
| 183 | Ga0070717_10109999 | 3300006028 | Bacteria | 2349 |
| 184 | Ga0070717_10127752 | 3300006028 | Bacteria | 2184 |
| 185 | Ga0075432_10078396 | 3300006058 | Bacteria | 1195 |
| 186 | Ga0075432_10576757 | 3300006058 | Bacteria | 511 |
| 187 | Ga0070716_101004882 | 3300006173 | Bacteria | 660 |
| 188 | Ga0070716_101602155 | 3300006173 | Bacteria | 535 |
| 189 | Ga0070712_100771338 | 3300006175 | Bacteria | 824 |
| 190 | Ga0070712_100999870 | 3300006175 | Bacteria | 724 |
| 191 | Ga0070712_101084186 | 3300006175 | Bacteria | 695 |
| 192 | Ga0070712_101652683 | 3300006175 | Bacteria | 560 |
| 193 | Ga0070712_101652685 | 3300006175 | Bacteria | 560 |
| 194 | Ga0097621_100256560 | 3300006237 | Bacteria | 1533 |
| 195 | Ga0068871_100618252 | 3300006358 | Bacteria | 986 |
| 196 | Ga0075428_100709312 | 3300006844 | Bacteria | 1072 |
| 197 | Ga0075428_100987396 | 3300006844 | Bacteria | 892 |
| 198 | Ga0075428_101126428 | 3300006844 | Bacteria | 828 |
| 199 | Ga0075430_100828232 | 3300006846 | Bacteria | 763 |
| 200 | Ga0075431_100111461 | 3300006847 | Bacteria | 2824 |
| 201 | Ga0075431_100165218 | 3300006847 | Bacteria | 2275 |
| 202 | Ga0075431_100272814 | 3300006847 | Bacteria | 1714 |
| 203 | Ga0075433_10023324 | 3300006852 | Bacteria | 5207 |
| 204 | Ga0075433_10038514 | 3300006852 | Bacteria | 4129 |
| 205 | Ga0075434_100020783 | 3300006871 | Bacteria | 6372 |
| 206 | Ga0075434_100773784 | 3300006871 | Bacteria | 976 |
| 207 | Ga0075429_100069055 | 3300006880 | Bacteria | 3076 |
| 208 | Ga0075429_100160507 | 3300006880 | Bacteria | 1969 |
| 209 | Ga0075429_100333478 | 3300006880 | Bacteria | 1328 |
| 210 | Ga0068865_100115964 | 3300006881 | Bacteria | 1983 |
| 211 | Ga0075436_100037931 | 3300006914 | Bacteria | 3326 |
| 212 | Ga0075436_100175281 | 3300006914 | Bacteria | 1514 |
| 213 | Ga0097620_100009699 | 3300006931 | Bacteria | 9721 |
| 214 | Ga0097620_100216736 | 3300006931 | Bacteria | 2002 |
| 215 | Ga0097620_100278078 | 3300006931 | Bacteria | 1766 |
| 216 | Ga0075435_100067286 | 3300007076 | Bacteria | 2916 |
| 217 | Ga0075435_100083231 | 3300007076 | Bacteria | 2630 |
| 218 | Ga0105251_10087257 | 3300009011 | Bacteria | 1436 |
| 219 | Ga0105244_10218282 | 3300009036 | Bacteria | 895 |
| 220 | Ga0105250_10389224 | 3300009092 | Bacteria | 616 |
| 221 | Ga0105240_10099855 | 3300009093 | Bacteria | 3532 |
| 222 | Ga0105240_10509793 | 3300009093 | Bacteria | 1336 |
| 223 | Ga0105240_11068288 | 3300009093 | Bacteria | 860 |
| 224 | Ga0111539_10042854 | 3300009094 | Bacteria | 5430 |
| 225 | Ga0111539_10070023 | 3300009094 | Bacteria | 4141 |
| 226 | Ga0105245_10003794 | 3300009098 | Bacteria | 13443 |
| 227 | Ga0105245_10173032 | 3300009098 | Bacteria | 2057 |
| 228 | Ga0105245_10312756 | 3300009098 | Bacteria | 1545 |
| 229 | Ga0105245_10685755 | 3300009098 | Bacteria | 1057 |
| 230 | Ga0105247_10003047 | 3300009101 | Bacteria | 11095 |
| 231 | Ga0105247_10052180 | 3300009101 | Bacteria | 2521 |
| 232 | Ga0105247_10103075 | 3300009101 | Bacteria | 1827 |
| 233 | Ga0114129_10335614 | 3300009147 | Bacteria | 2006 |
| 234 | Ga0114129_10408251 | 3300009147 | Bacteria | 1789 |
| 235 | Ga0105243_10100987 | 3300009148 | Bacteria | 2395 |
| 236 | Ga0105243_10991808 | 3300009148 | Bacteria | 842 |
| 237 | Ga0105243_11848405 | 3300009148 | Bacteria | 636 |
| 238 | Ga0105241_10051781 | 3300009174 | Bacteria | 3132 |
| 239 | Ga0105241_10101976 | 3300009174 | Bacteria | 2283 |
| 240 | Ga0105241_10140534 | 3300009174 | Bacteria | 1965 |
| 241 | Ga0105241_10320648 | 3300009174 | Bacteria | 1336 |
| 242 | Ga0105242_10295740 | 3300009176 | Bacteria | 1476 |
| 243 | Ga0105248_10202161 | 3300009177 | Bacteria | 2238 |
| 244 | Ga0105248_10369887 | 3300009177 | Bacteria | 1614 |
| 245 | Ga0105237_10108611 | 3300009545 | Bacteria | 2766 |
| 246 | Ga0105237_10210685 | 3300009545 | Bacteria | 1943 |
| 247 | Ga0105237_10211380 | 3300009545 | Bacteria | 1940 |
| 248 | Ga0105237_10776254 | 3300009545 | Bacteria | 965 |
| 249 | Ga0105237_11267190 | 3300009545 | Bacteria | 744 |
| 250 | Ga0105237_11589177 | 3300009545 | Bacteria | 661 |
| 251 | Ga0105237_11731426 | 3300009545 | Bacteria | 632 |
| 252 | Ga0105238_10141262 | 3300009551 | Bacteria | 2385 |
| 253 | Ga0105238_10268938 | 3300009551 | Bacteria | 1685 |
| 254 | Ga0105238_10316290 | 3300009551 | Bacteria | 1547 |
| 255 | Ga0105249_10003351 | 3300009553 | Bacteria | 13865 |
| 256 | Ga0105249_10371869 | 3300009553 | Bacteria | 1453 |
| 257 | Ga0105239_10219946 | 3300010375 | Bacteria | 2130 |
| 258 | Ga0105239_10254149 | 3300010375 | Bacteria | 1974 |
| 259 | Ga0105239_10262054 | 3300010375 | Bacteria | 1943 |
| 260 | Ga0105239_10738216 | 3300010375 | Bacteria | 1127 |
| 261 | Ga0105239_10888391 | 3300010375 | Bacteria | 1023 |
| 262 | Ga0105246_10092415 | 3300011119 | Bacteria | 2183 |
| 263 | Ga0105246_11680503 | 3300011119 | Bacteria | 603 |
| 264 | Ga0157322_1017566 | 3300012490 | Bacteria | 658 |
| 265 | Ga0157339_1007253 | 3300012505 | Bacteria | 926 |
| 266 | Ga0157327_1051457 | 3300012512 | Bacteria | 587 |
| 267 | Ga0157338_1025808 | 3300012515 | Bacteria | 717 |
| 268 | Ga0154018_106035 | 3300013043 | Bacteria | 615 |
| 269 | Ga0154019_132188 | 3300013044 | Bacteria | 679 |
| 270 | Ga0154016_126325 | 3300013045 | Bacteria | 656 |
| 271 | Ga0154016_141312 | 3300013045 | Bacteria | 624 |
| 272 | Ga0154014_115819 | 3300013052 | Bacteria | 632 |
| 273 | Ga0154012_121067 | 3300013059 | Bacteria | 732 |
| 274 | Ga0154012_145613 | 3300013059 | Bacteria | 500 |
| 275 | Ga0154010_133995 | 3300013062 | Bacteria | 552 |
| 276 | Ga0154010_163592 | 3300013062 | Bacteria | 636 |
| 277 | Ga0157373_10064774 | 3300013100 | Bacteria | 2587 |
| 278 | Ga0157373_10102351 | 3300013100 | Bacteria | 2015 |
| 279 | Ga0157371_10087013 | 3300013102 | Bacteria | 2213 |
| 280 | Ga0157371_10181287 | 3300013102 | Bacteria | 1506 |
| 281 | Ga0157370_10032625 | 3300013104 | Bacteria | 5084 |
| 282 | Ga0157370_10243087 | 3300013104 | Bacteria | 1665 |
| 283 | Ga0157369_10138299 | 3300013105 | Bacteria | 2578 |
| 284 | Ga0157369_10335593 | 3300013105 | Bacteria | 1570 |
| 285 | Ga0157369_10421418 | 3300013105 | Bacteria | 1384 |
| 286 | Ga0157369_10751155 | 3300013105 | Bacteria | 1003 |
| 287 | Ga0157369_11113801 | 3300013105 | Bacteria | 807 |
| 288 | Ga0157369_11556107 | 3300013105 | Bacteria | 672 |
| 289 | Ga0157374_10013476 | 3300013296 | Bacteria | 7134 |
| 290 | Ga0157374_10085138 | 3300013296 | Bacteria | 3005 |
| 291 | Ga0157374_10903969 | 3300013296 | Bacteria | 900 |
| 292 | Ga0157378_10107645 | 3300013297 | Bacteria | 2551 |
| 293 | Ga0157378_10203628 | 3300013297 | Bacteria | 1873 |
| 294 | Ga0163162_10010190 | 3300013306 | Bacteria | 9129 |
| 295 | Ga0163162_11808158 | 3300013306 | Bacteria | 699 |
| 296 | Ga0157372_10033763 | 3300013307 | Bacteria | 5622 |
| 297 | Ga0157372_11878948 | 3300013307 | Bacteria | 688 |
| 298 | Ga0157375_10320460 | 3300013308 | Bacteria | 1715 |
| 299 | Ga0157375_10422338 | 3300013308 | Bacteria | 1499 |
| 300 | Ga0163163_10075082 | 3300014325 | Bacteria | 3374 |
| 301 | Ga0163163_10213130 | 3300014325 | Bacteria | 1980 |
| 302 | Ga0157380_10027310 | 3300014326 | Bacteria | 4340 |
| 303 | Ga0182008_10423769 | 3300014497 | Bacteria | 719 |
| 304 | Ga0157377_10116951 | 3300014745 | Bacteria | 1611 |
| 305 | Ga0157377_10132403 | 3300014745 | Bacteria | 1525 |
| 306 | Ga0157379_10017319 | 3300014968 | Bacteria | 6349 |
| 307 | Ga0157379_10034232 | 3300014968 | Bacteria | 4528 |
| 308 | Ga0157379_11640908 | 3300014968 | Bacteria | 628 |
| 309 | Ga0157376_10365935 | 3300014969 | Bacteria | 1384 |
| 310 | Ga0157376_10574614 | 3300014969 | Bacteria | 1119 |
| 311 | Ga0157376_10686039 | 3300014969 | Bacteria | 1028 |
| 312 | Ga0182007_10225604 | 3300015262 | Bacteria | 663 |
| 313 | Ga0182005_1143526 | 3300015265 | Bacteria | 691 |
| 314 | Ga0163161_10062232 | 3300017792 | Bacteria | 2718 |
| 315 | Ga0197907_10136472 | 3300020069 | Bacteria | 884 |
| 316 | Ga0197907_10165799 | 3300020069 | Bacteria | 618 |
| 317 | Ga0197907_10417371 | 3300020069 | Bacteria | 531 |
| 318 | Ga0197907_10655106 | 3300020069 | Bacteria | 515 |
| 319 | Ga0197907_10665716 | 3300020069 | Bacteria | 817 |
| 320 | Ga0197907_10813524 | 3300020069 | Bacteria | 593 |
| 321 | Ga0197907_10890214 | 3300020069 | Bacteria | 1979 |
| 322 | Ga0197907_11011918 | 3300020069 | Bacteria | 706 |
| 323 | Ga0197907_11236551 | 3300020069 | Bacteria | 817 |
| 324 | Ga0197907_11425260 | 3300020069 | Bacteria | 621 |
| 325 | Ga0197907_11425484 | 3300020069 | Bacteria | 725 |
| 326 | Ga0206356_10461214 | 3300020070 | Bacteria | 767 |
| 327 | Ga0206356_11192521 | 3300020070 | Bacteria | 631 |
| 328 | Ga0206356_11542350 | 3300020070 | Bacteria | 4382 |
| 329 | Ga0206348_118668 | 3300020071 | Bacteria | 677 |
| 330 | Ga0206349_1039003 | 3300020075 | Bacteria | 1243 |
| 331 | Ga0206349_1572799 | 3300020075 | Bacteria | 748 |
| 332 | Ga0206349_1745300 | 3300020075 | Bacteria | 648 |
| 333 | Ga0206355_1029950 | 3300020076 | Bacteria | 761 |
| 334 | Ga0206355_1282491 | 3300020076 | Bacteria | 692 |
| 335 | Ga0206355_1285473 | 3300020076 | Bacteria | 705 |
| 336 | Ga0206355_1437175 | 3300020076 | Bacteria | 859 |
| 337 | Ga0206355_1468932 | 3300020076 | Bacteria | 697 |
| 338 | Ga0206355_1470679 | 3300020076 | Bacteria | 1051 |
| 339 | Ga0206355_1565251 | 3300020076 | Bacteria | 817 |
| 340 | Ga0206351_10129930 | 3300020077 | Bacteria | 592 |
| 341 | Ga0206351_10138064 | 3300020077 | Bacteria | 710 |
| 342 | Ga0206351_10165192 | 3300020077 | Bacteria | 531 |
| 343 | Ga0206351_10317064 | 3300020077 | Bacteria | 536 |
| 344 | Ga0206351_10583506 | 3300020077 | Bacteria | 698 |
| 345 | Ga0206352_10453915 | 3300020078 | Bacteria | 655 |
| 346 | Ga0206352_10583660 | 3300020078 | Bacteria | 630 |
| 347 | Ga0206352_10782919 | 3300020078 | Bacteria | 1378 |
| 348 | Ga0206352_10998634 | 3300020078 | Bacteria | 843 |
| 349 | Ga0206352_11289899 | 3300020078 | Bacteria | 503 |
| 350 | Ga0206350_10267178 | 3300020080 | Bacteria | 1181 |
| 351 | Ga0206350_10587062 | 3300020080 | Bacteria | 696 |
| 352 | Ga0206350_10614274 | 3300020080 | Bacteria | 593 |
| 353 | Ga0206350_10973946 | 3300020080 | Bacteria | 944 |
| 354 | Ga0206350_11037591 | 3300020080 | Bacteria | 625 |
| 355 | Ga0206350_11468155 | 3300020080 | Bacteria | 855 |
| 356 | Ga0206354_10328282 | 3300020081 | Bacteria | 752 |
| 357 | Ga0206354_10557356 | 3300020081 | Bacteria | 694 |
| 358 | Ga0206354_10818766 | 3300020081 | Bacteria | 858 |
| 359 | Ga0206354_11011929 | 3300020081 | Bacteria | 652 |
| 360 | Ga0206354_11313140 | 3300020081 | Bacteria | 534 |
| 361 | Ga0206354_11348322 | 3300020081 | Bacteria | 719 |
| 362 | Ga0206354_11366478 | 3300020081 | Bacteria | 842 |
| 363 | Ga0206354_11441011 | 3300020081 | Bacteria | 1554 |
| 364 | Ga0206354_11598942 | 3300020081 | Bacteria | 727 |
| 365 | Ga0206354_11651120 | 3300020081 | Bacteria | 4622 |
| 366 | Ga0206353_10186978 | 3300020082 | Bacteria | 4091 |
| 367 | Ga0206353_10292783 | 3300020082 | Bacteria | 1049 |
| 368 | Ga0206353_10389836 | 3300020082 | Bacteria | 19531 |
| 369 | Ga0206353_11104212 | 3300020082 | Bacteria | 528 |
| 370 | Ga0206353_11945709 | 3300020082 | Bacteria | 519 |
| 371 | Ga0206353_11945828 | 3300020082 | Bacteria | 1627 |
| 372 | Ga0154015_1323326 | 3300020610 | Bacteria | 975 |
| 373 | Ga0154015_1544223 | 3300020610 | Bacteria | 638 |
| 374 | Ga0154015_1599216 | 3300020610 | Bacteria | 1061 |
| 375 | Ga0213876_10179411 | 3300021384 | Bacteria | 1126 |
| 376 | Ga0213876_10448867 | 3300021384 | Bacteria | 686 |
| 377 | Ga0224712_10057189 | 3300022467 | Bacteria | 1540 |
| 378 | Ga0224712_10099262 | 3300022467 | Bacteria | 1232 |
| 379 | Ga0224712_10165193 | 3300022467 | Bacteria | 990 |
| 380 | Ga0224712_10165348 | 3300022467 | Bacteria | 989 |
| 381 | Ga0224712_10333902 | 3300022467 | Bacteria | 714 |
| 382 | Ga0224712_10352643 | 3300022467 | Bacteria | 695 |
| 383 | Ga0224712_10404852 | 3300022467 | Bacteria | 651 |
| 384 | Ga0224712_10560017 | 3300022467 | Bacteria | 556 |
| 385 | Ga0224712_10592967 | 3300022467 | Bacteria | 541 |
| 386 | Ga0207656_10165259 | 3300025321 | Bacteria | 1055 |
| 387 | Ga0207713_1045258 | 3300025735 | Bacteria | 1799 |
| 388 | Ga0207713_1099531 | 3300025735 | Bacteria | 1006 |
| 389 | Ga0207692_10028262 | 3300025898 | Bacteria | 2650 |
| 390 | Ga0207710_10005532 | 3300025900 | Bacteria | 5436 |
| 391 | Ga0207710_10030049 | 3300025900 | Bacteria | 2368 |
| 392 | Ga0207710_10032300 | 3300025900 | Bacteria | 2293 |
| 393 | Ga0207688_10005623 | 3300025901 | Bacteria | 6816 |
| 394 | Ga0207688_10008908 | 3300025901 | Bacteria | 5461 |
| 395 | Ga0207680_10576517 | 3300025903 | Bacteria | 804 |
| 396 | Ga0207647_10202619 | 3300025904 | Bacteria | 1147 |
