F483007

General Info

Members Datasets Scaffolds Average Seq Length
839 374 839 106

Family's Representative Sequence

Representative Sequence 3300005341|Ga0070691_10580119|Ga0070691_105801191
Length 104
Sequence MYAVIKTGGKQYKVASGDVILVEKIEGDAGASITLAEVLMIGDGANITVGAPTVKGSSVAAEVVDQVKADKVIIFKKNRRHNYRRKNGHRQKLTELKITGISAA

Samples

Sample ID Description Type Environment
1 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
9 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
10 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
11 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
12 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
13 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
14 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
15 3300004785 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
16 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
17 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
18 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
19 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
20 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
23 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
24 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
25 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
26 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
27 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
28 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
29 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
30 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
31 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
32 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
33 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
34 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
35 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
36 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
37 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
38 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
39 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
40 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
41 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
42 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
43 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
44 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
45 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
46 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
47 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
48 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
49 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
50 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
51 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
52 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
53 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
54 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
55 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
56 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
57 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
58 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
59 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
60 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
61 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
62 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
63 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
64 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
65 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
66 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
67 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
68 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
69 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
70 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
71 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
72 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
73 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
74 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
75 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
76 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
77 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
78 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
79 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
80 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
81 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
82 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
83 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
84 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
85 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
86 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
87 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
88 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
89 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
90 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
91 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
92 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
93 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
94 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
95 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
96 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
97 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
98 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
99 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
100 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
101 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
102 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
103 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
104 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
105 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
106 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
107 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
108 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
109 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
110 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
111 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
112 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
113 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
114 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
115 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
116 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
117 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
118 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
119 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
120 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
121 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
122 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
123 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
124 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
125 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
126 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
127 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
128 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
129 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
130 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
131 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
132 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
133 3300013043 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
134 3300013044 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
135 3300013045 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
136 3300013052 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
137 3300013059 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
138 3300013062 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
139 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
140 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
141 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
142 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
143 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
144 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
145 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
146 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
147 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
148 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
149 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
150 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
151 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
152 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
153 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
154 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
155 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
156 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
157 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
158 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
159 3300020071 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
160 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
161 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
162 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
163 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
164 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
165 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
166 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
167 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
169 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
170 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
233 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
237 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
238 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
239 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
240 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
241 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
242 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
243 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
244 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
245 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
246 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
247 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
248 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
249 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
250 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
251 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
252 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
253 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
254 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
255 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
256 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
257 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
258 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
259 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
260 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
261 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
262 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
263 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
264 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
265 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
266 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
267 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
268 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
269 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
270 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
271 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
272 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
273 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
274 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
275 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
276 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
277 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
278 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
279 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
280 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
281 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
282 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
283 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
284 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
285 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
286 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
287 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
288 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
289 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
290 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
291 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
292 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
293 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
294 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
295 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
296 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
297 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
298 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
299 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
300 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
301 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
302 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
303 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
304 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
305 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
306 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
307 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
308 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
309 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
310 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
311 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
312 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
313 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
314 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
315 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
316 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
317 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
318 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
319 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
320 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
321 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
322 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
323 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
324 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
325 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
326 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
327 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
328 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
329 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
330 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
331 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
332 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
333 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
334 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
335 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
336 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
337 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
338 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
339 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
340 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
341 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
342 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
343 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
344 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
345 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
346 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
347 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
348 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
349 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
350 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
351 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
352 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
353 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
354 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
355 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
356 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
357 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
358 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
359 3300059628 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
360 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
361 3300059631 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
362 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
363 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
364 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
365 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
366 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
367 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
368 3300059650 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 69R_SD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
369 3300059654 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
370 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
371 3300059659 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 157R_AD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
372 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
373 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
374 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.72
Metatranscriptomes 17.28
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.12
Nodule 0
Rhizoplane 6.2
Rhizosphere 91.18
Stem 0
Stem Tuber 0
Unclassified 2.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1025334 3300001915 Bacteria 907
2 JGI24740J21852_10102749 3300001979 Bacteria 726
3 JGI24739J22299_10239451 3300001989 Bacteria 531
4 JGI24737J22298_10067221 3300001990 Bacteria 1073
5 JGI24737J22298_10266325 3300001990 Bacteria 507
6 JGI24743J22301_10010175 3300001991 Bacteria 1675
7 JGI24743J22301_10143490 3300001991 Bacteria 532
8 JGI24735J21928_10088130 3300002067 Bacteria 889
9 JGI24735J21928_10094505 3300002067 Bacteria 858
10 JGI24735J21928_10099704 3300002067 Bacteria 834
11 JGI24735J21928_10150729 3300002067 Bacteria 671
12 JGI24735J21928_10179578 3300002067 Bacteria 613
13 JGI24738J21930_10036034 3300002075 Bacteria 1007
14 JGI24033J26618_1016950 3300002155 Bacteria 909
15 JGI24751J29686_10008749 3300002459 Bacteria 2075
16 Ga0006777J48905_1069915 3300003308 Bacteria 749
17 Ga0007409J51694_1061986 3300003575 Bacteria 657
18 Ga0007409J51694_1108460 3300003575 Bacteria 683
19 Ga0007429J51699_1018112 3300003579 Bacteria 728
20 JGI25404J52841_10125115 3300003659 Bacteria 542
21 Ga0032354_1058136 3300003693 Bacteria 636
22 Ga0058858_1228152 3300004785 Bacteria 761
23 Ga0058859_11241572 3300004798 Bacteria 678
24 Ga0058859_11702261 3300004798 Bacteria 510
25 Ga0058863_10038017 3300004799 Bacteria 583