| 397 | Ga0207647_10321788 | 3300025904 | Bacteria | 878 |
| 398 | Ga0207647_10325949 | 3300025904 | Bacteria | 872 |
| 399 | Ga0207647_10338745 | 3300025904 | Bacteria | 852 |
| 400 | Ga0207685_10093707 | 3300025905 | Bacteria | 1270 |
| 401 | Ga0207645_10060884 | 3300025907 | Bacteria | 2411 |
| 402 | Ga0207643_10000645 | 3300025908 | Bacteria | 21787 |
| 403 | Ga0207643_10302923 | 3300025908 | Bacteria | 995 |
| 404 | Ga0207705_10003405 | 3300025909 | Bacteria | 12092 |
| 405 | Ga0207705_10126859 | 3300025909 | Bacteria | 1897 |
| 406 | Ga0207705_10550255 | 3300025909 | Bacteria | 897 |
| 407 | Ga0207705_11232860 | 3300025909 | Bacteria | 573 |
| 408 | Ga0207684_11046939 | 3300025910 | Bacteria | 681 |
| 409 | Ga0207654_10022308 | 3300025911 | Bacteria | 3376 |
| 410 | Ga0207654_10111388 | 3300025911 | Bacteria | 1704 |
| 411 | Ga0207654_10745038 | 3300025911 | Bacteria | 706 |
| 412 | Ga0207707_10000764 | 3300025912 | Bacteria | 31604 |
| 413 | Ga0207707_10050988 | 3300025912 | Bacteria | 3603 |
| 414 | Ga0207695_10176566 | 3300025913 | Bacteria | 2058 |
| 415 | Ga0207695_10425580 | 3300025913 | Bacteria | 1212 |
| 416 | Ga0207695_10478025 | 3300025913 | Bacteria | 1128 |
| 417 | Ga0207671_10081214 | 3300025914 | Bacteria | 2431 |
| 418 | Ga0207671_10151997 | 3300025914 | Bacteria | 1789 |
| 419 | Ga0207671_10352690 | 3300025914 | Bacteria | 1167 |
| 420 | Ga0207671_10433955 | 3300025914 | Bacteria | 1046 |
| 421 | Ga0207671_10641434 | 3300025914 | Bacteria | 846 |
| 422 | Ga0207693_10033430 | 3300025915 | Bacteria | 4058 |
| 423 | Ga0207693_10664794 | 3300025915 | Bacteria | 809 |
| 424 | Ga0207693_10798382 | 3300025915 | Bacteria | 728 |
| 425 | Ga0207663_10321275 | 3300025916 | Bacteria | 1163 |
| 426 | Ga0207660_10018252 | 3300025917 | Bacteria | 4674 |
| 427 | Ga0207660_10025359 | 3300025917 | Bacteria | 4023 |
| 428 | Ga0207660_11327181 | 3300025917 | Bacteria | 584 |
| 429 | Ga0207662_10019315 | 3300025918 | Bacteria | 3876 |
| 430 | Ga0207662_10251634 | 3300025918 | Bacteria | 1160 |
| 431 | Ga0207657_10012324 | 3300025919 | Bacteria | 8448 |
| 432 | Ga0207657_10020145 | 3300025919 | Bacteria | 6311 |
| 433 | Ga0207657_10654639 | 3300025919 | Bacteria | 818 |
| 434 | Ga0207657_10870542 | 3300025919 | Bacteria | 695 |
| 435 | Ga0207649_10011169 | 3300025920 | Bacteria | 4944 |
| 436 | Ga0207649_11254238 | 3300025920 | Bacteria | 586 |
| 437 | Ga0207652_10000504 | 3300025921 | Bacteria | 39783 |
| 438 | Ga0207652_10098866 | 3300025921 | Bacteria | 2574 |
| 439 | Ga0207652_10965499 | 3300025921 | Bacteria | 750 |
| 440 | Ga0207652_11293338 | 3300025921 | Bacteria | 632 |
| 441 | Ga0207646_10267553 | 3300025922 | Bacteria | 1545 |
| 442 | Ga0207681_10384645 | 3300025923 | Bacteria | 1130 |
| 443 | Ga0207694_10084470 | 3300025924 | Bacteria | 2497 |
| 444 | Ga0207694_10328421 | 3300025924 | Bacteria | 1263 |
| 445 | Ga0207694_11199713 | 3300025924 | Bacteria | 642 |
| 446 | Ga0207650_10011084 | 3300025925 | Bacteria | 6199 |
| 447 | Ga0207659_10029646 | 3300025926 | Bacteria | 3731 |
| 448 | Ga0207659_10906264 | 3300025926 | Bacteria | 758 |
| 449 | Ga0207659_11018961 | 3300025926 | Bacteria | 712 |
| 450 | Ga0207687_10011377 | 3300025927 | Bacteria | 5816 |
| 451 | Ga0207687_10080384 | 3300025927 | Bacteria | 2353 |
| 452 | Ga0207687_10236097 | 3300025927 | Bacteria | 1446 |
| 453 | Ga0207687_11122816 | 3300025927 | Bacteria | 675 |
| 454 | Ga0207700_10356705 | 3300025928 | Bacteria | 1274 |
| 455 | Ga0207700_11136442 | 3300025928 | Bacteria | 698 |
| 456 | Ga0207700_11908082 | 3300025928 | Bacteria | 520 |
| 457 | Ga0207664_10333834 | 3300025929 | Bacteria | 1339 |
| 458 | Ga0207664_10393745 | 3300025929 | Bacteria | 1231 |
| 459 | Ga0207644_10119010 | 3300025931 | Bacteria | 2008 |
| 460 | Ga0207644_10215700 | 3300025931 | Bacteria | 1519 |
| 461 | Ga0207690_10097968 | 3300025932 | Bacteria | 2087 |
| 462 | Ga0207706_10071486 | 3300025933 | Bacteria | 3051 |
| 463 | Ga0207706_10239867 | 3300025933 | Bacteria | 1585 |
| 464 | Ga0207709_10037156 | 3300025935 | Bacteria | 2892 |
| 465 | Ga0207709_10101340 | 3300025935 | Bacteria | 1904 |
| 466 | Ga0207709_10735289 | 3300025935 | Bacteria | 792 |
| 467 | Ga0207670_10212038 | 3300025936 | Bacteria | 1477 |
| 468 | Ga0207670_10448113 | 3300025936 | Bacteria | 1040 |
| 469 | Ga0207669_10286183 | 3300025937 | Bacteria | 1246 |
| 470 | Ga0207669_11582358 | 3300025937 | Bacteria | 559 |
| 471 | Ga0207704_10080313 | 3300025938 | Bacteria | 2105 |
| 472 | Ga0207704_10910058 | 3300025938 | Bacteria | 740 |
| 473 | Ga0207665_10000841 | 3300025939 | Bacteria | 20734 |
| 474 | Ga0207665_10244955 | 3300025939 | Bacteria | 1322 |
| 475 | Ga0207665_10823825 | 3300025939 | Bacteria | 734 |
| 476 | Ga0207665_10878527 | 3300025939 | Bacteria | 710 |
| 477 | Ga0207691_10171271 | 3300025940 | Bacteria | 1901 |
| 478 | Ga0207691_10237092 | 3300025940 | Bacteria | 1578 |
| 479 | Ga0207711_10260653 | 3300025941 | Bacteria | 1593 |
| 480 | Ga0207711_10441140 | 3300025941 | Bacteria | 1211 |
| 481 | Ga0207711_11773963 | 3300025941 | Bacteria | 560 |
| 482 | Ga0207689_10000247 | 3300025942 | Bacteria | 48421 |
| 483 | Ga0207689_10018795 | 3300025942 | Bacteria | 5827 |
| 484 | Ga0207661_10008281 | 3300025944 | Bacteria | 7428 |
| 485 | Ga0207661_10416296 | 3300025944 | Bacteria | 1220 |
| 486 | Ga0207661_11624024 | 3300025944 | Bacteria | 591 |
| 487 | Ga0207679_10001936 | 3300025945 | Bacteria | 12852 |
| 488 | Ga0207679_10816991 | 3300025945 | Bacteria | 850 |
| 489 | Ga0207667_10010159 | 3300025949 | Bacteria | 11026 |
| 490 | Ga0207667_10118066 | 3300025949 | Bacteria | 2734 |
| 491 | Ga0207667_10135964 | 3300025949 | Bacteria | 2531 |
| 492 | Ga0207667_11927358 | 3300025949 | Bacteria | 552 |
| 493 | Ga0207651_11321024 | 3300025960 | Bacteria | 648 |
| 494 | Ga0207712_10065421 | 3300025961 | Bacteria | 2595 |
| 495 | Ga0207668_10011015 | 3300025972 | Bacteria | 5484 |
| 496 | Ga0207640_10019036 | 3300025981 | Bacteria | 4048 |
| 497 | Ga0207640_10366843 | 3300025981 | Bacteria | 1162 |
| 498 | Ga0207640_12110352 | 3300025981 | Bacteria | 511 |
| 499 | Ga0207677_10045516 | 3300026023 | Bacteria | 2930 |
| 500 | Ga0207703_10248429 | 3300026035 | Bacteria | 1602 |
| 501 | Ga0207639_12060972 | 3300026041 | Bacteria | 532 |
| 502 | Ga0207678_10000642 | 3300026067 | Bacteria | 32117 |
| 503 | Ga0207678_10001249 | 3300026067 | Bacteria | 23448 |
| 504 | Ga0207678_10417466 | 3300026067 | Bacteria | 1163 |
| 505 | Ga0207678_11241616 | 3300026067 | Bacteria | 660 |
| 506 | Ga0207708_10114677 | 3300026075 | Bacteria | 2094 |
| 507 | Ga0207702_10002205 | 3300026078 | Bacteria | 18667 |
| 508 | Ga0207702_10093978 | 3300026078 | Bacteria | 2631 |
| 509 | Ga0207702_10132479 | 3300026078 | Bacteria | 2245 |
| 510 | Ga0207702_10396653 | 3300026078 | Bacteria | 1330 |
| 511 | Ga0207641_10018849 | 3300026088 | Bacteria | 5659 |
| 512 | Ga0207641_10044128 | 3300026088 | Bacteria | 3748 |
| 513 | Ga0207648_10317239 | 3300026089 | Bacteria | 1400 |
| 514 | Ga0207648_11750794 | 3300026089 | Bacteria | 583 |
| 515 | Ga0207676_10002528 | 3300026095 | Bacteria | 13044 |
| 516 | Ga0207676_10107667 | 3300026095 | Bacteria | 2325 |
| 517 | Ga0207676_11753542 | 3300026095 | Bacteria | 619 |
| 518 | Ga0207676_11926288 | 3300026095 | Bacteria | 590 |
| 519 | Ga0207674_10367153 | 3300026116 | Bacteria | 1391 |
| 520 | Ga0207674_10988309 | 3300026116 | Bacteria | 811 |
| 521 | Ga0207674_11665621 | 3300026116 | Bacteria | 606 |
| 522 | Ga0207674_11806343 | 3300026116 | Bacteria | 578 |
| 523 | Ga0207675_100004308 | 3300026118 | Bacteria | 13751 |
| 524 | Ga0207675_100125041 | 3300026118 | Bacteria | 2436 |
| 525 | Ga0207683_10021780 | 3300026121 | Bacteria | 5494 |
| 526 | Ga0207683_10055090 | 3300026121 | Bacteria | 3488 |
| 527 | Ga0207698_10021270 | 3300026142 | Bacteria | 4482 |
| 528 | Ga0207698_10037957 | 3300026142 | Bacteria | 3554 |
| 529 | Ga0207698_10202369 | 3300026142 | Bacteria | 1779 |
| 530 | Ga0207698_10710431 | 3300026142 | Bacteria | 1001 |
| 531 | Ga0207698_12426283 | 3300026142 | Bacteria | 535 |
| 532 | Ga0207698_12547936 | 3300026142 | Bacteria | 521 |
| 533 | Ga0207428_10107183 | 3300027907 | Bacteria | 2153 |
| 534 | Ga0207428_10530242 | 3300027907 | Bacteria | 853 |
| 535 | Ga0268266_10038076 | 3300028379 | Bacteria | 4095 |
| 536 | Ga0268266_10087579 | 3300028379 | Bacteria | 2725 |
| 537 | Ga0268266_10309304 | 3300028379 | Bacteria | 1476 |
| 538 | Ga0268266_11601343 | 3300028379 | Bacteria | 627 |
| 539 | Ga0268265_10153939 | 3300028380 | Bacteria | 1943 |
| 540 | Ga0268264_10137202 | 3300028381 | Bacteria | 2176 |
| 541 | Ga0307413_11498924 | 3300031824 | Bacteria | 596 |
| 542 | Ga0307406_10807864 | 3300031901 | Bacteria | 792 |
| 543 | Ga0307415_100687678 | 3300032126 | Bacteria | 921 |
| 544 | Ga0307507_10021908 | 3300033179 | Bacteria | 7091 |
| 545 | Ga0373930_0095917 | 3300034816 | Bacteria | 700 |
| 546 | Ga0373950_0069445 | 3300034818 | Bacteria | 719 |
| 547 | Ga0373958_0198229 | 3300034819 | Bacteria | 524 |
| 548 | Ga0373959_0041526 | 3300034820 | Bacteria | 966 |
| 549 | Ga0373929_0073742 | 3300035085 | Bacteria | 820 |
| 550 | Ga0373929_0126813 | 3300035085 | Bacteria | 666 |
| 551 | Ga0373940_0020538 | 3300035088 | Bacteria | 1679 |
| 552 | Ga0373949_0029511 | 3300035090 | Bacteria | 1300 |
| 553 | Ga0373951_0075746 | 3300035091 | Bacteria | 863 |
| 554 | Ga0373952_0038018 | 3300035092 | Bacteria | 1101 |
| 555 | Ga0373932_0072271 | 3300035112 | Bacteria | 1073 |
| 556 | Ga0373939_0140174 | 3300035114 | Bacteria | 871 |
| 557 | Ga0373956_0360389 | 3300035119 | Bacteria | 693 |
| 558 | Ga0373961_0137976 | 3300035241 | Bacteria | 822 |
| 559 | Ga0373962_0093428 | 3300035242 | Bacteria | 929 |
| 560 | Ga0373931_0005247 | 3300035691 | Bacteria | 5975 |
| 561 | Ga0373931_0846090 | 3300035691 | Bacteria | 612 |
| 562 | Ga0373925_0164312 | 3300037068 | Bacteria | 1750 |
| 563 | Ga0395900_0973428 | 3300037418 | Bacteria | 769 |
| 564 | Ga0395898_1897662 | 3300037466 | Bacteria | 516 |
| 565 | Ga0436364_0634500 | 3300037853 | Bacteria | 528 |
| 566 | Ga0395901_0208594 | 3300038443 | Bacteria | 2046 |
| 567 | Ga0395901_0617866 | 3300038443 | Bacteria | 1091 |
| 568 | Ga0436365_0521780 | 3300039437 | Bacteria | 2103 |
| 569 | Ga0436365_0629779 | 3300039437 | Bacteria | 1176 |
| 570 | Ga0436362_0332052 | 3300039453 | Bacteria | 734 |
| 571 | Ga0451845_0359880 | 3300041501 | Bacteria | 1023 |
| 572 | Ga0439448_0092466 | 3300042005 | Bacteria | 1023 |
| 573 | Ga0439463_065896 | 3300042016 | Bacteria | 926 |
| 574 | Ga0450914_018083 | 3300042118 | Bacteria | 762 |
| 575 | Ga0450902_086087 | 3300042137 | Bacteria | 554 |
| 576 | Ga0439458_0109399 | 3300042157 | Bacteria | 722 |
| 577 | Ga0439459_0002498 | 3300042438 | Bacteria | 2843 |
| 578 | Ga0466969_0046923 | 3300044656 | Bacteria | 2140 |
| 579 | Ga0466969_0248751 | 3300044656 | Bacteria | 806 |
| 580 | Ga0466969_0316368 | 3300044656 | Bacteria | 706 |
| 581 | Ga0466969_0565087 | 3300044656 | Bacteria | 521 |
| 582 | Ga0466972_0037579 | 3300044658 | Bacteria | 2367 |
| 583 | Ga0466972_0063377 | 3300044658 | Bacteria | 1770 |
| 584 | Ga0466972_0590964 | 3300044658 | Bacteria | 524 |
| 585 | Ga0466965_0006927 | 3300044683 | Bacteria | 5186 |
| 586 | Ga0466965_0936989 | 3300044683 | Bacteria | 506 |
| 587 | Ga0466966_0005077 | 3300044684 | Bacteria | 8647 |
| 588 | Ga0466966_0041005 | 3300044684 | Bacteria | 2977 |
| 589 | Ga0466966_0044001 | 3300044684 | Bacteria | 2860 |
| 590 | Ga0466966_0098303 | 3300044684 | Bacteria | 1812 |
| 591 | Ga0466966_0107088 | 3300044684 | Bacteria | 1725 |
| 592 | Ga0466966_0165976 | 3300044684 | Bacteria | 1343 |
| 593 | Ga0466966_0410557 | 3300044684 | Bacteria | 814 |
| 594 | Ga0466966_0835546 | 3300044684 | Bacteria | 555 |
| 595 | Ga0466961_0003479 | 3300044693 | Bacteria | 9815 |
| 596 | Ga0466961_0024534 | 3300044693 | Bacteria | 3879 |
| 597 | Ga0466961_0034731 | 3300044693 | Bacteria | 3237 |
| 598 | Ga0466961_0041554 | 3300044693 | Bacteria | 2948 |
| 599 | Ga0466961_0075266 | 3300044693 | Bacteria | 2140 |
| 600 | Ga0466961_0099175 | 3300044693 | Bacteria | 1836 |
| 601 | Ga0466961_0109310 | 3300044693 | Bacteria | 1740 |
| 602 | Ga0466961_0113908 | 3300044693 | Bacteria | 1700 |
| 603 | Ga0466961_0126000 | 3300044693 | Bacteria | 1607 |
| 604 | Ga0466961_0755964 | 3300044693 | Bacteria | 581 |
| 605 | Ga0466963_0004552 | 3300044694 | Bacteria | 8072 |
| 606 | Ga0466963_0020515 | 3300044694 | Bacteria | 4156 |
| 607 | Ga0466963_0024445 | 3300044694 | Bacteria | 3847 |
| 608 | Ga0466963_0026304 | 3300044694 | Bacteria | 3721 |
| 609 | Ga0466963_0027706 | 3300044694 | Bacteria | 3631 |
| 610 | Ga0466963_0041139 | 3300044694 | Bacteria | 3030 |
| 611 | Ga0466963_0073964 | 3300044694 | Bacteria | 2298 |
| 612 | Ga0466963_0098223 | 3300044694 | Bacteria | 2001 |
| 613 | Ga0466963_0122948 | 3300044694 | Bacteria | 1787 |
| 614 | Ga0466963_0123019 | 3300044694 | Bacteria | 1787 |
| 615 | Ga0466963_1105730 | 3300044694 | Bacteria | 557 |
| 616 | Ga0466964_0027416 | 3300044706 | Bacteria | 2237 |
| 617 | Ga0466964_0044573 | 3300044706 | Bacteria | 1802 |
| 618 | Ga0466964_0272256 | 3300044706 | Bacteria | 843 |
| 619 | Ga0466964_0911731 | 3300044706 | Bacteria | 503 |
| 620 | Ga0466971_0058273 | 3300044719 | Bacteria | 1743 |
| 621 | Ga0466971_0063593 | 3300044719 | Bacteria | 1670 |
| 622 | Ga0466971_0172604 | 3300044719 | Bacteria | 1015 |
| 623 | Ga0466968_0177990 | 3300044735 | Bacteria | 988 |
| 624 | Ga0466968_0367873 | 3300044735 | Bacteria | 701 |
| 625 | Ga0466968_0697346 | 3300044735 | Bacteria | 518 |
| 626 | Ga0466970_0020020 | 3300044765 | Bacteria | 3472 |
| 627 | Ga0466970_0068183 | 3300044765 | Bacteria | 1911 |
| 628 | Ga0466970_0319758 | 3300044765 | Bacteria | 877 |
| 629 | Ga0466970_0336897 | 3300044765 | Bacteria | 855 |
| 630 | Ga0466970_0529456 | 3300044765 | Bacteria | 680 |
| 631 | Ga0466957_0008610 | 3300044842 | Bacteria | 5805 |
| 632 | Ga0466957_0013692 | 3300044842 | Bacteria | 4709 |
| 633 | Ga0466957_1218607 | 3300044842 | Bacteria | 545 |
| 634 | Ga0466957_1447894 | 3300044842 | Bacteria | 501 |
| 635 | Ga0466960_0042178 | 3300044901 | Bacteria | 2165 |
| 636 | Ga0466960_0073326 | 3300044901 | Bacteria | 1708 |
| 637 | Ga0466960_0380516 | 3300044901 | Bacteria | 810 |
| 638 | Ga0466959_0031341 | 3300045049 | Bacteria | 3935 |
| 639 | Ga0466959_0140789 | 3300045049 | Bacteria | 1705 |
| 640 | Ga0466959_0159297 | 3300045049 | Bacteria | 1587 |
| 641 | Ga0466959_0160639 | 3300045049 | Bacteria | 1580 |
| 642 | Ga0466959_0164256 | 3300045049 | Bacteria | 1560 |
| 643 | Ga0466959_0185817 | 3300045049 | Bacteria | 1452 |
| 644 | Ga0466959_0233960 | 3300045049 | Bacteria | 1271 |
| 645 | Ga0466959_0293888 | 3300045049 | Bacteria | 1113 |
| 646 | Ga0466959_0621274 | 3300045049 | Bacteria | 726 |
| 647 | Ga0466959_0933956 | 3300045049 | Bacteria | 578 |
| 648 | Ga0466959_0980056 | 3300045049 | Bacteria | 563 |
| 649 | Ga0466958_0009360 | 3300045836 | Bacteria | 5459 |
| 650 | Ga0466958_0010271 | 3300045836 | Bacteria | 5240 |
| 651 | Ga0466958_0017906 | 3300045836 | Bacteria | 4104 |
| 652 | Ga0466958_0045826 | 3300045836 | Bacteria | 2638 |
| 653 | Ga0466958_0075922 | 3300045836 | Bacteria | 2062 |
| 654 | Ga0466958_0096466 | 3300045836 | Bacteria | 1834 |
| 655 | Ga0466958_0097392 | 3300045836 | Bacteria | 1825 |
| 656 | Ga0466958_0215589 | 3300045836 | Bacteria | 1224 |
| 657 | Ga0466958_0841491 | 3300045836 | Bacteria | 598 |
| 658 | Ga0466967_0000382 | 3300045976 | Bacteria | 20625 |
| 659 | Ga0466967_0001908 | 3300045976 | Bacteria | 12596 |
| 660 | Ga0466967_0003147 | 3300045976 | Bacteria | 10631 |
| 661 | Ga0466967_0003455 | 3300045976 | Bacteria | 10312 |
| 662 | Ga0466967_0018239 | 3300045976 | Bacteria | 5601 |
| 663 | Ga0466967_0025063 | 3300045976 | Bacteria | 4913 |
| 664 | Ga0466967_0028813 | 3300045976 | Bacteria | 4641 |
| 665 | Ga0466967_0064160 | 3300045976 | Bacteria | 3266 |
| 666 | Ga0466967_0121206 | 3300045976 | Bacteria | 2416 |
| 667 | Ga0466967_0121224 | 3300045976 | Bacteria | 2416 |
| 668 | Ga0466967_0142225 | 3300045976 | Bacteria | 2236 |
| 669 | Ga0466967_0161380 | 3300045976 | Bacteria | 2104 |
| 670 | Ga0466967_0217855 | 3300045976 | Bacteria | 1813 |
| 671 | Ga0466967_0361788 | 3300045976 | Bacteria | 1406 |
| 672 | Ga0466967_0494623 | 3300045976 | Bacteria | 1199 |
| 673 | Ga0466967_0520175 | 3300045976 | Bacteria | 1169 |
| 674 | Ga0466967_0901098 | 3300045976 | Bacteria | 879 |
| 675 | Ga0466967_1371553 | 3300045976 | Bacteria | 704 |
| 676 | Ga0466967_2285297 | 3300045976 | Bacteria | 536 |
| 677 | Ga0495641_0531569 | 3300046461 | Bacteria | 537 |
| 678 | Ga0495653_0670779 | 3300046463 | Bacteria | 632 |
| 679 | Ga0495594_0454879 | 3300046499 | Bacteria | 728 |
| 680 | Ga0495622_0342591 | 3300046557 | Bacteria | 648 |
| 681 | Ga0495657_0581727 | 3300046675 | Bacteria | 649 |
| 682 | Ga0495674_0958047 | 3300047319 | Bacteria | 658 |
| 683 | Ga0495684_0383592 | 3300047471 | Bacteria | 991 |
| 684 | Ga0495602_0587103 | 3300048088 | Bacteria | 768 |
| 685 | Ga0496100_0013183 | 3300048903 | Bacteria | 4761 |
| 686 | Ga0496100_0018960 | 3300048903 | Bacteria | 4095 |
| 687 | Ga0496100_0468108 | 3300048903 | Bacteria | 968 |
| 688 | Ga0496100_0501320 | 3300048903 | Bacteria | 935 |
| 689 | Ga0496100_0940346 | 3300048903 | Bacteria | 679 |
| 690 | Ga0496101_0036739 | 3300048904 | Bacteria | 3470 |
| 691 | Ga0496102_0000142 | 3300048905 | Bacteria | 97037 |
| 692 | Ga0496102_0000569 | 3300048905 | Bacteria | 39306 |
| 693 | Ga0496102_0097385 | 3300048905 | Bacteria | 2728 |
| 694 | Ga0496102_0425862 | 3300048905 | Bacteria | 1246 |
| 695 | Ga0496102_0688843 | 3300048905 | Bacteria | 945 |
| 696 | Ga0496103_0000085 | 3300048906 | Bacteria | 105412 |
| 697 | Ga0496103_0072910 | 3300048906 | Bacteria | 2151 |
| 698 | Ga0496103_0097690 | 3300048906 | Bacteria | 1856 |
| 699 | Ga0496104_0024974 | 3300048907 | Bacteria | 5504 |
| 700 | Ga0496104_0121240 | 3300048907 | Bacteria | 2510 |
| 701 | Ga0496104_0691013 | 3300048907 | Bacteria | 928 |
| 702 | Ga0496105_0001319 | 3300048908 | Bacteria | 17352 |
| 703 | Ga0496105_0133027 | 3300048908 | Bacteria | 2049 |
| 704 | Ga0496105_0429126 | 3300048908 | Bacteria | 1046 |
| 705 | Ga0496106_0016694 | 3300048909 | Bacteria | 5432 |
| 706 | Ga0496106_0020578 | 3300048909 | Bacteria | 4898 |
| 707 | Ga0496107_0065388 | 3300048910 | Bacteria | 2636 |
| 708 | Ga0496107_0147572 | 3300048910 | Bacteria | 1739 |
| 709 | Ga0496107_1220650 | 3300048910 | Bacteria | 540 |
| 710 | Ga0496108_0010564 | 3300048911 | Bacteria | 7495 |
| 711 | Ga0496108_0037152 | 3300048911 | Bacteria | 4056 |
| 712 | Ga0496108_0167112 | 3300048911 | Bacteria | 1902 |
| 713 | Ga0496108_0397066 | 3300048911 | Bacteria | 1204 |
| 714 | Ga0496109_0008423 | 3300048912 | Bacteria | 8766 |
| 715 | Ga0496109_0094902 | 3300048912 | Bacteria | 2761 |
| 716 | Ga0496109_0928156 | 3300048912 | Bacteria | 808 |
| 717 | Ga0496110_0016699 | 3300048913 | Bacteria | 6131 |
| 718 | Ga0496110_0017885 | 3300048913 | Bacteria | 5934 |
| 719 | Ga0496110_0018611 | 3300048913 | Bacteria | 5825 |
| 720 | Ga0496110_1003861 | 3300048913 | Bacteria | 742 |
| 721 | Ga0496111_0036953 | 3300048914 | Bacteria | 3493 |
| 722 | Ga0496111_0093696 | 3300048914 | Bacteria | 2202 |
| 723 | Ga0496111_0174980 | 3300048914 | Bacteria | 1595 |
| 724 | Ga0496111_0685254 | 3300048914 | Bacteria | 746 |
| 725 | Ga0496111_1283621 | 3300048914 | Bacteria | 516 |
| 726 | Ga0496112_0040203 | 3300048915 | Bacteria | 4572 |
| 727 | Ga0496112_0042662 | 3300048915 | Bacteria | 4438 |
| 728 | Ga0496112_0163634 | 3300048915 | Bacteria | 2191 |
| 729 | Ga0496113_0057834 | 3300048916 | Bacteria | 2915 |
| 730 | Ga0496113_0169952 | 3300048916 | Bacteria | 1726 |
| 731 | Ga0496113_0599749 | 3300048916 | Bacteria | 882 |
| 732 | Ga0496114_0030521 | 3300048917 | Bacteria | 4435 |
| 733 | Ga0496114_0139236 | 3300048917 | Bacteria | 2100 |
| 734 | Ga0496115_0033887 | 3300048918 | Bacteria | 4034 |
| 735 | Ga0496115_1089098 | 3300048918 | Bacteria | 606 |
| 736 | Ga0496115_1409126 | 3300048918 | Bacteria | 514 |
| 737 | Ga0496118_0038691 | 3300048921 | Bacteria | 3819 |
| 738 | Ga0496118_0073130 | 3300048921 | Bacteria | 2458 |
| 739 | Ga0496119_0000153 | 3300048922 | Bacteria | 95945 |
| 740 | Ga0496119_0138796 | 3300048922 | Bacteria | 1315 |
| 741 | Ga0496120_0022025 | 3300048923 | Bacteria | 4013 |
| 742 | Ga0496121_0160827 | 3300048924 | Bacteria | 1642 |
| 743 | Ga0496126_0000013 | 3300048929 | Bacteria | 690046 |
| 744 | Ga0496126_0048031 | 3300048929 | Bacteria | 3905 |
| 745 | Ga0501336_025307 | 3300049552 | Bacteria | 560 |
| 746 | Ga0501031_0042529 | 3300049568 | Bacteria | 2965 |
| 747 | Ga0501032_0646700 | 3300049569 | Bacteria | 672 |
| 748 | Ga0501033_0162221 | 3300049570 | Bacteria | 1609 |
| 749 | Ga0501034_0568242 | 3300049571 | Bacteria | 1042 |
| 750 | Ga0501036_0534648 | 3300049572 | Bacteria | 974 |
| 751 | Ga0501037_0177488 | 3300049573 | Bacteria | 1512 |
| 752 | Ga0501038_0003697 | 3300049574 | Bacteria | 14253 |
| 753 | Ga0501043_0164881 | 3300049579 | Bacteria | 1730 |
| 754 | Ga0501046_0048811 | 3300049580 | Bacteria | 3351 |
| 755 | Ga0501047_0003454 | 3300049581 | Bacteria | 14936 |
| 756 | Ga0501047_0193219 | 3300049581 | Bacteria | 1898 |
| 757 | Ga0501048_0000303 | 3300049582 | Bacteria | 33444 |
| 758 | Ga0501070_0012680 | 3300049586 | Bacteria | 7109 |
| 759 | Ga0501070_0221651 | 3300049586 | Bacteria | 1551 |
| 760 | Ga0501072_1496607 | 3300049588 | Bacteria | 521 |
| 761 | Ga0501073_0726195 | 3300049589 | Bacteria | 685 |
| 762 | Ga0501074_0442584 | 3300049590 | Bacteria | 922 |
| 763 | Ga0501080_0372271 | 3300049742 | Bacteria | 1288 |
| 764 | Ga0501081_1020924 | 3300049743 | Bacteria | 625 |
| 765 | Ga0501044_0058974 | 3300049823 | Bacteria | 3934 |
| 766 | Ga0501044_0296426 | 3300049823 | Bacteria | 1547 |
| 767 | nmdc:mga05p37_1325116_c1 | 3300050507 | Bacteria | 732 |
| 768 | nmdc:mga05p37_384303_c1 | 3300050507 | Bacteria | 1644 |
| 769 | nmdc:mga05p37_903522_c1 | 3300050507 | Bacteria | 952 |
| 770 | nmdc:mga09592_307899_c1 | 3300050508 | Bacteria | 1373 |
| 771 | nmdc:mga09592_715019_c1 | 3300050508 | Bacteria | 852 |
| 772 | nmdc:mga06r32_134951_c1 | 3300050510 | Bacteria | 2442 |
| 773 | nmdc:mga06r32_444570_c1 | 3300050510 | Bacteria | 1276 |
| 774 | nmdc:mga06r32_59733_c1 | 3300050510 | Bacteria | 3668 |
| 775 | nmdc:mga08y16_147144_c1 | 3300050511 | Bacteria | 2449 |
| 776 | nmdc:mga08y16_1854401_c1 | 3300050511 | Bacteria | 555 |
| 777 | nmdc:mga08y16_2062836_c1 | 3300050511 | Bacteria | 518 |
| 778 | nmdc:mga0n895_157140_c1 | 3300050512 | Bacteria | 2305 |
| 779 | nmdc:mga0n895_26897_c1 | 3300050512 | Bacteria | 5458 |
| 780 | nmdc:mga0rr50_218326_c1 | 3300050513 | Bacteria | 1574 |
| 781 | nmdc:mga0rr50_4976_c1 | 3300050513 | Bacteria | 7870 |
| 782 | nmdc:mga08x19_14945_c1 | 3300050514 | Bacteria | 4715 |
| 783 | nmdc:mga08x19_79940_c1 | 3300050514 | Bacteria | 2145 |
| 784 | nmdc:mga0a205_3011_c1 | 3300050515 | Bacteria | 14933 |
| 785 | nmdc:mga0a205_35069_c1 | 3300050515 | Bacteria | 4817 |
| 786 | Ga0500555_175902 | 3300053103 | Bacteria | 519 |
| 787 | Ga0501084_1162898 | 3300054114 | Bacteria | 647 |
| 788 | Ga0587084_065957 | 3300059477 | Bacteria | 674 |
| 789 | Ga0587070_157464 | 3300059491 | Bacteria | 574 |
| 790 | Ga0587073_0139365 | 3300059492 | Bacteria | 675 |
| 791 | Ga0587073_0159663 | 3300059492 | Bacteria | 645 |
| 792 | Ga0587080_116700 | 3300059503 | Bacteria | 587 |
| 793 | Ga0587082_052942 | 3300059504 | Bacteria | 780 |
| 794 | Ga0587082_130295 | 3300059504 | Bacteria | 577 |
| 795 | Ga0587082_170623 | 3300059504 | Bacteria | 527 |
| 796 | Ga0587083_0237078 | 3300059505 | Bacteria | 538 |
| 797 | Ga0587083_0239493 | 3300059505 | Bacteria | 536 |
| 798 | Ga0587083_0262629 | 3300059505 | Bacteria | 519 |
| 799 | Ga0587088_158348 | 3300059508 | Bacteria | 553 |
| 800 | Ga0587088_185101 | 3300059508 | Bacteria | 524 |
| 801 | Ga0587089_057798 | 3300059509 | Bacteria | 635 |
| 802 | Ga0587090_121547 | 3300059510 | Bacteria | 567 |
| 803 | Ga0587090_132322 | 3300059510 | Bacteria | 551 |
| 804 | Ga0587091_159379 | 3300059511 | Bacteria | 579 |
| 805 | Ga0587092_141250 | 3300059512 | Bacteria | 531 |
| 806 | Ga0587092_155379 | 3300059512 | Bacteria | 514 |
| 807 | Ga0587094_112888 | 3300059513 | Bacteria | 537 |
| 808 | Ga0587106_156540 | 3300059605 | Bacteria | 511 |
| 809 | Ga0587125_033373 | 3300059607 | Bacteria | 667 |
| 810 | Ga0587113_026753 | 3300059625 | Bacteria | 637 |
| 811 | Ga0587115_085756 | 3300059626 | Bacteria | 565 |
| 812 | Ga0587117_121527 | 3300059627 | Bacteria | 518 |
| 813 | Ga0587122_028664 | 3300059628 | Bacteria | 645 |
| 814 | Ga0587128_166284 | 3300059630 | Bacteria | 512 |
| 815 | Ga0587130_039685 | 3300059631 | Bacteria | 566 |
| 816 | Ga0587067_109589 | 3300059640 | Bacteria | 650 |
| 817 | Ga0587067_237937 | 3300059640 | Bacteria | 500 |
| 818 | Ga0587072_143076 | 3300059643 | Bacteria | 572 |
| 819 | Ga0587075_054798 | 3300059644 | Bacteria | 705 |
| 820 | Ga0587075_145919 | 3300059644 | Bacteria | 509 |
| 821 | Ga0587076_129569 | 3300059645 | Bacteria | 593 |
| 822 | Ga0587076_150144 | 3300059645 | Bacteria | 565 |
| 823 | Ga0587076_150445 | 3300059645 | Bacteria | 564 |
| 824 | Ga0587078_024412 | 3300059646 | Bacteria | 783 |
| 825 | Ga0587078_042880 | 3300059646 | Bacteria | 644 |
| 826 | Ga0587079_132520 | 3300059647 | Bacteria | 628 |
| 827 | Ga0587079_167558 | 3300059647 | Bacteria | 579 |