26 Ga0058863_10049759 3300004799 Bacteria 627
27 Ga0058863_11784877 3300004799 Bacteria 898
28 Ga0058863_11912344 3300004799 Bacteria 590
29 Ga0058861_10170916 3300004800 Bacteria 602
30 Ga0058860_10051072 3300004801 Bacteria 741
31 Ga0058860_11926006 3300004801 Bacteria 535
32 Ga0058860_12151711 3300004801 Bacteria 837
33 Ga0058862_10038154 3300004803 Bacteria 881
34 Ga0058862_10059979 3300004803 Bacteria 587
35 Ga0070658_10002776 3300005327 Bacteria 14551
36 Ga0070658_10017448 3300005327 Bacteria 5744
37 Ga0070658_10236294 3300005327 Bacteria 1548
38 Ga0070658_10994130 3300005327 Bacteria 730
39 Ga0070676_10061366 3300005328 Bacteria 2235
40 Ga0070683_100249062 3300005329 Bacteria 1690
41 Ga0070683_100477399 3300005329 Bacteria 1190
42 Ga0070683_101413057 3300005329 Bacteria 669
43 Ga0070690_100311378 3300005330 Bacteria 1132
44 Ga0070677_10604200 3300005333 Bacteria 608
45 Ga0068869_100014640 3300005334 Bacteria 5244
46 Ga0068869_100115301 3300005334 Bacteria 2048
47 Ga0070666_10239457 3300005335 Bacteria 1283
48 Ga0070680_100000403 3300005336 Bacteria 29539
49 Ga0070680_100102565 3300005336 Bacteria 2376
50 Ga0070682_100009318 3300005337 Bacteria 5558
51 Ga0070682_100250965 3300005337 Bacteria 1275
52 Ga0070682_100570786 3300005337 Bacteria 888
53 Ga0070682_100779688 3300005337 Bacteria 775
54 Ga0070682_101669639 3300005337 Bacteria 553
55 Ga0068868_100010973 3300005338 Bacteria 6581
56 Ga0068868_100336562 3300005338 Bacteria 1289
57 Ga0070660_100042679 3300005339 Bacteria 3463
58 Ga0070660_100415482 3300005339 Bacteria 1113
59 Ga0070660_101093654 3300005339 Bacteria 675
60 Ga0070689_100037765 3300005340 Bacteria 3694
61 Ga0070689_100379023 3300005340 Bacteria 1192
62 Ga0070691_10002288 3300005341 Bacteria 8483
63 Ga0070691_10347568 3300005341 Bacteria 822
64 Ga0070691_10580119 3300005341 Bacteria 659
65 Ga0070687_100394995 3300005343 Bacteria 905
66 Ga0070661_100067572 3300005344 Bacteria 2627
67 Ga0070661_100476130 3300005344 Bacteria 996
68 Ga0070661_101184025 3300005344 Bacteria 639
69 Ga0070692_10001141 3300005345 Bacteria 9321
70 Ga0070692_10367576 3300005345 Bacteria 898
71 Ga0070668_100440273 3300005347 Bacteria 1119
72 Ga0070669_100136030 3300005353 Bacteria 1890
73 Ga0070669_100592761 3300005353 Bacteria 928
74 Ga0070675_100190937 3300005354 Bacteria 1775
75 Ga0070675_100426515 3300005354 Bacteria 1186
76 Ga0070671_100022196 3300005355 Bacteria 5185
77 Ga0070671_100066003 3300005355 Bacteria 3015
78 Ga0070674_100243236 3300005356 Bacteria 1410
79 Ga0070674_101087106 3300005356 Bacteria 706
80 Ga0070673_100045389 3300005364 Bacteria 3408
81 Ga0070673_101692251 3300005364 Bacteria 598
82 Ga0070688_100124063 3300005365 Bacteria 1734
83 Ga0070659_100073970 3300005366 Bacteria 2713
84 Ga0070659_101297416 3300005366 Bacteria 645
85 Ga0070667_100181210 3300005367 Bacteria 1863
86 Ga0070703_10020264 3300005406 Bacteria 1934
87 Ga0070709_10082413 3300005434 Bacteria 2101
88 Ga0070709_10204350 3300005434 Bacteria 1401
89 Ga0070714_100039499 3300005435 Bacteria 3974
90 Ga0070714_100196267 3300005435 Bacteria 1844
91 Ga0070714_100702659 3300005435 Bacteria 976
92 Ga0070714_100759449 3300005435 Bacteria 938
93 Ga0070713_100003681 3300005436 Bacteria 10146
94 Ga0070713_100063954 3300005436 Bacteria 3086
95 Ga0070713_100193100 3300005436 Bacteria 1836
96 Ga0070710_10087279 3300005437 Bacteria 1833
97 Ga0070701_11063369 3300005438 Bacteria 568
98 Ga0070711_100063662 3300005439 Bacteria 2575
99 Ga0070711_100467443 3300005439 Bacteria 1035
100 Ga0070705_100779847 3300005440 Bacteria 758
101 Ga0070700_100015218 3300005441 Bacteria 4359
102 Ga0070694_100451973 3300005444 Bacteria 1014
103 Ga0070708_101382832 3300005445 Bacteria 657
104 Ga0070708_101856206 3300005445 Bacteria 559
105 Ga0070663_100022899 3300005455 Bacteria 4181
106 Ga0070663_100255275 3300005455 Bacteria 1389
107 Ga0070663_100476598 3300005455 Bacteria 1032
108 Ga0070678_100036827 3300005456 Bacteria 3428
109 Ga0070678_100047642 3300005456 Bacteria 3081
110 Ga0070662_100473929 3300005457 Bacteria 1041
111 Ga0070662_100807909 3300005457 Bacteria 797
112 Ga0070662_101544972 3300005457 Bacteria 573
113 Ga0070681_10032811 3300005458 Bacteria 5213
114 Ga0070681_10066114 3300005458 Bacteria 3584
115 Ga0070681_11138170 3300005458 Bacteria 702
116 Ga0068867_102103651 3300005459 Bacteria 535
117 Ga0068867_102351593 3300005459 Bacteria 507
118 Ga0070685_10047048 3300005466 Bacteria 2479
119 Ga0070706_100304029 3300005467 Bacteria 1488
120 Ga0070707_100467645 3300005468 Bacteria 1222
121 Ga0070699_100596772 3300005518 Bacteria 1007
122 Ga0070679_100000591 3300005530 Bacteria 30747
123 Ga0070679_100189316 3300005530 Bacteria 2027
124 Ga0070679_100669321 3300005530 Bacteria 981
125 Ga0070679_100974609 3300005530 Bacteria 792
126 Ga0070684_100357105 3300005535 Bacteria 1345
127 Ga0070684_102323874 3300005535 Bacteria 505
128 Ga0070697_100121856 3300005536 Bacteria 2182
129 Ga0068853_100052946 3300005539 Bacteria 3495
130 Ga0068853_100063236 3300005539 Bacteria 3205
131 Ga0068853_102408943 3300005539 Bacteria 510
132 Ga0070672_100116896 3300005543 Bacteria 2179
133 Ga0070672_100908966 3300005543 Bacteria 778
134 Ga0070686_100147763 3300005544 Bacteria 1643
135 Ga0070686_100501870 3300005544 Bacteria 941
136 Ga0070695_100147064 3300005545 Bacteria 1640
137 Ga0070696_100044500 3300005546 Bacteria 3073
138 Ga0070693_100045268 3300005547 Bacteria 2493
139 Ga0070693_100209279 3300005547 Bacteria 1272
140 Ga0070665_100055530 3300005548 Bacteria 3971
141 Ga0070665_100282904 3300005548 Bacteria 1660
142 Ga0070704_100119640 3300005549 Bacteria 2020
143 Ga0068855_100056300 3300005563 Bacteria 4615
144 Ga0068855_100061160 3300005563 Bacteria 4401
145 Ga0068855_100101198 3300005563 Bacteria 3317
146 Ga0068855_100785786 3300005563 Bacteria 1013
147 Ga0068855_101946628 3300005563 Bacteria 595
148 Ga0070664_100683268 3300005564 Bacteria 955
149 Ga0068857_101079557 3300005577 Bacteria 775
150 Ga0068854_100102323 3300005578 Bacteria 2149
151 Ga0068854_100190576 3300005578 Bacteria 1606
152 Ga0068856_100520717 3300005614 Bacteria 1210
153 Ga0068856_100683982 3300005614 Bacteria 1046
154 Ga0068856_101083455 3300005614 Bacteria 819
155 Ga0070702_100000310 3300005615 Bacteria 16830
156 Ga0070702_100025843 3300005615 Bacteria 3150
157 Ga0068852_100007126 3300005616 Bacteria 8147
158 Ga0068852_100058031 3300005616 Bacteria 3350
159 Ga0068852_100581584 3300005616 Bacteria 1123
160 Ga0068852_101197733 3300005616 Bacteria 780
161 Ga0068859_100009699 3300005617 Bacteria 9721
162 Ga0068859_100216754 3300005617 Bacteria 2002
163 Ga0068859_100278093 3300005617 Bacteria 1766
164 Ga0068864_100148152 3300005618 Bacteria 2123
165 Ga0068864_101321867 3300005618 Bacteria 721
166 Ga0068866_10424985 3300005718 Bacteria 863
167 Ga0068861_100009878 3300005719 Bacteria 6602
168 Ga0068851_10093763 3300005834 Bacteria 1585
169 Ga0068851_10141320 3300005834 Bacteria 1309
170 Ga0068870_10031322 3300005840 Bacteria 2694
171 Ga0068870_10096807 3300005840 Bacteria 1660
172 Ga0068863_100056137 3300005841 Bacteria 3728
173 Ga0068858_100061566 3300005842 Bacteria 3470
174 Ga0068860_100086873 3300005843 Bacteria 2977
175 Ga0068860_100447135 3300005843 Bacteria 1285
176 Ga0068862_101137353 3300005844 Bacteria 777
177 Ga0081455_10003134 3300005937 Bacteria 19237
178 Ga0081455_10226092 3300005937 Bacteria 1384
179 Ga0081455_10438380 3300005937 Bacteria 896
180 Ga0081455_10540138 3300005937 Bacteria 773
181 Ga0081540_1057314 3300005983 Bacteria 1885
182 Ga0081540_1124755 3300005983 Bacteria 1062
183 Ga0070717_10109999 3300006028 Bacteria 2349
184 Ga0070717_10127752 3300006028 Bacteria 2184
185 Ga0075432_10078396 3300006058 Bacteria 1195
186 Ga0075432_10576757 3300006058 Bacteria 511
187 Ga0070716_101004882 3300006173 Bacteria 660
188 Ga0070716_101602155 3300006173 Bacteria 535
189 Ga0070712_100771338 3300006175 Bacteria 824
190 Ga0070712_100999870 3300006175 Bacteria 724
191 Ga0070712_101084186 3300006175 Bacteria 695
192 Ga0070712_101652683 3300006175 Bacteria 560
193 Ga0070712_101652685 3300006175 Bacteria 560
194 Ga0097621_100256560 3300006237 Bacteria 1533
195 Ga0068871_100618252 3300006358 Bacteria 986
196 Ga0075428_100709312 3300006844 Bacteria 1072
197 Ga0075428_100987396 3300006844 Bacteria 892
198 Ga0075428_101126428 3300006844 Bacteria 828
199 Ga0075430_100828232 3300006846 Bacteria 763
200 Ga0075431_100111461 3300006847 Bacteria 2824
201 Ga0075431_100165218 3300006847 Bacteria 2275
202 Ga0075431_100272814 3300006847 Bacteria 1714
203 Ga0075433_10023324 3300006852 Bacteria 5207
204 Ga0075433_10038514 3300006852 Bacteria 4129
205 Ga0075434_100020783 3300006871 Bacteria 6372
206 Ga0075434_100773784 3300006871 Bacteria 976
207 Ga0075429_100069055 3300006880 Bacteria 3076
208 Ga0075429_100160507 3300006880 Bacteria 1969
209 Ga0075429_100333478 3300006880 Bacteria 1328
210 Ga0068865_100115964 3300006881 Bacteria 1983
211 Ga0075436_100037931 3300006914 Bacteria 3326
212 Ga0075436_100175281 3300006914 Bacteria 1514
213 Ga0097620_100009699 3300006931 Bacteria 9721
214 Ga0097620_100216736 3300006931 Bacteria 2002
215 Ga0097620_100278078 3300006931 Bacteria 1766
216 Ga0075435_100067286 3300007076 Bacteria 2916
217 Ga0075435_100083231 3300007076 Bacteria 2630
218 Ga0105251_10087257 3300009011 Bacteria 1436
219 Ga0105244_10218282 3300009036 Bacteria 895
220 Ga0105250_10389224 3300009092 Bacteria 616
221 Ga0105240_10099855 3300009093 Bacteria 3532
222 Ga0105240_10509793 3300009093 Bacteria 1336
223 Ga0105240_11068288 3300009093 Bacteria 860
224 Ga0111539_10042854 3300009094 Bacteria 5430
225 Ga0111539_10070023 3300009094 Bacteria 4141
226 Ga0105245_10003794 3300009098 Bacteria 13443
227 Ga0105245_10173032 3300009098 Bacteria 2057
228 Ga0105245_10312756 3300009098 Bacteria 1545
229 Ga0105245_10685755 3300009098 Bacteria 1057
230 Ga0105247_10003047 3300009101 Bacteria 11095
231 Ga0105247_10052180 3300009101 Bacteria 2521
232 Ga0105247_10103075 3300009101 Bacteria 1827
233 Ga0114129_10335614 3300009147 Bacteria 2006
234 Ga0114129_10408251 3300009147 Bacteria 1789
235 Ga0105243_10100987 3300009148 Bacteria 2395
236 Ga0105243_10991808 3300009148 Bacteria 842
237 Ga0105243_11848405 3300009148 Bacteria 636
238 Ga0105241_10051781 3300009174 Bacteria 3132
239 Ga0105241_10101976 3300009174 Bacteria 2283
240 Ga0105241_10140534 3300009174 Bacteria 1965
241 Ga0105241_10320648 3300009174 Bacteria 1336
242 Ga0105242_10295740 3300009176 Bacteria 1476
243 Ga0105248_10202161 3300009177 Bacteria 2238
244 Ga0105248_10369887 3300009177 Bacteria 1614
245 Ga0105237_10108611 3300009545 Bacteria 2766
246 Ga0105237_10210685 3300009545 Bacteria 1943
247 Ga0105237_10211380 3300009545 Bacteria 1940
248 Ga0105237_10776254 3300009545 Bacteria 965
249 Ga0105237_11267190 3300009545 Bacteria 744
250 Ga0105237_11589177 3300009545 Bacteria 661
251 Ga0105237_11731426 3300009545 Bacteria 632
252 Ga0105238_10141262 3300009551 Bacteria 2385
253 Ga0105238_10268938 3300009551 Bacteria 1685
254 Ga0105238_10316290 3300009551 Bacteria 1547
255 Ga0105249_10003351 3300009553 Bacteria 13865
256 Ga0105249_10371869 3300009553 Bacteria 1453
257 Ga0105239_10219946 3300010375 Bacteria 2130
258 Ga0105239_10254149 3300010375 Bacteria 1974
259 Ga0105239_10262054 3300010375 Bacteria 1943
260 Ga0105239_10738216 3300010375 Bacteria 1127
261 Ga0105239_10888391 3300010375 Bacteria 1023
262 Ga0105246_10092415 3300011119 Bacteria 2183
263 Ga0105246_11680503 3300011119 Bacteria 603
264 Ga0157322_1017566 3300012490 Bacteria 658
265 Ga0157339_1007253 3300012505 Bacteria 926
266 Ga0157327_1051457 3300012512 Bacteria 587
267 Ga0157338_1025808 3300012515 Bacteria 717
268 Ga0154018_106035 3300013043 Bacteria 615
269 Ga0154019_132188 3300013044 Bacteria 679
270 Ga0154016_126325 3300013045 Bacteria 656
271 Ga0154016_141312 3300013045 Bacteria 624
272 Ga0154014_115819 3300013052 Bacteria 632
273 Ga0154012_121067 3300013059 Bacteria 732
274 Ga0154012_145613 3300013059 Bacteria 500
275 Ga0154010_133995 3300013062 Bacteria 552
276 Ga0154010_163592 3300013062 Bacteria 636
277 Ga0157373_10064774 3300013100 Bacteria 2587
278 Ga0157373_10102351 3300013100 Bacteria 2015
279 Ga0157371_10087013 3300013102 Bacteria 2213
280 Ga0157371_10181287 3300013102 Bacteria 1506
281 Ga0157370_10032625 3300013104 Bacteria 5084
282 Ga0157370_10243087 3300013104 Bacteria 1665
283 Ga0157369_10138299 3300013105 Bacteria 2578
284 Ga0157369_10335593 3300013105 Bacteria 1570
285 Ga0157369_10421418 3300013105 Bacteria 1384
286 Ga0157369_10751155 3300013105 Bacteria 1003
287 Ga0157369_11113801 3300013105 Bacteria 807
288 Ga0157369_11556107 3300013105 Bacteria 672
289 Ga0157374_10013476 3300013296 Bacteria 7134
290 Ga0157374_10085138 3300013296 Bacteria 3005
291 Ga0157374_10903969 3300013296 Bacteria 900
292 Ga0157378_10107645 3300013297 Bacteria 2551
293 Ga0157378_10203628 3300013297 Bacteria 1873
294 Ga0163162_10010190 3300013306 Bacteria 9129
295 Ga0163162_11808158 3300013306 Bacteria 699
296 Ga0157372_10033763 3300013307 Bacteria 5622
297 Ga0157372_11878948 3300013307 Bacteria 688
298 Ga0157375_10320460 3300013308 Bacteria 1715
299 Ga0157375_10422338 3300013308 Bacteria 1499
300 Ga0163163_10075082 3300014325 Bacteria 3374
301 Ga0163163_10213130 3300014325 Bacteria 1980
302 Ga0157380_10027310 3300014326 Bacteria 4340
303 Ga0182008_10423769 3300014497 Bacteria 719
304 Ga0157377_10116951 3300014745 Bacteria 1611
305 Ga0157377_10132403 3300014745 Bacteria 1525
306 Ga0157379_10017319 3300014968 Bacteria 6349
307 Ga0157379_10034232 3300014968 Bacteria 4528
308 Ga0157379_11640908 3300014968 Bacteria 628
309 Ga0157376_10365935 3300014969 Bacteria 1384
310 Ga0157376_10574614 3300014969 Bacteria 1119
311 Ga0157376_10686039 3300014969 Bacteria 1028
312 Ga0182007_10225604 3300015262 Bacteria 663
313 Ga0182005_1143526 3300015265 Bacteria 691
314 Ga0163161_10062232 3300017792 Bacteria 2718
315 Ga0197907_10136472 3300020069 Bacteria 884
316 Ga0197907_10165799 3300020069 Bacteria 618
317 Ga0197907_10417371 3300020069 Bacteria 531
318 Ga0197907_10655106 3300020069 Bacteria 515
319 Ga0197907_10665716 3300020069 Bacteria 817
320 Ga0197907_10813524 3300020069 Bacteria 593
321 Ga0197907_10890214 3300020069 Bacteria 1979
322 Ga0197907_11011918 3300020069 Bacteria 706
323 Ga0197907_11236551 3300020069 Bacteria 817
324 Ga0197907_11425260 3300020069 Bacteria 621
325 Ga0197907_11425484 3300020069 Bacteria 725
326 Ga0206356_10461214 3300020070 Bacteria 767
327 Ga0206356_11192521 3300020070 Bacteria 631
328 Ga0206356_11542350 3300020070 Bacteria 4382
329 Ga0206348_118668 3300020071 Bacteria 677
330 Ga0206349_1039003 3300020075 Bacteria 1243
331 Ga0206349_1572799 3300020075 Bacteria 748
332 Ga0206349_1745300 3300020075 Bacteria 648
333 Ga0206355_1029950 3300020076 Bacteria 761
334 Ga0206355_1282491 3300020076 Bacteria 692
335 Ga0206355_1285473 3300020076 Bacteria 705
336 Ga0206355_1437175 3300020076 Bacteria 859
337 Ga0206355_1468932 3300020076 Bacteria 697
338 Ga0206355_1470679 3300020076 Bacteria 1051
339 Ga0206355_1565251 3300020076 Bacteria 817
340 Ga0206351_10129930 3300020077 Bacteria 592
341 Ga0206351_10138064 3300020077 Bacteria 710
342 Ga0206351_10165192 3300020077 Bacteria 531
343 Ga0206351_10317064 3300020077 Bacteria 536
344 Ga0206351_10583506 3300020077 Bacteria 698
345 Ga0206352_10453915 3300020078 Bacteria 655
346 Ga0206352_10583660 3300020078 Bacteria 630
347 Ga0206352_10782919 3300020078 Bacteria 1378
348 Ga0206352_10998634 3300020078 Bacteria 843
349 Ga0206352_11289899 3300020078 Bacteria 503
350 Ga0206350_10267178 3300020080 Bacteria 1181
351 Ga0206350_10587062 3300020080 Bacteria 696
352 Ga0206350_10614274 3300020080 Bacteria 593
353 Ga0206350_10973946 3300020080 Bacteria 944
354 Ga0206350_11037591 3300020080 Bacteria 625
355 Ga0206350_11468155 3300020080 Bacteria 855
356 Ga0206354_10328282 3300020081 Bacteria 752
357 Ga0206354_10557356 3300020081 Bacteria 694
358 Ga0206354_10818766 3300020081 Bacteria 858
359 Ga0206354_11011929 3300020081 Bacteria 652
360 Ga0206354_11313140 3300020081 Bacteria 534
361 Ga0206354_11348322 3300020081 Bacteria 719
362 Ga0206354_11366478 3300020081 Bacteria 842
363 Ga0206354_11441011 3300020081 Bacteria 1554
364 Ga0206354_11598942 3300020081 Bacteria 727
365 Ga0206354_11651120 3300020081 Bacteria 4622
366 Ga0206353_10186978 3300020082 Bacteria 4091
367 Ga0206353_10292783 3300020082 Bacteria 1049
368 Ga0206353_10389836 3300020082 Bacteria 19531
369 Ga0206353_11104212 3300020082 Bacteria 528
370 Ga0206353_11945709 3300020082 Bacteria 519
371 Ga0206353_11945828 3300020082 Bacteria 1627
372 Ga0154015_1323326 3300020610 Bacteria 975
373 Ga0154015_1544223 3300020610 Bacteria 638
374 Ga0154015_1599216 3300020610 Bacteria 1061
375 Ga0213876_10179411 3300021384 Bacteria 1126
376 Ga0213876_10448867 3300021384 Bacteria 686
377 Ga0224712_10057189 3300022467 Bacteria 1540
378 Ga0224712_10099262 3300022467 Bacteria 1232
379 Ga0224712_10165193 3300022467 Bacteria 990
380 Ga0224712_10165348 3300022467 Bacteria 989
381 Ga0224712_10333902 3300022467 Bacteria 714
382 Ga0224712_10352643 3300022467 Bacteria 695
383 Ga0224712_10404852 3300022467 Bacteria 651
384 Ga0224712_10560017 3300022467 Bacteria 556
385 Ga0224712_10592967 3300022467 Bacteria 541
386 Ga0207656_10165259 3300025321 Bacteria 1055
387 Ga0207713_1045258 3300025735 Bacteria 1799
388 Ga0207713_1099531 3300025735 Bacteria 1006
389 Ga0207692_10028262 3300025898 Bacteria 2650
390 Ga0207710_10005532 3300025900 Bacteria 5436
391 Ga0207710_10030049 3300025900 Bacteria 2368
392 Ga0207710_10032300 3300025900 Bacteria 2293
393 Ga0207688_10005623 3300025901 Bacteria 6816
394 Ga0207688_10008908 3300025901 Bacteria 5461
395 Ga0207680_10576517 3300025903 Bacteria 804
396 Ga0207647_10202619 3300025904 Bacteria 1147
397 Ga0207647_10321788 3300025904 Bacteria 878
398 Ga0207647_10325949 3300025904 Bacteria 872
399 Ga0207647_10338745 3300025904 Bacteria 852
400 Ga0207685_10093707 3300025905 Bacteria 1270
401 Ga0207645_10060884 3300025907 Bacteria 2411
402 Ga0207643_10000645 3300025908 Bacteria 21787
403 Ga0207643_10302923 3300025908 Bacteria 995
404 Ga0207705_10003405 3300025909 Bacteria 12092
405 Ga0207705_10126859 3300025909 Bacteria 1897
406 Ga0207705_10550255 3300025909 Bacteria 897
407 Ga0207705_11232860 3300025909 Bacteria 573
408 Ga0207684_11046939 3300025910 Bacteria 681
409 Ga0207654_10022308 3300025911 Bacteria 3376
410 Ga0207654_10111388 3300025911 Bacteria 1704
411 Ga0207654_10745038 3300025911 Bacteria 706
412 Ga0207707_10000764 3300025912 Bacteria 31604
413 Ga0207707_10050988 3300025912 Bacteria 3603
414 Ga0207695_10176566 3300025913 Bacteria 2058
415 Ga0207695_10425580 3300025913 Bacteria 1212
416 Ga0207695_10478025 3300025913 Bacteria 1128
417 Ga0207671_10081214 3300025914 Bacteria 2431
418 Ga0207671_10151997 3300025914 Bacteria 1789
419 Ga0207671_10352690 3300025914 Bacteria 1167
420 Ga0207671_10433955 3300025914 Bacteria 1046
421 Ga0207671_10641434 3300025914 Bacteria 846
422 Ga0207693_10033430 3300025915 Bacteria 4058
423 Ga0207693_10664794 3300025915 Bacteria 809
424 Ga0207693_10798382 3300025915 Bacteria 728
425 Ga0207663_10321275 3300025916 Bacteria 1163
426 Ga0207660_10018252 3300025917 Bacteria 4674
427 Ga0207660_10025359 3300025917 Bacteria 4023
428 Ga0207660_11327181 3300025917 Bacteria 584
429 Ga0207662_10019315 3300025918 Bacteria 3876
430 Ga0207662_10251634 3300025918 Bacteria 1160
431 Ga0207657_10012324 3300025919 Bacteria 8448
432 Ga0207657_10020145 3300025919 Bacteria 6311
433 Ga0207657_10654639 3300025919 Bacteria 818
434 Ga0207657_10870542 3300025919 Bacteria 695
435 Ga0207649_10011169 3300025920 Bacteria 4944
436 Ga0207649_11254238 3300025920 Bacteria 586
437 Ga0207652_10000504 3300025921 Bacteria 39783
438 Ga0207652_10098866 3300025921 Bacteria 2574
439 Ga0207652_10965499 3300025921 Bacteria 750
440 Ga0207652_11293338 3300025921 Bacteria 632
441 Ga0207646_10267553 3300025922 Bacteria 1545
442 Ga0207681_10384645 3300025923 Bacteria 1130
443 Ga0207694_10084470 3300025924 Bacteria 2497
444 Ga0207694_10328421 3300025924 Bacteria 1263
445 Ga0207694_11199713 3300025924 Bacteria 642
446 Ga0207650_10011084 3300025925 Bacteria 6199
447 Ga0207659_10029646 3300025926 Bacteria 3731
448 Ga0207659_10906264 3300025926 Bacteria 758
449 Ga0207659_11018961 3300025926 Bacteria 712
450 Ga0207687_10011377 3300025927 Bacteria 5816
451 Ga0207687_10080384 3300025927 Bacteria 2353
452 Ga0207687_10236097 3300025927 Bacteria 1446
453 Ga0207687_11122816 3300025927 Bacteria 675
454 Ga0207700_10356705 3300025928 Bacteria 1274
455 Ga0207700_11136442 3300025928 Bacteria 698
456 Ga0207700_11908082 3300025928 Bacteria 520
457 Ga0207664_10333834 3300025929 Bacteria 1339
458 Ga0207664_10393745 3300025929 Bacteria 1231
459 Ga0207644_10119010 3300025931 Bacteria 2008
460 Ga0207644_10215700 3300025931 Bacteria 1519
461 Ga0207690_10097968 3300025932 Bacteria 2087
462 Ga0207706_10071486 3300025933 Bacteria 3051
463 Ga0207706_10239867 3300025933 Bacteria 1585
464 Ga0207709_10037156 3300025935 Bacteria 2892
465 Ga0207709_10101340 3300025935 Bacteria 1904
466 Ga0207709_10735289 3300025935 Bacteria 792
467 Ga0207670_10212038 3300025936 Bacteria 1477
468 Ga0207670_10448113 3300025936 Bacteria 1040
469 Ga0207669_10286183 3300025937 Bacteria 1246
470 Ga0207669_11582358 3300025937 Bacteria 559
471 Ga0207704_10080313 3300025938 Bacteria 2105
472 Ga0207704_10910058 3300025938 Bacteria 740
473 Ga0207665_10000841 3300025939 Bacteria 20734
474 Ga0207665_10244955 3300025939 Bacteria 1322
475 Ga0207665_10823825 3300025939 Bacteria 734
476 Ga0207665_10878527 3300025939 Bacteria 710
477 Ga0207691_10171271 3300025940 Bacteria 1901
478 Ga0207691_10237092 3300025940 Bacteria 1578
479 Ga0207711_10260653 3300025941 Bacteria 1593
480 Ga0207711_10441140 3300025941 Bacteria 1211
481 Ga0207711_11773963 3300025941 Bacteria 560
482 Ga0207689_10000247 3300025942 Bacteria 48421
483 Ga0207689_10018795 3300025942 Bacteria 5827
484 Ga0207661_10008281 3300025944 Bacteria 7428
485 Ga0207661_10416296 3300025944 Bacteria 1220
486 Ga0207661_11624024 3300025944 Bacteria 591
487 Ga0207679_10001936 3300025945 Bacteria 12852
488 Ga0207679_10816991 3300025945 Bacteria 850
489 Ga0207667_10010159 3300025949 Bacteria 11026
490 Ga0207667_10118066 3300025949 Bacteria 2734
491 Ga0207667_10135964 3300025949 Bacteria 2531
492 Ga0207667_11927358 3300025949 Bacteria 552
493 Ga0207651_11321024 3300025960 Bacteria 648
494 Ga0207712_10065421 3300025961 Bacteria 2595
495 Ga0207668_10011015 3300025972 Bacteria 5484
496 Ga0207640_10019036 3300025981 Bacteria 4048
497 Ga0207640_10366843 3300025981 Bacteria 1162
498 Ga0207640_12110352 3300025981 Bacteria 511
499 Ga0207677_10045516 3300026023 Bacteria 2930
500 Ga0207703_10248429 3300026035 Bacteria 1602
501 Ga0207639_12060972 3300026041 Bacteria 532
502 Ga0207678_10000642 3300026067 Bacteria 32117
503 Ga0207678_10001249 3300026067 Bacteria 23448
504 Ga0207678_10417466 3300026067 Bacteria 1163
505 Ga0207678_11241616 3300026067 Bacteria 660
506 Ga0207708_10114677 3300026075 Bacteria 2094
507 Ga0207702_10002205 3300026078 Bacteria 18667
508 Ga0207702_10093978 3300026078 Bacteria 2631
509 Ga0207702_10132479 3300026078 Bacteria 2245
510 Ga0207702_10396653 3300026078 Bacteria 1330
511 Ga0207641_10018849 3300026088 Bacteria 5659
512 Ga0207641_10044128 3300026088 Bacteria 3748
513 Ga0207648_10317239 3300026089 Bacteria 1400
514 Ga0207648_11750794 3300026089 Bacteria 583
515 Ga0207676_10002528 3300026095 Bacteria 13044
516 Ga0207676_10107667 3300026095 Bacteria 2325
517 Ga0207676_11753542 3300026095 Bacteria 619
518 Ga0207676_11926288 3300026095 Bacteria 590
519 Ga0207674_10367153 3300026116 Bacteria 1391
520 Ga0207674_10988309 3300026116 Bacteria 811
521 Ga0207674_11665621 3300026116 Bacteria 606
522 Ga0207674_11806343 3300026116 Bacteria 578
523 Ga0207675_100004308 3300026118 Bacteria 13751
524 Ga0207675_100125041 3300026118 Bacteria 2436
525 Ga0207683_10021780 3300026121 Bacteria 5494
526 Ga0207683_10055090 3300026121 Bacteria 3488
527 Ga0207698_10021270 3300026142 Bacteria 4482
528 Ga0207698_10037957 3300026142 Bacteria 3554
529 Ga0207698_10202369 3300026142 Bacteria 1779
530 Ga0207698_10710431 3300026142 Bacteria 1001
531 Ga0207698_12426283 3300026142 Bacteria 535
532 Ga0207698_12547936 3300026142 Bacteria 521
533 Ga0207428_10107183 3300027907 Bacteria 2153
534 Ga0207428_10530242 3300027907 Bacteria 853
535 Ga0268266_10038076 3300028379 Bacteria 4095
536 Ga0268266_10087579 3300028379 Bacteria 2725
537 Ga0268266_10309304 3300028379 Bacteria 1476
538 Ga0268266_11601343 3300028379 Bacteria 627
539 Ga0268265_10153939 3300028380 Bacteria 1943
540 Ga0268264_10137202 3300028381 Bacteria 2176
541 Ga0307413_11498924 3300031824 Bacteria 596
542 Ga0307406_10807864 3300031901 Bacteria 792
543 Ga0307415_100687678 3300032126 Bacteria 921
544 Ga0307507_10021908 3300033179 Bacteria 7091
545 Ga0373930_0095917 3300034816 Bacteria 700
546 Ga0373950_0069445 3300034818 Bacteria 719
547 Ga0373958_0198229 3300034819 Bacteria 524
548 Ga0373959_0041526 3300034820 Bacteria 966
549 Ga0373929_0073742 3300035085 Bacteria 820
550 Ga0373929_0126813 3300035085 Bacteria 666
551 Ga0373940_0020538 3300035088 Bacteria 1679
552 Ga0373949_0029511 3300035090 Bacteria 1300
553 Ga0373951_0075746 3300035091 Bacteria 863
554 Ga0373952_0038018 3300035092 Bacteria 1101
555 Ga0373932_0072271 3300035112 Bacteria 1073
556 Ga0373939_0140174 3300035114 Bacteria 871
557 Ga0373956_0360389 3300035119 Bacteria 693
558 Ga0373961_0137976 3300035241 Bacteria 822
559 Ga0373962_0093428 3300035242 Bacteria 929
560 Ga0373931_0005247 3300035691 Bacteria 5975
561 Ga0373931_0846090 3300035691 Bacteria 612
562 Ga0373925_0164312 3300037068 Bacteria 1750
563 Ga0395900_0973428 3300037418 Bacteria 769
564 Ga0395898_1897662 3300037466 Bacteria 516
565 Ga0436364_0634500 3300037853 Bacteria 528
566 Ga0395901_0208594 3300038443 Bacteria 2046
567 Ga0395901_0617866 3300038443 Bacteria 1091
568 Ga0436365_0521780 3300039437 Bacteria 2103
569 Ga0436365_0629779 3300039437 Bacteria 1176
570 Ga0436362_0332052 3300039453 Bacteria 734
571 Ga0451845_0359880 3300041501 Bacteria 1023
572 Ga0439448_0092466 3300042005 Bacteria 1023
573 Ga0439463_065896 3300042016 Bacteria 926
574 Ga0450914_018083 3300042118 Bacteria 762
575 Ga0450902_086087 3300042137 Bacteria 554
576 Ga0439458_0109399 3300042157 Bacteria 722
577 Ga0439459_0002498 3300042438 Bacteria 2843
578 Ga0466969_0046923 3300044656 Bacteria 2140
579 Ga0466969_0248751 3300044656 Bacteria 806
580 Ga0466969_0316368 3300044656 Bacteria 706
581 Ga0466969_0565087 3300044656 Bacteria 521
582 Ga0466972_0037579 3300044658 Bacteria 2367
583 Ga0466972_0063377 3300044658 Bacteria 1770
584 Ga0466972_0590964 3300044658 Bacteria 524
585 Ga0466965_0006927 3300044683 Bacteria 5186
586 Ga0466965_0936989 3300044683 Bacteria 506
587 Ga0466966_0005077 3300044684 Bacteria 8647
588 Ga0466966_0041005 3300044684 Bacteria 2977
589 Ga0466966_0044001 3300044684 Bacteria 2860
590 Ga0466966_0098303 3300044684 Bacteria 1812
591 Ga0466966_0107088 3300044684 Bacteria 1725
592 Ga0466966_0165976 3300044684 Bacteria 1343
593 Ga0466966_0410557 3300044684 Bacteria 814
594 Ga0466966_0835546 3300044684 Bacteria 555
595 Ga0466961_0003479 3300044693 Bacteria 9815
596 Ga0466961_0024534 3300044693 Bacteria 3879
597 Ga0466961_0034731 3300044693 Bacteria 3237
598 Ga0466961_0041554 3300044693 Bacteria 2948
599 Ga0466961_0075266 3300044693 Bacteria 2140
600 Ga0466961_0099175 3300044693 Bacteria 1836
601 Ga0466961_0109310 3300044693 Bacteria 1740
602 Ga0466961_0113908 3300044693 Bacteria 1700
603 Ga0466961_0126000 3300044693 Bacteria 1607
604 Ga0466961_0755964 3300044693 Bacteria 581
605 Ga0466963_0004552 3300044694 Bacteria 8072
606 Ga0466963_0020515 3300044694 Bacteria 4156
607 Ga0466963_0024445 3300044694 Bacteria 3847
608 Ga0466963_0026304 3300044694 Bacteria 3721
609 Ga0466963_0027706 3300044694 Bacteria 3631
610 Ga0466963_0041139 3300044694 Bacteria 3030
611 Ga0466963_0073964 3300044694 Bacteria 2298
612 Ga0466963_0098223 3300044694 Bacteria 2001
613 Ga0466963_0122948 3300044694 Bacteria 1787
614 Ga0466963_0123019 3300044694 Bacteria 1787
615 Ga0466963_1105730 3300044694 Bacteria 557
616 Ga0466964_0027416 3300044706 Bacteria 2237
617 Ga0466964_0044573 3300044706 Bacteria 1802
618 Ga0466964_0272256 3300044706 Bacteria 843
619 Ga0466964_0911731 3300044706 Bacteria 503
620 Ga0466971_0058273 3300044719 Bacteria 1743
621 Ga0466971_0063593 3300044719 Bacteria 1670
622 Ga0466971_0172604 3300044719 Bacteria 1015
623 Ga0466968_0177990 3300044735 Bacteria 988
624 Ga0466968_0367873 3300044735 Bacteria 701
625 Ga0466968_0697346 3300044735 Bacteria 518
626 Ga0466970_0020020 3300044765 Bacteria 3472
627 Ga0466970_0068183 3300044765 Bacteria 1911
628 Ga0466970_0319758 3300044765 Bacteria 877
629 Ga0466970_0336897 3300044765 Bacteria 855
630 Ga0466970_0529456 3300044765 Bacteria 680
631 Ga0466957_0008610 3300044842 Bacteria 5805
632 Ga0466957_0013692 3300044842 Bacteria 4709
633 Ga0466957_1218607 3300044842 Bacteria 545
634 Ga0466957_1447894 3300044842 Bacteria 501
635 Ga0466960_0042178 3300044901 Bacteria 2165
636 Ga0466960_0073326 3300044901 Bacteria 1708
637 Ga0466960_0380516 3300044901 Bacteria 810
638 Ga0466959_0031341 3300045049 Bacteria 3935
639 Ga0466959_0140789 3300045049 Bacteria 1705
640 Ga0466959_0159297 3300045049 Bacteria 1587
641 Ga0466959_0160639 3300045049 Bacteria 1580
642 Ga0466959_0164256 3300045049 Bacteria 1560
643 Ga0466959_0185817 3300045049 Bacteria 1452
644 Ga0466959_0233960 3300045049 Bacteria 1271
645 Ga0466959_0293888 3300045049 Bacteria 1113
646 Ga0466959_0621274 3300045049 Bacteria 726
647 Ga0466959_0933956 3300045049 Bacteria 578
648 Ga0466959_0980056 3300045049 Bacteria 563
649 Ga0466958_0009360 3300045836 Bacteria 5459
650 Ga0466958_0010271 3300045836 Bacteria 5240
651 Ga0466958_0017906 3300045836 Bacteria 4104
652 Ga0466958_0045826 3300045836 Bacteria 2638
653 Ga0466958_0075922 3300045836 Bacteria 2062
654 Ga0466958_0096466 3300045836 Bacteria 1834
655 Ga0466958_0097392 3300045836 Bacteria 1825
656 Ga0466958_0215589 3300045836 Bacteria 1224
657 Ga0466958_0841491 3300045836 Bacteria 598
658 Ga0466967_0000382 3300045976 Bacteria 20625
659 Ga0466967_0001908 3300045976 Bacteria 12596
660 Ga0466967_0003147 3300045976 Bacteria 10631
661 Ga0466967_0003455 3300045976 Bacteria 10312
662 Ga0466967_0018239 3300045976 Bacteria 5601
663 Ga0466967_0025063 3300045976 Bacteria 4913
664 Ga0466967_0028813 3300045976 Bacteria 4641
665 Ga0466967_0064160 3300045976 Bacteria 3266
666 Ga0466967_0121206 3300045976 Bacteria 2416
667 Ga0466967_0121224 3300045976 Bacteria 2416
668 Ga0466967_0142225 3300045976 Bacteria 2236
669 Ga0466967_0161380 3300045976 Bacteria 2104
670 Ga0466967_0217855 3300045976 Bacteria 1813
671 Ga0466967_0361788 3300045976 Bacteria 1406
672 Ga0466967_0494623 3300045976 Bacteria 1199
673 Ga0466967_0520175 3300045976 Bacteria 1169
674 Ga0466967_0901098 3300045976 Bacteria 879
675 Ga0466967_1371553 3300045976 Bacteria 704
676 Ga0466967_2285297 3300045976 Bacteria 536
677 Ga0495641_0531569 3300046461 Bacteria 537
678 Ga0495653_0670779 3300046463 Bacteria 632
679 Ga0495594_0454879 3300046499 Bacteria 728
680 Ga0495622_0342591 3300046557 Bacteria 648
681 Ga0495657_0581727 3300046675 Bacteria 649
682 Ga0495674_0958047 3300047319 Bacteria 658
683 Ga0495684_0383592 3300047471 Bacteria 991
684 Ga0495602_0587103 3300048088 Bacteria 768
685 Ga0496100_0013183 3300048903 Bacteria 4761
686 Ga0496100_0018960 3300048903 Bacteria 4095
687 Ga0496100_0468108 3300048903 Bacteria 968
688 Ga0496100_0501320 3300048903 Bacteria 935
689 Ga0496100_0940346 3300048903 Bacteria 679
690 Ga0496101_0036739 3300048904 Bacteria 3470
691 Ga0496102_0000142 3300048905 Bacteria 97037
692 Ga0496102_0000569 3300048905 Bacteria 39306
693 Ga0496102_0097385 3300048905 Bacteria 2728
694 Ga0496102_0425862 3300048905 Bacteria 1246
695 Ga0496102_0688843 3300048905 Bacteria 945
696 Ga0496103_0000085 3300048906 Bacteria 105412
697 Ga0496103_0072910 3300048906 Bacteria 2151
698 Ga0496103_0097690 3300048906 Bacteria 1856
699 Ga0496104_0024974 3300048907 Bacteria 5504
700 Ga0496104_0121240 3300048907 Bacteria 2510
701 Ga0496104_0691013 3300048907 Bacteria 928
702 Ga0496105_0001319 3300048908 Bacteria 17352
703 Ga0496105_0133027 3300048908 Bacteria 2049
704 Ga0496105_0429126 3300048908 Bacteria 1046
705 Ga0496106_0016694 3300048909 Bacteria 5432
706 Ga0496106_0020578 3300048909 Bacteria 4898
707 Ga0496107_0065388 3300048910 Bacteria 2636
708 Ga0496107_0147572 3300048910 Bacteria 1739
709 Ga0496107_1220650 3300048910 Bacteria 540
710 Ga0496108_0010564 3300048911 Bacteria 7495
711 Ga0496108_0037152 3300048911 Bacteria 4056
712 Ga0496108_0167112 3300048911 Bacteria 1902
713 Ga0496108_0397066 3300048911 Bacteria 1204
714 Ga0496109_0008423 3300048912 Bacteria 8766
715 Ga0496109_0094902 3300048912 Bacteria 2761
716 Ga0496109_0928156 3300048912 Bacteria 808
717 Ga0496110_0016699 3300048913 Bacteria 6131
718 Ga0496110_0017885 3300048913 Bacteria 5934
719 Ga0496110_0018611 3300048913 Bacteria 5825
720 Ga0496110_1003861 3300048913 Bacteria 742
721 Ga0496111_0036953 3300048914 Bacteria 3493
722 Ga0496111_0093696 3300048914 Bacteria 2202
723 Ga0496111_0174980 3300048914 Bacteria 1595
724 Ga0496111_0685254 3300048914 Bacteria 746
725 Ga0496111_1283621 3300048914 Bacteria 516
726 Ga0496112_0040203 3300048915 Bacteria 4572
727 Ga0496112_0042662 3300048915 Bacteria 4438
728 Ga0496112_0163634 3300048915 Bacteria 2191
729 Ga0496113_0057834 3300048916 Bacteria 2915
730 Ga0496113_0169952 3300048916 Bacteria 1726
731 Ga0496113_0599749 3300048916 Bacteria 882
732 Ga0496114_0030521 3300048917 Bacteria 4435
733 Ga0496114_0139236 3300048917 Bacteria 2100
734 Ga0496115_0033887 3300048918 Bacteria 4034
735 Ga0496115_1089098 3300048918 Bacteria 606
736 Ga0496115_1409126 3300048918 Bacteria 514
737 Ga0496118_0038691 3300048921 Bacteria 3819
738 Ga0496118_0073130 3300048921 Bacteria 2458
739 Ga0496119_0000153 3300048922 Bacteria 95945
740 Ga0496119_0138796 3300048922 Bacteria 1315
741 Ga0496120_0022025 3300048923 Bacteria 4013
742 Ga0496121_0160827 3300048924 Bacteria 1642
743 Ga0496126_0000013 3300048929 Bacteria 690046
744 Ga0496126_0048031 3300048929 Bacteria 3905
745 Ga0501336_025307 3300049552 Bacteria 560
746 Ga0501031_0042529 3300049568 Bacteria 2965
747 Ga0501032_0646700 3300049569 Bacteria 672
748 Ga0501033_0162221 3300049570 Bacteria 1609
749 Ga0501034_0568242 3300049571 Bacteria 1042
750 Ga0501036_0534648 3300049572 Bacteria 974
751 Ga0501037_0177488 3300049573 Bacteria 1512
752 Ga0501038_0003697 3300049574 Bacteria 14253
753 Ga0501043_0164881 3300049579 Bacteria 1730
754 Ga0501046_0048811 3300049580 Bacteria 3351
755 Ga0501047_0003454 3300049581 Bacteria 14936
756 Ga0501047_0193219 3300049581 Bacteria 1898
757 Ga0501048_0000303 3300049582 Bacteria 33444
758 Ga0501070_0012680 3300049586 Bacteria 7109
759 Ga0501070_0221651 3300049586 Bacteria 1551
760 Ga0501072_1496607 3300049588 Bacteria 521
761 Ga0501073_0726195 3300049589 Bacteria 685
762 Ga0501074_0442584 3300049590 Bacteria 922
763 Ga0501080_0372271 3300049742 Bacteria 1288
764 Ga0501081_1020924 3300049743 Bacteria 625
765 Ga0501044_0058974 3300049823 Bacteria 3934
766 Ga0501044_0296426 3300049823 Bacteria 1547
767 nmdc:mga05p37_1325116_c1 3300050507 Bacteria 732
768 nmdc:mga05p37_384303_c1 3300050507 Bacteria 1644
769 nmdc:mga05p37_903522_c1 3300050507 Bacteria 952
770 nmdc:mga09592_307899_c1 3300050508 Bacteria 1373
771 nmdc:mga09592_715019_c1 3300050508 Bacteria 852
772 nmdc:mga06r32_134951_c1 3300050510 Bacteria 2442
773 nmdc:mga06r32_444570_c1 3300050510 Bacteria 1276
774 nmdc:mga06r32_59733_c1 3300050510 Bacteria 3668
775 nmdc:mga08y16_147144_c1 3300050511 Bacteria 2449
776 nmdc:mga08y16_1854401_c1 3300050511 Bacteria 555
777 nmdc:mga08y16_2062836_c1 3300050511 Bacteria 518
778 nmdc:mga0n895_157140_c1 3300050512 Bacteria 2305
779 nmdc:mga0n895_26897_c1 3300050512 Bacteria 5458
780 nmdc:mga0rr50_218326_c1 3300050513 Bacteria 1574
781 nmdc:mga0rr50_4976_c1 3300050513 Bacteria 7870
782 nmdc:mga08x19_14945_c1 3300050514 Bacteria 4715
783 nmdc:mga08x19_79940_c1 3300050514 Bacteria 2145
784 nmdc:mga0a205_3011_c1 3300050515 Bacteria 14933
785 nmdc:mga0a205_35069_c1 3300050515 Bacteria 4817
786 Ga0500555_175902 3300053103 Bacteria 519
787 Ga0501084_1162898 3300054114 Bacteria 647
788 Ga0587084_065957 3300059477 Bacteria 674
789 Ga0587070_157464 3300059491 Bacteria 574
790 Ga0587073_0139365 3300059492 Bacteria 675
791 Ga0587073_0159663 3300059492 Bacteria 645
792 Ga0587080_116700 3300059503 Bacteria 587
793 Ga0587082_052942 3300059504 Bacteria 780
794 Ga0587082_130295 3300059504 Bacteria 577
795 Ga0587082_170623 3300059504 Bacteria 527
796 Ga0587083_0237078 3300059505 Bacteria 538
797 Ga0587083_0239493 3300059505 Bacteria 536
798 Ga0587083_0262629 3300059505 Bacteria 519
799 Ga0587088_158348 3300059508 Bacteria 553
800 Ga0587088_185101 3300059508 Bacteria 524
801 Ga0587089_057798 3300059509 Bacteria 635
802 Ga0587090_121547 3300059510 Bacteria 567
803 Ga0587090_132322 3300059510 Bacteria 551
804 Ga0587091_159379 3300059511 Bacteria 579
805 Ga0587092_141250 3300059512 Bacteria 531
806 Ga0587092_155379 3300059512 Bacteria 514
807 Ga0587094_112888 3300059513 Bacteria 537
808 Ga0587106_156540 3300059605 Bacteria 511
809 Ga0587125_033373 3300059607 Bacteria 667
810 Ga0587113_026753 3300059625 Bacteria 637
811 Ga0587115_085756 3300059626 Bacteria 565
812 Ga0587117_121527 3300059627 Bacteria 518
813 Ga0587122_028664 3300059628 Bacteria 645
814 Ga0587128_166284 3300059630 Bacteria 512
815 Ga0587130_039685 3300059631 Bacteria 566
816 Ga0587067_109589 3300059640 Bacteria 650
817 Ga0587067_237937 3300059640 Bacteria 500
818 Ga0587072_143076 3300059643 Bacteria 572
819 Ga0587075_054798 3300059644 Bacteria 705
820 Ga0587075_145919 3300059644 Bacteria 509
821 Ga0587076_129569 3300059645 Bacteria 593
822 Ga0587076_150144 3300059645 Bacteria 565
823 Ga0587076_150445 3300059645 Bacteria 564
824 Ga0587078_024412 3300059646 Bacteria 783
825 Ga0587078_042880 3300059646 Bacteria 644
826 Ga0587079_132520 3300059647 Bacteria 628
827 Ga0587079_167558 3300059647 Bacteria 579
828 Ga0587104_025040 3300059650 Bacteria 514
829 Ga0587110_026956 3300059654 Bacteria 683
830 Ga0587114_107038 3300059655 Bacteria 552
831 Ga0587120_038741 3300059659 Bacteria 506
832 Ga0587071_144093 3300060344 Bacteria 587
833 Ga0587071_206712 3300060344 Bacteria 516
834 Ga0587111_0234222 3300060346 Bacteria 536
835 Ga0587111_0277630 3300060346 Bacteria 505
836 Ga0466962_0037329 3300061719 Bacteria 2326
837 Ga0466962_0043154 3300061719 Bacteria 2158
838 Ga0466962_0165897 3300061719 Bacteria 1074
839 Ga0466962_0459419 3300061719 Bacteria 642