| 828 | Ga0587104_025040 | 3300059650 | Bacteria | 514 |
| 829 | Ga0587110_026956 | 3300059654 | Bacteria | 683 |
| 830 | Ga0587114_107038 | 3300059655 | Bacteria | 552 |
| 831 | Ga0587120_038741 | 3300059659 | Bacteria | 506 |
| 832 | Ga0587071_144093 | 3300060344 | Bacteria | 587 |
| 833 | Ga0587071_206712 | 3300060344 | Bacteria | 516 |
| 834 | Ga0587111_0234222 | 3300060346 | Bacteria | 536 |
| 835 | Ga0587111_0277630 | 3300060346 | Bacteria | 505 |
| 836 | Ga0466962_0037329 | 3300061719 | Bacteria | 2326 |
| 837 | Ga0466962_0043154 | 3300061719 | Bacteria | 2158 |
| 838 | Ga0466962_0165897 | 3300061719 | Bacteria | 1074 |
| 839 | Ga0466962_0459419 | 3300061719 | Bacteria | 642 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300045976 | Ga0466967_0142225 | Ga0466967_0142225_255_569 | 100 |
| 2 | 3300005937 | Ga0081455_10226092 | Ga0081455_102260922 | 101 |
| 3 | 3300012512 | Ga0157327_1051457 | Ga0157327_10514572 | 101 |
| 4 | 3300025935 | Ga0207709_10101340 | Ga0207709_101013403 | 101 |
| 5 | 3300041501 | Ga0451845_0359880 | Ga0451845_0359880_138_443 | 101 |
| 6 | 3300046557 | Ga0495622_0342591 | Ga0495622_0342591_158_463 | 101 |
| 7 | 3300059655 | Ga0587114_107038 | Ga0587114_107038_165_470 | 101 |
| 8 | 3300003575 | Ga0007409J51694_1108460 | Ga0007409J51694_11084601 | 102 |
| 9 | 3300003579 | Ga0007429J51699_1018112 | Ga0007429J51699_10181121 | 102 |
| 10 | 3300005617 | Ga0068859_100009699 | Ga0068859_1000096994 | 102 |
| 11 | 3300006175 | Ga0070712_101084186 | Ga0070712_1010841861 | 102 |
| 12 | 3300006931 | Ga0097620_100009699 | Ga0097620_1000096994 | 102 |
| 13 | 3300009101 | Ga0105247_10003047 | Ga0105247_100030475 | 102 |
| 14 | 3300013043 | Ga0154018_106035 | Ga0154018_1060352 | 102 |
| 15 | 3300014968 | Ga0157379_11640908 | Ga0157379_116409081 | 102 |
| 16 | 3300025900 | Ga0207710_10005532 | Ga0207710_100055324 | 102 |
| 17 | 3300025928 | Ga0207700_11908082 | Ga0207700_119080821 | 102 |
| 18 | 3300026142 | Ga0207698_12426283 | Ga0207698_124262831 | 102 |
| 19 | 3300031901 | Ga0307406_10807864 | Ga0307406_108078642 | 102 |
| 20 | 3300033179 | Ga0307507_10021908 | Ga0307507_100219084 | 102 |
| 21 | 3300044693 | Ga0466961_0755964 | Ga0466961_0755964_128_478 | 102 |
| 22 | 3300044694 | Ga0466963_1105730 | Ga0466963_1105730_88_396 | 102 |
| 23 | 3300044842 | Ga0466957_1218607 | Ga0466957_1218607_188_496 | 102 |
| 24 | 3300045049 | Ga0466959_0164256 | Ga0466959_0164256_74_382 | 102 |
| 25 | 3300045976 | Ga0466967_0520175 | Ga0466967_0520175_82_390 | 102 |
| 26 | 3300045976 | Ga0466967_2285297 | Ga0466967_2285297_109_417 | 102 |
| 27 | 3300048903 | Ga0496100_0468108 | Ga0496100_0468108_259_567 | 102 |
| 28 | 3300048904 | Ga0496101_0036739 | Ga0496101_0036739_2984_3292 | 102 |
| 29 | 3300048905 | Ga0496102_0000142 | Ga0496102_0000142_82372_82680 | 102 |
| 30 | 3300048906 | Ga0496103_0000085 | Ga0496103_0000085_90738_91046 | 102 |
| 31 | 3300048921 | Ga0496118_0038691 | Ga0496118_0038691_3330_3638 | 102 |
| 32 | 3300048922 | Ga0496119_0138796 | Ga0496119_0138796_962_1270 | 102 |
| 33 | 3300048924 | Ga0496121_0160827 | Ga0496121_0160827_1085_1393 | 102 |
| 34 | 3300049552 | Ga0501336_025307 | Ga0501336_025307_106_414 | 102 |
| 35 | 3300053103 | Ga0500555_175902 | Ga0500555_175902_13_321 | 102 |
| 36 | 3300059505 | Ga0587083_0262629 | Ga0587083_0262629_74_403 | 102 |
| 37 | 3300001990 | JGI24737J22298_10067221 | JGI24737J22298_100672213 | 103 |
| 38 | 3300002067 | JGI24735J21928_10099704 | JGI24735J21928_100997043 | 103 |
| 39 | 3300002067 | JGI24735J21928_10150729 | JGI24735J21928_101507291 | 103 |
| 40 | 3300002067 | JGI24735J21928_10179578 | JGI24735J21928_101795782 | 103 |
| 41 | 3300003575 | Ga0007409J51694_1061986 | Ga0007409J51694_10619861 | 103 |
| 42 | 3300003693 | Ga0032354_1058136 | Ga0032354_10581361 | 103 |
| 43 | 3300004799 | Ga0058863_11912344 | Ga0058863_119123442 | 103 |
| 44 | 3300005327 | Ga0070658_10017448 | Ga0070658_100174484 | 103 |
| 45 | 3300005327 | Ga0070658_10994130 | Ga0070658_109941301 | 103 |
| 46 | 3300005329 | Ga0070683_100477399 | Ga0070683_1004773991 | 103 |
| 47 | 3300005337 | Ga0070682_100570786 | Ga0070682_1005707862 | 103 |
| 48 | 3300005337 | Ga0070682_100779688 | Ga0070682_1007796882 | 103 |
| 49 | 3300005337 | Ga0070682_101669639 | Ga0070682_1016696391 | 103 |
| 50 | 3300005339 | Ga0070660_101093654 | Ga0070660_1010936541 | 103 |
| 51 | 3300005341 | Ga0070691_10580119 | Ga0070691_105801191 | 103 |
| 52 | 3300005344 | Ga0070661_101184025 | Ga0070661_1011840251 | 103 |
| 53 | 3300005435 | Ga0070714_100702659 | Ga0070714_1007026592 | 103 |
| 54 | 3300005435 | Ga0070714_100759449 | Ga0070714_1007594491 | 103 |
| 55 | 3300005439 | Ga0070711_100467443 | Ga0070711_1004674432 | 103 |
| 56 | 3300005455 | Ga0070663_100476598 | Ga0070663_1004765982 | 103 |
| 57 | 3300005458 | Ga0070681_11138170 | Ga0070681_111381701 | 103 |
| 58 | 3300005530 | Ga0070679_100669321 | Ga0070679_1006693212 | 103 |
| 59 | 3300005530 | Ga0070679_100974609 | Ga0070679_1009746092 | 103 |
| 60 | 3300005535 | Ga0070684_100357105 | Ga0070684_1003571053 | 103 |
| 61 | 3300005539 | Ga0068853_102408943 | Ga0068853_1024089431 | 103 |
| 62 | 3300005563 | Ga0068855_100101198 | Ga0068855_1001011984 | 103 |
| 63 | 3300005563 | Ga0068855_100785786 | Ga0068855_1007857862 | 103 |
| 64 | 3300005563 | Ga0068855_101946628 | Ga0068855_1019466282 | 103 |
| 65 | 3300005577 | Ga0068857_101079557 | Ga0068857_1010795572 | 103 |
| 66 | 3300005614 | Ga0068856_100520717 | Ga0068856_1005207173 | 103 |
| 67 | 3300005614 | Ga0068856_101083455 | Ga0068856_1010834552 | 103 |
| 68 | 3300005616 | Ga0068852_100581584 | Ga0068852_1005815843 | 103 |
| 69 | 3300005616 | Ga0068852_101197733 | Ga0068852_1011977332 | 103 |
| 70 | 3300005937 | Ga0081455_10540138 | Ga0081455_105401382 | 103 |
| 71 | 3300006173 | Ga0070716_101004882 | Ga0070716_1010048821 | 103 |
| 72 | 3300006173 | Ga0070716_101602155 | Ga0070716_1016021551 | 103 |
| 73 | 3300006175 | Ga0070712_100999870 | Ga0070712_1009998702 | 103 |
| 74 | 3300009093 | Ga0105240_11068288 | Ga0105240_110682881 | 103 |
| 75 | 3300009098 | Ga0105245_10003794 | Ga0105245_100037947 | 103 |
| 76 | 3300009098 | Ga0105245_10685755 | Ga0105245_106857553 | 103 |
| 77 | 3300009148 | Ga0105243_11848405 | Ga0105243_118484051 | 103 |
| 78 | 3300009174 | Ga0105241_10051781 | Ga0105241_100517812 | 103 |
| 79 | 3300009174 | Ga0105241_10140534 | Ga0105241_101405342 | 103 |
| 80 | 3300009545 | Ga0105237_10211380 | Ga0105237_102113802 | 103 |
| 81 | 3300009545 | Ga0105237_10776254 | Ga0105237_107762542 | 103 |
| 82 | 3300009545 | Ga0105237_11267190 | Ga0105237_112671902 | 103 |
| 83 | 3300009545 | Ga0105237_11589177 | Ga0105237_115891772 | 103 |
| 84 | 3300009545 | Ga0105237_11731426 | Ga0105237_117314261 | 103 |
| 85 | 3300010375 | Ga0105239_10219946 | Ga0105239_102199463 | 103 |
| 86 | 3300010375 | Ga0105239_10738216 | Ga0105239_107382162 | 103 |
| 87 | 3300010375 | Ga0105239_10888391 | Ga0105239_108883912 | 103 |
| 88 | 3300013044 | Ga0154019_132188 | Ga0154019_1321882 | 103 |
| 89 | 3300013045 | Ga0154016_126325 | Ga0154016_1263251 | 103 |
| 90 | 3300013059 | Ga0154012_145613 | Ga0154012_1456132 | 103 |
| 91 | 3300013062 | Ga0154010_163592 | Ga0154010_1635921 | 103 |
| 92 | 3300013105 | Ga0157369_10335593 | Ga0157369_103355933 | 103 |
| 93 | 3300013105 | Ga0157369_10421418 | Ga0157369_104214182 | 103 |
| 94 | 3300013105 | Ga0157369_11113801 | Ga0157369_111138012 | 103 |
| 95 | 3300013296 | Ga0157374_10903969 | Ga0157374_109039692 | 103 |
| 96 | 3300013307 | Ga0157372_11878948 | Ga0157372_118789482 | 103 |
| 97 | 3300015262 | Ga0182007_10225604 | Ga0182007_102256041 | 103 |
| 98 | 3300020069 | Ga0197907_10165799 | Ga0197907_101657991 | 103 |
| 99 | 3300020069 | Ga0197907_10417371 | Ga0197907_104173712 | 103 |
| 100 | 3300020069 | Ga0197907_10655106 | Ga0197907_106551062 | 103 |
| 101 | 3300020069 | Ga0197907_10665716 | Ga0197907_106657162 | 103 |
| 102 | 3300020069 | Ga0197907_10813524 | Ga0197907_108135241 | 103 |
| 103 | 3300020069 | Ga0197907_11011918 | Ga0197907_110119182 | 103 |
| 104 | 3300020069 | Ga0197907_11236551 | Ga0197907_112365512 | 103 |
| 105 | 3300020069 | Ga0197907_11425260 | Ga0197907_114252602 | 103 |
| 106 | 3300020070 | Ga0206356_10461214 | Ga0206356_104612142 | 103 |
| 107 | 3300020070 | Ga0206356_11192521 | Ga0206356_111925212 | 103 |
| 108 | 3300020071 | Ga0206348_118668 | Ga0206348_1186681 | 103 |
| 109 | 3300020075 | Ga0206349_1572799 | Ga0206349_15727992 | 103 |
| 110 | 3300020075 | Ga0206349_1745300 | Ga0206349_17453002 | 103 |
| 111 | 3300020076 | Ga0206355_1029950 | Ga0206355_10299501 | 103 |
| 112 | 3300020076 | Ga0206355_1282491 | Ga0206355_12824912 | 103 |
| 113 | 3300020076 | Ga0206355_1285473 | Ga0206355_12854732 | 103 |
| 114 | 3300020076 | Ga0206355_1468932 | Ga0206355_14689321 | 103 |
| 115 | 3300020076 | Ga0206355_1470679 | Ga0206355_14706791 | 103 |
| 116 | 3300020076 | Ga0206355_1565251 | Ga0206355_15652512 | 103 |
| 117 | 3300020077 | Ga0206351_10129930 | Ga0206351_101299302 | 103 |
| 118 | 3300020077 | Ga0206351_10138064 | Ga0206351_101380642 | 103 |
| 119 | 3300020077 | Ga0206351_10317064 | Ga0206351_103170641 | 103 |
| 120 | 3300020080 | Ga0206350_10267178 | Ga0206350_102671782 | 103 |
| 121 | 3300020080 | Ga0206350_10587062 | Ga0206350_105870622 | 103 |
| 122 | 3300020080 | Ga0206350_10614274 | Ga0206350_106142741 | 103 |
| 123 | 3300020080 | Ga0206350_11037591 | Ga0206350_110375911 | 103 |
| 124 | 3300020081 | Ga0206354_10557356 | Ga0206354_105573562 | 103 |
| 125 | 3300020081 | Ga0206354_10818766 | Ga0206354_108187662 | 103 |
| 126 | 3300020081 | Ga0206354_11313140 | Ga0206354_113131402 | 103 |
| 127 | 3300020081 | Ga0206354_11348322 | Ga0206354_113483222 | 103 |
| 128 | 3300020081 | Ga0206354_11366478 | Ga0206354_113664781 | 103 |
| 129 | 3300020081 | Ga0206354_11441011 | Ga0206354_114410111 | 103 |
| 130 | 3300020081 | Ga0206354_11598942 | Ga0206354_115989421 | 103 |
| 131 | 3300020082 | Ga0206353_10186978 | Ga0206353_101869785 | 103 |
| 132 | 3300020082 | Ga0206353_11104212 | Ga0206353_111042121 | 103 |
| 133 | 3300020610 | Ga0154015_1323326 | Ga0154015_13233261 | 103 |
| 134 | 3300020610 | Ga0154015_1544223 | Ga0154015_15442232 | 103 |
| 135 | 3300022467 | Ga0224712_10165193 | Ga0224712_101651932 | 103 |
| 136 | 3300022467 | Ga0224712_10165348 | Ga0224712_101653481 | 103 |
| 137 | 3300022467 | Ga0224712_10333902 | Ga0224712_103339021 | 103 |
| 138 | 3300022467 | Ga0224712_10404852 | Ga0224712_104048522 | 103 |
| 139 | 3300022467 | Ga0224712_10560017 | Ga0224712_105600172 | 103 |
| 140 | 3300025904 | Ga0207647_10321788 | Ga0207647_103217881 | 103 |
| 141 | 3300025904 | Ga0207647_10338745 | Ga0207647_103387452 | 103 |
| 142 | 3300025909 | Ga0207705_10550255 | Ga0207705_105502552 | 103 |
| 143 | 3300025909 | Ga0207705_11232860 | Ga0207705_112328602 | 103 |
| 144 | 3300025911 | Ga0207654_10745038 | Ga0207654_107450382 | 103 |
| 145 | 3300025914 | Ga0207671_10151997 | Ga0207671_101519972 | 103 |
| 146 | 3300025914 | Ga0207671_10433955 | Ga0207671_104339551 | 103 |
| 147 | 3300025914 | Ga0207671_10641434 | Ga0207671_106414342 | 103 |
| 148 | 3300025915 | Ga0207693_10798382 | Ga0207693_107983821 | 103 |
| 149 | 3300025917 | Ga0207660_11327181 | Ga0207660_113271811 | 103 |
| 150 | 3300025919 | Ga0207657_10654639 | Ga0207657_106546393 | 103 |
| 151 | 3300025919 | Ga0207657_10870542 | Ga0207657_108705421 | 103 |
| 152 | 3300025920 | Ga0207649_11254238 | Ga0207649_112542382 | 103 |
| 153 | 3300025921 | Ga0207652_10965499 | Ga0207652_109654992 | 103 |
| 154 | 3300025921 | Ga0207652_11293338 | Ga0207652_112933381 | 103 |
| 155 | 3300025924 | Ga0207694_11199713 | Ga0207694_111997132 | 103 |
| 156 | 3300025927 | Ga0207687_10236097 | Ga0207687_102360971 | 103 |
| 157 | 3300025927 | Ga0207687_11122816 | Ga0207687_111228162 | 103 |
| 158 | 3300025929 | Ga0207664_10333834 | Ga0207664_103338342 | 103 |
| 159 | 3300025939 | Ga0207665_10823825 | Ga0207665_108238251 | 103 |
| 160 | 3300025939 | Ga0207665_10878527 | Ga0207665_108785272 | 103 |
| 161 | 3300025941 | Ga0207711_11773963 | Ga0207711_117739631 | 103 |
| 162 | 3300025944 | Ga0207661_10416296 | Ga0207661_104162961 | 103 |
| 163 | 3300025949 | Ga0207667_10010159 | Ga0207667_1001015910 | 103 |
| 164 | 3300025949 | Ga0207667_10118066 | Ga0207667_101180661 | 103 |
| 165 | 3300025949 | Ga0207667_11927358 | Ga0207667_119273582 | 103 |
| 166 | 3300025981 | Ga0207640_12110352 | Ga0207640_121103521 | 103 |
| 167 | 3300026041 | Ga0207639_12060972 | Ga0207639_120609721 | 103 |
| 168 | 3300026067 | Ga0207678_10417466 | Ga0207678_104174663 | 103 |
| 169 | 3300026067 | Ga0207678_11241616 | Ga0207678_112416162 | 103 |
| 170 | 3300026078 | Ga0207702_10132479 | Ga0207702_101324792 | 103 |
| 171 | 3300026078 | Ga0207702_10396653 | Ga0207702_103966531 | 103 |
| 172 | 3300026116 | Ga0207674_11665621 | Ga0207674_116656211 | 103 |
| 173 | 3300026116 | Ga0207674_11806343 | Ga0207674_118063431 | 103 |
| 174 | 3300026142 | Ga0207698_10037957 | Ga0207698_100379573 | 103 |
| 175 | 3300026142 | Ga0207698_10710431 | Ga0207698_107104311 | 103 |
| 176 | 3300026142 | Ga0207698_12547936 | Ga0207698_125479361 | 103 |
| 177 | 3300037418 | Ga0395900_0973428 | Ga0395900_0973428_220_531 | 103 |
| 178 | 3300037466 | Ga0395898_1897662 | Ga0395898_1897662_177_488 | 103 |
| 179 | 3300044656 | Ga0466969_0248751 | Ga0466969_0248751_41_352 | 103 |
| 180 | 3300044656 | Ga0466969_0316368 | Ga0466969_0316368_315_629 | 103 |
| 181 | 3300044656 | Ga0466969_0565087 | Ga0466969_0565087_64_375 | 103 |
| 182 | 3300044658 | Ga0466972_0037579 | Ga0466972_0037579_893_1204 | 103 |
| 183 | 3300044658 | Ga0466972_0063377 | Ga0466972_0063377_908_1219 | 103 |
| 184 | 3300044658 | Ga0466972_0590964 | Ga0466972_0590964_77_388 | 103 |
| 185 | 3300044683 | Ga0466965_0006927 | Ga0466965_0006927_865_1176 | 103 |
| 186 | 3300044683 | Ga0466965_0936989 | Ga0466965_0936989_173_490 | 103 |
| 187 | 3300044684 | Ga0466966_0041005 | Ga0466966_0041005_2478_2789 | 103 |
| 188 | 3300044684 | Ga0466966_0044001 | Ga0466966_0044001_1103_1414 | 103 |
| 189 | 3300044684 | Ga0466966_0098303 | Ga0466966_0098303_1317_1640 | 103 |
| 190 | 3300044684 | Ga0466966_0107088 | Ga0466966_0107088_896_1237 | 103 |
| 191 | 3300044684 | Ga0466966_0165976 | Ga0466966_0165976_993_1304 | 103 |
| 192 | 3300044684 | Ga0466966_0835546 | Ga0466966_0835546_186_497 | 103 |
| 193 | 3300044693 | Ga0466961_0003479 | Ga0466961_0003479_4394_4705 | 103 |
| 194 | 3300044693 | Ga0466961_0024534 | Ga0466961_0024534_2930_3241 | 103 |
| 195 | 3300044693 | Ga0466961_0041554 | Ga0466961_0041554_34_345 | 103 |
| 196 | 3300044693 | Ga0466961_0075266 | Ga0466961_0075266_380_691 | 103 |
| 197 | 3300044693 | Ga0466961_0109310 | Ga0466961_0109310_1248_1571 | 103 |
| 198 | 3300044693 | Ga0466961_0113908 | Ga0466961_0113908_657_971 | 103 |
| 199 | 3300044693 | Ga0466961_0126000 | Ga0466961_0126000_913_1227 | 103 |
| 200 | 3300044694 | Ga0466963_0004552 | Ga0466963_0004552_3882_4193 | 103 |
| 201 | 3300044694 | Ga0466963_0020515 | Ga0466963_0020515_611_922 | 103 |
| 202 | 3300044694 | Ga0466963_0024445 | Ga0466963_0024445_2632_2943 | 103 |
| 203 | 3300044694 | Ga0466963_0026304 | Ga0466963_0026304_2116_2427 | 103 |
| 204 | 3300044694 | Ga0466963_0027706 | Ga0466963_0027706_1014_1331 | 103 |
| 205 | 3300044694 | Ga0466963_0041139 | Ga0466963_0041139_1966_2331 | 103 |
| 206 | 3300044694 | Ga0466963_0073964 | Ga0466963_0073964_1170_1481 | 103 |
| 207 | 3300044694 | Ga0466963_0123019 | Ga0466963_0123019_1380_1694 | 103 |
| 208 | 3300044706 | Ga0466964_0027416 | Ga0466964_0027416_872_1183 | 103 |
| 209 | 3300044706 | Ga0466964_0044573 | Ga0466964_0044573_825_1136 | 103 |
| 210 | 3300044706 | Ga0466964_0272256 | Ga0466964_0272256_177_494 | 103 |
| 211 | 3300044706 | Ga0466964_0911731 | Ga0466964_0911731_13_327 | 103 |
| 212 | 3300044719 | Ga0466971_0058273 | Ga0466971_0058273_305_616 | 103 |
| 213 | 3300044719 | Ga0466971_0063593 | Ga0466971_0063593_703_1014 | 103 |
| 214 | 3300044719 | Ga0466971_0172604 | Ga0466971_0172604_567_881 | 103 |
| 215 | 3300044735 | Ga0466968_0177990 | Ga0466968_0177990_25_336 | 103 |
| 216 | 3300044735 | Ga0466968_0367873 | Ga0466968_0367873_374_688 | 103 |
| 217 | 3300044735 | Ga0466968_0697346 | Ga0466968_0697346_53_364 | 103 |
| 218 | 3300044765 | Ga0466970_0020020 | Ga0466970_0020020_701_1012 | 103 |
| 219 | 3300044765 | Ga0466970_0068183 | Ga0466970_0068183_830_1141 | 103 |
| 220 | 3300044765 | Ga0466970_0319758 | Ga0466970_0319758_236_547 | 103 |
| 221 | 3300044842 | Ga0466957_0008610 | Ga0466957_0008610_199_510 | 103 |
| 222 | 3300044842 | Ga0466957_0013692 | Ga0466957_0013692_665_976 | 103 |
| 223 | 3300044901 | Ga0466960_0042178 | Ga0466960_0042178_1163_1474 | 103 |
| 224 | 3300044901 | Ga0466960_0073326 | Ga0466960_0073326_748_1059 | 103 |
| 225 | 3300044901 | Ga0466960_0380516 | Ga0466960_0380516_404_715 | 103 |
| 226 | 3300045049 | Ga0466959_0031341 | Ga0466959_0031341_2356_2697 | 103 |
| 227 | 3300045049 | Ga0466959_0140789 | Ga0466959_0140789_24_335 | 103 |
| 228 | 3300045049 | Ga0466959_0160639 | Ga0466959_0160639_817_1128 | 103 |
| 229 | 3300045049 | Ga0466959_0185817 | Ga0466959_0185817_90_401 | 103 |
| 230 | 3300045049 | Ga0466959_0933956 | Ga0466959_0933956_89_403 | 103 |
| 231 | 3300045049 | Ga0466959_0980056 | Ga0466959_0980056_41_352 | 103 |
| 232 | 3300045836 | Ga0466958_0009360 | Ga0466958_0009360_774_1085 | 103 |
| 233 | 3300045836 | Ga0466958_0010271 | Ga0466958_0010271_3520_3831 | 103 |
| 234 | 3300045836 | Ga0466958_0045826 | Ga0466958_0045826_756_1067 | 103 |
| 235 | 3300045836 | Ga0466958_0075922 | Ga0466958_0075922_1723_2037 | 103 |
| 236 | 3300045836 | Ga0466958_0097392 | Ga0466958_0097392_701_1012 | 103 |
| 237 | 3300045836 | Ga0466958_0215589 | Ga0466958_0215589_349_666 | 103 |
| 238 | 3300045976 | Ga0466967_0000382 | Ga0466967_0000382_3992_4303 | 103 |
| 239 | 3300045976 | Ga0466967_0001908 | Ga0466967_0001908_11593_11958 | 103 |
| 240 | 3300045976 | Ga0466967_0003147 | Ga0466967_0003147_5616_5936 | 103 |
| 241 | 3300045976 | Ga0466967_0003455 | Ga0466967_0003455_2898_3209 | 103 |
| 242 | 3300045976 | Ga0466967_0018239 | Ga0466967_0018239_3524_3838 | 103 |
| 243 | 3300045976 | Ga0466967_0025063 | Ga0466967_0025063_3516_3830 | 103 |
| 244 | 3300045976 | Ga0466967_0028813 | Ga0466967_0028813_2751_3068 | 103 |
| 245 | 3300045976 | Ga0466967_0121206 | Ga0466967_0121206_574_885 | 103 |
| 246 | 3300045976 | Ga0466967_0121224 | Ga0466967_0121224_52_366 | 103 |
| 247 | 3300045976 | Ga0466967_0217855 | Ga0466967_0217855_1093_1407 | 103 |
| 248 | 3300045976 | Ga0466967_0901098 | Ga0466967_0901098_121_432 | 103 |
| 249 | 3300045976 | Ga0466967_1371553 | Ga0466967_1371553_18_332 | 103 |
| 250 | 3300046463 | Ga0495653_0670779 | Ga0495653_0670779_114_425 | 103 |
| 251 | 3300046675 | Ga0495657_0581727 | Ga0495657_0581727_210_524 | 103 |
| 252 | 3300047319 | Ga0495674_0958047 | Ga0495674_0958047_106_417 | 103 |
| 253 | 3300047471 | Ga0495684_0383592 | Ga0495684_0383592_502_813 | 103 |
| 254 | 3300048088 | Ga0495602_0587103 | Ga0495602_0587103_138_452 | 103 |
| 255 | 3300048903 | Ga0496100_0501320 | Ga0496100_0501320_19_333 | 103 |
| 256 | 3300048903 | Ga0496100_0940346 | Ga0496100_0940346_69_380 | 103 |
| 257 | 3300048905 | Ga0496102_0000569 | Ga0496102_0000569_28069_28380 | 103 |
| 258 | 3300048905 | Ga0496102_0688843 | Ga0496102_0688843_476_787 | 103 |
| 259 | 3300048906 | Ga0496103_0097690 | Ga0496103_0097690_1386_1697 | 103 |
| 260 | 3300048907 | Ga0496104_0691013 | Ga0496104_0691013_404_715 | 103 |
| 261 | 3300048908 | Ga0496105_0429126 | Ga0496105_0429126_303_614 | 103 |
| 262 | 3300048910 | Ga0496107_1220650 | Ga0496107_1220650_155_469 | 103 |
| 263 | 3300048911 | Ga0496108_0037152 | Ga0496108_0037152_2850_3164 | 103 |
| 264 | 3300048911 | Ga0496108_0397066 | Ga0496108_0397066_407_718 | 103 |
| 265 | 3300048912 | Ga0496109_0094902 | Ga0496109_0094902_1150_1464 | 103 |
| 266 | 3300048912 | Ga0496109_0928156 | Ga0496109_0928156_365_676 | 103 |
| 267 | 3300048913 | Ga0496110_0016699 | Ga0496110_0016699_2902_3216 | 103 |
| 268 | 3300048914 | Ga0496111_0093696 | Ga0496111_0093696_727_1041 | 103 |
| 269 | 3300048914 | Ga0496111_1283621 | Ga0496111_1283621_15_326 | 103 |
| 270 | 3300048915 | Ga0496112_0163634 | Ga0496112_0163634_1130_1444 | 103 |
| 271 | 3300048916 | Ga0496113_0599749 | Ga0496113_0599749_425_739 | 103 |
| 272 | 3300048918 | Ga0496115_1089098 | Ga0496115_1089098_189_500 | 103 |
| 273 | 3300048918 | Ga0496115_1409126 | Ga0496115_1409126_61_375 | 103 |
| 274 | 3300048921 | Ga0496118_0073130 | Ga0496118_0073130_28_339 | 103 |
| 275 | 3300048922 | Ga0496119_0000153 | Ga0496119_0000153_41202_41513 | 103 |
| 276 | 3300048923 | Ga0496120_0022025 | Ga0496120_0022025_840_1151 | 103 |
| 277 | 3300049568 | Ga0501031_0042529 | Ga0501031_0042529_587_898 | 103 |
| 278 | 3300049569 | Ga0501032_0646700 | Ga0501032_0646700_118_429 | 103 |
| 279 | 3300049570 | Ga0501033_0162221 | Ga0501033_0162221_590_901 | 103 |
| 280 | 3300049571 | Ga0501034_0568242 | Ga0501034_0568242_67_378 | 103 |
| 281 | 3300049572 | Ga0501036_0534648 | Ga0501036_0534648_492_803 | 103 |
| 282 | 3300049573 | Ga0501037_0177488 | Ga0501037_0177488_698_1009 | 103 |
| 283 | 3300049574 | Ga0501038_0003697 | Ga0501038_0003697_13257_13568 | 103 |
| 284 | 3300049579 | Ga0501043_0164881 | Ga0501043_0164881_325_636 | 103 |
| 285 | 3300049580 | Ga0501046_0048811 | Ga0501046_0048811_1845_2156 | 103 |
| 286 | 3300049581 | Ga0501047_0003454 | Ga0501047_0003454_6737_7048 | 103 |
| 287 | 3300049581 | Ga0501047_0193219 | Ga0501047_0193219_1485_1796 | 103 |
| 288 | 3300049582 | Ga0501048_0000303 | Ga0501048_0000303_20264_20575 | 103 |
| 289 | 3300049586 | Ga0501070_0012680 | Ga0501070_0012680_474_785 | 103 |
| 290 | 3300049586 | Ga0501070_0221651 | Ga0501070_0221651_292_603 | 103 |
| 291 | 3300049588 | Ga0501072_1496607 | Ga0501072_1496607_193_504 | 103 |
| 292 | 3300049589 | Ga0501073_0726195 | Ga0501073_0726195_132_443 | 103 |
| 293 | 3300049590 | Ga0501074_0442584 | Ga0501074_0442584_466_777 | 103 |
| 294 | 3300049742 | Ga0501080_0372271 | Ga0501080_0372271_629_940 | 103 |
| 295 | 3300049743 | Ga0501081_1020924 | Ga0501081_1020924_273_584 | 103 |
| 296 | 3300049823 | Ga0501044_0058974 | Ga0501044_0058974_272_583 | 103 |
| 297 | 3300049823 | Ga0501044_0296426 | Ga0501044_0296426_795_1106 | 103 |
| 298 | 3300050511 | nmdc:mga08y16_2062836_c1 | nmdc:mga08y16_2062836_c1_85_396 | 103 |
| 299 | 3300059492 | Ga0587073_0139365 | Ga0587073_0139365_71_382 | 103 |
| 300 | 3300059492 | Ga0587073_0159663 | Ga0587073_0159663_88_399 | 103 |
| 301 | 3300059503 | Ga0587080_116700 | Ga0587080_116700_89_400 | 103 |
| 302 | 3300059504 | Ga0587082_052942 | Ga0587082_052942_112_423 | 103 |
| 303 | 3300059504 | Ga0587082_130295 | Ga0587082_130295_89_403 | 103 |
| 304 | 3300059505 | Ga0587083_0237078 | Ga0587083_0237078_154_477 | 103 |
| 305 | 3300059508 | Ga0587088_158348 | Ga0587088_158348_187_498 | 103 |
| 306 | 3300059510 | Ga0587090_121547 | Ga0587090_121547_207_518 | 103 |
| 307 | 3300059511 | Ga0587091_159379 | Ga0587091_159379_188_499 | 103 |
| 308 | 3300059512 | Ga0587092_141250 | Ga0587092_141250_66_389 | 103 |
| 309 | 3300059605 | Ga0587106_156540 | Ga0587106_156540_101_412 | 103 |
| 310 | 3300059626 | Ga0587115_085756 | Ga0587115_085756_103_414 | 103 |
| 311 | 3300059630 | Ga0587128_166284 | Ga0587128_166284_157_468 | 103 |
| 312 | 3300059631 | Ga0587130_039685 | Ga0587130_039685_188_499 | 103 |
| 313 | 3300059640 | Ga0587067_237937 | Ga0587067_237937_101_412 | 103 |
| 314 | 3300059643 | Ga0587072_143076 | Ga0587072_143076_131_445 | 103 |
| 315 | 3300059644 | Ga0587075_054798 | Ga0587075_054798_301_612 | 103 |
| 316 | 3300059644 | Ga0587075_145919 | Ga0587075_145919_96_410 | 103 |
| 317 | 3300059645 | Ga0587076_129569 | Ga0587076_129569_95_406 | 103 |
| 318 | 3300059645 | Ga0587076_150144 | Ga0587076_150144_176_490 | 103 |
| 319 | 3300059647 | Ga0587079_167558 | Ga0587079_167558_171_482 | 103 |
| 320 | 3300059650 | Ga0587104_025040 | Ga0587104_025040_101_412 | 103 |
| 321 | 3300060344 | Ga0587071_144093 | Ga0587071_144093_89_400 | 103 |
| 322 | 3300060346 | Ga0587111_0234222 | Ga0587111_0234222_129_440 | 103 |
| 323 | 3300061719 | Ga0466962_0037329 | Ga0466962_0037329_1108_1419 | 103 |
| 324 | 3300061719 | Ga0466962_0043154 | Ga0466962_0043154_619_930 | 103 |
| 325 | 3300061719 | Ga0466962_0165897 | Ga0466962_0165897_39_350 | 103 |
| 326 | 3300061719 | Ga0466962_0459419 | Ga0466962_0459419_170_481 | 103 |
| 327 | 3300001915 | JGI24741J21665_1025334 | JGI24741J21665_10253343 | 104 |
| 328 | 3300001979 | JGI24740J21852_10102749 | JGI24740J21852_101027491 | 104 |
| 329 | 3300001989 | JGI24739J22299_10239451 | JGI24739J22299_102394512 | 104 |
| 330 | 3300001990 | JGI24737J22298_10266325 | JGI24737J22298_102663251 | 104 |
| 331 | 3300001991 | JGI24743J22301_10010175 | JGI24743J22301_100101752 | 104 |
| 332 | 3300001991 | JGI24743J22301_10143490 | JGI24743J22301_101434901 | 104 |
| 333 | 3300002067 | JGI24735J21928_10088130 | JGI24735J21928_100881301 | 104 |
| 334 | 3300002067 | JGI24735J21928_10094505 | JGI24735J21928_100945052 | 104 |
| 335 | 3300002075 | JGI24738J21930_10036034 | JGI24738J21930_100360342 | 104 |
| 336 | 3300002155 | JGI24033J26618_1016950 | JGI24033J26618_10169503 | 104 |
| 337 | 3300002459 | JGI24751J29686_10008749 | JGI24751J29686_100087493 | 104 |
| 338 | 3300003308 | Ga0006777J48905_1069915 | Ga0006777J48905_10699151 | 104 |
| 339 | 3300003659 | JGI25404J52841_10125115 | JGI25404J52841_101251151 | 104 |