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045976 Ga0466967_0142225 Ga0466967_0142225_255_569 100
2 3300005937 Ga0081455_10226092 Ga0081455_102260922 101
3 3300012512 Ga0157327_1051457 Ga0157327_10514572 101
4 3300025935 Ga0207709_10101340 Ga0207709_101013403 101
5 3300041501 Ga0451845_0359880 Ga0451845_0359880_138_443 101
6 3300046557 Ga0495622_0342591 Ga0495622_0342591_158_463 101
7 3300059655 Ga0587114_107038 Ga0587114_107038_165_470 101
8 3300003575 Ga0007409J51694_1108460 Ga0007409J51694_11084601 102
9 3300003579 Ga0007429J51699_1018112 Ga0007429J51699_10181121 102
10 3300005617 Ga0068859_100009699 Ga0068859_1000096994 102
11 3300006175 Ga0070712_101084186 Ga0070712_1010841861 102
12 3300006931 Ga0097620_100009699 Ga0097620_1000096994 102
13 3300009101 Ga0105247_10003047 Ga0105247_100030475 102
14 3300013043 Ga0154018_106035 Ga0154018_1060352 102
15 3300014968 Ga0157379_11640908 Ga0157379_116409081 102
16 3300025900 Ga0207710_10005532 Ga0207710_100055324 102
17 3300025928 Ga0207700_11908082 Ga0207700_119080821 102
18 3300026142 Ga0207698_12426283 Ga0207698_124262831 102
19 3300031901 Ga0307406_10807864 Ga0307406_108078642 102
20 3300033179 Ga0307507_10021908 Ga0307507_100219084 102
21 3300044693 Ga0466961_0755964 Ga0466961_0755964_128_478 102
22 3300044694 Ga0466963_1105730 Ga0466963_1105730_88_396 102
23 3300044842 Ga0466957_1218607 Ga0466957_1218607_188_496 102
24 3300045049 Ga0466959_0164256 Ga0466959_0164256_74_382 102
25 3300045976 Ga0466967_0520175 Ga0466967_0520175_82_390 102
26 3300045976 Ga0466967_2285297 Ga0466967_2285297_109_417 102
27 3300048903 Ga0496100_0468108 Ga0496100_0468108_259_567 102
28 3300048904 Ga0496101_0036739 Ga0496101_0036739_2984_3292 102
29 3300048905 Ga0496102_0000142 Ga0496102_0000142_82372_82680 102
30 3300048906 Ga0496103_0000085 Ga0496103_0000085_90738_91046 102
31 3300048921 Ga0496118_0038691 Ga0496118_0038691_3330_3638 102
32 3300048922 Ga0496119_0138796 Ga0496119_0138796_962_1270 102
33 3300048924 Ga0496121_0160827 Ga0496121_0160827_1085_1393 102
34 3300049552 Ga0501336_025307 Ga0501336_025307_106_414 102
35 3300053103 Ga0500555_175902 Ga0500555_175902_13_321 102
36 3300059505 Ga0587083_0262629 Ga0587083_0262629_74_403 102
37 3300001990 JGI24737J22298_10067221 JGI24737J22298_100672213 103
38 3300002067 JGI24735J21928_10099704 JGI24735J21928_100997043 103
39 3300002067 JGI24735J21928_10150729 JGI24735J21928_101507291 103
40 3300002067 JGI24735J21928_10179578 JGI24735J21928_101795782 103
41 3300003575 Ga0007409J51694_1061986 Ga0007409J51694_10619861 103
42 3300003693 Ga0032354_1058136 Ga0032354_10581361 103
43 3300004799 Ga0058863_11912344 Ga0058863_119123442 103
44 3300005327 Ga0070658_10017448 Ga0070658_100174484 103
45 3300005327 Ga0070658_10994130 Ga0070658_109941301 103
46 3300005329 Ga0070683_100477399 Ga0070683_1004773991 103
47 3300005337 Ga0070682_100570786 Ga0070682_1005707862 103
48 3300005337 Ga0070682_100779688 Ga0070682_1007796882 103
49 3300005337 Ga0070682_101669639 Ga0070682_1016696391 103
50 3300005339 Ga0070660_101093654 Ga0070660_1010936541 103
51 3300005341 Ga0070691_10580119 Ga0070691_105801191 103
52 3300005344 Ga0070661_101184025 Ga0070661_1011840251 103
53 3300005435 Ga0070714_100702659 Ga0070714_1007026592 103
54 3300005435 Ga0070714_100759449 Ga0070714_1007594491 103
55 3300005439 Ga0070711_100467443 Ga0070711_1004674432 103
56 3300005455 Ga0070663_100476598 Ga0070663_1004765982 103
57 3300005458 Ga0070681_11138170 Ga0070681_111381701 103
58 3300005530 Ga0070679_100669321 Ga0070679_1006693212 103
59 3300005530 Ga0070679_100974609 Ga0070679_1009746092 103
60 3300005535 Ga0070684_100357105 Ga0070684_1003571053 103
61 3300005539 Ga0068853_102408943 Ga0068853_1024089431 103
62 3300005563 Ga0068855_100101198 Ga0068855_1001011984 103
63 3300005563 Ga0068855_100785786 Ga0068855_1007857862 103
64 3300005563 Ga0068855_101946628 Ga0068855_1019466282 103
65 3300005577 Ga0068857_101079557 Ga0068857_1010795572 103
66 3300005614 Ga0068856_100520717 Ga0068856_1005207173 103
67 3300005614 Ga0068856_101083455 Ga0068856_1010834552 103
68 3300005616 Ga0068852_100581584 Ga0068852_1005815843 103
69 3300005616 Ga0068852_101197733 Ga0068852_1011977332 103
70 3300005937 Ga0081455_10540138 Ga0081455_105401382 103
71 3300006173 Ga0070716_101004882 Ga0070716_1010048821 103
72 3300006173 Ga0070716_101602155 Ga0070716_1016021551 103
73 3300006175 Ga0070712_100999870 Ga0070712_1009998702 103
74 3300009093 Ga0105240_11068288 Ga0105240_110682881 103
75 3300009098 Ga0105245_10003794 Ga0105245_100037947 103
76 3300009098 Ga0105245_10685755 Ga0105245_106857553 103
77 3300009148 Ga0105243_11848405 Ga0105243_118484051 103
78 3300009174 Ga0105241_10051781 Ga0105241_100517812 103
79 3300009174 Ga0105241_10140534 Ga0105241_101405342 103
80 3300009545 Ga0105237_10211380 Ga0105237_102113802 103
81 3300009545 Ga0105237_10776254 Ga0105237_107762542 103
82 3300009545 Ga0105237_11267190 Ga0105237_112671902 103
83 3300009545 Ga0105237_11589177 Ga0105237_115891772 103
84 3300009545 Ga0105237_11731426 Ga0105237_117314261 103
85 3300010375 Ga0105239_10219946 Ga0105239_102199463 103
86 3300010375 Ga0105239_10738216 Ga0105239_107382162 103
87 3300010375 Ga0105239_10888391 Ga0105239_108883912 103
88 3300013044 Ga0154019_132188 Ga0154019_1321882 103
89 3300013045 Ga0154016_126325 Ga0154016_1263251 103
90 3300013059 Ga0154012_145613 Ga0154012_1456132 103
91 3300013062 Ga0154010_163592 Ga0154010_1635921 103
92 3300013105 Ga0157369_10335593 Ga0157369_103355933 103
93 3300013105 Ga0157369_10421418 Ga0157369_104214182 103
94 3300013105 Ga0157369_11113801 Ga0157369_111138012 103
95 3300013296 Ga0157374_10903969 Ga0157374_109039692 103
96 3300013307 Ga0157372_11878948 Ga0157372_118789482 103
97 3300015262 Ga0182007_10225604 Ga0182007_102256041 103
98 3300020069 Ga0197907_10165799 Ga0197907_101657991 103
99 3300020069 Ga0197907_10417371 Ga0197907_104173712 103
100 3300020069 Ga0197907_10655106 Ga0197907_106551062 103
101 3300020069 Ga0197907_10665716 Ga0197907_106657162 103
102 3300020069 Ga0197907_10813524 Ga0197907_108135241 103
103 3300020069 Ga0197907_11011918 Ga0197907_110119182 103
104 3300020069 Ga0197907_11236551 Ga0197907_112365512 103
105 3300020069 Ga0197907_11425260 Ga0197907_114252602 103
106 3300020070 Ga0206356_10461214 Ga0206356_104612142 103
107 3300020070 Ga0206356_11192521 Ga0206356_111925212 103
108 3300020071 Ga0206348_118668 Ga0206348_1186681 103
109 3300020075 Ga0206349_1572799 Ga0206349_15727992 103
110 3300020075 Ga0206349_1745300 Ga0206349_17453002 103
111 3300020076 Ga0206355_1029950 Ga0206355_10299501 103
112 3300020076 Ga0206355_1282491 Ga0206355_12824912 103
113 3300020076 Ga0206355_1285473 Ga0206355_12854732 103
114 3300020076 Ga0206355_1468932 Ga0206355_14689321 103
115 3300020076 Ga0206355_1470679 Ga0206355_14706791 103
116 3300020076 Ga0206355_1565251 Ga0206355_15652512 103
117 3300020077 Ga0206351_10129930 Ga0206351_101299302 103
118 3300020077 Ga0206351_10138064 Ga0206351_101380642 103
119 3300020077 Ga0206351_10317064 Ga0206351_103170641 103
120 3300020080 Ga0206350_10267178 Ga0206350_102671782 103
121 3300020080 Ga0206350_10587062 Ga0206350_105870622 103
122 3300020080 Ga0206350_10614274 Ga0206350_106142741 103
123 3300020080 Ga0206350_11037591 Ga0206350_110375911 103
124 3300020081 Ga0206354_10557356 Ga0206354_105573562 103
125 3300020081 Ga0206354_10818766 Ga0206354_108187662 103
126 3300020081 Ga0206354_11313140 Ga0206354_113131402 103
127 3300020081 Ga0206354_11348322 Ga0206354_113483222 103
128 3300020081 Ga0206354_11366478 Ga0206354_113664781 103
129 3300020081 Ga0206354_11441011 Ga0206354_114410111 103
130 3300020081 Ga0206354_11598942 Ga0206354_115989421 103
131 3300020082 Ga0206353_10186978 Ga0206353_101869785 103
132 3300020082 Ga0206353_11104212 Ga0206353_111042121 103
133 3300020610 Ga0154015_1323326 Ga0154015_13233261 103
134 3300020610 Ga0154015_1544223 Ga0154015_15442232 103
135 3300022467 Ga0224712_10165193 Ga0224712_101651932 103
136 3300022467 Ga0224712_10165348 Ga0224712_101653481 103
137 3300022467 Ga0224712_10333902 Ga0224712_103339021 103
138 3300022467 Ga0224712_10404852 Ga0224712_104048522 103
139 3300022467 Ga0224712_10560017 Ga0224712_105600172 103
140 3300025904 Ga0207647_10321788 Ga0207647_103217881 103
141 3300025904 Ga0207647_10338745 Ga0207647_103387452 103
142 3300025909 Ga0207705_10550255 Ga0207705_105502552 103
143 3300025909 Ga0207705_11232860 Ga0207705_112328602 103
144 3300025911 Ga0207654_10745038 Ga0207654_107450382 103
145 3300025914 Ga0207671_10151997 Ga0207671_101519972 103
146 3300025914 Ga0207671_10433955 Ga0207671_104339551 103
147 3300025914 Ga0207671_10641434 Ga0207671_106414342 103
148 3300025915 Ga0207693_10798382 Ga0207693_107983821 103
149 3300025917 Ga0207660_11327181 Ga0207660_113271811 103
150 3300025919 Ga0207657_10654639 Ga0207657_106546393 103
151 3300025919 Ga0207657_10870542 Ga0207657_108705421 103
152 3300025920 Ga0207649_11254238 Ga0207649_112542382 103
153 3300025921 Ga0207652_10965499 Ga0207652_109654992 103
154 3300025921 Ga0207652_11293338 Ga0207652_112933381 103
155 3300025924 Ga0207694_11199713 Ga0207694_111997132 103
156 3300025927 Ga0207687_10236097 Ga0207687_102360971 103
157 3300025927 Ga0207687_11122816 Ga0207687_111228162 103
158 3300025929 Ga0207664_10333834 Ga0207664_103338342 103
159 3300025939 Ga0207665_10823825 Ga0207665_108238251 103
160 3300025939 Ga0207665_10878527 Ga0207665_108785272 103
161 3300025941 Ga0207711_11773963 Ga0207711_117739631 103
162 3300025944 Ga0207661_10416296 Ga0207661_104162961 103
163 3300025949 Ga0207667_10010159 Ga0207667_1001015910 103
164 3300025949 Ga0207667_10118066 Ga0207667_101180661 103
165 3300025949 Ga0207667_11927358 Ga0207667_119273582 103
166 3300025981 Ga0207640_12110352 Ga0207640_121103521 103
167 3300026041 Ga0207639_12060972 Ga0207639_120609721 103
168 3300026067 Ga0207678_10417466 Ga0207678_104174663 103
169 3300026067 Ga0207678_11241616 Ga0207678_112416162 103
170 3300026078 Ga0207702_10132479 Ga0207702_101324792 103
171 3300026078 Ga0207702_10396653 Ga0207702_103966531 103
172 3300026116 Ga0207674_11665621 Ga0207674_116656211 103
173 3300026116 Ga0207674_11806343 Ga0207674_118063431 103
174 3300026142 Ga0207698_10037957 Ga0207698_100379573 103
175 3300026142 Ga0207698_10710431 Ga0207698_107104311 103
176 3300026142 Ga0207698_12547936 Ga0207698_125479361 103
177 3300037418 Ga0395900_0973428 Ga0395900_0973428_220_531 103
178 3300037466 Ga0395898_1897662 Ga0395898_1897662_177_488 103
179 3300044656 Ga0466969_0248751 Ga0466969_0248751_41_352 103
180 3300044656 Ga0466969_0316368 Ga0466969_0316368_315_629 103
181 3300044656 Ga0466969_0565087 Ga0466969_0565087_64_375 103
182 3300044658 Ga0466972_0037579 Ga0466972_0037579_893_1204 103
183 3300044658 Ga0466972_0063377 Ga0466972_0063377_908_1219 103
184 3300044658 Ga0466972_0590964 Ga0466972_0590964_77_388 103
185 3300044683 Ga0466965_0006927 Ga0466965_0006927_865_1176 103
186 3300044683 Ga0466965_0936989 Ga0466965_0936989_173_490 103
187 3300044684 Ga0466966_0041005 Ga0466966_0041005_2478_2789 103
188 3300044684 Ga0466966_0044001 Ga0466966_0044001_1103_1414 103
189 3300044684 Ga0466966_0098303 Ga0466966_0098303_1317_1640 103
190 3300044684 Ga0466966_0107088 Ga0466966_0107088_896_1237 103
191 3300044684 Ga0466966_0165976 Ga0466966_0165976_993_1304 103
192 3300044684 Ga0466966_0835546 Ga0466966_0835546_186_497 103
193 3300044693 Ga0466961_0003479 Ga0466961_0003479_4394_4705 103
194 3300044693 Ga0466961_0024534 Ga0466961_0024534_2930_3241 103
195 3300044693 Ga0466961_0041554 Ga0466961_0041554_34_345 103
196 3300044693 Ga0466961_0075266 Ga0466961_0075266_380_691 103
197 3300044693 Ga0466961_0109310 Ga0466961_0109310_1248_1571 103
198 3300044693 Ga0466961_0113908 Ga0466961_0113908_657_971 103
199 3300044693 Ga0466961_0126000 Ga0466961_0126000_913_1227 103
200 3300044694 Ga0466963_0004552 Ga0466963_0004552_3882_4193 103
201 3300044694 Ga0466963_0020515 Ga0466963_0020515_611_922 103
202 3300044694 Ga0466963_0024445 Ga0466963_0024445_2632_2943 103
203 3300044694 Ga0466963_0026304 Ga0466963_0026304_2116_2427 103
204 3300044694 Ga0466963_0027706 Ga0466963_0027706_1014_1331 103
205 3300044694 Ga0466963_0041139 Ga0466963_0041139_1966_2331 103
206 3300044694 Ga0466963_0073964 Ga0466963_0073964_1170_1481 103
207 3300044694 Ga0466963_0123019 Ga0466963_0123019_1380_1694 103
208 3300044706 Ga0466964_0027416 Ga0466964_0027416_872_1183 103
209 3300044706 Ga0466964_0044573 Ga0466964_0044573_825_1136 103
210 3300044706 Ga0466964_0272256 Ga0466964_0272256_177_494 103
211 3300044706 Ga0466964_0911731 Ga0466964_0911731_13_327 103
212 3300044719 Ga0466971_0058273 Ga0466971_0058273_305_616 103
213 3300044719 Ga0466971_0063593 Ga0466971_0063593_703_1014 103