| 340 | 3300004785 | Ga0058858_1228152 | Ga0058858_12281521 | 104 |
| 341 | 3300004798 | Ga0058859_11241572 | Ga0058859_112415722 | 104 |
| 342 | 3300004798 | Ga0058859_11702261 | Ga0058859_117022611 | 104 |
| 343 | 3300004799 | Ga0058863_10038017 | Ga0058863_100380171 | 104 |
| 344 | 3300004799 | Ga0058863_10049759 | Ga0058863_100497591 | 104 |
| 345 | 3300004799 | Ga0058863_11784877 | Ga0058863_117848771 | 104 |
| 346 | 3300004800 | Ga0058861_10170916 | Ga0058861_101709161 | 104 |
| 347 | 3300004801 | Ga0058860_10051072 | Ga0058860_100510722 | 104 |
| 348 | 3300004801 | Ga0058860_11926006 | Ga0058860_119260062 | 104 |
| 349 | 3300004801 | Ga0058860_12151711 | Ga0058860_121517112 | 104 |
| 350 | 3300004803 | Ga0058862_10038154 | Ga0058862_100381542 | 104 |
| 351 | 3300004803 | Ga0058862_10059979 | Ga0058862_100599791 | 104 |
| 352 | 3300005327 | Ga0070658_10002776 | Ga0070658_100027763 | 104 |
| 353 | 3300005327 | Ga0070658_10236294 | Ga0070658_102362943 | 104 |
| 354 | 3300005328 | Ga0070676_10061366 | Ga0070676_100613663 | 104 |
| 355 | 3300005329 | Ga0070683_100249062 | Ga0070683_1002490622 | 104 |
| 356 | 3300005329 | Ga0070683_101413057 | Ga0070683_1014130572 | 104 |
| 357 | 3300005330 | Ga0070690_100311378 | Ga0070690_1003113781 | 104 |
| 358 | 3300005333 | Ga0070677_10604200 | Ga0070677_106042001 | 104 |
| 359 | 3300005334 | Ga0068869_100014640 | Ga0068869_1000146405 | 104 |
| 360 | 3300005334 | Ga0068869_100115301 | Ga0068869_1001153012 | 104 |
| 361 | 3300005335 | Ga0070666_10239457 | Ga0070666_102394572 | 104 |
| 362 | 3300005336 | Ga0070680_100000403 | Ga0070680_1000004032 | 104 |
| 363 | 3300005336 | Ga0070680_100102565 | Ga0070680_1001025653 | 104 |
| 364 | 3300005337 | Ga0070682_100009318 | Ga0070682_1000093186 | 104 |
| 365 | 3300005337 | Ga0070682_100250965 | Ga0070682_1002509652 | 104 |
| 366 | 3300005338 | Ga0068868_100010973 | Ga0068868_1000109734 | 104 |
| 367 | 3300005338 | Ga0068868_100336562 | Ga0068868_1003365622 | 104 |
| 368 | 3300005339 | Ga0070660_100042679 | Ga0070660_1000426793 | 104 |
| 369 | 3300005339 | Ga0070660_100415482 | Ga0070660_1004154822 | 104 |
| 370 | 3300005340 | Ga0070689_100037765 | Ga0070689_1000377653 | 104 |
| 371 | 3300005340 | Ga0070689_100379023 | Ga0070689_1003790232 | 104 |
| 372 | 3300005341 | Ga0070691_10002288 | Ga0070691_100022887 | 104 |
| 373 | 3300005341 | Ga0070691_10347568 | Ga0070691_103475682 | 104 |
| 374 | 3300005343 | Ga0070687_100394995 | Ga0070687_1003949951 | 104 |
| 375 | 3300005344 | Ga0070661_100067572 | Ga0070661_1000675724 | 104 |
| 376 | 3300005344 | Ga0070661_100476130 | Ga0070661_1004761301 | 104 |
| 377 | 3300005345 | Ga0070692_10001141 | Ga0070692_100011413 | 104 |
| 378 | 3300005345 | Ga0070692_10367576 | Ga0070692_103675762 | 104 |
| 379 | 3300005347 | Ga0070668_100440273 | Ga0070668_1004402732 | 104 |
| 380 | 3300005353 | Ga0070669_100136030 | Ga0070669_1001360303 | 104 |
| 381 | 3300005353 | Ga0070669_100592761 | Ga0070669_1005927612 | 104 |
| 382 | 3300005354 | Ga0070675_100190937 | Ga0070675_1001909372 | 104 |
| 383 | 3300005354 | Ga0070675_100426515 | Ga0070675_1004265153 | 104 |
| 384 | 3300005355 | Ga0070671_100022196 | Ga0070671_1000221962 | 104 |
| 385 | 3300005355 | Ga0070671_100066003 | Ga0070671_1000660031 | 104 |
| 386 | 3300005356 | Ga0070674_100243236 | Ga0070674_1002432362 | 104 |
| 387 | 3300005356 | Ga0070674_101087106 | Ga0070674_1010871062 | 104 |
| 388 | 3300005364 | Ga0070673_100045389 | Ga0070673_1000453893 | 104 |
| 389 | 3300005364 | Ga0070673_101692251 | Ga0070673_1016922511 | 104 |
| 390 | 3300005365 | Ga0070688_100124063 | Ga0070688_1001240632 | 104 |
| 391 | 3300005366 | Ga0070659_100073970 | Ga0070659_1000739702 | 104 |
| 392 | 3300005366 | Ga0070659_101297416 | Ga0070659_1012974162 | 104 |
| 393 | 3300005367 | Ga0070667_100181210 | Ga0070667_1001812103 | 104 |
| 394 | 3300005406 | Ga0070703_10020264 | Ga0070703_100202642 | 104 |
| 395 | 3300005434 | Ga0070709_10082413 | Ga0070709_100824132 | 104 |
| 396 | 3300005434 | Ga0070709_10204350 | Ga0070709_102043502 | 104 |
| 397 | 3300005435 | Ga0070714_100039499 | Ga0070714_1000394992 | 104 |
| 398 | 3300005435 | Ga0070714_100196267 | Ga0070714_1001962673 | 104 |
| 399 | 3300005436 | Ga0070713_100003681 | Ga0070713_1000036812 | 104 |
| 400 | 3300005436 | Ga0070713_100063954 | Ga0070713_1000639544 | 104 |
| 401 | 3300005436 | Ga0070713_100193100 | Ga0070713_1001931002 | 104 |
| 402 | 3300005437 | Ga0070710_10087279 | Ga0070710_100872793 | 104 |
| 403 | 3300005438 | Ga0070701_11063369 | Ga0070701_110633691 | 104 |
| 404 | 3300005439 | Ga0070711_100063662 | Ga0070711_1000636623 | 104 |
| 405 | 3300005440 | Ga0070705_100779847 | Ga0070705_1007798472 | 104 |
| 406 | 3300005441 | Ga0070700_100015218 | Ga0070700_1000152182 | 104 |
| 407 | 3300005444 | Ga0070694_100451973 | Ga0070694_1004519732 | 104 |
| 408 | 3300005445 | Ga0070708_101382832 | Ga0070708_1013828321 | 104 |
| 409 | 3300005445 | Ga0070708_101856206 | Ga0070708_1018562062 | 104 |
| 410 | 3300005455 | Ga0070663_100022899 | Ga0070663_1000228995 | 104 |
| 411 | 3300005455 | Ga0070663_100255275 | Ga0070663_1002552753 | 104 |
| 412 | 3300005456 | Ga0070678_100036827 | Ga0070678_1000368272 | 104 |
| 413 | 3300005456 | Ga0070678_100047642 | Ga0070678_1000476423 | 104 |
| 414 | 3300005457 | Ga0070662_100473929 | Ga0070662_1004739291 | 104 |
| 415 | 3300005457 | Ga0070662_100807909 | Ga0070662_1008079092 | 104 |
| 416 | 3300005457 | Ga0070662_101544972 | Ga0070662_1015449721 | 104 |
| 417 | 3300005458 | Ga0070681_10032811 | Ga0070681_100328113 | 104 |
| 418 | 3300005458 | Ga0070681_10066114 | Ga0070681_100661142 | 104 |
| 419 | 3300005459 | Ga0068867_102103651 | Ga0068867_1021036511 | 104 |
| 420 | 3300005459 | Ga0068867_102351593 | Ga0068867_1023515931 | 104 |
| 421 | 3300005466 | Ga0070685_10047048 | Ga0070685_100470482 | 104 |
| 422 | 3300005467 | Ga0070706_100304029 | Ga0070706_1003040293 | 104 |
| 423 | 3300005468 | Ga0070707_100467645 | Ga0070707_1004676453 | 104 |
| 424 | 3300005518 | Ga0070699_100596772 | Ga0070699_1005967723 | 104 |
| 425 | 3300005530 | Ga0070679_100000591 | Ga0070679_10000059130 | 104 |
| 426 | 3300005530 | Ga0070679_100189316 | Ga0070679_1001893163 | 104 |
| 427 | 3300005535 | Ga0070684_102323874 | Ga0070684_1023238741 | 104 |
| 428 | 3300005536 | Ga0070697_100121856 | Ga0070697_1001218563 | 104 |
| 429 | 3300005539 | Ga0068853_100052946 | Ga0068853_1000529461 | 104 |
| 430 | 3300005539 | Ga0068853_100063236 | Ga0068853_1000632362 | 104 |
| 431 | 3300005543 | Ga0070672_100116896 | Ga0070672_1001168963 | 104 |
| 432 | 3300005543 | Ga0070672_100908966 | Ga0070672_1009089662 | 104 |
| 433 | 3300005544 | Ga0070686_100147763 | Ga0070686_1001477633 | 104 |
| 434 | 3300005544 | Ga0070686_100501870 | Ga0070686_1005018702 | 104 |
| 435 | 3300005545 | Ga0070695_100147064 | Ga0070695_1001470643 | 104 |
| 436 | 3300005546 | Ga0070696_100044500 | Ga0070696_1000445001 | 104 |
| 437 | 3300005547 | Ga0070693_100045268 | Ga0070693_1000452683 | 104 |
| 438 | 3300005547 | Ga0070693_100209279 | Ga0070693_1002092792 | 104 |
| 439 | 3300005548 | Ga0070665_100055530 | Ga0070665_1000555305 | 104 |
| 440 | 3300005548 | Ga0070665_100282904 | Ga0070665_1002829042 | 104 |
| 441 | 3300005549 | Ga0070704_100119640 | Ga0070704_1001196403 | 104 |
| 442 | 3300005563 | Ga0068855_100056300 | Ga0068855_1000563003 | 104 |
| 443 | 3300005563 | Ga0068855_100061160 | Ga0068855_1000611602 | 104 |
| 444 | 3300005564 | Ga0070664_100683268 | Ga0070664_1006832682 | 104 |
| 445 | 3300005578 | Ga0068854_100102323 | Ga0068854_1001023232 | 104 |
| 446 | 3300005578 | Ga0068854_100190576 | Ga0068854_1001905762 | 104 |
| 447 | 3300005614 | Ga0068856_100683982 | Ga0068856_1006839822 | 104 |
| 448 | 3300005615 | Ga0070702_100000310 | Ga0070702_1000003102 | 104 |
| 449 | 3300005615 | Ga0070702_100025843 | Ga0070702_1000258433 | 104 |
| 450 | 3300005616 | Ga0068852_100007126 | Ga0068852_1000071262 | 104 |
| 451 | 3300005616 | Ga0068852_100058031 | Ga0068852_1000580314 | 104 |
| 452 | 3300005617 | Ga0068859_100216754 | Ga0068859_1002167542 | 104 |
| 453 | 3300005617 | Ga0068859_100278093 | Ga0068859_1002780933 | 104 |
| 454 | 3300005618 | Ga0068864_100148152 | Ga0068864_1001481523 | 104 |
| 455 | 3300005618 | Ga0068864_101321867 | Ga0068864_1013218671 | 104 |
| 456 | 3300005718 | Ga0068866_10424985 | Ga0068866_104249853 | 104 |
| 457 | 3300005719 | Ga0068861_100009878 | Ga0068861_1000098787 | 104 |
| 458 | 3300005834 | Ga0068851_10093763 | Ga0068851_100937632 | 104 |
| 459 | 3300005834 | Ga0068851_10141320 | Ga0068851_101413201 | 104 |
| 460 | 3300005840 | Ga0068870_10031322 | Ga0068870_100313223 | 104 |
| 461 | 3300005840 | Ga0068870_10096807 | Ga0068870_100968072 | 104 |
| 462 | 3300005841 | Ga0068863_100056137 | Ga0068863_1000561372 | 104 |
| 463 | 3300005842 | Ga0068858_100061566 | Ga0068858_1000615662 | 104 |
| 464 | 3300005843 | Ga0068860_100086873 | Ga0068860_1000868733 | 104 |
| 465 | 3300005843 | Ga0068860_100447135 | Ga0068860_1004471351 | 104 |
| 466 | 3300005844 | Ga0068862_101137353 | Ga0068862_1011373531 | 104 |
| 467 | 3300005937 | Ga0081455_10003134 | Ga0081455_1000313410 | 104 |
| 468 | 3300005937 | Ga0081455_10438380 | Ga0081455_104383801 | 104 |
| 469 | 3300005983 | Ga0081540_1057314 | Ga0081540_10573143 | 104 |
| 470 | 3300005983 | Ga0081540_1124755 | Ga0081540_11247552 | 104 |
| 471 | 3300006028 | Ga0070717_10109999 | Ga0070717_101099993 | 104 |
| 472 | 3300006028 | Ga0070717_10127752 | Ga0070717_101277523 | 104 |
| 473 | 3300006058 | Ga0075432_10078396 | Ga0075432_100783962 | 104 |
| 474 | 3300006058 | Ga0075432_10576757 | Ga0075432_105767571 | 104 |
| 475 | 3300006175 | Ga0070712_100771338 | Ga0070712_1007713382 | 104 |
| 476 | 3300006175 | Ga0070712_101652683 | Ga0070712_1016526832 | 104 |
| 477 | 3300006175 | Ga0070712_101652685 | Ga0070712_1016526852 | 104 |
| 478 | 3300006237 | Ga0097621_100256560 | Ga0097621_1002565602 | 104 |
| 479 | 3300006358 | Ga0068871_100618252 | Ga0068871_1006182521 | 104 |
| 480 | 3300006844 | Ga0075428_100709312 | Ga0075428_1007093123 | 104 |
| 481 | 3300006844 | Ga0075428_100987396 | Ga0075428_1009873962 | 104 |
| 482 | 3300006844 | Ga0075428_101126428 | Ga0075428_1011264282 | 104 |
| 483 | 3300006846 | Ga0075430_100828232 | Ga0075430_1008282322 | 104 |
| 484 | 3300006847 | Ga0075431_100111461 | Ga0075431_1001114613 | 104 |
| 485 | 3300006847 | Ga0075431_100165218 | Ga0075431_1001652183 | 104 |
| 486 | 3300006847 | Ga0075431_100272814 | Ga0075431_1002728141 | 104 |
| 487 | 3300006852 | Ga0075433_10023324 | Ga0075433_100233243 | 104 |
| 488 | 3300006852 | Ga0075433_10038514 | Ga0075433_100385142 | 104 |
| 489 | 3300006871 | Ga0075434_100020783 | Ga0075434_1000207836 | 104 |
| 490 | 3300006871 | Ga0075434_100773784 | Ga0075434_1007737841 | 104 |
| 491 | 3300006880 | Ga0075429_100069055 | Ga0075429_1000690552 | 104 |
| 492 | 3300006880 | Ga0075429_100160507 | Ga0075429_1001605072 | 104 |
| 493 | 3300006880 | Ga0075429_100333478 | Ga0075429_1003334781 | 104 |
| 494 | 3300006881 | Ga0068865_100115964 | Ga0068865_1001159643 | 104 |
| 495 | 3300006914 | Ga0075436_100037931 | Ga0075436_1000379314 | 104 |
| 496 | 3300006914 | Ga0075436_100175281 | Ga0075436_1001752812 | 104 |
| 497 | 3300006931 | Ga0097620_100216736 | Ga0097620_1002167362 | 104 |
| 498 | 3300006931 | Ga0097620_100278078 | Ga0097620_1002780783 | 104 |
| 499 | 3300007076 | Ga0075435_100067286 | Ga0075435_1000672862 | 104 |
| 500 | 3300007076 | Ga0075435_100083231 | Ga0075435_1000832312 | 104 |
| 501 | 3300009011 | Ga0105251_10087257 | Ga0105251_100872573 | 104 |
| 502 | 3300009036 | Ga0105244_10218282 | Ga0105244_102182822 | 104 |
| 503 | 3300009092 | Ga0105250_10389224 | Ga0105250_103892242 | 104 |
| 504 | 3300009093 | Ga0105240_10099855 | Ga0105240_100998554 | 104 |
| 505 | 3300009093 | Ga0105240_10509793 | Ga0105240_105097933 | 104 |
| 506 | 3300009094 | Ga0111539_10042854 | Ga0111539_100428542 | 104 |
| 507 | 3300009094 | Ga0111539_10070023 | Ga0111539_100700231 | 104 |
| 508 | 3300009098 | Ga0105245_10173032 | Ga0105245_101730321 | 104 |
| 509 | 3300009098 | Ga0105245_10312756 | Ga0105245_103127563 | 104 |
| 510 | 3300009101 | Ga0105247_10052180 | Ga0105247_100521804 | 104 |
| 511 | 3300009101 | Ga0105247_10103075 | Ga0105247_101030752 | 104 |
| 512 | 3300009147 | Ga0114129_10335614 | Ga0114129_103356142 | 104 |
| 513 | 3300009147 | Ga0114129_10408251 | Ga0114129_104082513 | 104 |
| 514 | 3300009148 | Ga0105243_10100987 | Ga0105243_101009873 | 104 |
| 515 | 3300009148 | Ga0105243_10991808 | Ga0105243_109918082 | 104 |
| 516 | 3300009174 | Ga0105241_10101976 | Ga0105241_101019762 | 104 |
| 517 | 3300009174 | Ga0105241_10320648 | Ga0105241_103206483 | 104 |
| 518 | 3300009176 | Ga0105242_10295740 | Ga0105242_102957402 | 104 |
| 519 | 3300009177 | Ga0105248_10202161 | Ga0105248_102021612 | 104 |
| 520 | 3300009177 | Ga0105248_10369887 | Ga0105248_103698873 | 104 |
| 521 | 3300009545 | Ga0105237_10108611 | Ga0105237_101086113 | 104 |
| 522 | 3300009545 | Ga0105237_10210685 | Ga0105237_102106853 | 104 |
| 523 | 3300009551 | Ga0105238_10141262 | Ga0105238_101412623 | 104 |
| 524 | 3300009551 | Ga0105238_10268938 | Ga0105238_102689383 | 104 |
| 525 | 3300009551 | Ga0105238_10316290 | Ga0105238_103162902 | 104 |
| 526 | 3300009553 | Ga0105249_10003351 | Ga0105249_100033514 | 104 |
| 527 | 3300009553 | Ga0105249_10371869 | Ga0105249_103718691 | 104 |
| 528 | 3300010375 | Ga0105239_10254149 | Ga0105239_102541493 | 104 |
| 529 | 3300010375 | Ga0105239_10262054 | Ga0105239_102620543 | 104 |
| 530 | 3300011119 | Ga0105246_10092415 | Ga0105246_100924153 | 104 |
| 531 | 3300011119 | Ga0105246_11680503 | Ga0105246_116805032 | 104 |
| 532 | 3300012490 | Ga0157322_1017566 | Ga0157322_10175662 | 104 |
| 533 | 3300012505 | Ga0157339_1007253 | Ga0157339_10072531 | 104 |
| 534 | 3300012515 | Ga0157338_1025808 | Ga0157338_10258081 | 104 |
| 535 | 3300013045 | Ga0154016_141312 | Ga0154016_1413121 | 104 |
| 536 | 3300013052 | Ga0154014_115819 | Ga0154014_1158192 | 104 |
| 537 | 3300013059 | Ga0154012_121067 | Ga0154012_1210672 | 104 |
| 538 | 3300013062 | Ga0154010_133995 | Ga0154010_1339952 | 104 |
| 539 | 3300013100 | Ga0157373_10064774 | Ga0157373_100647742 | 104 |
| 540 | 3300013100 | Ga0157373_10102351 | Ga0157373_101023512 | 104 |
| 541 | 3300013102 | Ga0157371_10087013 | Ga0157371_100870132 | 104 |
| 542 | 3300013102 | Ga0157371_10181287 | Ga0157371_101812873 | 104 |
| 543 | 3300013104 | Ga0157370_10032625 | Ga0157370_100326253 | 104 |
| 544 | 3300013104 | Ga0157370_10243087 | Ga0157370_102430872 | 104 |
| 545 | 3300013105 | Ga0157369_10138299 | Ga0157369_101382993 | 104 |
| 546 | 3300013105 | Ga0157369_10751155 | Ga0157369_107511552 | 104 |
| 547 | 3300013105 | Ga0157369_11556107 | Ga0157369_115561072 | 104 |
| 548 | 3300013296 | Ga0157374_10013476 | Ga0157374_100134765 | 104 |
| 549 | 3300013296 | Ga0157374_10085138 | Ga0157374_100851383 | 104 |
| 550 | 3300013297 | Ga0157378_10107645 | Ga0157378_101076453 | 104 |
| 551 | 3300013297 | Ga0157378_10203628 | Ga0157378_102036282 | 104 |
| 552 | 3300013306 | Ga0163162_10010190 | Ga0163162_1001019011 | 104 |
| 553 | 3300013306 | Ga0163162_11808158 | Ga0163162_118081582 | 104 |
| 554 | 3300013307 | Ga0157372_10033763 | Ga0157372_100337635 | 104 |
| 555 | 3300013308 | Ga0157375_10320460 | Ga0157375_103204602 | 104 |
| 556 | 3300013308 | Ga0157375_10422338 | Ga0157375_104223383 | 104 |
| 557 | 3300014325 | Ga0163163_10075082 | Ga0163163_100750824 | 104 |
| 558 | 3300014325 | Ga0163163_10213130 | Ga0163163_102131303 | 104 |
| 559 | 3300014326 | Ga0157380_10027310 | Ga0157380_100273102 | 104 |
| 560 | 3300014497 | Ga0182008_10423769 | Ga0182008_104237691 | 104 |
| 561 | 3300014745 | Ga0157377_10116951 | Ga0157377_101169512 | 104 |
| 562 | 3300014745 | Ga0157377_10132403 | Ga0157377_101324032 | 104 |
| 563 | 3300014968 | Ga0157379_10017319 | Ga0157379_100173193 | 104 |
| 564 | 3300014968 | Ga0157379_10034232 | Ga0157379_100342322 | 104 |
| 565 | 3300014969 | Ga0157376_10365935 | Ga0157376_103659353 | 104 |
| 566 | 3300014969 | Ga0157376_10574614 | Ga0157376_105746142 | 104 |
| 567 | 3300014969 | Ga0157376_10686039 | Ga0157376_106860391 | 104 |
| 568 | 3300015265 | Ga0182005_1143526 | Ga0182005_11435262 | 104 |
| 569 | 3300017792 | Ga0163161_10062232 | Ga0163161_100622321 | 104 |
| 570 | 3300020069 | Ga0197907_10136472 | Ga0197907_101364723 | 104 |
| 571 | 3300020069 | Ga0197907_10890214 | Ga0197907_108902142 | 104 |
| 572 | 3300020069 | Ga0197907_11425484 | Ga0197907_114254841 | 104 |
| 573 | 3300020070 | Ga0206356_11542350 | Ga0206356_115423504 | 104 |
| 574 | 3300020075 | Ga0206349_1039003 | Ga0206349_10390032 | 104 |
| 575 | 3300020076 | Ga0206355_1437175 | Ga0206355_14371753 | 104 |
| 576 | 3300020077 | Ga0206351_10165192 | Ga0206351_101651921 | 104 |
| 577 | 3300020077 | Ga0206351_10583506 | Ga0206351_105835062 | 104 |
| 578 | 3300020078 | Ga0206352_10453915 | Ga0206352_104539152 | 104 |
| 579 | 3300020078 | Ga0206352_10583660 | Ga0206352_105836602 | 104 |
| 580 | 3300020078 | Ga0206352_10782919 | Ga0206352_107829192 | 104 |
| 581 | 3300020078 | Ga0206352_10998634 | Ga0206352_109986341 | 104 |
| 582 | 3300020078 | Ga0206352_11289899 | Ga0206352_112898992 | 104 |
| 583 | 3300020080 | Ga0206350_10973946 | Ga0206350_109739462 | 104 |
| 584 | 3300020080 | Ga0206350_11468155 | Ga0206350_114681553 | 104 |
| 585 | 3300020081 | Ga0206354_10328282 | Ga0206354_103282821 | 104 |
| 586 | 3300020081 | Ga0206354_11011929 | Ga0206354_110119292 | 104 |
| 587 | 3300020081 | Ga0206354_11651120 | Ga0206354_116511203 | 104 |
| 588 | 3300020082 | Ga0206353_10292783 | Ga0206353_102927831 | 104 |
| 589 | 3300020082 | Ga0206353_10389836 | Ga0206353_1038983619 | 104 |
| 590 | 3300020082 | Ga0206353_11945709 | Ga0206353_119457092 | 104 |
| 591 | 3300020082 | Ga0206353_11945828 | Ga0206353_119458283 | 104 |
| 592 | 3300020610 | Ga0154015_1599216 | Ga0154015_15992162 | 104 |
| 593 | 3300021384 | Ga0213876_10179411 | Ga0213876_101794112 | 104 |
| 594 | 3300021384 | Ga0213876_10448867 | Ga0213876_104488671 | 104 |
| 595 | 3300022467 | Ga0224712_10057189 | Ga0224712_100571893 | 104 |
| 596 | 3300022467 | Ga0224712_10099262 | Ga0224712_100992622 | 104 |
| 597 | 3300022467 | Ga0224712_10352643 | Ga0224712_103526432 | 104 |
| 598 | 3300022467 | Ga0224712_10592967 | Ga0224712_105929672 | 104 |
| 599 | 3300025321 | Ga0207656_10165259 | Ga0207656_101652593 | 104 |
| 600 | 3300025735 | Ga0207713_1045258 | Ga0207713_10452582 | 104 |
| 601 | 3300025735 | Ga0207713_1099531 | Ga0207713_10995311 | 104 |
| 602 | 3300025898 | Ga0207692_10028262 | Ga0207692_100282623 | 104 |
| 603 | 3300025900 | Ga0207710_10030049 | Ga0207710_100300493 | 104 |
| 604 | 3300025900 | Ga0207710_10032300 | Ga0207710_100323002 | 104 |
| 605 | 3300025901 | Ga0207688_10005623 | Ga0207688_100056232 | 104 |
| 606 | 3300025901 | Ga0207688_10008908 | Ga0207688_100089086 | 104 |
| 607 | 3300025903 | Ga0207680_10576517 | Ga0207680_105765172 | 104 |
| 608 | 3300025904 | Ga0207647_10202619 | Ga0207647_102026192 | 104 |
| 609 | 3300025904 | Ga0207647_10325949 | Ga0207647_103259492 | 104 |
| 610 | 3300025905 | Ga0207685_10093707 | Ga0207685_100937072 | 104 |
| 611 | 3300025907 | Ga0207645_10060884 | Ga0207645_100608842 | 104 |
| 612 | 3300025908 | Ga0207643_10000645 | Ga0207643_1000064520 | 104 |
| 613 | 3300025908 | Ga0207643_10302923 | Ga0207643_103029232 | 104 |
| 614 | 3300025909 | Ga0207705_10003405 | Ga0207705_100034059 | 104 |
| 615 | 3300025909 | Ga0207705_10126859 | Ga0207705_101268592 | 104 |
| 616 | 3300025910 | Ga0207684_11046939 | Ga0207684_110469392 | 104 |
| 617 | 3300025911 | Ga0207654_10022308 | Ga0207654_100223084 | 104 |
| 618 | 3300025911 | Ga0207654_10111388 | Ga0207654_101113882 | 104 |
| 619 | 3300025912 | Ga0207707_10000764 | Ga0207707_100007643 | 104 |
| 620 | 3300025912 | Ga0207707_10050988 | Ga0207707_100509881 | 104 |
| 621 | 3300025913 | Ga0207695_10176566 | Ga0207695_101765663 | 104 |
| 622 | 3300025913 | Ga0207695_10425580 | Ga0207695_104255803 | 104 |
| 623 | 3300025913 | Ga0207695_10478025 | Ga0207695_104780253 | 104 |
| 624 | 3300025914 | Ga0207671_10081214 | Ga0207671_100812143 | 104 |
| 625 | 3300025914 | Ga0207671_10352690 | Ga0207671_103526901 | 104 |
| 626 | 3300025915 | Ga0207693_10033430 | Ga0207693_100334305 | 104 |
| 627 | 3300025915 | Ga0207693_10664794 | Ga0207693_106647942 | 104 |
| 628 | 3300025916 | Ga0207663_10321275 | Ga0207663_103212753 | 104 |
| 629 | 3300025917 | Ga0207660_10018252 | Ga0207660_100182522 | 104 |
| 630 | 3300025917 | Ga0207660_10025359 | Ga0207660_100253592 | 104 |
| 631 | 3300025918 | Ga0207662_10019315 | Ga0207662_100193152 | 104 |
| 632 | 3300025918 | Ga0207662_10251634 | Ga0207662_102516342 | 104 |
| 633 | 3300025919 | Ga0207657_10012324 | Ga0207657_100123247 | 104 |
| 634 | 3300025919 | Ga0207657_10020145 | Ga0207657_100201452 | 104 |
| 635 | 3300025920 | Ga0207649_10011169 | Ga0207649_100111692 | 104 |
| 636 | 3300025921 | Ga0207652_10000504 | Ga0207652_100005049 | 104 |
| 637 | 3300025921 | Ga0207652_10098866 | Ga0207652_100988663 | 104 |
| 638 | 3300025922 | Ga0207646_10267553 | Ga0207646_102675532 | 104 |
| 639 | 3300025923 | Ga0207681_10384645 | Ga0207681_103846453 | 104 |
| 640 | 3300025924 | Ga0207694_10084470 | Ga0207694_100844703 | 104 |
| 641 | 3300025924 | Ga0207694_10328421 | Ga0207694_103284211 | 104 |
| 642 | 3300025925 | Ga0207650_10011084 | Ga0207650_100110842 | 104 |
| 643 | 3300025926 | Ga0207659_10029646 | Ga0207659_100296462 | 104 |
| 644 | 3300025926 | Ga0207659_10906264 | Ga0207659_109062641 | 104 |
| 645 | 3300025926 | Ga0207659_11018961 | Ga0207659_110189612 | 104 |
| 646 | 3300025927 | Ga0207687_10011377 | Ga0207687_100113772 | 104 |
| 647 | 3300025927 | Ga0207687_10080384 | Ga0207687_100803843 | 104 |
| 648 | 3300025928 | Ga0207700_10356705 | Ga0207700_103567052 | 104 |
| 649 | 3300025928 | Ga0207700_11136442 | Ga0207700_111364422 | 104 |
| 650 | 3300025929 | Ga0207664_10393745 | Ga0207664_103937451 | 104 |
| 651 | 3300025931 | Ga0207644_10119010 | Ga0207644_101190103 | 104 |
| 652 | 3300025931 | Ga0207644_10215700 | Ga0207644_102157002 | 104 |
| 653 | 3300025932 | Ga0207690_10097968 | Ga0207690_100979682 | 104 |
| 654 | 3300025933 | Ga0207706_10071486 | Ga0207706_100714864 | 104 |
| 655 | 3300025933 | Ga0207706_10239867 | Ga0207706_102398673 | 104 |
| 656 | 3300025935 | Ga0207709_10037156 | Ga0207709_100371562 | 104 |
| 657 | 3300025935 | Ga0207709_10735289 | Ga0207709_107352892 | 104 |
| 658 | 3300025936 | Ga0207670_10212038 | Ga0207670_102120382 | 104 |
| 659 | 3300025936 | Ga0207670_10448113 | Ga0207670_104481132 | 104 |
| 660 | 3300025937 | Ga0207669_10286183 | Ga0207669_102861832 | 104 |
| 661 | 3300025937 | Ga0207669_11582358 | Ga0207669_115823581 | 104 |
| 662 | 3300025938 | Ga0207704_10080313 | Ga0207704_100803133 | 104 |
| 663 | 3300025938 | Ga0207704_10910058 | Ga0207704_109100581 | 104 |
| 664 | 3300025939 | Ga0207665_10000841 | Ga0207665_1000084112 | 104 |
| 665 | 3300025939 | Ga0207665_10244955 | Ga0207665_102449552 | 104 |
| 666 | 3300025940 | Ga0207691_10171271 | Ga0207691_101712713 | 104 |
| 667 | 3300025940 | Ga0207691_10237092 | Ga0207691_102370922 | 104 |
| 668 | 3300025941 | Ga0207711_10260653 | Ga0207711_102606532 | 104 |
| 669 | 3300025941 | Ga0207711_10441140 | Ga0207711_104411403 | 104 |
| 670 | 3300025942 | Ga0207689_10000247 | Ga0207689_1000024728 | 104 |
| 671 | 3300025942 | Ga0207689_10018795 | Ga0207689_100187953 | 104 |
| 672 | 3300025944 | Ga0207661_10008281 | Ga0207661_100082814 | 104 |
| 673 | 3300025944 | Ga0207661_11624024 | Ga0207661_116240241 | 104 |
| 674 | 3300025945 | Ga0207679_10001936 | Ga0207679_100019362 | 104 |
| 675 | 3300025945 | Ga0207679_10816991 | Ga0207679_108169912 | 104 |
| 676 | 3300025949 | Ga0207667_10135964 | Ga0207667_101359643 | 104 |
| 677 | 3300025960 | Ga0207651_11321024 | Ga0207651_113210241 | 104 |
| 678 | 3300025961 | Ga0207712_10065421 | Ga0207712_100654213 | 104 |
| 679 | 3300025972 | Ga0207668_10011015 | Ga0207668_100110152 | 104 |
| 680 | 3300025981 | Ga0207640_10019036 | Ga0207640_100190362 | 104 |
| 681 | 3300025981 | Ga0207640_10366843 | Ga0207640_103668432 | 104 |
| 682 | 3300026023 | Ga0207677_10045516 | Ga0207677_100455163 | 104 |
| 683 | 3300026035 | Ga0207703_10248429 | Ga0207703_102484292 | 104 |
| 684 | 3300026067 | Ga0207678_10000642 | Ga0207678_100006422 | 104 |
| 685 | 3300026067 | Ga0207678_10001249 | Ga0207678_1000124911 | 104 |
| 686 | 3300026075 | Ga0207708_10114677 | Ga0207708_101146773 | 104 |
| 687 | 3300026078 | Ga0207702_10002205 | Ga0207702_100022052 | 104 |
| 688 | 3300026078 | Ga0207702_10093978 | Ga0207702_100939783 | 104 |
| 689 | 3300026088 | Ga0207641_10018849 | Ga0207641_100188492 | 104 |
| 690 | 3300026088 | Ga0207641_10044128 | Ga0207641_100441284 | 104 |
| 691 | 3300026089 | Ga0207648_10317239 | Ga0207648_103172392 | 104 |
| 692 | 3300026089 | Ga0207648_11750794 | Ga0207648_117507941 | 104 |
| 693 | 3300026095 | Ga0207676_10002528 | Ga0207676_100025282 | 104 |
| 694 | 3300026095 | Ga0207676_10107667 | Ga0207676_101076672 | 104 |
| 695 | 3300026095 | Ga0207676_11753542 | Ga0207676_117535422 | 104 |
| 696 | 3300026095 | Ga0207676_11926288 | Ga0207676_119262881 | 104 |
| 697 | 3300026116 | Ga0207674_10367153 | Ga0207674_103671533 | 104 |
| 698 | 3300026116 | Ga0207674_10988309 | Ga0207674_109883091 | 104 |
| 699 | 3300026118 | Ga0207675_100004308 | Ga0207675_10000430813 | 104 |
| 700 | 3300026118 | Ga0207675_100125041 | Ga0207675_1001250412 | 104 |