214 3300044719 Ga0466971_0172604 Ga0466971_0172604_567_881 103
215 3300044735 Ga0466968_0177990 Ga0466968_0177990_25_336 103
216 3300044735 Ga0466968_0367873 Ga0466968_0367873_374_688 103
217 3300044735 Ga0466968_0697346 Ga0466968_0697346_53_364 103
218 3300044765 Ga0466970_0020020 Ga0466970_0020020_701_1012 103
219 3300044765 Ga0466970_0068183 Ga0466970_0068183_830_1141 103
220 3300044765 Ga0466970_0319758 Ga0466970_0319758_236_547 103
221 3300044842 Ga0466957_0008610 Ga0466957_0008610_199_510 103
222 3300044842 Ga0466957_0013692 Ga0466957_0013692_665_976 103
223 3300044901 Ga0466960_0042178 Ga0466960_0042178_1163_1474 103
224 3300044901 Ga0466960_0073326 Ga0466960_0073326_748_1059 103
225 3300044901 Ga0466960_0380516 Ga0466960_0380516_404_715 103
226 3300045049 Ga0466959_0031341 Ga0466959_0031341_2356_2697 103
227 3300045049 Ga0466959_0140789 Ga0466959_0140789_24_335 103
228 3300045049 Ga0466959_0160639 Ga0466959_0160639_817_1128 103
229 3300045049 Ga0466959_0185817 Ga0466959_0185817_90_401 103
230 3300045049 Ga0466959_0933956 Ga0466959_0933956_89_403 103
231 3300045049 Ga0466959_0980056 Ga0466959_0980056_41_352 103
232 3300045836 Ga0466958_0009360 Ga0466958_0009360_774_1085 103
233 3300045836 Ga0466958_0010271 Ga0466958_0010271_3520_3831 103
234 3300045836 Ga0466958_0045826 Ga0466958_0045826_756_1067 103
235 3300045836 Ga0466958_0075922 Ga0466958_0075922_1723_2037 103
236 3300045836 Ga0466958_0097392 Ga0466958_0097392_701_1012 103
237 3300045836 Ga0466958_0215589 Ga0466958_0215589_349_666 103
238 3300045976 Ga0466967_0000382 Ga0466967_0000382_3992_4303 103
239 3300045976 Ga0466967_0001908 Ga0466967_0001908_11593_11958 103
240 3300045976 Ga0466967_0003147 Ga0466967_0003147_5616_5936 103
241 3300045976 Ga0466967_0003455 Ga0466967_0003455_2898_3209 103
242 3300045976 Ga0466967_0018239 Ga0466967_0018239_3524_3838 103
243 3300045976 Ga0466967_0025063 Ga0466967_0025063_3516_3830 103
244 3300045976 Ga0466967_0028813 Ga0466967_0028813_2751_3068 103
245 3300045976 Ga0466967_0121206 Ga0466967_0121206_574_885 103
246 3300045976 Ga0466967_0121224 Ga0466967_0121224_52_366 103
247 3300045976 Ga0466967_0217855 Ga0466967_0217855_1093_1407 103
248 3300045976 Ga0466967_0901098 Ga0466967_0901098_121_432 103
249 3300045976 Ga0466967_1371553 Ga0466967_1371553_18_332 103
250 3300046463 Ga0495653_0670779 Ga0495653_0670779_114_425 103
251 3300046675 Ga0495657_0581727 Ga0495657_0581727_210_524 103
252 3300047319 Ga0495674_0958047 Ga0495674_0958047_106_417 103
253 3300047471 Ga0495684_0383592 Ga0495684_0383592_502_813 103
254 3300048088 Ga0495602_0587103 Ga0495602_0587103_138_452 103
255 3300048903 Ga0496100_0501320 Ga0496100_0501320_19_333 103
256 3300048903 Ga0496100_0940346 Ga0496100_0940346_69_380 103
257 3300048905 Ga0496102_0000569 Ga0496102_0000569_28069_28380 103
258 3300048905 Ga0496102_0688843 Ga0496102_0688843_476_787 103
259 3300048906 Ga0496103_0097690 Ga0496103_0097690_1386_1697 103
260 3300048907 Ga0496104_0691013 Ga0496104_0691013_404_715 103
261 3300048908 Ga0496105_0429126 Ga0496105_0429126_303_614 103
262 3300048910 Ga0496107_1220650 Ga0496107_1220650_155_469 103
263 3300048911 Ga0496108_0037152 Ga0496108_0037152_2850_3164 103
264 3300048911 Ga0496108_0397066 Ga0496108_0397066_407_718 103
265 3300048912 Ga0496109_0094902 Ga0496109_0094902_1150_1464 103
266 3300048912 Ga0496109_0928156 Ga0496109_0928156_365_676 103
267 3300048913 Ga0496110_0016699 Ga0496110_0016699_2902_3216 103
268 3300048914 Ga0496111_0093696 Ga0496111_0093696_727_1041 103
269 3300048914 Ga0496111_1283621 Ga0496111_1283621_15_326 103
270 3300048915 Ga0496112_0163634 Ga0496112_0163634_1130_1444 103
271 3300048916 Ga0496113_0599749 Ga0496113_0599749_425_739 103
272 3300048918 Ga0496115_1089098 Ga0496115_1089098_189_500 103
273 3300048918 Ga0496115_1409126 Ga0496115_1409126_61_375 103
274 3300048921 Ga0496118_0073130 Ga0496118_0073130_28_339 103
275 3300048922 Ga0496119_0000153 Ga0496119_0000153_41202_41513 103
276 3300048923 Ga0496120_0022025 Ga0496120_0022025_840_1151 103
277 3300049568 Ga0501031_0042529 Ga0501031_0042529_587_898 103
278 3300049569 Ga0501032_0646700 Ga0501032_0646700_118_429 103
279 3300049570 Ga0501033_0162221 Ga0501033_0162221_590_901 103
280 3300049571 Ga0501034_0568242 Ga0501034_0568242_67_378 103
281 3300049572 Ga0501036_0534648 Ga0501036_0534648_492_803 103
282 3300049573 Ga0501037_0177488 Ga0501037_0177488_698_1009 103
283 3300049574 Ga0501038_0003697 Ga0501038_0003697_13257_13568 103
284 3300049579 Ga0501043_0164881 Ga0501043_0164881_325_636 103
285 3300049580 Ga0501046_0048811 Ga0501046_0048811_1845_2156 103
286 3300049581 Ga0501047_0003454 Ga0501047_0003454_6737_7048 103
287 3300049581 Ga0501047_0193219 Ga0501047_0193219_1485_1796 103
288 3300049582 Ga0501048_0000303 Ga0501048_0000303_20264_20575 103
289 3300049586 Ga0501070_0012680 Ga0501070_0012680_474_785 103
290 3300049586 Ga0501070_0221651 Ga0501070_0221651_292_603 103
291 3300049588 Ga0501072_1496607 Ga0501072_1496607_193_504 103
292 3300049589 Ga0501073_0726195 Ga0501073_0726195_132_443 103
293 3300049590 Ga0501074_0442584 Ga0501074_0442584_466_777 103
294 3300049742 Ga0501080_0372271 Ga0501080_0372271_629_940 103
295 3300049743 Ga0501081_1020924 Ga0501081_1020924_273_584 103
296 3300049823 Ga0501044_0058974 Ga0501044_0058974_272_583 103
297 3300049823 Ga0501044_0296426 Ga0501044_0296426_795_1106 103
298 3300050511 nmdc:mga08y16_2062836_c1 nmdc:mga08y16_2062836_c1_85_396 103
299 3300059492 Ga0587073_0139365 Ga0587073_0139365_71_382 103
300 3300059492 Ga0587073_0159663 Ga0587073_0159663_88_399 103
301 3300059503 Ga0587080_116700 Ga0587080_116700_89_400 103
302 3300059504 Ga0587082_052942 Ga0587082_052942_112_423 103
303 3300059504 Ga0587082_130295 Ga0587082_130295_89_403 103
304 3300059505 Ga0587083_0237078 Ga0587083_0237078_154_477 103
305 3300059508 Ga0587088_158348 Ga0587088_158348_187_498 103
306 3300059510 Ga0587090_121547 Ga0587090_121547_207_518 103
307 3300059511 Ga0587091_159379 Ga0587091_159379_188_499 103
308 3300059512 Ga0587092_141250 Ga0587092_141250_66_389 103
309 3300059605 Ga0587106_156540 Ga0587106_156540_101_412 103
310 3300059626 Ga0587115_085756 Ga0587115_085756_103_414 103
311 3300059630 Ga0587128_166284 Ga0587128_166284_157_468 103
312 3300059631 Ga0587130_039685 Ga0587130_039685_188_499 103
313 3300059640 Ga0587067_237937 Ga0587067_237937_101_412 103
314 3300059643 Ga0587072_143076 Ga0587072_143076_131_445 103
315 3300059644 Ga0587075_054798 Ga0587075_054798_301_612 103
316 3300059644 Ga0587075_145919 Ga0587075_145919_96_410 103
317 3300059645 Ga0587076_129569 Ga0587076_129569_95_406 103
318 3300059645 Ga0587076_150144 Ga0587076_150144_176_490 103
319 3300059647 Ga0587079_167558 Ga0587079_167558_171_482 103
320 3300059650 Ga0587104_025040 Ga0587104_025040_101_412 103
321 3300060344 Ga0587071_144093 Ga0587071_144093_89_400 103
322 3300060346 Ga0587111_0234222 Ga0587111_0234222_129_440 103
323 3300061719 Ga0466962_0037329 Ga0466962_0037329_1108_1419 103
324 3300061719 Ga0466962_0043154 Ga0466962_0043154_619_930 103
325 3300061719 Ga0466962_0165897 Ga0466962_0165897_39_350 103
326 3300061719 Ga0466962_0459419 Ga0466962_0459419_170_481 103
327 3300001915 JGI24741J21665_1025334 JGI24741J21665_10253343 104
328 3300001979 JGI24740J21852_10102749 JGI24740J21852_101027491 104
329 3300001989 JGI24739J22299_10239451 JGI24739J22299_102394512 104
330 3300001990 JGI24737J22298_10266325 JGI24737J22298_102663251 104
331 3300001991 JGI24743J22301_10010175 JGI24743J22301_100101752 104
332 3300001991 JGI24743J22301_10143490 JGI24743J22301_101434901 104
333 3300002067 JGI24735J21928_10088130 JGI24735J21928_100881301 104
334 3300002067 JGI24735J21928_10094505 JGI24735J21928_100945052 104
335 3300002075 JGI24738J21930_10036034 JGI24738J21930_100360342 104
336 3300002155 JGI24033J26618_1016950 JGI24033J26618_10169503 104
337 3300002459 JGI24751J29686_10008749 JGI24751J29686_100087493 104
338 3300003308 Ga0006777J48905_1069915 Ga0006777J48905_10699151 104
339 3300003659 JGI25404J52841_10125115 JGI25404J52841_101251151 104
340 3300004785 Ga0058858_1228152 Ga0058858_12281521 104
341 3300004798 Ga0058859_11241572 Ga0058859_112415722 104
342 3300004798 Ga0058859_11702261 Ga0058859_117022611 104
343 3300004799 Ga0058863_10038017 Ga0058863_100380171 104
344 3300004799 Ga0058863_10049759 Ga0058863_100497591 104
345 3300004799 Ga0058863_11784877 Ga0058863_117848771 104
346 3300004800 Ga0058861_10170916 Ga0058861_101709161 104
347 3300004801 Ga0058860_10051072 Ga0058860_100510722 104
348 3300004801 Ga0058860_11926006 Ga0058860_119260062 104
349 3300004801 Ga0058860_12151711 Ga0058860_121517112 104
350 3300004803 Ga0058862_10038154 Ga0058862_100381542 104
351 3300004803 Ga0058862_10059979 Ga0058862_100599791 104
352 3300005327 Ga0070658_10002776 Ga0070658_100027763 104
353 3300005327 Ga0070658_10236294 Ga0070658_102362943 104
354 3300005328 Ga0070676_10061366 Ga0070676_100613663 104
355 3300005329 Ga0070683_100249062 Ga0070683_1002490622 104
356 3300005329 Ga0070683_101413057 Ga0070683_1014130572 104
357 3300005330 Ga0070690_100311378 Ga0070690_1003113781 104
358 3300005333 Ga0070677_10604200 Ga0070677_106042001 104
359 3300005334 Ga0068869_100014640 Ga0068869_1000146405 104
360 3300005334 Ga0068869_100115301 Ga0068869_1001153012 104
361 3300005335 Ga0070666_10239457 Ga0070666_102394572 104
362 3300005336 Ga0070680_100000403 Ga0070680_1000004032 104
363 3300005336 Ga0070680_100102565 Ga0070680_1001025653 104
364 3300005337 Ga0070682_100009318 Ga0070682_1000093186 104
365 3300005337 Ga0070682_100250965 Ga0070682_1002509652 104
366 3300005338 Ga0068868_100010973 Ga0068868_1000109734 104
367 3300005338 Ga0068868_100336562 Ga0068868_1003365622 104
368 3300005339 Ga0070660_100042679 Ga0070660_1000426793 104
369 3300005339 Ga0070660_100415482 Ga0070660_1004154822 104
370 3300005340 Ga0070689_100037765 Ga0070689_1000377653 104
371 3300005340 Ga0070689_100379023 Ga0070689_1003790232 104
372 3300005341 Ga0070691_10002288 Ga0070691_100022887 104
373 3300005341 Ga0070691_10347568 Ga0070691_103475682 104
374 3300005343 Ga0070687_100394995 Ga0070687_1003949951 104
375 3300005344 Ga0070661_100067572 Ga0070661_1000675724 104
376 3300005344 Ga0070661_100476130 Ga0070661_1004761301 104
377 3300005345 Ga0070692_10001141 Ga0070692_100011413 104
378 3300005345 Ga0070692_10367576 Ga0070692_103675762 104
379 3300005347 Ga0070668_100440273 Ga0070668_1004402732 104
380 3300005353 Ga0070669_100136030 Ga0070669_1001360303 104
381 3300005353 Ga0070669_100592761 Ga0070669_1005927612 104
382 3300005354 Ga0070675_100190937 Ga0070675_1001909372 104
383 3300005354 Ga0070675_100426515 Ga0070675_1004265153 104
384 3300005355 Ga0070671_100022196 Ga0070671_1000221962 104
385 3300005355 Ga0070671_100066003 Ga0070671_1000660031 104
386 3300005356 Ga0070674_100243236 Ga0070674_1002432362 104
387 3300005356 Ga0070674_101087106 Ga0070674_1010871062 104
388 3300005364 Ga0070673_100045389 Ga0070673_1000453893 104
389 3300005364 Ga0070673_101692251 Ga0070673_1016922511 104
390 3300005365 Ga0070688_100124063 Ga0070688_1001240632 104
391 3300005366 Ga0070659_100073970 Ga0070659_1000739702 104
392 3300005366 Ga0070659_101297416 Ga0070659_1012974162 104
393 3300005367 Ga0070667_100181210 Ga0070667_1001812103 104
394 3300005406 Ga0070703_10020264 Ga0070703_100202642 104
395 3300005434 Ga0070709_10082413 Ga0070709_100824132 104
396 3300005434 Ga0070709_10204350 Ga0070709_102043502 104
397 3300005435 Ga0070714_100039499 Ga0070714_1000394992 104
398 3300005435 Ga0070714_100196267 Ga0070714_1001962673 104
399 3300005436 Ga0070713_100003681 Ga0070713_1000036812 104
400 3300005436 Ga0070713_100063954 Ga0070713_1000639544 104
401 3300005436 Ga0070713_100193100 Ga0070713_1001931002 104
402 3300005437 Ga0070710_10087279 Ga0070710_100872793 104
403 3300005438 Ga0070701_11063369 Ga0070701_110633691 104
404 3300005439 Ga0070711_100063662 Ga0070711_1000636623 104
405 3300005440 Ga0070705_100779847 Ga0070705_1007798472 104
406 3300005441 Ga0070700_100015218 Ga0070700_1000152182 104
407 3300005444 Ga0070694_100451973 Ga0070694_1004519732 104
408 3300005445 Ga0070708_101382832 Ga0070708_1013828321 104
409 3300005445 Ga0070708_101856206 Ga0070708_1018562062 104
410 3300005455 Ga0070663_100022899 Ga0070663_1000228995 104
411 3300005455 Ga0070663_100255275 Ga0070663_1002552753 104
412 3300005456 Ga0070678_100036827 Ga0070678_1000368272 104
413 3300005456 Ga0070678_100047642 Ga0070678_1000476423 104
414 3300005457 Ga0070662_100473929 Ga0070662_1004739291 104
415 3300005457 Ga0070662_100807909 Ga0070662_1008079092 104
416 3300005457 Ga0070662_101544972 Ga0070662_1015449721 104
417 3300005458 Ga0070681_10032811 Ga0070681_100328113 104
418 3300005458 Ga0070681_10066114 Ga0070681_100661142 104
419 3300005459 Ga0068867_102103651 Ga0068867_1021036511 104
420 3300005459 Ga0068867_102351593 Ga0068867_1023515931 104
421 3300005466 Ga0070685_10047048 Ga0070685_100470482 104
422 3300005467 Ga0070706_100304029 Ga0070706_1003040293 104
423 3300005468 Ga0070707_100467645 Ga0070707_1004676453 104
424 3300005518 Ga0070699_100596772 Ga0070699_1005967723 104
425 3300005530 Ga0070679_100000591 Ga0070679_10000059130 104
426 3300005530 Ga0070679_100189316 Ga0070679_1001893163 104
427 3300005535 Ga0070684_102323874 Ga0070684_1023238741 104
428 3300005536 Ga0070697_100121856 Ga0070697_1001218563 104
429 3300005539 Ga0068853_100052946 Ga0068853_1000529461 104
430 3300005539 Ga0068853_100063236 Ga0068853_1000632362 104
431 3300005543 Ga0070672_100116896 Ga0070672_1001168963 104
432 3300005543 Ga0070672_100908966 Ga0070672_1009089662 104
433 3300005544 Ga0070686_100147763 Ga0070686_1001477633 104
434 3300005544 Ga0070686_100501870 Ga0070686_1005018702 104
435 3300005545 Ga0070695_100147064 Ga0070695_1001470643 104
436 3300005546 Ga0070696_100044500 Ga0070696_1000445001 104
437 3300005547 Ga0070693_100045268 Ga0070693_1000452683 104
438 3300005547 Ga0070693_100209279 Ga0070693_1002092792 104
439 3300005548 Ga0070665_100055530 Ga0070665_1000555305 104
440 3300005548 Ga0070665_100282904 Ga0070665_1002829042 104
441 3300005549 Ga0070704_100119640 Ga0070704_1001196403 104
442 3300005563 Ga0068855_100056300 Ga0068855_1000563003 104
443 3300005563 Ga0068855_100061160 Ga0068855_1000611602 104
444 3300005564 Ga0070664_100683268 Ga0070664_1006832682 104
445 3300005578 Ga0068854_100102323 Ga0068854_1001023232 104
446 3300005578 Ga0068854_100190576 Ga0068854_1001905762 104
447 3300005614 Ga0068856_100683982 Ga0068856_1006839822 104
448 3300005615 Ga0070702_100000310 Ga0070702_1000003102 104
449 3300005615 Ga0070702_100025843 Ga0070702_1000258433 104
450 3300005616 Ga0068852_100007126 Ga0068852_1000071262 104
451 3300005616 Ga0068852_100058031 Ga0068852_1000580314 104
452 3300005617 Ga0068859_100216754 Ga0068859_1002167542 104
453 3300005617 Ga0068859_100278093 Ga0068859_1002780933 104
454 3300005618 Ga0068864_100148152 Ga0068864_1001481523 104
455 3300005618 Ga0068864_101321867 Ga0068864_1013218671 104
456 3300005718 Ga0068866_10424985 Ga0068866_104249853 104
457 3300005719 Ga0068861_100009878 Ga0068861_1000098787 104
458 3300005834 Ga0068851_10093763 Ga0068851_100937632 104
459 3300005834 Ga0068851_10141320 Ga0068851_101413201 104
460 3300005840 Ga0068870_10031322 Ga0068870_100313223 104
461 3300005840 Ga0068870_10096807 Ga0068870_100968072 104
462 3300005841 Ga0068863_100056137 Ga0068863_1000561372 104
463 3300005842 Ga0068858_100061566 Ga0068858_1000615662 104
464 3300005843 Ga0068860_100086873 Ga0068860_1000868733 104
465 3300005843 Ga0068860_100447135 Ga0068860_1004471351 104
466 3300005844 Ga0068862_101137353 Ga0068862_1011373531 104
467 3300005937 Ga0081455_10003134 Ga0081455_1000313410 104
468 3300005937 Ga0081455_10438380 Ga0081455_104383801 104
469 3300005983 Ga0081540_1057314 Ga0081540_10573143 104
470 3300005983 Ga0081540_1124755 Ga0081540_11247552 104
471 3300006028 Ga0070717_10109999 Ga0070717_101099993 104
472 3300006028 Ga0070717_10127752 Ga0070717_101277523 104
473 3300006058 Ga0075432_10078396 Ga0075432_100783962 104
474 3300006058 Ga0075432_10576757 Ga0075432_105767571 104
475 3300006175 Ga0070712_100771338 Ga0070712_1007713382 104
476 3300006175 Ga0070712_101652683 Ga0070712_1016526832 104
477 3300006175 Ga0070712_101652685 Ga0070712_1016526852 104
478 3300006237 Ga0097621_100256560 Ga0097621_1002565602 104
479 3300006358 Ga0068871_100618252 Ga0068871_1006182521 104
480 3300006844 Ga0075428_100709312 Ga0075428_1007093123 104
481 3300006844 Ga0075428_100987396 Ga0075428_1009873962 104
482 3300006844 Ga0075428_101126428 Ga0075428_1011264282 104
483 3300006846 Ga0075430_100828232 Ga0075430_1008282322 104
484 3300006847 Ga0075431_100111461 Ga0075431_1001114613 104
485 3300006847 Ga0075431_100165218 Ga0075431_1001652183 104
486 3300006847 Ga0075431_100272814 Ga0075431_1002728141 104
487 3300006852 Ga0075433_10023324 Ga0075433_100233243 104
488 3300006852 Ga0075433_10038514 Ga0075433_100385142 104
489 3300006871 Ga0075434_100020783 Ga0075434_1000207836 104
490 3300006871 Ga0075434_100773784 Ga0075434_1007737841 104
491 3300006880 Ga0075429_100069055 Ga0075429_1000690552 104
492 3300006880 Ga0075429_100160507 Ga0075429_1001605072 104
493 3300006880 Ga0075429_100333478 Ga0075429_1003334781 104
494 3300006881 Ga0068865_100115964 Ga0068865_1001159643 104
495 3300006914 Ga0075436_100037931 Ga0075436_1000379314 104
496 3300006914 Ga0075436_100175281 Ga0075436_1001752812 104
497 3300006931 Ga0097620_100216736 Ga0097620_1002167362 104
498 3300006931 Ga0097620_100278078 Ga0097620_1002780783 104
499 3300007076 Ga0075435_100067286 Ga0075435_1000672862 104
500 3300007076 Ga0075435_100083231 Ga0075435_1000832312 104
501 3300009011 Ga0105251_10087257 Ga0105251_100872573 104
502 3300009036 Ga0105244_10218282 Ga0105244_102182822 104
503 3300009092 Ga0105250_10389224 Ga0105250_103892242 104
504 3300009093 Ga0105240_10099855 Ga0105240_100998554 104
505 3300009093 Ga0105240_10509793 Ga0105240_105097933 104
506 3300009094 Ga0111539_10042854 Ga0111539_100428542 104
507 3300009094 Ga0111539_10070023 Ga0111539_100700231 104
508 3300009098 Ga0105245_10173032 Ga0105245_101730321 104
509 3300009098 Ga0105245_10312756 Ga0105245_103127563 104
510 3300009101 Ga0105247_10052180 Ga0105247_100521804 104
511 3300009101 Ga0105247_10103075 Ga0105247_101030752 104
512 3300009147 Ga0114129_10335614 Ga0114129_103356142 104
513 3300009147 Ga0114129_10408251 Ga0114129_104082513 104
514 3300009148 Ga0105243_10100987 Ga0105243_101009873 104
515 3300009148 Ga0105243_10991808 Ga0105243_109918082 104
516 3300009174 Ga0105241_10101976 Ga0105241_101019762 104
517 3300009174 Ga0105241_10320648 Ga0105241_103206483 104
518 3300009176 Ga0105242_10295740 Ga0105242_102957402 104
519 3300009177 Ga0105248_10202161 Ga0105248_102021612 104
520 3300009177 Ga0105248_10369887 Ga0105248_103698873 104
521 3300009545 Ga0105237_10108611 Ga0105237_101086113 104
522 3300009545 Ga0105237_10210685 Ga0105237_102106853 104
523 3300009551 Ga0105238_10141262 Ga0105238_101412623 104
524 3300009551 Ga0105238_10268938 Ga0105238_102689383 104
525 3300009551 Ga0105238_10316290 Ga0105238_103162902 104
526 3300009553 Ga0105249_10003351 Ga0105249_100033514 104
527 3300009553 Ga0105249_10371869 Ga0105249_103718691 104
528 3300010375 Ga0105239_10254149 Ga0105239_102541493 104
529 3300010375 Ga0105239_10262054 Ga0105239_102620543 104
530 3300011119 Ga0105246_10092415 Ga0105246_100924153 104
531 3300011119 Ga0105246_11680503 Ga0105246_116805032 104
532 3300012490 Ga0157322_1017566 Ga0157322_10175662 104
533 3300012505 Ga0157339_1007253 Ga0157339_10072531 104
534 3300012515 Ga0157338_1025808 Ga0157338_10258081 104
535 3300013045 Ga0154016_141312 Ga0154016_1413121 104
536 3300013052 Ga0154014_115819 Ga0154014_1158192 104
537 3300013059 Ga0154012_121067 Ga0154012_1210672 104
538 3300013062 Ga0154010_133995 Ga0154010_1339952 104
539 3300013100 Ga0157373_10064774 Ga0157373_100647742 104
540 3300013100 Ga0157373_10102351 Ga0157373_101023512 104
541 3300013102 Ga0157371_10087013 Ga0157371_100870132 104
542 3300013102 Ga0157371_10181287 Ga0157371_101812873 104
543 3300013104 Ga0157370_10032625 Ga0157370_100326253 104
544 3300013104 Ga0157370_10243087 Ga0157370_102430872 104
545 3300013105 Ga0157369_10138299 Ga0157369_101382993 104
546 3300013105 Ga0157369_10751155 Ga0157369_107511552 104
547 3300013105 Ga0157369_11556107 Ga0157369_115561072 104
548 3300013296 Ga0157374_10013476 Ga0157374_100134765 104
549 3300013296 Ga0157374_10085138 Ga0157374_100851383 104
550 3300013297 Ga0157378_10107645 Ga0157378_101076453 104
551 3300013297 Ga0157378_10203628 Ga0157378_102036282 104
552 3300013306 Ga0163162_10010190 Ga0163162_1001019011 104
553 3300013306 Ga0163162_11808158 Ga0163162_118081582 104
554 3300013307 Ga0157372_10033763 Ga0157372_100337635 104
555 3300013308 Ga0157375_10320460 Ga0157375_103204602 104
556 3300013308 Ga0157375_10422338 Ga0157375_104223383 104
557 3300014325 Ga0163163_10075082 Ga0163163_100750824 104
558 3300014325 Ga0163163_10213130 Ga0163163_102131303 104
559 3300014326 Ga0157380_10027310 Ga0157380_100273102 104
560 3300014497 Ga0182008_10423769 Ga0182008_104237691 104
561 3300014745 Ga0157377_10116951 Ga0157377_101169512 104
562 3300014745 Ga0157377_10132403 Ga0157377_101324032 104
563 3300014968 Ga0157379_10017319 Ga0157379_100173193 104
564 3300014968 Ga0157379_10034232 Ga0157379_100342322 104
565 3300014969 Ga0157376_10365935 Ga0157376_103659353 104
566 3300014969 Ga0157376_10574614 Ga0157376_105746142 104
567 3300014969 Ga0157376_10686039 Ga0157376_106860391 104
568 3300015265 Ga0182005_1143526 Ga0182005_11435262 104
569 3300017792 Ga0163161_10062232 Ga0163161_100622321 104
570 3300020069 Ga0197907_10136472 Ga0197907_101364723 104
571 3300020069 Ga0197907_10890214 Ga0197907_108902142 104
572 3300020069 Ga0197907_11425484 Ga0197907_114254841 104
573 3300020070 Ga0206356_11542350 Ga0206356_115423504 104
574 3300020075 Ga0206349_1039003 Ga0206349_10390032 104
575 3300020076 Ga0206355_1437175 Ga0206355_14371753 104
576 3300020077 Ga0206351_10165192 Ga0206351_101651921 104
577 3300020077 Ga0206351_10583506 Ga0206351_105835062 104
578 3300020078 Ga0206352_10453915 Ga0206352_104539152 104
579 3300020078 Ga0206352_10583660 Ga0206352_105836602 104
580 3300020078 Ga0206352_10782919 Ga0206352_107829192 104
581 3300020078 Ga0206352_10998634 Ga0206352_109986341 104
582 3300020078 Ga0206352_11289899 Ga0206352_112898992 104
583 3300020080 Ga0206350_10973946 Ga0206350_109739462 104
584 3300020080 Ga0206350_11468155 Ga0206350_114681553 104
585 3300020081 Ga0206354_10328282 Ga0206354_103282821 104
586 3300020081 Ga0206354_11011929 Ga0206354_110119292 104
587 3300020081 Ga0206354_11651120 Ga0206354_116511203 104
588 3300020082 Ga0206353_10292783 Ga0206353_102927831 104
589 3300020082 Ga0206353_10389836 Ga0206353_1038983619 104
590 3300020082 Ga0206353_11945709 Ga0206353_119457092 104
591 3300020082 Ga0206353_11945828 Ga0206353_119458283 104
592 3300020610 Ga0154015_1599216 Ga0154015_15992162 104
593 3300021384 Ga0213876_10179411 Ga0213876_101794112 104
594 3300021384 Ga0213876_10448867 Ga0213876_104488671 104
595 3300022467 Ga0224712_10057189 Ga0224712_100571893 104
596 3300022467 Ga0224712_10099262 Ga0224712_100992622 104
597 3300022467 Ga0224712_10352643 Ga0224712_103526432 104
598 3300022467 Ga0224712_10592967 Ga0224712_105929672 104
599 3300025321 Ga0207656_10165259 Ga0207656_101652593 104
600 3300025735 Ga0207713_1045258 Ga0207713_10452582 104
601 3300025735 Ga0207713_1099531 Ga0207713_10995311 104
602 3300025898 Ga0207692_10028262 Ga0207692_100282623 104
603 3300025900 Ga0207710_10030049 Ga0207710_100300493 104
604 3300025900 Ga0207710_10032300 Ga0207710_100323002 104
605 3300025901 Ga0207688_10005623 Ga0207688_100056232 104
606 3300025901 Ga0207688_10008908 Ga0207688_100089086 104
607 3300025903 Ga0207680_10576517 Ga0207680_105765172 104
608 3300025904 Ga0207647_10202619 Ga0207647_102026192 104
609 3300025904 Ga0207647_10325949 Ga0207647_103259492 104
610 3300025905 Ga0207685_10093707 Ga0207685_100937072 104
611 3300025907 Ga0207645_10060884 Ga0207645_100608842 104
612 3300025908 Ga0207643_10000645 Ga0207643_1000064520 104
613 3300025908 Ga0207643_10302923 Ga0207643_103029232 104
614 3300025909 Ga0207705_10003405 Ga0207705_100034059 104
615 3300025909 Ga0207705_10126859 Ga0207705_101268592 104
616 3300025910 Ga0207684_11046939 Ga0207684_110469392 104
617 3300025911 Ga0207654_10022308 Ga0207654_100223084 104
618 3300025911 Ga0207654_10111388 Ga0207654_101113882 104
619 3300025912 Ga0207707_10000764 Ga0207707_100007643 104
620 3300025912 Ga0207707_10050988 Ga0207707_100509881 104
621 3300025913 Ga0207695_10176566 Ga0207695_101765663 104
622 3300025913 Ga0207695_10425580 Ga0207695_104255803 104
623 3300025913 Ga0207695_10478025 Ga0207695_104780253 104
624 3300025914 Ga0207671_10081214 Ga0207671_100812143 104
625 3300025914 Ga0207671_10352690 Ga0207671_103526901 104
626 3300025915 Ga0207693_10033430 Ga0207693_100334305 104
627 3300025915 Ga0207693_10664794 Ga0207693_106647942 104
628 3300025916 Ga0207663_10321275 Ga0207663_103212753 104
629 3300025917 Ga0207660_10018252 Ga0207660_100182522 104
630 3300025917 Ga0207660_10025359 Ga0207660_100253592 104
631 3300025918 Ga0207662_10019315 Ga0207662_100193152 104
632 3300025918 Ga0207662_10251634 Ga0207662_102516342 104
633 3300025919 Ga0207657_10012324 Ga0207657_100123247 104
634 3300025919 Ga0207657_10020145 Ga0207657_100201452 104
635 3300025920 Ga0207649_10011169 Ga0207649_100111692 104
636 3300025921 Ga0207652_10000504 Ga0207652_100005049 104
637 3300025921 Ga0207652_10098866 Ga0207652_100988663 104
638 3300025922 Ga0207646_10267553 Ga0207646_102675532 104
639 3300025923 Ga0207681_10384645 Ga0207681_103846453 104
640 3300025924 Ga0207694_10084470 Ga0207694_100844703 104
641 3300025924 Ga0207694_10328421 Ga0207694_103284211 104
642 3300025925 Ga0207650_10011084 Ga0207650_100110842 104
643 3300025926 Ga0207659_10029646 Ga0207659_100296462 104
644 3300025926 Ga0207659_10906264 Ga0207659_109062641 104
645 3300025926 Ga0207659_11018961 Ga0207659_110189612 104
646 3300025927 Ga0207687_10011377 Ga0207687_100113772 104
647 3300025927 Ga0207687_10080384 Ga0207687_100803843 104
648 3300025928 Ga0207700_10356705 Ga0207700_103567052 104
649 3300025928 Ga0207700_11136442 Ga0207700_111364422 104
650 3300025929 Ga0207664_10393745 Ga0207664_103937451 104
651 3300025931 Ga0207644_10119010 Ga0207644_101190103 104
652 3300025931 Ga0207644_10215700 Ga0207644_102157002 104
653 3300025932 Ga0207690_10097968 Ga0207690_100979682 104
654 3300025933 Ga0207706_10071486 Ga0207706_100714864 104
655 3300025933 Ga0207706_10239867 Ga0207706_102398673 104
656 3300025935 Ga0207709_10037156 Ga0207709_100371562 104
657 3300025935 Ga0207709_10735289 Ga0207709_107352892 104
658 3300025936 Ga0207670_10212038 Ga0207670_102120382 104
659 3300025936 Ga0207670_10448113 Ga0207670_104481132 104
660 3300025937 Ga0207669_10286183 Ga0207669_102861832 104
661 3300025937 Ga0207669_11582358 Ga0207669_115823581 104
662 3300025938 Ga0207704_10080313 Ga0207704_100803133 104
663 3300025938 Ga0207704_10910058 Ga0207704_109100581 104
664 3300025939 Ga0207665_10000841 Ga0207665_1000084112 104
665 3300025939 Ga0207665_10244955 Ga0207665_102449552 104
666 3300025940 Ga0207691_10171271 Ga0207691_101712713 104
667 3300025940 Ga0207691_10237092 Ga0207691_102370922 104
668 3300025941 Ga0207711_10260653 Ga0207711_102606532 104
669 3300025941 Ga0207711_10441140 Ga0207711_104411403 104
670 3300025942 Ga0207689_10000247 Ga0207689_1000024728 104
671 3300025942 Ga0207689_10018795 Ga0207689_100187953 104
672 3300025944 Ga0207661_10008281 Ga0207661_100082814 104
673 3300025944 Ga0207661_11624024 Ga0207661_116240241 104
674 3300025945 Ga0207679_10001936 Ga0207679_100019362 104
675 3300025945 Ga0207679_10816991 Ga0207679_108169912 104
676 3300025949 Ga0207667_10135964 Ga0207667_101359643 104
677 3300025960 Ga0207651_11321024 Ga0207651_113210241 104
678 3300025961 Ga0207712_10065421 Ga0207712_100654213 104
679 3300025972 Ga0207668_10011015 Ga0207668_100110152 104
680 3300025981 Ga0207640_10019036 Ga0207640_100190362 104
681 3300025981 Ga0207640_10366843 Ga0207640_103668432 104
682 3300026023 Ga0207677_10045516 Ga0207677_100455163 104
683 3300026035 Ga0207703_10248429 Ga0207703_102484292 104
684 3300026067 Ga0207678_10000642 Ga0207678_100006422 104
685 3300026067 Ga0207678_10001249 Ga0207678_1000124911 104
686 3300026075 Ga0207708_10114677 Ga0207708_101146773 104
687 3300026078 Ga0207702_10002205 Ga0207702_100022052 104
688 3300026078 Ga0207702_10093978 Ga0207702_100939783 104
689 3300026088 Ga0207641_10018849 Ga0207641_100188492 104
690 3300026088 Ga0207641_10044128 Ga0207641_100441284 104
691 3300026089 Ga0207648_10317239 Ga0207648_103172392 104
692 3300026089 Ga0207648_11750794 Ga0207648_117507941 104
693 3300026095 Ga0207676_10002528 Ga0207676_100025282 104
694 3300026095 Ga0207676_10107667 Ga0207676_101076672 104
695 3300026095 Ga0207676_11753542 Ga0207676_117535422 104
696 3300026095 Ga0207676_11926288 Ga0207676_119262881 104
697 3300026116 Ga0207674_10367153 Ga0207674_103671533 104
698 3300026116 Ga0207674_10988309 Ga0207674_109883091 104
699 3300026118 Ga0207675_100004308 Ga0207675_10000430813 104
700 3300026118 Ga0207675_100125041 Ga0207675_1001250412 104
701 3300026121 Ga0207683_10021780 Ga0207683_100217804 104
702 3300026121 Ga0207683_10055090 Ga0207683_100550902 104
703 3300026142 Ga0207698_10021270 Ga0207698_100212703 104
704 3300026142 Ga0207698_10202369 Ga0207698_102023692 104
705 3300027907 Ga0207428_10107183 Ga0207428_101071832 104
706 3300027907 Ga0207428_10530242 Ga0207428_105302422 104
707 3300028379 Ga0268266_10038076 Ga0268266_100380765 104
708 3300028379 Ga0268266_10087579 Ga0268266_100875793 104
709 3300028379 Ga0268266_10309304 Ga0268266_103093041 104
710 3300028379 Ga0268266_11601343 Ga0268266_116013432 104
711 3300028380 Ga0268265_10153939 Ga0268265_101539392 104
712 3300028381 Ga0268264_10137202 Ga0268264_101372022 104
713 3300031824 Ga0307413_11498924 Ga0307413_114989242 104
714 3300032126 Ga0307415_100687678 Ga0307415_1006876781 104
715 3300034816 Ga0373930_0095917 Ga0373930_0095917_266_598 104
716 3300034818 Ga0373950_0069445 Ga0373950_0069445_284_616 104
717 3300034819 Ga0373958_0198229 Ga0373958_0198229_117_449 104
718 3300034820 Ga0373959_0041526 Ga0373959_0041526_190_522 104
719 3300035085 Ga0373929_0073742 Ga0373929_0073742_161_493 104
720 3300035085 Ga0373929_0126813 Ga0373929_0126813_23_364 104
721 3300035088 Ga0373940_0020538 Ga0373940_0020538_333_665 104
722 3300035090 Ga0373949_0029511 Ga0373949_0029511_425_757 104
723 3300035091 Ga0373951_0075746 Ga0373951_0075746_221_553 104
724 3300035092 Ga0373952_0038018 Ga0373952_0038018_112_444 104
725 3300035112 Ga0373932_0072271 Ga0373932_0072271_516_848 104
726 3300035114 Ga0373939_0140174 Ga0373939_0140174_254_586 104
727 3300035119 Ga0373956_0360389 Ga0373956_0360389_91_408 104
728 3300035241 Ga0373961_0137976 Ga0373961_0137976_426_758 104
729 3300035242 Ga0373962_0093428 Ga0373962_0093428_430_762 104
730 3300035691 Ga0373931_0005247 Ga0373931_0005247_2424_2756 104
731 3300035691 Ga0373931_0846090 Ga0373931_0846090_144_458 104
732 3300037068 Ga0373925_0164312 Ga0373925_0164312_1150_1509 104
733 3300037853 Ga0436364_0634500 Ga0436364_0634500_154_474 104
734 3300038443 Ga0395901_0208594 Ga0395901_0208594_1545_1865 104
735 3300038443 Ga0395901_0617866 Ga0395901_0617866_600_914 104
736 3300039437 Ga0436365_0521780 Ga0436365_0521780_1230_1559 104
737 3300039437 Ga0436365_0629779 Ga0436365_0629779_142_459 104
738 3300039453 Ga0436362_0332052 Ga0436362_0332052_145_462 104
739 3300042005 Ga0439448_0092466 Ga0439448_0092466_417_731 104
740 3300042016 Ga0439463_065896 Ga0439463_065896_253_567 104
741 3300042118 Ga0450914_018083 Ga0450914_018083_372_686 104
742 3300042137 Ga0450902_086087 Ga0450902_086087_202_516 104
743 3300042157 Ga0439458_0109399 Ga0439458_0109399_291_605 104
744 3300042438 Ga0439459_0002498 Ga0439459_0002498_1359_1673 104
745 3300044656 Ga0466969_0046923 Ga0466969_0046923_980_1303 104
746 3300044684 Ga0466966_0005077 Ga0466966_0005077_7225_7548 104
747 3300044684 Ga0466966_0410557 Ga0466966_0410557_40_363 104
748 3300044693 Ga0466961_0034731 Ga0466961_0034731_1352_1675 104
749 3300044693 Ga0466961_0099175 Ga0466961_0099175_812_1126 104
750 3300044694 Ga0466963_0098223 Ga0466963_0098223_388_708 104
751 3300044694 Ga0466963_0122948 Ga0466963_0122948_33_356 104
752 3300044765 Ga0466970_0336897 Ga0466970_0336897_281_604 104
753 3300044765 Ga0466970_0529456 Ga0466970_0529456_279_605 104
754 3300044842 Ga0466957_1447894 Ga0466957_1447894_157_480 104
755 3300045049 Ga0466959_0159297 Ga0466959_0159297_989_1303 104
756 3300045049 Ga0466959_0233960 Ga0466959_0233960_599_919 104
757 3300045049 Ga0466959_0293888 Ga0466959_0293888_660_986 104
758 3300045049 Ga0466959_0621274 Ga0466959_0621274_187_510 104
759 3300045836 Ga0466958_0017906 Ga0466958_0017906_608_928 104
760 3300045836 Ga0466958_0096466 Ga0466958_0096466_426_740 104
761 3300045836 Ga0466958_0841491 Ga0466958_0841491_162_485 104
762 3300045976 Ga0466967_0064160 Ga0466967_0064160_878_1198 104
763 3300045976 Ga0466967_0161380 Ga0466967_0161380_153_467 104
764 3300045976 Ga0466967_0361788 Ga0466967_0361788_888_1220 104
765 3300045976 Ga0466967_0494623 Ga0466967_0494623_437_760 104
766 3300046461 Ga0495641_0531569 Ga0495641_0531569_35_367 104
767 3300046499 Ga0495594_0454879 Ga0495594_0454879_135_467 104
768 3300048903 Ga0496100_0013183 Ga0496100_0013183_494_808 104
769 3300048903 Ga0496100_0018960 Ga0496100_0018960_3367_3699 104
770 3300048905 Ga0496102_0097385 Ga0496102_0097385_1679_1993 104
771 3300048905 Ga0496102_0425862 Ga0496102_0425862_653_985 104
772 3300048906 Ga0496103_0072910 Ga0496103_0072910_180_512 104
773 3300048907 Ga0496104_0024974 Ga0496104_0024974_850_1164 104
774 3300048907 Ga0496104_0121240 Ga0496104_0121240_2096_2428 104
775 3300048908 Ga0496105_0001319 Ga0496105_0001319_597_911 104
776 3300048908 Ga0496105_0133027 Ga0496105_0133027_601_933 104
777 3300048909 Ga0496106_0016694 Ga0496106_0016694_4484_4798 104
778 3300048909 Ga0496106_0020578 Ga0496106_0020578_3611_3943 104
779 3300048910 Ga0496107_0065388 Ga0496107_0065388_1264_1596 104
780 3300048910 Ga0496107_0147572 Ga0496107_0147572_934_1248 104
781 3300048911 Ga0496108_0010564 Ga0496108_0010564_3796_4128 104
782 3300048911 Ga0496108_0167112 Ga0496108_0167112_1378_1692 104
783 3300048912 Ga0496109_0008423 Ga0496109_0008423_3531_3863 104
784 3300048913 Ga0496110_0017885 Ga0496110_0017885_4332_4664 104
785 3300048913 Ga0496110_0018611 Ga0496110_0018611_588_902 104
786 3300048913 Ga0496110_1003861 Ga0496110_1003861_300_620 104
787 3300048914 Ga0496111_0036953 Ga0496111_0036953_2528_2842 104
788 3300048914 Ga0496111_0174980 Ga0496111_0174980_232_564 104
789 3300048914 Ga0496111_0685254 Ga0496111_0685254_355_675 104
790 3300048915 Ga0496112_0040203 Ga0496112_0040203_1135_1467 104
791 3300048915 Ga0496112_0042662 Ga0496112_0042662_4047_4361 104
792 3300048916 Ga0496113_0057834 Ga0496113_0057834_1633_1947 104
793 3300048916 Ga0496113_0169952 Ga0496113_0169952_518_850 104
794 3300048917 Ga0496114_0030521 Ga0496114_0030521_3004_3336 104
795 3300048917 Ga0496114_0139236 Ga0496114_0139236_1080_1394 104
796 3300048918 Ga0496115_0033887 Ga0496115_0033887_2238_2570 104
797 3300048929 Ga0496126_0000013 Ga0496126_0000013_505835_506155 104
798 3300048929 Ga0496126_0048031 Ga0496126_0048031_2828_3208 104
799 3300050507 nmdc:mga05p37_1325116_c1 nmdc:mga05p37_1325116_c1_33_347 104
800 3300050507 nmdc:mga05p37_384303_c1 nmdc:mga05p37_384303_c1_1221_1535 104
801 3300050507 nmdc:mga05p37_903522_c1 nmdc:mga05p37_903522_c1_124_438 104
802 3300050508 nmdc:mga09592_307899_c1 nmdc:mga09592_307899_c1_185_499 104
803 3300050508 nmdc:mga09592_715019_c1 nmdc:mga09592_715019_c1_344_658 104
804 3300050510 nmdc:mga06r32_134951_c1 nmdc:mga06r32_134951_c1_1075_1389 104
805 3300050510 nmdc:mga06r32_444570_c1 nmdc:mga06r32_444570_c1_771_1085 104
806 3300050510 nmdc:mga06r32_59733_c1 nmdc:mga06r32_59733_c1_252_566 104
807 3300050511 nmdc:mga08y16_147144_c1 nmdc:mga08y16_147144_c1_760_1074 104
808 3300050511 nmdc:mga08y16_1854401_c1 nmdc:mga08y16_1854401_c1_192_524 104
809 3300050512 nmdc:mga0n895_157140_c1 nmdc:mga0n895_157140_c1_855_1169 104
810 3300050512 nmdc:mga0n895_26897_c1 nmdc:mga0n895_26897_c1_2713_3045 104
811 3300050513 nmdc:mga0rr50_218326_c1 nmdc:mga0rr50_218326_c1_1134_1466 104
812 3300050513 nmdc:mga0rr50_4976_c1 nmdc:mga0rr50_4976_c1_6820_7134 104
813 3300050514 nmdc:mga08x19_14945_c1 nmdc:mga08x19_14945_c1_807_1121 104
814 3300050514 nmdc:mga08x19_79940_c1 nmdc:mga08x19_79940_c1_1058_1390 104
815 3300050515 nmdc:mga0a205_3011_c1 nmdc:mga0a205_3011_c1_10992_11306 104
816 3300050515 nmdc:mga0a205_35069_c1 nmdc:mga0a205_35069_c1_3287_3619 104
817 3300054114 Ga0501084_1162898 Ga0501084_1162898_305_619 104
818 3300059477 Ga0587084_065957 Ga0587084_065957_98_415 104
819 3300059491 Ga0587070_157464 Ga0587070_157464_199_513 104
820 3300059504 Ga0587082_170623 Ga0587082_170623_147_461 104
821 3300059505 Ga0587083_0239493 Ga0587083_0239493_119_433 104
822 3300059508 Ga0587088_185101 Ga0587088_185101_66_383 104
823 3300059509 Ga0587089_057798 Ga0587089_057798_165_479 104
824 3300059510 Ga0587090_132322 Ga0587090_132322_221_541 104
825 3300059512 Ga0587092_155379 Ga0587092_155379_164_481 104
826 3300059513 Ga0587094_112888 Ga0587094_112888_41_355 104
827 3300059607 Ga0587125_033373 Ga0587125_033373_54_368 104
828 3300059625 Ga0587113_026753 Ga0587113_026753_225_539 104
829 3300059627 Ga0587117_121527 Ga0587117_121527_75_389 104
830 3300059628 Ga0587122_028664 Ga0587122_028664_283_597 104
831 3300059640 Ga0587067_109589 Ga0587067_109589_254_568 104
832 3300059645 Ga0587076_150445 Ga0587076_150445_106_423 104
833 3300059646 Ga0587078_024412 Ga0587078_024412_315_629 104
834 3300059646 Ga0587078_042880 Ga0587078_042880_256_576 104
835 3300059647 Ga0587079_132520 Ga0587079_132520_231_548 104
836 3300059654 Ga0587110_026956 Ga0587110_026956_286_600 104
837 3300059659 Ga0587120_038741 Ga0587120_038741_178_495 104
838 3300060344 Ga0587071_206712 Ga0587071_206712_149_466 104
839 3300060346 Ga0587111_0277630 Ga0587111_0277630_50_364 104

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00829

Ribosomal_L21p

Ribosomal prokaryotic L21 protein

1

101

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
8cvm-assembly1.cif.gz_q cutibacterium acnes 50s ribosomal subunit with p-site trna and sarecycline bound in the local refined map 0.9406 1 101
7y41-assembly1.cif.gz_S mycobacterium smegmatis 50s ribosomal subunit from log phase of growth 0.9338 1 100
7msm-assembly1.cif.gz_R mtb 70sic in complex with mtbetta at trans_r0 state 0.9317 1 100
7y41-assembly1.cif.gz_S mycobacterium smegmatis 50s ribosomal subunit from log phase of growth 0.925 1 100
8cvm-assembly1.cif.gz_q cutibacterium acnes 50s ribosomal subunit with p-site trna and sarecycline bound in the local refined map 0.9232 1 101
ID Description Score Start End Superfamily
af_P9WHC3_3_102_2.40.10.190 Mainly Beta;Beta Barrel;Thrombin, subunit H;translation elongation factor selb, chain A, domain 4 0.9419 1 100 2.40.10.190
af_P9WHC3_3_102_2.40.10.190 Mainly Beta;Beta Barrel;Thrombin, subunit H;translation elongation factor selb, chain A, domain 4 0.933 1 100 2.40.10.190
af_P0AG48_1_101_2.40.10.190 Mainly Beta;Beta Barrel;Thrombin, subunit H;translation elongation factor selb, chain A, domain 4 0.926 1 100 2.40.10.190
af_Q4DUK1_23_123_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9244 1 100 2.40.50.140
af_A0A1D6H5B5_111_217_2.40.10.190 Mainly Beta;Beta Barrel;Thrombin, subunit H;translation elongation factor selb, chain A, domain 4 0.9094 1 100 2.40.10.190
ID Description Score Start End GO Terms
AF-E6D663-F1-model_v4 deleted 0.9783 2 101
AF-A0A7C6IEB5-F1-model_v4 Large ribosomal subunit protein bL21 0.9731 2 101 GO:0003735
GO:0005737
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-L1PLH8-F1-model_v4 deleted 0.9731 2 101
AF-A0A4R4ZVZ2-F1-model_v4 Large ribosomal subunit protein bL21 0.9729 1 102 GO:0003735
GO:0005737
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-H5X4E2-F1-model_v4 Large ribosomal subunit protein bL21 0.9716 2 101 GO:0003735
GO:0005737
GO:0005840
GO:0006412
GO:0019843
GO:1990904

Feature Viewer

pLDDT pTM Quality
92.37 0.73 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map