| 701 | 3300026121 | Ga0207683_10021780 | Ga0207683_100217804 | 104 |
| 702 | 3300026121 | Ga0207683_10055090 | Ga0207683_100550902 | 104 |
| 703 | 3300026142 | Ga0207698_10021270 | Ga0207698_100212703 | 104 |
| 704 | 3300026142 | Ga0207698_10202369 | Ga0207698_102023692 | 104 |
| 705 | 3300027907 | Ga0207428_10107183 | Ga0207428_101071832 | 104 |
| 706 | 3300027907 | Ga0207428_10530242 | Ga0207428_105302422 | 104 |
| 707 | 3300028379 | Ga0268266_10038076 | Ga0268266_100380765 | 104 |
| 708 | 3300028379 | Ga0268266_10087579 | Ga0268266_100875793 | 104 |
| 709 | 3300028379 | Ga0268266_10309304 | Ga0268266_103093041 | 104 |
| 710 | 3300028379 | Ga0268266_11601343 | Ga0268266_116013432 | 104 |
| 711 | 3300028380 | Ga0268265_10153939 | Ga0268265_101539392 | 104 |
| 712 | 3300028381 | Ga0268264_10137202 | Ga0268264_101372022 | 104 |
| 713 | 3300031824 | Ga0307413_11498924 | Ga0307413_114989242 | 104 |
| 714 | 3300032126 | Ga0307415_100687678 | Ga0307415_1006876781 | 104 |
| 715 | 3300034816 | Ga0373930_0095917 | Ga0373930_0095917_266_598 | 104 |
| 716 | 3300034818 | Ga0373950_0069445 | Ga0373950_0069445_284_616 | 104 |
| 717 | 3300034819 | Ga0373958_0198229 | Ga0373958_0198229_117_449 | 104 |
| 718 | 3300034820 | Ga0373959_0041526 | Ga0373959_0041526_190_522 | 104 |
| 719 | 3300035085 | Ga0373929_0073742 | Ga0373929_0073742_161_493 | 104 |
| 720 | 3300035085 | Ga0373929_0126813 | Ga0373929_0126813_23_364 | 104 |
| 721 | 3300035088 | Ga0373940_0020538 | Ga0373940_0020538_333_665 | 104 |
| 722 | 3300035090 | Ga0373949_0029511 | Ga0373949_0029511_425_757 | 104 |
| 723 | 3300035091 | Ga0373951_0075746 | Ga0373951_0075746_221_553 | 104 |
| 724 | 3300035092 | Ga0373952_0038018 | Ga0373952_0038018_112_444 | 104 |
| 725 | 3300035112 | Ga0373932_0072271 | Ga0373932_0072271_516_848 | 104 |
| 726 | 3300035114 | Ga0373939_0140174 | Ga0373939_0140174_254_586 | 104 |
| 727 | 3300035119 | Ga0373956_0360389 | Ga0373956_0360389_91_408 | 104 |
| 728 | 3300035241 | Ga0373961_0137976 | Ga0373961_0137976_426_758 | 104 |
| 729 | 3300035242 | Ga0373962_0093428 | Ga0373962_0093428_430_762 | 104 |
| 730 | 3300035691 | Ga0373931_0005247 | Ga0373931_0005247_2424_2756 | 104 |
| 731 | 3300035691 | Ga0373931_0846090 | Ga0373931_0846090_144_458 | 104 |
| 732 | 3300037068 | Ga0373925_0164312 | Ga0373925_0164312_1150_1509 | 104 |
| 733 | 3300037853 | Ga0436364_0634500 | Ga0436364_0634500_154_474 | 104 |
| 734 | 3300038443 | Ga0395901_0208594 | Ga0395901_0208594_1545_1865 | 104 |
| 735 | 3300038443 | Ga0395901_0617866 | Ga0395901_0617866_600_914 | 104 |
| 736 | 3300039437 | Ga0436365_0521780 | Ga0436365_0521780_1230_1559 | 104 |
| 737 | 3300039437 | Ga0436365_0629779 | Ga0436365_0629779_142_459 | 104 |
| 738 | 3300039453 | Ga0436362_0332052 | Ga0436362_0332052_145_462 | 104 |
| 739 | 3300042005 | Ga0439448_0092466 | Ga0439448_0092466_417_731 | 104 |
| 740 | 3300042016 | Ga0439463_065896 | Ga0439463_065896_253_567 | 104 |
| 741 | 3300042118 | Ga0450914_018083 | Ga0450914_018083_372_686 | 104 |
| 742 | 3300042137 | Ga0450902_086087 | Ga0450902_086087_202_516 | 104 |
| 743 | 3300042157 | Ga0439458_0109399 | Ga0439458_0109399_291_605 | 104 |
| 744 | 3300042438 | Ga0439459_0002498 | Ga0439459_0002498_1359_1673 | 104 |
| 745 | 3300044656 | Ga0466969_0046923 | Ga0466969_0046923_980_1303 | 104 |
| 746 | 3300044684 | Ga0466966_0005077 | Ga0466966_0005077_7225_7548 | 104 |
| 747 | 3300044684 | Ga0466966_0410557 | Ga0466966_0410557_40_363 | 104 |
| 748 | 3300044693 | Ga0466961_0034731 | Ga0466961_0034731_1352_1675 | 104 |
| 749 | 3300044693 | Ga0466961_0099175 | Ga0466961_0099175_812_1126 | 104 |
| 750 | 3300044694 | Ga0466963_0098223 | Ga0466963_0098223_388_708 | 104 |
| 751 | 3300044694 | Ga0466963_0122948 | Ga0466963_0122948_33_356 | 104 |
| 752 | 3300044765 | Ga0466970_0336897 | Ga0466970_0336897_281_604 | 104 |
| 753 | 3300044765 | Ga0466970_0529456 | Ga0466970_0529456_279_605 | 104 |
| 754 | 3300044842 | Ga0466957_1447894 | Ga0466957_1447894_157_480 | 104 |
| 755 | 3300045049 | Ga0466959_0159297 | Ga0466959_0159297_989_1303 | 104 |
| 756 | 3300045049 | Ga0466959_0233960 | Ga0466959_0233960_599_919 | 104 |
| 757 | 3300045049 | Ga0466959_0293888 | Ga0466959_0293888_660_986 | 104 |
| 758 | 3300045049 | Ga0466959_0621274 | Ga0466959_0621274_187_510 | 104 |
| 759 | 3300045836 | Ga0466958_0017906 | Ga0466958_0017906_608_928 | 104 |
| 760 | 3300045836 | Ga0466958_0096466 | Ga0466958_0096466_426_740 | 104 |
| 761 | 3300045836 | Ga0466958_0841491 | Ga0466958_0841491_162_485 | 104 |
| 762 | 3300045976 | Ga0466967_0064160 | Ga0466967_0064160_878_1198 | 104 |
| 763 | 3300045976 | Ga0466967_0161380 | Ga0466967_0161380_153_467 | 104 |
| 764 | 3300045976 | Ga0466967_0361788 | Ga0466967_0361788_888_1220 | 104 |
| 765 | 3300045976 | Ga0466967_0494623 | Ga0466967_0494623_437_760 | 104 |
| 766 | 3300046461 | Ga0495641_0531569 | Ga0495641_0531569_35_367 | 104 |
| 767 | 3300046499 | Ga0495594_0454879 | Ga0495594_0454879_135_467 | 104 |
| 768 | 3300048903 | Ga0496100_0013183 | Ga0496100_0013183_494_808 | 104 |
| 769 | 3300048903 | Ga0496100_0018960 | Ga0496100_0018960_3367_3699 | 104 |
| 770 | 3300048905 | Ga0496102_0097385 | Ga0496102_0097385_1679_1993 | 104 |
| 771 | 3300048905 | Ga0496102_0425862 | Ga0496102_0425862_653_985 | 104 |
| 772 | 3300048906 | Ga0496103_0072910 | Ga0496103_0072910_180_512 | 104 |
| 773 | 3300048907 | Ga0496104_0024974 | Ga0496104_0024974_850_1164 | 104 |
| 774 | 3300048907 | Ga0496104_0121240 | Ga0496104_0121240_2096_2428 | 104 |
| 775 | 3300048908 | Ga0496105_0001319 | Ga0496105_0001319_597_911 | 104 |
| 776 | 3300048908 | Ga0496105_0133027 | Ga0496105_0133027_601_933 | 104 |
| 777 | 3300048909 | Ga0496106_0016694 | Ga0496106_0016694_4484_4798 | 104 |
| 778 | 3300048909 | Ga0496106_0020578 | Ga0496106_0020578_3611_3943 | 104 |
| 779 | 3300048910 | Ga0496107_0065388 | Ga0496107_0065388_1264_1596 | 104 |
| 780 | 3300048910 | Ga0496107_0147572 | Ga0496107_0147572_934_1248 | 104 |
| 781 | 3300048911 | Ga0496108_0010564 | Ga0496108_0010564_3796_4128 | 104 |
| 782 | 3300048911 | Ga0496108_0167112 | Ga0496108_0167112_1378_1692 | 104 |
| 783 | 3300048912 | Ga0496109_0008423 | Ga0496109_0008423_3531_3863 | 104 |
| 784 | 3300048913 | Ga0496110_0017885 | Ga0496110_0017885_4332_4664 | 104 |
| 785 | 3300048913 | Ga0496110_0018611 | Ga0496110_0018611_588_902 | 104 |
| 786 | 3300048913 | Ga0496110_1003861 | Ga0496110_1003861_300_620 | 104 |
| 787 | 3300048914 | Ga0496111_0036953 | Ga0496111_0036953_2528_2842 | 104 |
| 788 | 3300048914 | Ga0496111_0174980 | Ga0496111_0174980_232_564 | 104 |
| 789 | 3300048914 | Ga0496111_0685254 | Ga0496111_0685254_355_675 | 104 |
| 790 | 3300048915 | Ga0496112_0040203 | Ga0496112_0040203_1135_1467 | 104 |
| 791 | 3300048915 | Ga0496112_0042662 | Ga0496112_0042662_4047_4361 | 104 |
| 792 | 3300048916 | Ga0496113_0057834 | Ga0496113_0057834_1633_1947 | 104 |
| 793 | 3300048916 | Ga0496113_0169952 | Ga0496113_0169952_518_850 | 104 |
| 794 | 3300048917 | Ga0496114_0030521 | Ga0496114_0030521_3004_3336 | 104 |
| 795 | 3300048917 | Ga0496114_0139236 | Ga0496114_0139236_1080_1394 | 104 |
| 796 | 3300048918 | Ga0496115_0033887 | Ga0496115_0033887_2238_2570 | 104 |
| 797 | 3300048929 | Ga0496126_0000013 | Ga0496126_0000013_505835_506155 | 104 |
| 798 | 3300048929 | Ga0496126_0048031 | Ga0496126_0048031_2828_3208 | 104 |
| 799 | 3300050507 | nmdc:mga05p37_1325116_c1 | nmdc:mga05p37_1325116_c1_33_347 | 104 |
| 800 | 3300050507 | nmdc:mga05p37_384303_c1 | nmdc:mga05p37_384303_c1_1221_1535 | 104 |
| 801 | 3300050507 | nmdc:mga05p37_903522_c1 | nmdc:mga05p37_903522_c1_124_438 | 104 |
| 802 | 3300050508 | nmdc:mga09592_307899_c1 | nmdc:mga09592_307899_c1_185_499 | 104 |
| 803 | 3300050508 | nmdc:mga09592_715019_c1 | nmdc:mga09592_715019_c1_344_658 | 104 |
| 804 | 3300050510 | nmdc:mga06r32_134951_c1 | nmdc:mga06r32_134951_c1_1075_1389 | 104 |
| 805 | 3300050510 | nmdc:mga06r32_444570_c1 | nmdc:mga06r32_444570_c1_771_1085 | 104 |
| 806 | 3300050510 | nmdc:mga06r32_59733_c1 | nmdc:mga06r32_59733_c1_252_566 | 104 |
| 807 | 3300050511 | nmdc:mga08y16_147144_c1 | nmdc:mga08y16_147144_c1_760_1074 | 104 |
| 808 | 3300050511 | nmdc:mga08y16_1854401_c1 | nmdc:mga08y16_1854401_c1_192_524 | 104 |
| 809 | 3300050512 | nmdc:mga0n895_157140_c1 | nmdc:mga0n895_157140_c1_855_1169 | 104 |
| 810 | 3300050512 | nmdc:mga0n895_26897_c1 | nmdc:mga0n895_26897_c1_2713_3045 | 104 |
| 811 | 3300050513 | nmdc:mga0rr50_218326_c1 | nmdc:mga0rr50_218326_c1_1134_1466 | 104 |
| 812 | 3300050513 | nmdc:mga0rr50_4976_c1 | nmdc:mga0rr50_4976_c1_6820_7134 | 104 |
| 813 | 3300050514 | nmdc:mga08x19_14945_c1 | nmdc:mga08x19_14945_c1_807_1121 | 104 |
| 814 | 3300050514 | nmdc:mga08x19_79940_c1 | nmdc:mga08x19_79940_c1_1058_1390 | 104 |
| 815 | 3300050515 | nmdc:mga0a205_3011_c1 | nmdc:mga0a205_3011_c1_10992_11306 | 104 |
| 816 | 3300050515 | nmdc:mga0a205_35069_c1 | nmdc:mga0a205_35069_c1_3287_3619 | 104 |
| 817 | 3300054114 | Ga0501084_1162898 | Ga0501084_1162898_305_619 | 104 |
| 818 | 3300059477 | Ga0587084_065957 | Ga0587084_065957_98_415 | 104 |
| 819 | 3300059491 | Ga0587070_157464 | Ga0587070_157464_199_513 | 104 |
| 820 | 3300059504 | Ga0587082_170623 | Ga0587082_170623_147_461 | 104 |
| 821 | 3300059505 | Ga0587083_0239493 | Ga0587083_0239493_119_433 | 104 |
| 822 | 3300059508 | Ga0587088_185101 | Ga0587088_185101_66_383 | 104 |
| 823 | 3300059509 | Ga0587089_057798 | Ga0587089_057798_165_479 | 104 |
| 824 | 3300059510 | Ga0587090_132322 | Ga0587090_132322_221_541 | 104 |
| 825 | 3300059512 | Ga0587092_155379 | Ga0587092_155379_164_481 | 104 |
| 826 | 3300059513 | Ga0587094_112888 | Ga0587094_112888_41_355 | 104 |
| 827 | 3300059607 | Ga0587125_033373 | Ga0587125_033373_54_368 | 104 |
| 828 | 3300059625 | Ga0587113_026753 | Ga0587113_026753_225_539 | 104 |
| 829 | 3300059627 | Ga0587117_121527 | Ga0587117_121527_75_389 | 104 |
| 830 | 3300059628 | Ga0587122_028664 | Ga0587122_028664_283_597 | 104 |
| 831 | 3300059640 | Ga0587067_109589 | Ga0587067_109589_254_568 | 104 |
| 832 | 3300059645 | Ga0587076_150445 | Ga0587076_150445_106_423 | 104 |
| 833 | 3300059646 | Ga0587078_024412 | Ga0587078_024412_315_629 | 104 |
| 834 | 3300059646 | Ga0587078_042880 | Ga0587078_042880_256_576 | 104 |
| 835 | 3300059647 | Ga0587079_132520 | Ga0587079_132520_231_548 | 104 |
| 836 | 3300059654 | Ga0587110_026956 | Ga0587110_026956_286_600 | 104 |
| 837 | 3300059659 | Ga0587120_038741 | Ga0587120_038741_178_495 | 104 |
| 838 | 3300060344 | Ga0587071_206712 | Ga0587071_206712_149_466 | 104 |
| 839 | 3300060346 | Ga0587111_0277630 | Ga0587111_0277630_50_364 | 104 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8cvm-assembly1.cif.gz_q | cutibacterium acnes 50s ribosomal subunit with p-site trna and sarecycline bound in the local refined map | 0.9406 | 1 | 101 |
| 7y41-assembly1.cif.gz_S | mycobacterium smegmatis 50s ribosomal subunit from log phase of growth | 0.9338 | 1 | 100 |
| 7msm-assembly1.cif.gz_R | mtb 70sic in complex with mtbetta at trans_r0 state | 0.9317 | 1 | 100 |
| 7y41-assembly1.cif.gz_S | mycobacterium smegmatis 50s ribosomal subunit from log phase of growth | 0.925 | 1 | 100 |
| 8cvm-assembly1.cif.gz_q | cutibacterium acnes 50s ribosomal subunit with p-site trna and sarecycline bound in the local refined map | 0.9232 | 1 | 101 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WHC3_3_102_2.40.10.190 | Mainly Beta;Beta Barrel;Thrombin, subunit H;translation elongation factor selb, chain A, domain 4 | 0.9419 | 1 | 100 | 2.40.10.190 |
| af_P9WHC3_3_102_2.40.10.190 | Mainly Beta;Beta Barrel;Thrombin, subunit H;translation elongation factor selb, chain A, domain 4 | 0.933 | 1 | 100 | 2.40.10.190 |
| af_P0AG48_1_101_2.40.10.190 | Mainly Beta;Beta Barrel;Thrombin, subunit H;translation elongation factor selb, chain A, domain 4 | 0.926 | 1 | 100 | 2.40.10.190 |
| af_Q4DUK1_23_123_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9244 | 1 | 100 | 2.40.50.140 |
| af_A0A1D6H5B5_111_217_2.40.10.190 | Mainly Beta;Beta Barrel;Thrombin, subunit H;translation elongation factor selb, chain A, domain 4 | 0.9094 | 1 | 100 | 2.40.10.190 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-E6D663-F1-model_v4 | deleted | 0.9783 | 2 | 101 |
|
| AF-A0A7C6IEB5-F1-model_v4 | Large ribosomal subunit protein bL21 | 0.9731 | 2 | 101 |
GO:0003735
GO:0005737 GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-L1PLH8-F1-model_v4 | deleted | 0.9731 | 2 | 101 |
|
| AF-A0A4R4ZVZ2-F1-model_v4 | Large ribosomal subunit protein bL21 | 0.9729 | 1 | 102 |
GO:0003735
GO:0005737 GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-H5X4E2-F1-model_v4 | Large ribosomal subunit protein bL21 | 0.9716 | 2 | 101 |
GO:0003735
GO:0005737 GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar