F482958

General Info

Members Datasets Scaffolds Average Seq Length
837 341 830 173

Family's Representative Sequence

Representative Sequence 3300049522|Ga0501299_100846|Ga0501299_100846_81_659
Length 192
Sequence MALAAKFSASSRERAMSRIAKYPVPVPKGVEVNLAGGSIAVKGPLGAIARPADPNVGVQKEGENIVFKALGNSNHANAMSGTMRALVAGMVTGVTKGFEKRLALVGVGFRAQAQGDKLSLALGYSHPVVHQMPKGIKVATPTQTEIVISGVDKQLVGQVAAEVRAYRPPEPYKGKGVRYRDEVIVLKETKKK

Samples

Sample ID Description Type Environment
1 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
2 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
3 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
4 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
5 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
6 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
7 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
8 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
9 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
10 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
11 3300002863 Avena fatua rhizosphere microbial communities - H2_Bulk_Litter_12 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
12 3300002868 Avena fatua rhizosphere microbial communities - H2_Bulk_Litter_10 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
13 3300002870 Avena fatua rhizosphere microbial communities - H1_Bulk_Litter_6 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
14 3300002872 Avena fatua rhizosphere microbial communities - H1_Bulk_Litter_5 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
15 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
16 3300003300 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
17 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
18 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
19 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
20 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
21 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
22 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
23 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
24 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
25 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
26 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
27 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
28 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
29 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
30 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
31 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
32 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
33 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
34 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
35 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
36 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
37 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
38 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
39 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
40 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
41 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
42 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
43 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
44 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
45 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
46 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
47 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
48 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
49 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
50 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
51 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
52 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
53 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
54 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
55 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
56 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
57 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
58 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
59 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
60 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
61 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
62 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
63 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
64 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
65 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
66 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
67 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
68 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
69 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
70 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
71 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
72 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
73 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
74 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
75 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
76 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
79 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
80 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
84 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
85 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
89 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
90 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
102 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
103 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
104 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
105 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
106 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
107 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
112 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
123 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
124 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
191 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
194 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
195 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
196 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
197 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
198 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
199 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
200 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
201 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
202 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
203 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
204 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
205 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
206 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
207 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
208 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
209 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
210 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
211 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
212 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
213 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
214 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
215 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
216 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
217 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
218 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
219 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
220 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
221 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
222 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
223 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
224 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
225 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
226 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
227 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
228 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
229 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
230 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
231 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
232 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
233 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
234 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
235 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
236 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
237 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
238 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
239 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
240 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
241 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
242 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
243 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
244 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
245 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
246 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
247 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
248 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
249 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
250 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
251 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
252 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
253 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
254 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
255 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
256 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
257 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
258 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
259 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
260 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
261 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
262 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
263 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
264 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
265 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
266 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
267 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
268 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
269 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
270 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
271 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
272 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
273 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
274 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
275 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
276 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
277 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
278 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
279 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
280 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
281 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
282 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
283 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
284 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
285 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
286 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
287 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
288 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
289 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
290 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
291 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
292 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
293 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
294 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
295 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
296 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
297 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
298 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
300 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
301 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
303 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
304 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
306 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
308 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
310 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
311 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
312 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
313 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
314 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
315 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
316 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
317 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
318 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
319 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
320 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
321 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
322 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
323 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
324 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
325 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
326 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
327 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
328 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
329 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
330 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
331 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
332 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
333 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
334 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
335 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
336 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
337 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
338 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
339 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
340 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
341 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.58
Metatranscriptomes 3.58
Isolates 0.84

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.48
Nodule 0.12
Rhizoplane 2.99
Rhizosphere 95.1
Stem 0
Stem Tuber 0
Unclassified 1.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1001432 3300001904 Bacteria 4372
2 JGI24741J21665_1002594 3300001915 Bacteria 4630
3 JGI24741J21665_1003527 3300001915 Bacteria 3707
4 JGI24741J21665_1005405 3300001915 Bacteria 2678
5 JGI24740J21852_10000021 3300001979 Bacteria 53145
6 JGI24740J21852_10035979 3300001979 Bacteria 1542
7 Ga0006769J43182_106839 3300002863 Bacteria 957
8 Ga0006767J43181_103125 3300002868 Bacteria 8971
9 Ga0006763J43179_104103 3300002870 Bacteria 8906
10 Ga0006762J43184_103419 3300002872 Bacteria 7285
11 Ga0006759J45824_1006649 3300003163 Bacteria 16605
12 Ga0006758J48902_1009034 3300003300 Bacteria 9061
13 Ga0006770J48903_1038246 3300003305 Bacteria 2122
14 rootH1_10188922 3300003323 Bacteria 2269
15 Ga0032354_1009872 3300003693 Bacteria 14763
16 Ga0055536_1017591 3300003781 Bacteria 2331
17 Ga0058692_1000785 3300003856 Bacteria 12735
18 Ga0058863_11635206 3300004799 Bacteria 797
19 Ga0058862_10077182 3300004803 Bacteria 1541
20 Ga0058862_12882013 3300004803 Bacteria 1687
21 Ga0070658_10030484 3300005327 Bacteria 4333
22 Ga0070658_10235420 3300005327 Bacteria 1551
23 Ga0070676_10018293 3300005328 Bacteria 3881
24 Ga0070683_100004175 3300005329 Bacteria 11835
25 Ga0070683_100171208 3300005329 Bacteria 2061
26 Ga0070683_100414698 3300005329 Bacteria 1284
27 Ga0070690_100006945 3300005330 Bacteria 6443
28 Ga0070690_100030946 3300005330 Bacteria 3331
29 Ga0070690_100147431 3300005330 Bacteria 1602
30 Ga0068869_100175044 3300005334 Bacteria 1679
31 Ga0068869_100731884 3300005334 Bacteria 846
32 Ga0070680_100038408 3300005336 Bacteria 3872
33 Ga0070680_100134858 3300005336 Bacteria 2067
34 Ga0070680_100193212 3300005336 Bacteria 1715
35 Ga0070680_100246153 3300005336 Bacteria 1511
36 Ga0070680_100361640 3300005336 Bacteria 1234
37 Ga0070682_100004587 3300005337 Bacteria 7681
38 Ga0070682_100005710 3300005337 Bacteria 6936
39 Ga0070682_100220158 3300005337 Bacteria 1350
40 Ga0070682_100458803 3300005337 Bacteria 978
41 Ga0070682_100788564 3300005337 Bacteria 771
42 Ga0068868_100141043 3300005338 Bacteria 1978
43 Ga0068868_100203129 3300005338 Bacteria 1653
44 Ga0070660_100213139 3300005339 Bacteria 1568
45 Ga0070660_100422572 3300005339 Bacteria 1104
46 Ga0070689_100061460 3300005340 Bacteria 2922
47 Ga0070689_100122321 3300005340 Bacteria 2079
48 Ga0070689_100148496 3300005340 Bacteria 1889
49 Ga0070689_100181334 3300005340 Bacteria 1710
50 Ga0070691_10035321 3300005341 Bacteria 2353
51 Ga0070691_10069454 3300005341 Bacteria 1707
52 Ga0070691_10070502 3300005341 Bacteria 1695
53 Ga0070687_100030365 3300005343 Bacteria 2641
54 Ga0070687_100102888 3300005343 Bacteria 1602
55 Ga0070687_100158248 3300005343 Bacteria 1336
56 Ga0070661_100035059 3300005344 Bacteria 3642
57 Ga0070661_100308916 3300005344 Bacteria 1232
58 Ga0070661_100383406 3300005344 Bacteria 1108
59 Ga0070692_10097842 3300005345 Bacteria 1604
60 Ga0070692_10121246 3300005345 Bacteria 1458
61 Ga0070692_10187900 3300005345 Bacteria 1201
62 Ga0070692_10266435 3300005345 Bacteria 1032
63 Ga0070668_100028739 3300005347 Bacteria 4219
64 Ga0070668_100056723 3300005347 Bacteria 3026
65 Ga0070669_100008256 3300005353 Bacteria 7434
66 Ga0070675_100049635 3300005354 Bacteria 3445
67 Ga0070675_100244545 3300005354 Bacteria 1568
68 Ga0070674_100007457 3300005356 Bacteria 6453
69 Ga0070674_100145445 3300005356 Bacteria 1784
70 Ga0070674_100483983 3300005356 Bacteria 1028
71 Ga0070673_100133910 3300005364 Bacteria 2083
72 Ga0070673_100172506 3300005364 Bacteria 1847
73 Ga0070673_100229659 3300005364 Bacteria 1609
74 Ga0070673_100238981 3300005364 Bacteria 1579
75 Ga0070673_100270803 3300005364 Bacteria 1486
76 Ga0070673_100289316 3300005364 Bacteria 1439
77 Ga0070688_100050485 3300005365 Bacteria 2591
78 Ga0070688_100055298 3300005365 Bacteria 2489
79 Ga0070688_100077192 3300005365 Bacteria 2145
80 Ga0070688_100084618 3300005365 Bacteria 2060
81 Ga0070688_100195933 3300005365 Bacteria 1410
82 Ga0070659_100010672 3300005366 Bacteria 6766
83 Ga0070659_100158561 3300005366 Bacteria 1849
84 Ga0070659_100233463 3300005366 Bacteria 1520
85 Ga0070659_100376913 3300005366 Bacteria 1194
86 Ga0070659_100656636 3300005366 Bacteria 904
87 Ga0070667_101162910 3300005367 Bacteria 722
88 Ga0070701_10351515 3300005438 Bacteria 921
89 Ga0070701_10395258 3300005438 Bacteria 875
90 Ga0070705_100046738 3300005440 Bacteria 2498
91 Ga0070700_100008581 3300005441 Bacteria 5568
92 Ga0070700_100042432 3300005441 Bacteria 2793
93 Ga0070708_100536975 3300005445 Bacteria 1103
94 Ga0070663_100054376 3300005455 Bacteria 2861
95 Ga0070678_100050282 3300005456 Bacteria 3014
96 Ga0070662_100346748 3300005457 Bacteria 1216
97 Ga0070681_10046978 3300005458 Bacteria 4316
98 Ga0070681_10133625 3300005458 Bacteria 2412
99 Ga0070681_10138345 3300005458 Bacteria 2365
100 Ga0070681_10428714 3300005458 Bacteria 1234
101 Ga0070681_10447670 3300005458 Bacteria 1203
102 Ga0068867_100016292 3300005459 Bacteria 5278
103 Ga0068867_100021915 3300005459 Bacteria 4562
104 Ga0070685_10033482 3300005466 Bacteria 2887
105 Ga0070679_100033803 3300005530 Bacteria 5063
106 Ga0070679_100046691 3300005530 Bacteria 4317
107 Ga0070679_100057568 3300005530 Bacteria 3874
108 Ga0070679_100202672 3300005530 Bacteria 1949
109 Ga0070679_100424735 3300005530 Bacteria 1274
110 Ga0070679_100448761 3300005530 Bacteria 1234
111 Ga0070679_100576876 3300005530 Bacteria 1068
112 Ga0070684_100034321 3300005535 Bacteria 4337
113 Ga0070684_100186707 3300005535 Bacteria 1885
114 Ga0070684_100246367 3300005535 Bacteria 1633
115 Ga0070684_100254645 3300005535 Bacteria 1605
116 Ga0070684_100332896 3300005535 Bacteria 1395
117 Ga0070684_100419938 3300005535 Bacteria 1234
118 Ga0070684_100556689 3300005535 Bacteria 1064
119 Ga0068853_100002850 3300005539 Bacteria 13105
120 Ga0068853_100003768 3300005539 Bacteria 11627
121 Ga0068853_100110968 3300005539 Bacteria 2436
122 Ga0068853_100267160 3300005539 Bacteria 1574
123 Ga0068853_100560009 3300005539 Bacteria 1083
124 Ga0068853_101341539 3300005539 Bacteria 691
125 Ga0070672_100064132 3300005543 Bacteria 2902
126 Ga0070672_100064690 3300005543 Bacteria 2890
127 Ga0070672_100204397 3300005543 Bacteria 1652
128 Ga0070672_100450237 3300005543 Bacteria 1109
129 Ga0070686_100006132 3300005544 Bacteria 6673
130 Ga0070686_100008053 3300005544 Bacteria 5887
131 Ga0070686_100350856 3300005544 Bacteria 1108
132 Ga0070696_100006375 3300005546 Bacteria 7892
133 Ga0070696_100050189 3300005546 Bacteria 2900
134 Ga0070696_100848669 3300005546 Bacteria 755
135 Ga0070696_101373913 3300005546 Bacteria 601
136 Ga0070693_100010949 3300005547 Bacteria 4558
137 Ga0070693_100259652 3300005547 Bacteria 1155
138 Ga0070704_100325887 3300005549 Bacteria 1288
139 Ga0068855_100004696 3300005563 Bacteria 16698
140 Ga0068855_100006029 3300005563 Bacteria 14785
141 Ga0068855_100021141 3300005563 Bacteria 7802
142 Ga0068855_100067646 3300005563 Bacteria 4160
143 Ga0068855_100223754 3300005563 Bacteria 2109
144 Ga0070664_100070218 3300005564 Bacteria 2999
145 Ga0068857_100117726 3300005577 Bacteria 2391
146 Ga0068854_100008257 3300005578 Bacteria 6684
147 Ga0068854_100047152 3300005578 Bacteria 3070
148 Ga0068854_100256109 3300005578 Bacteria 1399
149 Ga0068854_100696532 3300005578 Bacteria 876
150 Ga0068856_100078416 3300005614 Bacteria 3275
151 Ga0068856_100084913 3300005614 Bacteria 3145
152 Ga0068856_100090766 3300005614 Bacteria 3039
153 Ga0068856_100182072 3300005614 Bacteria 2114
154 Ga0068856_100238892 3300005614 Bacteria 1832
155 Ga0068856_100657568 3300005614 Bacteria 1068
156 Ga0068856_100700014 3300005614 Bacteria 1033
157 Ga0070702_100141947 3300005615 Bacteria 1531
158 Ga0068852_100020534 3300005616 Bacteria 5254
159 Ga0068852_100039943 3300005616 Bacteria 3954
160 Ga0068852_100171595 3300005616 Bacteria 2033
161 Ga0068852_100675542 3300005616 Bacteria 1042
162 Ga0068852_101538692 3300005616 Bacteria 687
163 Ga0068859_100158427 3300005617 Bacteria 2342
164 Ga0068859_100622992 3300005617 Bacteria 1172
165 Ga0068864_100528194 3300005618 Bacteria 1138
166 Ga0068864_100593828 3300005618 Bacteria 1074
167 Ga0068864_100595292 3300005618 Bacteria 1073
168 Ga0068866_10035746 3300005718 Bacteria 2429
169 Ga0068861_100088764 3300005719 Bacteria 2435
170 Ga0068851_10015238 3300005834 Bacteria 3660
171 Ga0068851_10371974 3300005834 Bacteria 835
172 Ga0068870_10292690 3300005840 Bacteria 1025
173 Ga0068860_100357814 3300005843 Bacteria 1438
174 Ga0068862_100038391 3300005844 Bacteria 4061
175 Ga0068862_100203189 3300005844 Bacteria 1787
176 Ga0068862_101006302 3300005844 Bacteria 824
177 Ga0081538_10106324 3300005981 Bacteria 1393
178 Ga0081539_10051462 3300005985 Bacteria 2320
179 Ga0097621_100001348 3300006237 Bacteria 16895
180 Ga0068871_100000763 3300006358 Bacteria 21687
181 Ga0068871_100256492 3300006358 Bacteria 1524
182 Ga0075428_100022001 3300006844 Bacteria 7058
183 Ga0075428_100249709 3300006844 Bacteria 1912
184 Ga0075428_100538806 3300006844 Bacteria 1248
185 Ga0075428_100861603 3300006844 Bacteria 962
186 Ga0075428_100903512 3300006844 Bacteria 937
187 Ga0075430_100018107 3300006846 Bacteria 5994
188 Ga0075430_100536529 3300006846 Bacteria 965
189 Ga0075431_100033449 3300006847 Bacteria 5298
190 Ga0068865_100218603 3300006881 Bacteria 1488
191 Ga0097620_100158439 3300006931 Bacteria 2342
192 Ga0097620_100623014 3300006931 Bacteria 1172
193 Ga0075435_100114268 3300007076 Bacteria 2247
194 Ga0099794_10043462 3300007265 Bacteria 2145
195 Ga0105240_10060137 3300009093 Bacteria 4737
196 Ga0105240_10212412 3300009093 Bacteria 2260
197 Ga0105240_10391090 3300009093 Bacteria 1568
198 Ga0105240_10582943 3300009093 Bacteria 1234
199 Ga0111539_10058961 3300009094 Bacteria 4554
200 Ga0111539_10214617 3300009094 Bacteria 2242
201 Ga0111539_10432969 3300009094 Bacteria 1532
202 Ga0111539_10640704 3300009094 Bacteria 1237
203 Ga0114129_10126592 3300009147 Bacteria 3512
204 Ga0114129_10144198 3300009147 Bacteria 3263
205 Ga0114129_10513346 3300009147 Bacteria 1563
206 Ga0114129_11191028 3300009147 Bacteria 949
207 Ga0114129_11259091 3300009147 Bacteria 919
208 Ga0105243_10010767 3300009148 Bacteria 6922
209 Ga0105243_10214065 3300009148 Bacteria 1698
210 Ga0105243_10917973 3300009148 Bacteria 872
211 Ga0105241_10112994 3300009174 Bacteria 2177
212 Ga0105241_10435095 3300009174 Bacteria 1157
213 Ga0105241_10448524 3300009174 Bacteria 1141
214 Ga0105242_10218702 3300009176 Bacteria 1701
215 Ga0105248_10057742 3300009177 Bacteria 4356
216 Ga0105248_10745197 3300009177 Bacteria 1105
217 Ga0105248_10746019 3300009177 Bacteria 1105
218 Ga0105237_10002220 3300009545 Bacteria 24289
219 Ga0105237_10365407 3300009545 Bacteria 1447
220 Ga0105237_10441781 3300009545 Bacteria 1307
221 Ga0105237_10885161 3300009545 Bacteria 900
222 Ga0105238_10022051 3300009551 Bacteria 6491
223 Ga0105238_10037314 3300009551 Bacteria 4940
224 Ga0105238_10042550 3300009551 Bacteria 4599
225 Ga0105249_10010299 3300009553 Bacteria 8213
226 Ga0105249_10246729 3300009553 Bacteria 1768
227 Ga0105239_10413902 3300010375 Bacteria 1526
228 Ga0105239_11217999 3300010375 Bacteria 868
229 Ga0105239_11300654 3300010375 Bacteria 839
230 Ga0105246_11242083 3300011119 Bacteria 688
231 Ga0157373_10025259 3300013100 Bacteria 4299
232 Ga0157373_10104415 3300013100 Bacteria 1993
233 Ga0157373_10124104 3300013100 Bacteria 1816
234 Ga0157371_10011870 3300013102 Bacteria 6686
235 Ga0157371_10122492 3300013102 Bacteria 1849
236 Ga0157371_10249901 3300013102 Bacteria 1277
237 Ga0157371_10393985 3300013102 Bacteria 1013
238 Ga0157371_10525154 3300013102 Bacteria 876
239 Ga0157371_10620889 3300013102 Bacteria 805
240 Ga0157370_10060742 3300013104 Bacteria 3587
241 Ga0157370_10125442 3300013104 Bacteria 2396
242 Ga0157370_10233935 3300013104 Bacteria 1700
243 Ga0157370_10299241 3300013104 Bacteria 1485
244 Ga0157370_10431838 3300013104 Bacteria 1211
245 Ga0157369_10025057 3300013105 Bacteria 6626
246 Ga0157369_10163977 3300013105 Bacteria 2344
247 Ga0157369_10245732 3300013105 Bacteria 1868
248 Ga0157369_10719878 3300013105 Bacteria 1027
249 Ga0157369_11711022 3300013105 Bacteria 639
250 Ga0157374_10039567 3300013296 Bacteria 4339
251 Ga0157374_10079651 3300013296 Bacteria 3105
252 Ga0157378_10352400 3300013297 Bacteria 1438
253 Ga0157378_11670393 3300013297 Bacteria 683
254 Ga0163162_10118214 3300013306 Bacteria 2752
255 Ga0163162_10566535 3300013306 Bacteria 1263
256 Ga0157372_10022741 3300013307 Bacteria 6786
257 Ga0157372_10073028 3300013307 Bacteria 3866
258 Ga0157372_10121630 3300013307 Bacteria 2999
259 Ga0157372_10144665 3300013307 Bacteria 2741
260 Ga0157372_10434420 3300013307 Bacteria 1530
261 Ga0157372_10748996 3300013307 Bacteria 1136
262 Ga0157375_10202649 3300013308 Bacteria 2140
263 Ga0157375_10272772 3300013308 Bacteria 1854
264 Ga0157375_10472260 3300013308 Bacteria 1419
265 Ga0157380_10033551 3300014326 Bacteria 3953
266 Ga0157377_10015531 3300014745 Bacteria 3898
267 Ga0157377_10576000 3300014745 Bacteria 799
268 Ga0157379_10049835 3300014968 Bacteria 3739
269 Ga0157376_10130727 3300014969 Bacteria 2240
270 Ga0197907_10443089 3300020069 Bacteria 4382
271 Ga0206356_10188034 3300020070 Bacteria 1048
272 Ga0206356_10645239 3300020070 Bacteria 1262
273 Ga0206356_11464639 3300020070 Bacteria 1101
274 Ga0206356_11779262 3300020070 Bacteria 5478
275 Ga0206351_10126906 3300020077 Bacteria 1547
276 Ga0206352_11092907 3300020078 Bacteria 7966
277 Ga0206352_11285822 3300020078 Bacteria 3267
278 Ga0206350_10904125 3300020080 Bacteria 1603
279 Ga0206354_10159778 3300020081 Bacteria 7584
280 Ga0206354_10693867 3300020081 Bacteria 1011
281 Ga0206354_10843824 3300020081 Bacteria 4618
282 Ga0206353_10129542 3300020082 Bacteria 10452
283 Ga0206353_10595977 3300020082 Bacteria 1433
284 Ga0206353_10961318 3300020082 Bacteria 1235
285 Ga0154015_1153700 3300020610 Bacteria 2305
286 Ga0154015_1332456 3300020610 Bacteria 2064
287 Ga0213876_10165535 3300021384 Bacteria 1176
288 Ga0224712_10053363 3300022467 Bacteria 1582
289 Ga0224712_10525145 3300022467 Bacteria 574
290 Ga0209676_1004379 3300025292 Bacteria 7893
291 Ga0209050_1017914 3300025298 Bacteria 2789
292 Ga0209257_1024354 3300025304 Bacteria 2098
293 Ga0207697_10069394 3300025315 Bacteria 1475
294 Ga0207656_10009267 3300025321 Bacteria 3652
295 Ga0207656_10388191 3300025321 Bacteria 701
296 Ga0207653_10038952 3300025885 Bacteria 1554
297 Ga0207692_10032528 3300025898 Bacteria 2508
298 Ga0207642_10023568 3300025899 Bacteria 2461
299 Ga0207680_10145936 3300025903 Bacteria 1573
300 Ga0207647_10036662 3300025904 Bacteria 3114
301 Ga0207647_10266696 3300025904 Bacteria 979
302 Ga0207647_10266916 3300025904 Bacteria 979
303 Ga0207647_10379288 3300025904 Bacteria 798
304 Ga0207645_10021058 3300025907 Bacteria 4257
305 Ga0207645_10082768 3300025907 Bacteria 2057
306 Ga0207643_10011769 3300025908 Bacteria 4722
307 Ga0207705_10004273 3300025909 Bacteria 10819
308 Ga0207705_10006472 3300025909 Bacteria 8676
309 Ga0207705_10011179 3300025909 Bacteria 6507
310 Ga0207705_10013911 3300025909 Bacteria 5802
311 Ga0207654_10149686 3300025911 Bacteria 1497
312 Ga0207654_10910828 3300025911 Bacteria 638
313 Ga0207707_10000201 3300025912 Bacteria 63617
314 Ga0207707_10000210 3300025912 Bacteria 62292
315 Ga0207707_10001339 3300025912 Bacteria 22957
316 Ga0207707_10006555 3300025912 Bacteria 10160
317 Ga0207707_10010320 3300025912 Bacteria 8104
318 Ga0207707_10366855 3300025912 Bacteria 1239
319 Ga0207695_10006299 3300025913 Bacteria 15447
320 Ga0207695_10022941 3300025913 Bacteria 7069
321 Ga0207695_10044284 3300025913 Bacteria 4735
322 Ga0207695_10044738 3300025913 Bacteria 4707
323 Ga0207695_10109993 3300025913 Bacteria 2736
324 Ga0207671_10000510 3300025914 Bacteria 52543
325 Ga0207671_10006782 3300025914 Bacteria 10121
326 Ga0207663_10110382 3300025916 Bacteria 1865
327 Ga0207663_10916137 3300025916 Bacteria 701
328 Ga0207660_10000360 3300025917 Bacteria 29709
329 Ga0207660_10005835 3300025917 Bacteria 7991
330 Ga0207660_10009553 3300025917 Bacteria 6278
331 Ga0207660_10041771 3300025917 Bacteria 3215
332 Ga0207660_10093040 3300025917 Bacteria 2239
333 Ga0207660_10215847 3300025917 Bacteria 1504
334 Ga0207660_10281695 3300025917 Bacteria 1319
335 Ga0207660_10717801 3300025917 Bacteria 815
336 Ga0207662_10009139 3300025918 Bacteria 5448
337 Ga0207662_10036126 3300025918 Bacteria 2887
338 Ga0207662_10055422 3300025918 Bacteria 2366
339 Ga0207662_10119311 3300025918 Bacteria 1653
340 Ga0207662_10617621 3300025918 Bacteria 755
341 Ga0207657_10057043 3300025919 Bacteria 3368
342 Ga0207657_10108254 3300025919 Bacteria 2298
343 Ga0207657_10226429 3300025919 Bacteria 1496
344 Ga0207657_10475918 3300025919 Bacteria 979
345 Ga0207657_10533527 3300025919 Bacteria 918
346 Ga0207657_11036117 3300025919 Bacteria 629
347 Ga0207649_10002213 3300025920 Bacteria 10987
348 Ga0207649_10030130 3300025920 Bacteria 3210
349 Ga0207649_10155028 3300025920 Bacteria 1581
350 Ga0207649_10291796 3300025920 Bacteria 1189
351 Ga0207652_10002222 3300025921 Bacteria 16561
352 Ga0207652_10004193 3300025921 Bacteria 11761
353 Ga0207652_10005745 3300025921 Bacteria 10069
354 Ga0207652_10011010 3300025921 Bacteria 7292
355 Ga0207652_10013571 3300025921 Bacteria 6590
356 Ga0207652_10073451 3300025921 Bacteria 2976
357 Ga0207652_10149440 3300025921 Bacteria 2091
358 Ga0207652_10585895 3300025921 Bacteria 1001
359 Ga0207681_10002742 3300025923 Bacteria 11146
360 Ga0207681_10003287 3300025923 Bacteria 10121
361 Ga0207694_10025532 3300025924 Bacteria 4490
362 Ga0207694_10069504 3300025924 Bacteria 2751
363 Ga0207694_10069793 3300025924 Bacteria 2745
364 Ga0207650_10016378 3300025925 Bacteria 5182
365 Ga0207659_10199373 3300025926 Bacteria 1597
366 Ga0207659_10281980 3300025926 Bacteria 1358
367 Ga0207700_10155768 3300025928 Bacteria 1893
368 Ga0207690_10003289 3300025932 Bacteria 9676
369 Ga0207690_10005316 3300025932 Bacteria 7589
370 Ga0207690_10078622 3300025932 Bacteria 2296
371 Ga0207706_10019518 3300025933 Bacteria 6098
372 Ga0207709_10007251 3300025935 Bacteria 6185
373 Ga0207670_10017436 3300025936 Bacteria 4341
374 Ga0207670_10156028 3300025936 Bacteria 1699
375 Ga0207670_10398206 3300025936 Bacteria 1100
376 Ga0207670_10509207 3300025936 Bacteria 978
377 Ga0207669_10266219 3300025937 Bacteria 1285
378 Ga0207704_10003227 3300025938 Bacteria 7388
379 Ga0207704_10003857 3300025938 Bacteria 6810
380 Ga0207691_10028424 3300025940 Bacteria 5236
381 Ga0207691_10230106 3300025940 Bacteria 1605
382 Ga0207691_10351045 3300025940 Bacteria 1262
383 Ga0207711_10129621 3300025941 Bacteria 2260
384 Ga0207689_10375899 3300025942 Bacteria 1183
385 Ga0207689_10449004 3300025942 Bacteria 1077
386 Ga0207661_10004252 3300025944 Bacteria 10024
387 Ga0207661_10007008 3300025944 Bacteria 7997
388 Ga0207661_10015870 3300025944 Bacteria 5548
389 Ga0207661_10057404 3300025944 Bacteria 3130
390 Ga0207661_10058289 3300025944 Bacteria 3107
391 Ga0207661_10070548 3300025944 Bacteria 2853
392 Ga0207661_10139755 3300025944 Bacteria 2083
393 Ga0207661_10151347 3300025944 Bacteria 2006
394 Ga0207661_10779862 3300025944 Bacteria 880
395 Ga0207679_10007471 3300025945 Bacteria 6936
396 Ga0207679_10027652 3300025945 Bacteria 3925
397 Ga0207667_10000358 3300025949 Bacteria 61982
398 Ga0207667_10008758 3300025949 Bacteria 11990
399 Ga0207667_10009904 3300025949 Bacteria 11181
400 Ga0207667_10010803 3300025949 Bacteria 10649
401 Ga0207667_10012000 3300025949 Bacteria 10029
402 Ga0207667_10087997 3300025949 Bacteria 3212
403 Ga0207667_10135136 3300025949 Bacteria 2539
404 Ga0207667_10136064 3300025949 Bacteria 2530
405 Ga0207651_10021221 3300025960 Bacteria 3941
406 Ga0207651_10045826 3300025960 Bacteria 2935
407 Ga0207651_10141959 3300025960 Bacteria 1856
408 Ga0207651_10228346 3300025960 Bacteria 1509
409 Ga0207651_10274524 3300025960 Bacteria 1390
410 Ga0207651_10307280 3300025960 Bacteria 1321
411 Ga0207712_10007287 3300025961 Bacteria 6976
412 Ga0207668_10028961 3300025972 Bacteria 3626
413 Ga0207640_10002025 3300025981 Bacteria 10946
414 Ga0207640_10003985 3300025981 Bacteria 7977
415 Ga0207640_10004259 3300025981 Bacteria 7741
416 Ga0207640_10038078 3300025981 Bacteria 3032
417 Ga0207640_10103079 3300025981 Bacteria 2005
418 Ga0207640_10811543 3300025981 Bacteria 811
419 Ga0207640_10911377 3300025981 Bacteria 768
420 Ga0207658_10219118 3300025986 Bacteria 1600
421 Ga0207658_10895431 3300025986 Bacteria 808
422 Ga0207658_10938842 3300025986 Bacteria 788
423 Ga0207677_10174178 3300026023 Bacteria 1686
424 Ga0207677_10391051 3300026023 Bacteria 1176
425 Ga0207703_10263798 3300026035 Bacteria 1558
426 Ga0207703_10960747 3300026035 Bacteria 819
427 Ga0207639_10000231 3300026041 Bacteria 41634
428 Ga0207639_10005667 3300026041 Bacteria 8449
429 Ga0207639_10008268 3300026041 Bacteria 7129
430 Ga0207639_10018424 3300026041 Bacteria 4960
431 Ga0207639_10064484 3300026041 Bacteria 2840
432 Ga0207639_10595924 3300026041 Bacteria 1019
433 Ga0207678_10018442 3300026067 Bacteria 6128
434 Ga0207678_10033539 3300026067 Bacteria 4472
435 Ga0207678_10056807 3300026067 Bacteria 3368
436 Ga0207678_10584235 3300026067 Bacteria 979
437 Ga0207678_11355407 3300026067 Bacteria 629
438 Ga0207678_11423702 3300026067 Bacteria 613
439 Ga0207708_10057714 3300026075 Bacteria 2962
440 Ga0207702_10006690 3300026078 Bacteria 9905
441 Ga0207702_10078446 3300026078 Bacteria 2859
442 Ga0207702_10100543 3300026078 Bacteria 2551
443 Ga0207702_10106909 3300026078 Bacteria 2480
444 Ga0207702_11198523 3300026078 Bacteria 753
445 Ga0207648_10008885 3300026089 Bacteria 9673
446 Ga0207648_10011154 3300026089 Bacteria 8479
447 Ga0207648_10390627 3300026089 Bacteria 1259
448 Ga0207648_11182781 3300026089 Bacteria 718
449 Ga0207676_10460360 3300026095 Bacteria 1201
450 Ga0207676_10716842 3300026095 Bacteria 970
451 Ga0207676_11361061 3300026095 Bacteria 705
452 Ga0207674_10057822 3300026116 Bacteria 3931
453 Ga0207674_10301678 3300026116 Bacteria 1551
454 Ga0207674_10358305 3300026116 Bacteria 1410
455 Ga0207675_100004342 3300026118 Bacteria 13698
456 Ga0207675_100013850 3300026118 Bacteria 7520
457 Ga0207675_100560357 3300026118 Bacteria 1143
458 Ga0207675_100995031 3300026118 Bacteria 857
459 Ga0207683_10094403 3300026121 Bacteria 2666
460 Ga0207683_10277095 3300026121 Bacteria 1533
461 Ga0207698_10003169 3300026142 Bacteria 9865
462 Ga0207698_10053564 3300026142 Bacteria 3098
463 Ga0207698_10158112 3300026142 Bacteria 1978
464 Ga0207698_10179531 3300026142 Bacteria 1874
465 Ga0207698_10300931 3300026142 Bacteria 1493
466 Ga0209967_1000358 3300027364 Bacteria 6044
467 Ga0209981_1039323 3300027378 Bacteria 705
468 Ga0209996_1014019 3300027395 Bacteria 1088
469 Ga0210000_1012354 3300027462 Bacteria 1269
470 Ga0209995_1001135 3300027471 Bacteria 4092
471 Ga0209968_1001973 3300027526 Bacteria 3121
472 Ga0209999_1008412 3300027543 Bacteria 1859
473 Ga0209998_10037285 3300027717 Bacteria 1094
474 Ga0207428_10017611 3300027907 Bacteria 6126
475 Ga0207428_10061701 3300027907 Bacteria 2967
476 Ga0268265_10000858 3300028380 Bacteria 28507
477 Ga0268265_10034866 3300028380 Bacteria 3671
478 Ga0268265_10215412 3300028380 Bacteria 1676
479 Ga0268264_10581208 3300028381 Bacteria 1102
480 Ga0265337_1006282 3300028556 Bacteria 4606
481 Ga0265326_10006368 3300028558 Bacteria 3677
482 Ga0265319_1000335 3300028563 Bacteria 34634
483 Ga0265319_1139301 3300028563 Bacteria 753
484 Ga0265318_10000169 3300028577 Bacteria 57590
485 Ga0265318_10001647 3300028577 Bacteria 12876
486 Ga0265323_10065335 3300028653 Bacteria 1255
487 Ga0265336_10002452 3300028666 Bacteria 7638
488 Ga0265336_10031393 3300028666 Bacteria 1650
489 Ga0265336_10069504 3300028666 Bacteria 1053
490 Ga0265336_10087446 3300028666 Bacteria 929
491 Ga0307515_10600584 3300028794 Bacteria 711
492 Ga0265338_10001810 3300028800 Bacteria 33582
493 Ga0265338_10013017 3300028800 Bacteria 9435
494 Ga0265338_10191950 3300028800 Bacteria 1547
495 Ga0265338_10554871 3300028800 Bacteria 804
496 Ga0265338_10681489 3300028800 Bacteria 711
497 Ga0265330_10000068 3300031235 Bacteria 90225
498 Ga0265330_10001241 3300031235 Bacteria 14953
499 Ga0265332_10001607 3300031238 Bacteria 12385
500 Ga0265332_10040797 3300031238 Bacteria 2009
501 Ga0265332_10047768 3300031238 Bacteria 1842
502 Ga0265328_10000172 3300031239 Bacteria 29964
503 Ga0265328_10000528 3300031239 Bacteria 17832
504 Ga0265320_10000069 3300031240 Bacteria 90253
505 Ga0265320_10010819 3300031240 Bacteria 5405
506 Ga0265320_10213635 3300031240 Bacteria 860
507 Ga0265325_10079690 3300031241 Bacteria 1630
508 Ga0265329_10045049 3300031242 Bacteria 1410
509 Ga0265329_10066059 3300031242 Bacteria 1144
510 Ga0265340_10010589 3300031247 Bacteria 4930
511 Ga0265340_10067657 3300031247 Bacteria 1697
512 Ga0265339_10002072 3300031249 Bacteria 14690
513 Ga0265339_10006807 3300031249 Bacteria 7455
514 Ga0265339_10242013 3300031249 Bacteria 876
515 Ga0265339_10322278 3300031249 Bacteria 733
516 Ga0265331_10000149 3300031250 Bacteria 90395
517 Ga0265331_10026117 3300031250 Bacteria 2941
518 Ga0265316_10004187 3300031344 Bacteria 14418
519 Ga0265316_10007181 3300031344 Bacteria 10525
520 Ga0265316_10017518 3300031344 Bacteria 6186
521 Ga0265316_10029372 3300031344 Bacteria 4523
522 Ga0307509_10246925 3300031507 Bacteria 1572
523 Ga0307408_100171421 3300031548 Bacteria 1733
524 Ga0265313_10000812 3300031595 Bacteria 31563
525 Ga0265313_10015631 3300031595 Bacteria 4407
526 Ga0265313_10036999 3300031595 Bacteria 2446
527 Ga0265313_10057584 3300031595 Bacteria 1834
528 Ga0265314_10000191 3300031711 Bacteria 91214
529 Ga0265314_10001397 3300031711 Bacteria 27067
530 Ga0265314_10004534 3300031711 Bacteria 12837
531 Ga0265314_10086729 3300031711 Bacteria 2048
532 Ga0265314_10137646 3300031711 Bacteria 1514
533 Ga0265342_10001254 3300031712 Bacteria 23972
534 Ga0265342_10001889 3300031712 Bacteria 18879
535 Ga0265342_10006711 3300031712 Bacteria 8527
536 Ga0265342_10013077 3300031712 Bacteria 5587
537 Ga0316578_10315561 3300031728 Bacteria 934
538 Ga0307405_10084665 3300031731 Bacteria 2082
539 Ga0307405_10560462 3300031731 Bacteria 926
540 Ga0307410_10069857 3300031852 Bacteria 2431
541 Ga0307407_10287024 3300031903 Bacteria 1142
542 Ga0307416_100408942 3300032002 Bacteria 1397
543 Ga0307416_100509346 3300032002 Bacteria 1269
544 Ga0307416_100751083 3300032002 Bacteria 1068
545 Ga0307411_10035780 3300032005 Bacteria 3105
546 Ga0307411_10116566 3300032005 Bacteria 1923
547 Ga0373950_0000002 3300034818 Bacteria 933559
548 Ga0373950_0000057 3300034818 Bacteria 72831
549 Ga0373958_0006655 3300034819 Bacteria 1810
550 Ga0373926_0265212 3300035083 Bacteria 667
551 Ga0373952_0025211 3300035092 Bacteria 1283
552 Ga0373952_0143843 3300035092 Bacteria 664
553 Ga0373923_0037762 3300035111 Bacteria 1977
554 Ga0373923_0223919 3300035111 Bacteria 875
555 Ga0373932_0122931 3300035112 Bacteria 867
556 Ga0373932_0305649 3300035112 Bacteria 595
557 Ga0373936_0091362 3300035113 Bacteria 1277
558 Ga0373936_0267227 3300035113 Bacteria 767
559 Ga0373953_0319184 3300035117 Bacteria 679
560 Ga0373954_0014604 3300035118 Bacteria 3502
561 Ga0373954_0028117 3300035118 Bacteria 2583
562 Ga0373954_0048783 3300035118 Bacteria 1984
563 Ga0373954_0061842 3300035118 Bacteria 1768
564 Ga0373954_0073523 3300035118 Bacteria 1627
565 Ga0373956_0004261 3300035119 Bacteria 5747
566 Ga0373956_0023587 3300035119 Bacteria 2642
567 Ga0373956_0112149 3300035119 Bacteria 1270
568 Ga0373957_0045467 3300035120 Bacteria 1664
569 Ga0373946_0032634 3300035171 Bacteria 2092
570 Ga0373955_0002904 3300035172 Bacteria 7521
571 Ga0373955_0206647 3300035172 Bacteria 1170
572 Ga0373955_0417050 3300035172 Bacteria 816
573 Ga0373961_0100306 3300035241 Bacteria 937
574 Ga0373924_0028722 3300035410 Bacteria 2218
575 Ga0373931_0041283 3300035691 Bacteria 2423
576 Ga0373931_0127927 3300035691 Bacteria 1459
577 Ga0373935_0199170 3300035692 Bacteria 1383
578 Ga0373933_0029527 3300035724 Bacteria 3171
579 Ga0373933_0063865 3300035724 Bacteria 2226
580 Ga0373933_0069385 3300035724 Bacteria 2142
581 Ga0373933_0125719 3300035724 Bacteria 1608
582 Ga0373933_0206114 3300035724 Bacteria 1259
583 Ga0373933_0675627 3300035724 Unclassified 679
584 Ga0373937_0002498 3300036401 Bacteria 15273
585 Ga0373937_0025601 3300036401 Bacteria 5328
586 Ga0373937_0183070 3300036401 Bacteria 1967
587 Ga0316582_0075143 3300036647 Bacteria 2195
588 Ga0373925_0587993 3300037068 Bacteria 916
589 Ga0395899_0182864 3300037312 Bacteria 1470
590 Ga0395900_0015556 3300037418 Bacteria 7754
591 Ga0395900_0153997 3300037418 Bacteria 2348
592 Ga0395898_0034826 3300037466 Bacteria 5012
593 Ga0395898_0118682 3300037466 Bacteria 2534
594 Ga0395901_0020479 3300038443 Bacteria 6769
595 Ga0395901_0966513 3300038443 Bacteria 829
596 Ga0436365_0027917 3300039437 Bacteria 1050
597 Ga0436365_1643703 3300039437 Bacteria 2607
598 Ga0451787_677116 3300041441 Bacteria 714
599 Ga0451802_1249106 3300041460 Bacteria 1612
600 Ga0439446_0005512 3300042156 Bacteria 3257
601 Ga0439434_0125201 3300042435 Bacteria 840
602 Ga0439435_0000723 3300042436 Bacteria 5528
603 Ga0451577_0001597 3300042876 Bacteria 29525
604 Ga0451577_0045788 3300042876 Bacteria 3915
605 Ga0451577_0242446 3300042876 Bacteria 1631
606 Ga0453684_0000116 3300044712 Bacteria 352304
607 Ga0453684_0000194 3300044712 Bacteria 265783
608 Ga0453684_0019106 3300044712 Bacteria 10459
609 Ga0453684_0034156 3300044712 Bacteria 7068
610 Ga0453684_0236326 3300044712 Bacteria 2106
611 Ga0453684_0550428 3300044712 Bacteria 1271
612 Ga0453684_0576757 3300044712 Bacteria 1236
613 Ga0453684_0589304 3300044712 Unclassified 1220
614 Ga0453684_1143788 3300044712 Bacteria 820
615 Ga0466967_0699277 3300045976 Bacteria 1004
616 Ga0495629_0291700 3300046459 Bacteria 1118
617 Ga0495641_0078650 3300046461 Bacteria 1478
618 Ga0495582_0087478 3300046473 Bacteria 1735
619 Ga0495662_0097335 3300046476 Bacteria 1438
620 Ga0495664_0005945 3300046477 Bacteria 6720
621 Ga0495584_0281352 3300046491 Bacteria 845
622 Ga0495630_0165382 3300046517 Bacteria 1684
623 Ga0495642_0040298 3300046528 Bacteria 1897
624 Ga0495586_0043692 3300046535 Bacteria 2413
625 Ga0495587_0249500 3300046536 Bacteria 998
626 Ga0495621_0019581 3300046539 Bacteria 2212
627 Ga0495667_0007843 3300046559 Bacteria 7235
628 Ga0495656_0335825 3300046615 Bacteria 781
629 Ga0495668_0318683 3300046616 Bacteria 853
630 Ga0495634_0000649 3300046642 Bacteria 33746
631 Ga0495659_0042767 3300046664 Bacteria 1623
632 Ga0495657_0102867 3300046675 Bacteria 1818
633 Ga0495647_0023213 3300046681 Bacteria 2248
634 Ga0495658_0246579 3300046683 Bacteria 1123
635 Ga0495669_0106277 3300046684 Bacteria 1307
636 Ga0495613_0706878 3300046689 Bacteria 663
637 Ga0495624_0077788 3300046690 Bacteria 2058
638 Ga0495674_0001336 3300047319 Bacteria 24042
639 Ga0495674_0305483 3300047319 Bacteria 1299
640 Ga0495676_0133580 3300047321 Bacteria 1788
641 Ga0495680_0717460 3300047322 Bacteria 659
642 Ga0495684_0175430 3300047471 Bacteria 1591
643 Ga0495684_0605913 3300047471 Bacteria 738
644 Ga0495615_0036745 3300048090 Bacteria 1203
645 Ga0496100_0003660 3300048903 Bacteria 8042
646 Ga0496100_0801097 3300048903 Bacteria 738
647 Ga0496101_0046745 3300048904 Bacteria 3105
648 Ga0496104_0091762 3300048907 Bacteria 2904
649 Ga0496104_0626947 3300048907 Bacteria 985
650 Ga0496104_0863714 3300048907 Bacteria 810
651 Ga0496106_0035630 3300048909 Bacteria 3721
652 Ga0496108_0011674 3300048911 Bacteria 7148
653 Ga0496109_0099816 3300048912 Bacteria 2693
654 Ga0496109_0935874 3300048912 Bacteria 804
655 Ga0496110_0328255 3300048913 Bacteria 1394
656 Ga0496112_0030222 3300048915 Bacteria 5242
657 Ga0496114_0000386 3300048917 Bacteria 32590
658 Ga0496114_0006073 3300048917 Bacteria 9506
659 Ga0496114_0068408 3300048917 Bacteria 2981
660 Ga0496114_0234351 3300048917 Bacteria 1613
661 Ga0496114_0265781 3300048917 Bacteria 1511
662 Ga0496114_0417919 3300048917 Bacteria 1188
663 Ga0496115_0030301 3300048918 Bacteria 4255
664 Ga0496115_0059367 3300048918 Bacteria 3080
665 Ga0496115_0239629 3300048918 Bacteria 1495
666 Ga0496115_0302381 3300048918 Bacteria 1311
667 Ga0496115_0882893 3300048918 Bacteria 690
668 Ga0501291_007417 3300049514 Bacteria 1485
669 Ga0501291_017783 3300049514 Bacteria 1099
670 Ga0501299_100846 3300049522 Bacteria 670
671 Ga0501031_0085694 3300049568 Bacteria 2054
672 Ga0501032_0081732 3300049569 Bacteria 2150
673 Ga0501032_0250066 3300049569 Bacteria 1151
674 Ga0501033_0112132 3300049570 Bacteria 1984
675 Ga0501033_0126838 3300049570 Bacteria 1850
676 Ga0501033_0203952 3300049570 Bacteria 1412
677 Ga0501033_0669759 3300049570 Bacteria 708
678 Ga0501034_0000037 3300049571 Bacteria 239254
679 Ga0501034_0008263 3300049571 Bacteria 11016
680 Ga0501034_0347244 3300049571 Bacteria 1413
681 Ga0501034_0368469 3300049571 Bacteria 1363
682 Ga0501036_0101300 3300049572 Bacteria 2436
683 Ga0501036_0244241 3300049572 Bacteria 1505
684 Ga0501036_0333348 3300049572 Bacteria 1267
685 Ga0501037_0003640 3300049573 Bacteria 11182
686 Ga0501037_0009833 3300049573 Bacteria 7020
687 Ga0501037_0179035 3300049573 Bacteria 1505
688 Ga0501037_0255880 3300049573 Bacteria 1224
689 Ga0501038_0416404 3300049574 Bacteria 1037
690 Ga0501039_0074777 3300049575 Bacteria 2633
691 Ga0501039_0178645 3300049575 Bacteria 1669
692 Ga0501039_0577354 3300049575 Bacteria 882
693 Ga0501040_0175961 3300049576 Bacteria 1516
694 Ga0501041_0100601 3300049577 Bacteria 1789
695 Ga0501041_0478164 3300049577 Bacteria 792
696 Ga0501042_0161937 3300049578 Bacteria 1614
697 Ga0501043_0002483 3300049579 Bacteria 15600
698 Ga0501043_0024041 3300049579 Bacteria 4781
699 Ga0501043_0126658 3300049579 Bacteria 2003
700 Ga0501043_0201720 3300049579 Bacteria 1544
701 Ga0501046_0000751 3300049580 Bacteria 31319
702 Ga0501046_0400806 3300049580 Bacteria 991
703 Ga0501047_0000053 3300049581 Bacteria 150440
704 Ga0501047_0013042 3300049581 Bacteria 7872
705 Ga0501047_0225379 3300049581 Bacteria 1729
706 Ga0501048_0001235 3300049582 Bacteria 19382
707 Ga0501048_0112107 3300049582 Bacteria 1926
708 Ga0501048_0129189 3300049582 Bacteria 1787
709 Ga0501067_0000339 3300049583 Bacteria 25485
710 Ga0501067_0003773 3300049583 Bacteria 8357
711 Ga0501067_0160812 3300049583 Bacteria 1251
712 Ga0501067_0165225 3300049583 Bacteria 1232
713 Ga0501067_0197172 3300049583 Bacteria 1121
714 Ga0501068_0001718 3300049584 Bacteria 11652
715 Ga0501068_0031405 3300049584 Bacteria 3154
716 Ga0501068_0033481 3300049584 Bacteria 3060
717 Ga0501069_0009337 3300049585 Bacteria 5178
718 Ga0501069_0015342 3300049585 Bacteria 4105
719 Ga0501069_0185040 3300049585 Bacteria 1204
720 Ga0501070_0005205 3300049586 Bacteria 11084
721 Ga0501070_0006574 3300049586 Bacteria 9894
722 Ga0501070_0007053 3300049586 Bacteria 9559
723 Ga0501070_0008005 3300049586 Bacteria 8949
724 Ga0501070_0011369 3300049586 Bacteria 7523
725 Ga0501070_0053065 3300049586 Bacteria 3364
726 Ga0501070_0059869 3300049586 Bacteria 3157
727 Ga0501070_0085817 3300049586 Bacteria 2606
728 Ga0501070_0173000 3300049586 Bacteria 1778
729 Ga0501070_0753105 3300049586 Bacteria 767
730 Ga0501070_1098754 3300049586 Bacteria 613
731 Ga0501071_0004109 3300049587 Bacteria 9201
732 Ga0501071_0125408 3300049587 Bacteria 1905
733 Ga0501071_0263177 3300049587 Bacteria 1303
734 Ga0501072_0002806 3300049588 Bacteria 13074
735 Ga0501072_0030599 3300049588 Bacteria 4211
736 Ga0501072_0051854 3300049588 Bacteria 3230
737 Ga0501072_0574872 3300049588 Bacteria 889
738 Ga0501073_0001831 3300049589 Bacteria 15830
739 Ga0501073_0003382 3300049589 Bacteria 11991
740 Ga0501073_0005323 3300049589 Bacteria 9649
741 Ga0501073_0005367 3300049589 Bacteria 9602
742 Ga0501073_0008056 3300049589 Bacteria 7819
743 Ga0501073_0101363 3300049589 Bacteria 1999
744 Ga0501073_0147856 3300049589 Bacteria 1628
745 Ga0501073_0185329 3300049589 Bacteria 1440
746 Ga0501073_0331562 3300049589 Bacteria 1050
747 Ga0501073_0576657 3300049589 Bacteria 777
748 Ga0501074_0000980 3300049590 Bacteria 18498
749 Ga0501074_0026506 3300049590 Bacteria 4202
750 Ga0501074_0029541 3300049590 Bacteria 3970
751 Ga0501074_0051564 3300049590 Bacteria 2969
752 Ga0501074_0189502 3300049590 Bacteria 1467
753 Ga0501074_0933708 3300049590 Bacteria 610
754 Ga0501075_0024398 3300049591 Bacteria 4434
755 Ga0501075_0207545 3300049591 Bacteria 1494
756 Ga0501075_0216701 3300049591 Bacteria 1460
757 Ga0501075_0521002 3300049591 Bacteria 907
758 Ga0501076_0047645 3300049592 Bacteria 3389
759 Ga0501076_0254546 3300049592 Bacteria 1437
760 Ga0501076_0329518 3300049592 Bacteria 1252
761 Ga0501076_0454623 3300049592 Bacteria 1054
762 Ga0501076_1471983 3300049592 Bacteria 559
763 Ga0501077_0037441 3300049593 Bacteria 3089
764 Ga0501077_0129475 3300049593 Bacteria 1600
765 Ga0501077_0156314 3300049593 Bacteria 1447
766 Ga0501077_0282312 3300049593 Bacteria 1057
767 Ga0501217_008735 3300049661 Bacteria 2195
768 Ga0501079_0000174 3300049741 Bacteria 36202
769 Ga0501079_0039556 3300049741 Bacteria 3637
770 Ga0501079_0092127 3300049741 Bacteria 2348
771 Ga0501079_0223511 3300049741 Bacteria 1471
772 Ga0501079_0279849 3300049741 Bacteria 1305
773 Ga0501079_0370757 3300049741 Bacteria 1122
774 Ga0501080_0001428 3300049742 Bacteria 20060
775 Ga0501080_0002282 3300049742 Bacteria 16696
776 Ga0501080_0007066 3300049742 Bacteria 10138
777 Ga0501080_0046155 3300049742 Bacteria 4058
778 Ga0501080_0062816 3300049742 Bacteria 3456
779 Ga0501080_0077933 3300049742 Bacteria 3082
780 Ga0501080_0348082 3300049742 Bacteria 1338
781 Ga0501080_0365193 3300049742 Bacteria 1302
782 Ga0501080_0730968 3300049742 Bacteria 872
783 Ga0501081_0014431 3300049743 Bacteria 5211
784 Ga0501081_0031168 3300049743 Bacteria 3613
785 Ga0501081_0153632 3300049743 Bacteria 1655
786 Ga0501081_0256912 3300049743 Bacteria 1276
787 Ga0501083_0006838 3300049744 Bacteria 8096
788 Ga0501083_0020228 3300049744 Bacteria 4631
789 Ga0501083_0073859 3300049744 Bacteria 2267
790 Ga0501083_0169543 3300049744 Bacteria 1427
791 Ga0501083_0261830 3300049744 Bacteria 1125
792 Ga0501273_019264 3300049770 Bacteria 914
793 Ga0501283_018878 3300049779 Bacteria 1088
794 Ga0501035_0009970 3300049822 Bacteria 8817
795 Ga0501035_0074733 3300049822 Bacteria 2997
796 Ga0501035_0189691 3300049822 Bacteria 1767
797 Ga0501035_0243400 3300049822 Bacteria 1529
798 Ga0501035_0287348 3300049822 Unclassified 1388
799 Ga0501044_0006317 3300049823 Bacteria 13104
800 Ga0501044_0121516 3300049823 Bacteria 2612
801 Ga0501044_0145476 3300049823 Bacteria 2356
802 Ga0501044_0215426 3300049823 Bacteria 1873
803 Ga0501044_1365185 3300049823 Bacteria 574
804 Ga0501044_1484791 3300049823 Bacteria 543
805 Ga0501045_0157271 3300049824 Bacteria 1691
806 Ga0501045_0754090 3300049824 Bacteria 717
807 nmdc:mga05p37_139147_c1 3300050507 Bacteria 2975
808 nmdc:mga05p37_367510_c1 3300050507 Bacteria 1689
809 nmdc:mga05p37_579843_c1 3300050507 Bacteria 1270
810 nmdc:mga09592_1124905_c1 3300050508 Bacteria 652
811 nmdc:mga09592_619973_c1 3300050508 Bacteria 926
812 nmdc:mga0qj67_72554_c1 3300050509 Bacteria 2749
813 nmdc:mga06r32_49740_c1 3300050510 Bacteria 4010
814 nmdc:mga08y16_108089_c1 3300050511 Bacteria 2896
815 nmdc:mga08y16_20950_c1 3300050511 Bacteria 6902
816 nmdc:mga08y16_257425_c1 3300050511 Bacteria 1803
817 Ga0495601_0016503 3300053077 Bacteria 4476
818 Ga0495595_0360633 3300053084 Bacteria 734
819 Ga0501084_0000022 3300054114 Bacteria 145804
820 Ga0501084_0111217 3300054114 Bacteria 2302
821 Ga0501084_0159890 3300054114 Bacteria 1900
822 Ga0501084_0271147 3300054114 Bacteria 1433
823 Ga0501084_1025194 3300054114 Bacteria 693
824 Ga0590077_027417 3300059426 Bacteria 1234
825 Ga0501082_0006072 3300060353 Bacteria 10487
826 Ga0501082_0010049 3300060353 Bacteria 8154
827 Ga0501082_0622644 3300060353 Bacteria 944
828 Ga0501082_1060100 3300060353 Bacteria 709
829 Ga0530510_0538474 3300061734 Bacteria 886
830 Ga0530510_0875769 3300061734 Bacteria 686

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035724 Ga0373933_0675627 Ga0373933_0675627_45_506 135
2 3300049823 Ga0501044_1484791 Ga0501044_1484791_100_525 138
3 3300005614 Ga0068856_100238892 Ga0068856_1002388923 141
4 3300044712 Ga0453684_0550428 Ga0453684_0550428_511_1056 146
5 3300028563 Ga0265319_1139301 Ga0265319_11393012 150
6 3300028577 Ga0265318_10000169 Ga0265318_1000016916 150
7 3300031235 Ga0265330_10000068 Ga0265330_1000006885 150
8 3300031238 Ga0265332_10001607 Ga0265332_1000160716 150
9 3300031239 Ga0265328_10000528 Ga0265328_1000052813 150
10 3300031240 Ga0265320_10000069 Ga0265320_1000006916 150
11 3300031241 Ga0265325_10079690 Ga0265325_100796903 150
12 3300031242 Ga0265329_10066059 Ga0265329_100660592 150
13 3300031250 Ga0265331_10000149 Ga0265331_1000014985 150
14 3300031344 Ga0265316_10007181 Ga0265316_1000718111 150
15 3300031595 Ga0265313_10000812 Ga0265313_1000081211 150
16 3300031711 Ga0265314_10000191 Ga0265314_1000019186 150
17 3300031712 Ga0265342_10006711 Ga0265342_100067113 150
18 3300005336 Ga0070680_100246153 Ga0070680_1002461533 151
19 3300005458 Ga0070681_10133625 Ga0070681_101336254 151
20 3300005530 Ga0070679_100202672 Ga0070679_1002026721 151
21 3300025912 Ga0207707_10006555 Ga0207707_1000655510 151
22 3300025917 Ga0207660_10215847 Ga0207660_102158472 151
23 3300025921 Ga0207652_10011010 Ga0207652_100110106 151
24 3300028666 Ga0265336_10031393 Ga0265336_100313934 152
25 3300031247 Ga0265340_10010589 Ga0265340_100105898 152
26 3300031249 Ga0265339_10322278 Ga0265339_103222781 152
27 3300041460 Ga0451802_1249106 Ga0451802_1249106_760_1305 152
28 3300028653 Ga0265323_10065335 Ga0265323_100653353 153
29 3300044712 Ga0453684_0019106 Ga0453684_0019106_2098_2646 153
30 3300044712 Ga0453684_0576757 Ga0453684_0576757_238_786 153
31 3300054114 Ga0501084_0271147 Ga0501084_0271147_835_1389 153
32 3300004799 Ga0058863_11635206 Ga0058863_116352061 154
33 3300004803 Ga0058862_10077182 Ga0058862_100771823 154
34 3300005336 Ga0070680_100038408 Ga0070680_1000384082 154
35 3300005445 Ga0070708_100536975 Ga0070708_1005369752 154
36 3300005455 Ga0070663_100054376 Ga0070663_1000543763 154
37 3300005458 Ga0070681_10046978 Ga0070681_100469789 154
38 3300005530 Ga0070679_100033803 Ga0070679_1000338037 154
39 3300005530 Ga0070679_100057568 Ga0070679_1000575689 154
40 3300005563 Ga0068855_100004696 Ga0068855_10000469624 154
41 3300005563 Ga0068855_100067646 Ga0068855_1000676462 154
42 3300005578 Ga0068854_100008257 Ga0068854_1000082576 154
43 3300005614 Ga0068856_100084913 Ga0068856_1000849134 154
44 3300009545 Ga0105237_10002220 Ga0105237_1000222024 154
45 3300010375 Ga0105239_11217999 Ga0105239_112179991 154
46 3300013100 Ga0157373_10124104 Ga0157373_101241043 154
47 3300013104 Ga0157370_10125442 Ga0157370_101254423 154
48 3300013104 Ga0157370_10299241 Ga0157370_102992412 154
49 3300013105 Ga0157369_10245732 Ga0157369_102457322 154
50 3300013307 Ga0157372_10022741 Ga0157372_100227419 154
51 3300020070 Ga0206356_10188034 Ga0206356_101880342 154
52 3300020078 Ga0206352_11285822 Ga0206352_112858225 154
53 3300025912 Ga0207707_10000201 Ga0207707_1000020115 154
54 3300025914 Ga0207671_10000510 Ga0207671_1000051017 154
55 3300025914 Ga0207671_10006782 Ga0207671_100067824 154
56 3300025917 Ga0207660_10281695 Ga0207660_102816952 154
57 3300025921 Ga0207652_10002222 Ga0207652_1000222210 154
58 3300025921 Ga0207652_10073451 Ga0207652_100734516 154
59 3300025949 Ga0207667_10087997 Ga0207667_100879976 154
60 3300025949 Ga0207667_10136064 Ga0207667_101360643 154
61 3300025981 Ga0207640_10038078 Ga0207640_100380785 154
62 3300026067 Ga0207678_10033539 Ga0207678_100335396 154
63 3300026078 Ga0207702_10100543 Ga0207702_101005433 154
64 3300028800 Ga0265338_10681489 Ga0265338_106814891 154
65 3300031595 Ga0265313_10057584 Ga0265313_100575842 154
66 3300045976 Ga0466967_0699277 Ga0466967_0699277_264_815 154
67 3300049569 Ga0501032_0081732 Ga0501032_0081732_687_1211 154
68 3300049570 Ga0501033_0126838 Ga0501033_0126838_1295_1819 154
69 3300049571 Ga0501034_0347244 Ga0501034_0347244_237_761 154
70 3300049572 Ga0501036_0333348 Ga0501036_0333348_512_1036 154
71 3300049574 Ga0501038_0416404 Ga0501038_0416404_469_993 154
72 3300049575 Ga0501039_0577354 Ga0501039_0577354_338_862 154
73 3300049579 Ga0501043_0201720 Ga0501043_0201720_477_1001 154
74 3300049580 Ga0501046_0400806 Ga0501046_0400806_318_842 154
75 3300049589 Ga0501073_0101363 Ga0501073_0101363_973_1497 154
76 3300049742 Ga0501080_0062816 Ga0501080_0062816_2805_3329 154
77 3300049822 Ga0501035_0074733 Ga0501035_0074733_1644_2168 154
78 3300049823 Ga0501044_1365185 Ga0501044_1365185_21_545 154
79 3300005353 Ga0070669_100008256 Ga0070669_10000825612 155
80 3300005354 Ga0070675_100244545 Ga0070675_1002445452 155
81 3300005356 Ga0070674_100145445 Ga0070674_1001454453 155
82 3300005364 Ga0070673_100238981 Ga0070673_1002389813 155
83 3300005438 Ga0070701_10395258 Ga0070701_103952582 155
84 3300005441 Ga0070700_100008581 Ga0070700_1000085816 155
85 3300005459 Ga0068867_100021915 Ga0068867_1000219152 155
86 3300005543 Ga0070672_100204397 Ga0070672_1002043972 155
87 3300005549 Ga0070704_100325887 Ga0070704_1003258871 155
88 3300005840 Ga0068870_10292690 Ga0068870_102926902 155
89 3300005844 Ga0068862_100038391 Ga0068862_1000383912 155
90 3300009148 Ga0105243_10010767 Ga0105243_100107679 155
91 3300009176 Ga0105242_10218702 Ga0105242_102187024 155
92 3300009553 Ga0105249_10010299 Ga0105249_1001029912 155
93 3300013306 Ga0163162_10566535 Ga0163162_105665352 155
94 3300014326 Ga0157380_10033551 Ga0157380_100335518 155
95 3300025885 Ga0207653_10038952 Ga0207653_100389523 155
96 3300025923 Ga0207681_10003287 Ga0207681_1000328718 155
97 3300025926 Ga0207659_10199373 Ga0207659_101993732 155
98 3300025935 Ga0207709_10007251 Ga0207709_100072519 155
99 3300025937 Ga0207669_10266219 Ga0207669_102662192 155
100 3300025938 Ga0207704_10003227 Ga0207704_100032274 155
101 3300025940 Ga0207691_10028424 Ga0207691_1002842411 155
102 3300025960 Ga0207651_10141959 Ga0207651_101419592 155
103 3300025961 Ga0207712_10007287 Ga0207712_100072876 155
104 3300025981 Ga0207640_10911377 Ga0207640_109113771 155
105 3300026075 Ga0207708_10057714 Ga0207708_100577146 155
106 3300026089 Ga0207648_10008885 Ga0207648_1000888517 155
107 3300026118 Ga0207675_100004342 Ga0207675_10000434218 155
108 3300027907 Ga0207428_10061701 Ga0207428_100617014 155
109 3300028380 Ga0268265_10000858 Ga0268265_100008586 155
110 3300048918 Ga0496115_0239629 Ga0496115_0239629_549_1076 155
111 3300005343 Ga0070687_100158248 Ga0070687_1001582482 156
112 3300005347 Ga0070668_100056723 Ga0070668_1000567236 156
113 3300005546 Ga0070696_100848669 Ga0070696_1008486691 156
114 3300006844 Ga0075428_100249709 Ga0075428_1002497093 156
115 3300009147 Ga0114129_11259091 Ga0114129_112590912 156
116 3300013308 Ga0157375_10272772 Ga0157375_102727722 156
117 3300025918 Ga0207662_10055422 Ga0207662_100554223 156
118 3300025936 Ga0207670_10509207 Ga0207670_105092072 156
119 3300026089 Ga0207648_11182781 Ga0207648_111827812 156
120 3300026121 Ga0207683_10277095 Ga0207683_102770953 156
121 3300046539 Ga0495621_0019581 Ga0495621_0019581_505_1038 156
122 3300046684 Ga0495669_0106277 Ga0495669_0106277_677_1210 156
123 3300048090 Ga0495615_0036745 Ga0495615_0036745_378_911 156
124 3300050507 nmdc:mga05p37_579843_c1 nmdc:mga05p37_579843_c1_155_688 156
125 3300050508 nmdc:mga09592_619973_c1 nmdc:mga09592_619973_c1_157_690 156
126 3300009094 Ga0111539_10058961 Ga0111539_100589616 157
127 3300035083 Ga0373926_0265212 Ga0373926_0265212_17_529 157
128 3300035118 Ga0373954_0014604 Ga0373954_0014604_2418_2933 157
129 3300035119 Ga0373956_0112149 Ga0373956_0112149_750_1259 157
130 3300035120 Ga0373957_0045467 Ga0373957_0045467_149_664 157
131 3300035410 Ga0373924_0028722 Ga0373924_0028722_1629_2144 157
132 3300035724 Ga0373933_0063865 Ga0373933_0063865_85_600 157
133 3300036401 Ga0373937_0025601 Ga0373937_0025601_3736_4251 157
134 3300047471 Ga0495684_0175430 Ga0495684_0175430_992_1501 157
135 3300048907 Ga0496104_0091762 Ga0496104_0091762_790_1299 157
136 3300048911 Ga0496108_0011674 Ga0496108_0011674_1041_1589 157
137 3300048912 Ga0496109_0935874 Ga0496109_0935874_179_727 157
138 3300048917 Ga0496114_0265781 Ga0496114_0265781_430_939 157
139 3300048918 Ga0496115_0059367 Ga0496115_0059367_2431_2943 157
140 3300005614 Ga0068856_100700014 Ga0068856_1007000142 158
141 3300006844 Ga0075428_100903512 Ga0075428_1009035122 158
142 3300006846 Ga0075430_100018107 Ga0075430_1000181075 158
143 3300013296 Ga0157374_10039567 Ga0157374_1003956710 158
144 3300014968 Ga0157379_10049835 Ga0157379_100498356 158
145 3300048917 Ga0496114_0068408 Ga0496114_0068408_1968_2513 158
146 3300048918 Ga0496115_0882893 Ga0496115_0882893_109_654 158
147 3300050509 nmdc:mga0qj67_72554_c1 nmdc:mga0qj67_72554_c1_1578_2111 158
148 3300005578 Ga0068854_100256109 Ga0068854_1002561093 160
149 3300009093 Ga0105240_10212412 Ga0105240_102124123 160
150 3300013308 Ga0157375_10202649 Ga0157375_102026495 160
151 3300035113 Ga0373936_0267227 Ga0373936_0267227_138_665 160
152 3300035172 Ga0373955_0417050 Ga0373955_0417050_239_796 160
153 3300048917 Ga0496114_0417919 Ga0496114_0417919_172_699 160
154 3300049583 Ga0501067_0165225 Ga0501067_0165225_221_769 160
155 3300049592 Ga0501076_1471983 Ga0501076_1471983_10_492 160
156 3300010375 Ga0105239_11300654 Ga0105239_113006542 161
157 3300028556 Ga0265337_1006282 Ga0265337_10062825 161
158 3300034818 Ga0373950_0000002 Ga0373950_0000002_6744_7265 161
159 3300034818 Ga0373950_0000057 Ga0373950_0000057_71498_72016 161
160 3300039437 Ga0436365_0027917 Ga0436365_0027917_522_1022 161
161 3300048917 Ga0496114_0234351 Ga0496114_0234351_152_670 161
162 3300049570 Ga0501033_0203952 Ga0501033_0203952_44_577 161
163 3300049571 Ga0501034_0000037 Ga0501034_0000037_164884_165402 161
164 3300049572 Ga0501036_0101300 Ga0501036_0101300_1795_2313 161
165 3300049572 Ga0501036_0244241 Ga0501036_0244241_490_1008 161
166 3300049573 Ga0501037_0255880 Ga0501037_0255880_630_1163 161
167 3300049575 Ga0501039_0178645 Ga0501039_0178645_482_1015 161
168 3300049579 Ga0501043_0002483 Ga0501043_0002483_6885_7403 161
169 3300049580 Ga0501046_0000751 Ga0501046_0000751_28194_28712 161
170 3300049581 Ga0501047_0000053 Ga0501047_0000053_45361_45879 161
171 3300049582 Ga0501048_0001235 Ga0501048_0001235_6370_6888 161
172 3300049583 Ga0501067_0000339 Ga0501067_0000339_1541_2062 161
173 3300049583 Ga0501067_0160812 Ga0501067_0160812_45_563 161
174 3300049584 Ga0501068_0001718 Ga0501068_0001718_10375_10893 161
175 3300049584 Ga0501068_0031405 Ga0501068_0031405_2254_2775 161
176 3300049585 Ga0501069_0185040 Ga0501069_0185040_235_756 161
177 3300049586 Ga0501070_0007053 Ga0501070_0007053_2157_2675 161
178 3300049588 Ga0501072_0002806 Ga0501072_0002806_5672_6190 161
179 3300049589 Ga0501073_0005323 Ga0501073_0005323_6690_7211 161
180 3300049589 Ga0501073_0005367 Ga0501073_0005367_4843_5361 161
181 3300049589 Ga0501073_0185329 Ga0501073_0185329_407_928 161
182 3300049589 Ga0501073_0331562 Ga0501073_0331562_400_921 161
183 3300049590 Ga0501074_0026506 Ga0501074_0026506_1869_2387 161
184 3300049590 Ga0501074_0051564 Ga0501074_0051564_375_896 161
185 3300049590 Ga0501074_0189502 Ga0501074_0189502_136_657 161
186 3300049591 Ga0501075_0216701 Ga0501075_0216701_824_1357 161
187 3300049592 Ga0501076_0329518 Ga0501076_0329518_11_544 161
188 3300049741 Ga0501079_0000174 Ga0501079_0000174_21560_22078 161
189 3300049741 Ga0501079_0039556 Ga0501079_0039556_2893_3426 161
190 3300049742 Ga0501080_0007066 Ga0501080_0007066_2736_3254 161
191 3300049742 Ga0501080_0077933 Ga0501080_0077933_2231_2752 161
192 3300049742 Ga0501080_0730968 Ga0501080_0730968_236_769 161
193 3300049743 Ga0501081_0256912 Ga0501081_0256912_655_1188 161
194 3300049744 Ga0501083_0006838 Ga0501083_0006838_4971_5489 161
195 3300049744 Ga0501083_0020228 Ga0501083_0020228_3641_4162 161
196 3300049744 Ga0501083_0169543 Ga0501083_0169543_266_799 161
197 3300049744 Ga0501083_0261830 Ga0501083_0261830_141_662 161
198 3300049823 Ga0501044_0215426 Ga0501044_0215426_865_1383 161
199 3300049824 Ga0501045_0157271 Ga0501045_0157271_648_1181 161
200 3300054114 Ga0501084_0000022 Ga0501084_0000022_104534_105052 161
201 3300054114 Ga0501084_1025194 Ga0501084_1025194_30_563 161
202 3300060353 Ga0501082_0006072 Ga0501082_0006072_3128_3646 161
203 3300060353 Ga0501082_0622644 Ga0501082_0622644_362_883 161
204 3300028558 Ga0265326_10006368 Ga0265326_100063681 162
205 3300028563 Ga0265319_1000335 Ga0265319_100033531 162
206 3300028577 Ga0265318_10001647 Ga0265318_1000164716 162
207 3300028800 Ga0265338_10013017 Ga0265338_1001301713 162
208 3300035117 Ga0373953_0319184 Ga0373953_0319184_61_618 163
209 3300035241 Ga0373961_0100306 Ga0373961_0100306_13_543 163
210 3300047322 Ga0495680_0717460 Ga0495680_0717460_99_635 163
211 3300048917 Ga0496114_0006073 Ga0496114_0006073_6775_7311 163
212 3300035092 Ga0373952_0025211 Ga0373952_0025211_505_1059 164
213 3300035172 Ga0373955_0206647 Ga0373955_0206647_81_611 164
214 3300046536 Ga0495587_0249500 Ga0495587_0249500_391_921 164
215 3300046689 Ga0495613_0706878 Ga0495613_0706878_16_546 164
216 3300048913 Ga0496110_0328255 Ga0496110_0328255_450_980 164
217 3300049585 Ga0501069_0015342 Ga0501069_0015342_1300_1851 164
218 3300049586 Ga0501070_0005205 Ga0501070_0005205_5592_6143 164
219 3300049741 Ga0501079_0092127 Ga0501079_0092127_433_984 164
220 3300049742 Ga0501080_0348082 Ga0501080_0348082_399_950 164
221 3300049743 Ga0501081_0014431 Ga0501081_0014431_2392_2943 164
222 3300049744 Ga0501083_0073859 Ga0501083_0073859_1324_1875 164
223 3300053084 Ga0495595_0360633 Ga0495595_0360633_35_589 164
224 3300060353 Ga0501082_0010049 Ga0501082_0010049_5573_6124 164
225 3300014745 Ga0157377_10015531 Ga0157377_100155313 165
226 3300050508 nmdc:mga09592_1124905_c1 nmdc:mga09592_1124905_c1_30_590 166
227 3300048907 Ga0496104_0626947 Ga0496104_0626947_139_696 167
228 3300005458 Ga0070681_10138345 Ga0070681_101383454 168
229 3300005535 Ga0070684_100556689 Ga0070684_1005566891 168
230 3300005544 Ga0070686_100350856 Ga0070686_1003508562 168
231 3300005618 Ga0068864_100595292 Ga0068864_1005952921 168
232 3300011119 Ga0105246_11242083 Ga0105246_112420831 168
233 3300025986 Ga0207658_10895431 Ga0207658_108954312 168
234 3300048915 Ga0496112_0030222 Ga0496112_0030222_1983_2540 168
235 iso_pu_bacteria 2547132130 2547502397 168
236 iso_pu_bacteria 2747842428 2747950342 168
237 iso_pu_bacteria 2765235840 2765577797 168
238 iso_pu_bacteria 2816332141 2816515860 168
239 iso_pu_bacteria 2842391507 2842394184 168
240 iso_pu_bacteria 2919134579 2919134921 168
241 iso_pu_bacteria 2961064222 2961068537 168
242 3300005345 Ga0070692_10266435 Ga0070692_102664352 169
243 3300005328 Ga0070676_10018293 Ga0070676_100182939 170
244 3300005330 Ga0070690_100147431 Ga0070690_1001474314 170
245 3300005334 Ga0068869_100731884 Ga0068869_1007318842 170
246 3300005340 Ga0070689_100181334 Ga0070689_1001813343 170
247 3300005347 Ga0070668_100028739 Ga0070668_1000287393 170
248 3300005356 Ga0070674_100007457 Ga0070674_10000745713 170
249 3300005365 Ga0070688_100195933 Ga0070688_1001959332 170
250 3300005438 Ga0070701_10351515 Ga0070701_103515152 170
251 3300005440 Ga0070705_100046738 Ga0070705_1000467385 170
252 3300005441 Ga0070700_100042432 Ga0070700_1000424322 170
253 3300005459 Ga0068867_100016292 Ga0068867_10001629210 170
254 3300005543 Ga0070672_100064690 Ga0070672_1000646906 170
255 3300005617 Ga0068859_100622992 Ga0068859_1006229922 170
256 3300005718 Ga0068866_10035746 Ga0068866_100357464 170
257 3300005719 Ga0068861_100088764 Ga0068861_1000887642 170
258 3300005844 Ga0068862_101006302 Ga0068862_1010063022 170
259 3300006881 Ga0068865_100218603 Ga0068865_1002186033 170
260 3300006931 Ga0097620_100623014 Ga0097620_1006230142 170
261 3300009148 Ga0105243_10214065 Ga0105243_102140654 170
262 3300009553 Ga0105249_10246729 Ga0105249_102467294 170
263 3300013306 Ga0163162_10118214 Ga0163162_101182146 170
264 3300025315 Ga0207697_10069394 Ga0207697_100693943 170
265 3300025907 Ga0207645_10021058 Ga0207645_100210582 170
266 3300025913 Ga0207695_10109993 Ga0207695_101099934 170
267 3300025919 Ga0207657_10226429 Ga0207657_102264292 170
268 3300025923 Ga0207681_10002742 Ga0207681_100027427 170
269 3300025936 Ga0207670_10398206 Ga0207670_103982063 170
270 3300025938 Ga0207704_10003857 Ga0207704_100038576 170
271 3300025942 Ga0207689_10449004 Ga0207689_104490043 170
272 3300025972 Ga0207668_10028961 Ga0207668_100289614 170
273 3300025981 Ga0207640_10811543 Ga0207640_108115431 170
274 3300025986 Ga0207658_10219118 Ga0207658_102191183 170
275 3300026023 Ga0207677_10391051 Ga0207677_103910513 170
276 3300026035 Ga0207703_10960747 Ga0207703_109607472 170
277 3300026089 Ga0207648_10011154 Ga0207648_100111545 170
278 3300026118 Ga0207675_100013850 Ga0207675_1000138502 170
279 3300027717 Ga0209998_10037285 Ga0209998_100372851 170
280 3300028380 Ga0268265_10034866 Ga0268265_100348662 170
281 3300028381 Ga0268264_10581208 Ga0268264_105812081 170
282 3300031240 Ga0265320_10213635 Ga0265320_102136352 170
283 3300031249 Ga0265339_10002072 Ga0265339_1000207220 170
284 3300031344 Ga0265316_10029372 Ga0265316_100293726 170
285 3300031595 Ga0265313_10015631 Ga0265313_100156319 170
286 3300031711 Ga0265314_10137646 Ga0265314_101376462 170
287 3300035112 Ga0373932_0305649 Ga0373932_0305649_24_581 170
288 3300048903 Ga0496100_0003660 Ga0496100_0003660_1820_2377 170
289 3300048904 Ga0496101_0046745 Ga0496101_0046745_1017_1574 170
290 3300048907 Ga0496104_0863714 Ga0496104_0863714_200_757 170
291 3300048909 Ga0496106_0035630 Ga0496106_0035630_1721_2278 170
292 3300048917 Ga0496114_0000386 Ga0496114_0000386_23922_24479 170
293 3300048918 Ga0496115_0030301 Ga0496115_0030301_2683_3240 170
294 3300049583 Ga0501067_0003773 Ga0501067_0003773_7431_7988 170
295 3300049583 Ga0501067_0197172 Ga0501067_0197172_225_782 170
296 3300049589 Ga0501073_0003382 Ga0501073_0003382_6218_6775 170
297 3300049589 Ga0501073_0576657 Ga0501073_0576657_193_750 170
298 3300049822 Ga0501035_0287348 Ga0501035_0287348_279_812 170
299 3300002863 Ga0006769J43182_106839 Ga0006769J43182_1068392 171
300 3300002868 Ga0006767J43181_103125 Ga0006767J43181_10312515 171
301 3300002870 Ga0006763J43179_104103 Ga0006763J43179_10410315 171
302 3300002872 Ga0006762J43184_103419 Ga0006762J43184_10341914 171
303 3300003163 Ga0006759J45824_1006649 Ga0006759J45824_100664917 171
304 3300003300 Ga0006758J48902_1009034 Ga0006758J48902_10090344 171
305 3300003305 Ga0006770J48903_1038246 Ga0006770J48903_10382464 171
306 3300003323 rootH1_10188922 rootH1_101889224 171
307 3300003693 Ga0032354_1009872 Ga0032354_100987216 171
308 3300005327 Ga0070658_10030484 Ga0070658_100304846 171
309 3300005329 Ga0070683_100004175 Ga0070683_10000417510 171
310 3300005330 Ga0070690_100030946 Ga0070690_1000309467 171
311 3300005337 Ga0070682_100458803 Ga0070682_1004588032 171
312 3300005337 Ga0070682_100788564 Ga0070682_1007885641 171
313 3300005338 Ga0068868_100141043 Ga0068868_1001410432 171
314 3300005339 Ga0070660_100422572 Ga0070660_1004225722 171
315 3300005340 Ga0070689_100061460 Ga0070689_1000614606 171
316 3300005340 Ga0070689_100148496 Ga0070689_1001484961 171
317 3300005343 Ga0070687_100102888 Ga0070687_1001028884 171
318 3300005354 Ga0070675_100049635 Ga0070675_1000496356 171
319 3300005356 Ga0070674_100483983 Ga0070674_1004839832 171
320 3300005364 Ga0070673_100133910 Ga0070673_1001339103 171
321 3300005364 Ga0070673_100270803 Ga0070673_1002708033 171
322 3300005364 Ga0070673_100289316 Ga0070673_1002893163 171
323 3300005365 Ga0070688_100050485 Ga0070688_1000504852 171
324 3300005365 Ga0070688_100077192 Ga0070688_1000771922 171
325 3300005365 Ga0070688_100084618 Ga0070688_1000846184 171
326 3300005367 Ga0070667_101162910 Ga0070667_1011629101 171
327 3300005456 Ga0070678_100050282 Ga0070678_1000502823 171
328 3300005466 Ga0070685_10033482 Ga0070685_100334824 171
329 3300005535 Ga0070684_100034321 Ga0070684_1000343211 171
330 3300005535 Ga0070684_100186707 Ga0070684_1001867074 171
331 3300005539 Ga0068853_100002850 Ga0068853_10000285013 171
332 3300005543 Ga0070672_100064132 Ga0070672_1000641326 171
333 3300005543 Ga0070672_100450237 Ga0070672_1004502372 171
334 3300005544 Ga0070686_100006132 Ga0070686_1000061322 171
335 3300005563 Ga0068855_100223754 Ga0068855_1002237543 171
336 3300005614 Ga0068856_100078416 Ga0068856_1000784163 171
337 3300005615 Ga0070702_100141947 Ga0070702_1001419473 171
338 3300005616 Ga0068852_100675542 Ga0068852_1006755422 171
339 3300005618 Ga0068864_100528194 Ga0068864_1005281942 171
340 3300005618 Ga0068864_100593828 Ga0068864_1005938282 171
341 3300005843 Ga0068860_100357814 Ga0068860_1003578143 171
342 3300006358 Ga0068871_100256492 Ga0068871_1002564923 171
343 3300006844 Ga0075428_100861603 Ga0075428_1008616032 171
344 3300009094 Ga0111539_10214617 Ga0111539_102146175 171
345 3300009147 Ga0114129_10126592 Ga0114129_101265923 171
346 3300009177 Ga0105248_10745197 Ga0105248_107451972 171
347 3300009545 Ga0105237_10885161 Ga0105237_108851612 171
348 3300009551 Ga0105238_10022051 Ga0105238_100220519 171
349 3300010375 Ga0105239_10413902 Ga0105239_104139024 171
350 3300013297 Ga0157378_10352400 Ga0157378_103524002 171
351 3300013297 Ga0157378_11670393 Ga0157378_116703931 171
352 3300014745 Ga0157377_10576000 Ga0157377_105760001 171
353 3300020070 Ga0206356_11464639 Ga0206356_114646392 171
354 3300025899 Ga0207642_10023568 Ga0207642_100235684 171
355 3300025904 Ga0207647_10379288 Ga0207647_103792882 171
356 3300025916 Ga0207663_10110382 Ga0207663_101103824 171
357 3300025916 Ga0207663_10916137 Ga0207663_109161371 171
358 3300025917 Ga0207660_10717801 Ga0207660_107178011 171
359 3300025918 Ga0207662_10036126 Ga0207662_100361266 171
360 3300025918 Ga0207662_10119311 Ga0207662_101193114 171
361 3300025919 Ga0207657_10108254 Ga0207657_101082544 171
362 3300025924 Ga0207694_10069793 Ga0207694_100697936 171
363 3300025928 Ga0207700_10155768 Ga0207700_101557682 171
364 3300025936 Ga0207670_10017436 Ga0207670_100174366 171
365 3300025936 Ga0207670_10156028 Ga0207670_101560283 171
366 3300025940 Ga0207691_10230106 Ga0207691_102301061 171
367 3300025944 Ga0207661_10007008 Ga0207661_1000700810 171
368 3300025944 Ga0207661_10070548 Ga0207661_100705484 171
369 3300025960 Ga0207651_10021221 Ga0207651_100212214 171
370 3300025960 Ga0207651_10045826 Ga0207651_100458264 171
371 3300025960 Ga0207651_10228346 Ga0207651_102283464 171
372 3300025986 Ga0207658_10938842 Ga0207658_109388422 171
373 3300026041 Ga0207639_10005667 Ga0207639_100056673 171
374 3300026041 Ga0207639_10595924 Ga0207639_105959242 171
375 3300026067 Ga0207678_11423702 Ga0207678_114237021 171
376 3300026078 Ga0207702_11198523 Ga0207702_111985231 171
377 3300026095 Ga0207676_10460360 Ga0207676_104603602 171
378 3300026095 Ga0207676_10716842 Ga0207676_107168422 171
379 3300026095 Ga0207676_11361061 Ga0207676_113610612 171
380 3300026118 Ga0207675_100995031 Ga0207675_1009950311 171
381 3300026121 Ga0207683_10094403 Ga0207683_100944032 171
382 3300026142 Ga0207698_10179531 Ga0207698_101795312 171
383 3300027907 Ga0207428_10017611 Ga0207428_100176116 171
384 3300028666 Ga0265336_10002452 Ga0265336_1000245212 171
385 3300028666 Ga0265336_10069504 Ga0265336_100695041 171
386 3300028666 Ga0265336_10087446 Ga0265336_100874462 171
387 3300028794 Ga0307515_10600584 Ga0307515_106005842 171
388 3300028800 Ga0265338_10001810 Ga0265338_1000181023 171
389 3300028800 Ga0265338_10191950 Ga0265338_101919502 171
390 3300028800 Ga0265338_10554871 Ga0265338_105548711 171
391 3300031238 Ga0265332_10040797 Ga0265332_100407972 171
392 3300031238 Ga0265332_10047768 Ga0265332_100477684 171
393 3300031239 Ga0265328_10000172 Ga0265328_1000017225 171
394 3300031240 Ga0265320_10010819 Ga0265320_100108198 171
395 3300031242 Ga0265329_10045049 Ga0265329_100450493 171
396 3300031247 Ga0265340_10067657 Ga0265340_100676573 171
397 3300031249 Ga0265339_10006807 Ga0265339_100068078 171
398 3300031249 Ga0265339_10242013 Ga0265339_102420131 171
399 3300031250 Ga0265331_10026117 Ga0265331_100261176 171
400 3300031344 Ga0265316_10017518 Ga0265316_100175187 171
401 3300031507 Ga0307509_10246925 Ga0307509_102469252 171
402 3300031595 Ga0265313_10036999 Ga0265313_100369992 171
403 3300031711 Ga0265314_10001397 Ga0265314_1000139714 171
404 3300031711 Ga0265314_10004534 Ga0265314_1000453417 171
405 3300031711 Ga0265314_10086729 Ga0265314_100867293 171
406 3300031712 Ga0265342_10001254 Ga0265342_1000125417 171
407 3300031712 Ga0265342_10001889 Ga0265342_1000188917 171
408 3300031712 Ga0265342_10013077 Ga0265342_100130776 171
409 3300031728 Ga0316578_10315561 Ga0316578_103155612 171
410 3300035111 Ga0373923_0223919 Ga0373923_0223919_201_755 171
411 3300035113 Ga0373936_0091362 Ga0373936_0091362_557_1111 171
412 3300035118 Ga0373954_0028117 Ga0373954_0028117_1184_1738 171
413 3300035118 Ga0373954_0048783 Ga0373954_0048783_790_1344 171
414 3300035118 Ga0373954_0061842 Ga0373954_0061842_265_816 171
415 3300035118 Ga0373954_0073523 Ga0373954_0073523_1057_1605 171
416 3300035119 Ga0373956_0023587 Ga0373956_0023587_115_669 171
417 3300035171 Ga0373946_0032634 Ga0373946_0032634_821_1375 171
418 3300035691 Ga0373931_0041283 Ga0373931_0041283_818_1387 171
419 3300035692 Ga0373935_0199170 Ga0373935_0199170_131_685 171
420 3300035724 Ga0373933_0069385 Ga0373933_0069385_1077_1631 171
421 3300035724 Ga0373933_0125719 Ga0373933_0125719_863_1414 171
422 3300035724 Ga0373933_0206114 Ga0373933_0206114_537_1088 171
423 3300036401 Ga0373937_0183070 Ga0373937_0183070_387_941 171
424 3300037068 Ga0373925_0587993 Ga0373925_0587993_92_646 171
425 3300042876 Ga0451577_0242446 Ga0451577_0242446_282_833 171
426 3300044712 Ga0453684_0000116 Ga0453684_0000116_252862_253413 171
427 3300044712 Ga0453684_1143788 Ga0453684_1143788_128_676 171
428 3300046476 Ga0495662_0097335 Ga0495662_0097335_21_575 171
429 3300046477 Ga0495664_0005945 Ga0495664_0005945_2019_2573 171
430 3300046517 Ga0495630_0165382 Ga0495630_0165382_803_1357 171
431 3300046535 Ga0495586_0043692 Ga0495586_0043692_34_588 171
432 3300046616 Ga0495668_0318683 Ga0495668_0318683_147_698 171
433 3300046642 Ga0495634_0000649 Ga0495634_0000649_6812_7366 171
434 3300046675 Ga0495657_0102867 Ga0495657_0102867_972_1526 171
435 3300047319 Ga0495674_0001336 Ga0495674_0001336_16705_17259 171
436 3300048903 Ga0496100_0801097 Ga0496100_0801097_126_680 171
437 3300048912 Ga0496109_0099816 Ga0496109_0099816_1140_1685 171
438 3300048918 Ga0496115_0302381 Ga0496115_0302381_93_647 171
439 3300050511 nmdc:mga08y16_20950_c1 nmdc:mga08y16_20950_c1_2652_3206 171
440 3300053077 Ga0495601_0016503 Ga0495601_0016503_3857_4411 171
441 3300003781 Ga0055536_1017591 Ga0055536_10175913 172
442 3300003856 Ga0058692_1000785 Ga0058692_100078517 172
443 3300005337 Ga0070682_100004587 Ga0070682_1000045872 172
444 3300005366 Ga0070659_100010672 Ga0070659_1000106722 172
445 3300005539 Ga0068853_100003768 Ga0068853_10000376815 172
446 3300005563 Ga0068855_100021141 Ga0068855_10002114112 172
447 3300005985 Ga0081539_10051462 Ga0081539_100514622 172
448 3300006844 Ga0075428_100538806 Ga0075428_1005388063 172
449 3300009148 Ga0105243_10917973 Ga0105243_109179732 172
450 3300009174 Ga0105241_10435095 Ga0105241_104350952 172
451 3300009177 Ga0105248_10057742 Ga0105248_1005774210 172
452 3300009551 Ga0105238_10037314 Ga0105238_100373148 172
453 3300013100 Ga0157373_10104415 Ga0157373_101044153 172
454 3300013102 Ga0157371_10011870 Ga0157371_100118702 172
455 3300013104 Ga0157370_10233935 Ga0157370_102339353 172
456 3300013296 Ga0157374_10079651 Ga0157374_100796516 172
457 3300013307 Ga0157372_10144665 Ga0157372_101446652 172
458 3300013308 Ga0157375_10472260 Ga0157375_104722604 172
459 3300021384 Ga0213876_10165535 Ga0213876_101655352 172
460 3300025292 Ga0209676_1004379 Ga0209676_10043793 172
461 3300025298 Ga0209050_1017914 Ga0209050_10179143 172
462 3300025304 Ga0209257_1024354 Ga0209257_10243543 172
463 3300025911 Ga0207654_10149686 Ga0207654_101496863 172
464 3300025919 Ga0207657_10533527 Ga0207657_105335272 172
465 3300025924 Ga0207694_10069504 Ga0207694_100695046 172
466 3300025941 Ga0207711_10129621 Ga0207711_101296213 172
467 3300025949 Ga0207667_10012000 Ga0207667_100120008 172
468 3300026041 Ga0207639_10064484 Ga0207639_100644842 172
469 3300026116 Ga0207674_10358305 Ga0207674_103583052 172
470 3300031235 Ga0265330_10001241 Ga0265330_1000124118 172
471 3300031344 Ga0265316_10004187 Ga0265316_1000418717 172
472 3300039437 Ga0436365_1643703 Ga0436365_1643703_227_769 172
473 3300042876 Ga0451577_0001597 Ga0451577_0001597_10878_11414 172
474 3300042876 Ga0451577_0045788 Ga0451577_0045788_493_1029 172
475 3300044712 Ga0453684_0000194 Ga0453684_0000194_98896_99432 172
476 3300044712 Ga0453684_0034156 Ga0453684_0034156_5512_6048 172
477 3300044712 Ga0453684_0236326 Ga0453684_0236326_1052_1588 172
478 3300044712 Ga0453684_0589304 Ga0453684_0589304_645_1184 172
479 3300046459 Ga0495629_0291700 Ga0495629_0291700_213_749 172
480 3300046461 Ga0495641_0078650 Ga0495641_0078650_485_1021 172
481 3300046473 Ga0495582_0087478 Ga0495582_0087478_409_945 172
482 3300046681 Ga0495647_0023213 Ga0495647_0023213_952_1488 172
483 3300046683 Ga0495658_0246579 Ga0495658_0246579_468_1004 172
484 3300046690 Ga0495624_0077788 Ga0495624_0077788_861_1397 172
485 3300047321 Ga0495676_0133580 Ga0495676_0133580_797_1333 172
486 3300049569 Ga0501032_0250066 Ga0501032_0250066_254_781 172
487 3300049570 Ga0501033_0112132 Ga0501033_0112132_729_1256 172
488 3300049571 Ga0501034_0008263 Ga0501034_0008263_2698_3225 172
489 3300049573 Ga0501037_0003640 Ga0501037_0003640_698_1225 172
490 3300049579 Ga0501043_0024041 Ga0501043_0024041_552_1079 172
491 3300049586 Ga0501070_0059869 Ga0501070_0059869_878_1405 172
492 3300049822 Ga0501035_0009970 Ga0501035_0009970_2819_3346 172
493 3300049823 Ga0501044_0121516 Ga0501044_0121516_494_1021 172
494 3300005330 Ga0070690_100006945 Ga0070690_10000694511 173
495 3300005334 Ga0068869_100175044 Ga0068869_1001750441 173
496 3300005338 Ga0068868_100203129 Ga0068868_1002031291 173
497 3300005340 Ga0070689_100122321 Ga0070689_1001223212 173
498 3300005343 Ga0070687_100030365 Ga0070687_1000303651 173
499 3300005364 Ga0070673_100172506 Ga0070673_1001725063 173
500 3300005364 Ga0070673_100229659 Ga0070673_1002296592 173
501 3300005365 Ga0070688_100055298 Ga0070688_1000552984 173
502 3300005535 Ga0070684_100246367 Ga0070684_1002463673 173
503 3300005535 Ga0070684_100254645 Ga0070684_1002546452 173
504 3300005544 Ga0070686_100008053 Ga0070686_10000805310 173
505 3300005546 Ga0070696_100050189 Ga0070696_1000501893 173
506 3300005547 Ga0070693_100259652 Ga0070693_1002596522 173
507 3300005563 Ga0068855_100006029 Ga0068855_10000602916 173
508 3300005577 Ga0068857_100117726 Ga0068857_1001177264 173
509 3300005616 Ga0068852_100171595 Ga0068852_1001715953 173
510 3300005617 Ga0068859_100158427 Ga0068859_1001584272 173
511 3300005844 Ga0068862_100203189 Ga0068862_1002031892 173
512 3300005981 Ga0081538_10106324 Ga0081538_101063242 173
513 3300006237 Ga0097621_100001348 Ga0097621_10000134816 173
514 3300006358 Ga0068871_100000763 Ga0068871_10000076316 173
515 3300006844 Ga0075428_100022001 Ga0075428_1000220016 173
516 3300006846 Ga0075430_100536529 Ga0075430_1005365292 173
517 3300006847 Ga0075431_100033449 Ga0075431_1000334494 173
518 3300006931 Ga0097620_100158439 Ga0097620_1001584392 173
519 3300007076 Ga0075435_100114268 Ga0075435_1001142683 173
520 3300007265 Ga0099794_10043462 Ga0099794_100434622 173
521 3300009094 Ga0111539_10432969 Ga0111539_104329692 173
522 3300009094 Ga0111539_10640704 Ga0111539_106407042 173
523 3300009147 Ga0114129_10144198 Ga0114129_101441984 173
524 3300009147 Ga0114129_10513346 Ga0114129_105133463 173
525 3300009147 Ga0114129_11191028 Ga0114129_111910282 173
526 3300009177 Ga0105248_10746019 Ga0105248_107460192 173
527 3300014969 Ga0157376_10130727 Ga0157376_101307274 173
528 3300025898 Ga0207692_10032528 Ga0207692_100325283 173
529 3300025903 Ga0207680_10145936 Ga0207680_101459363 173
530 3300025907 Ga0207645_10082768 Ga0207645_100827684 173
531 3300025908 Ga0207643_10011769 Ga0207643_100117697 173
532 3300025918 Ga0207662_10009139 Ga0207662_100091396 173
533 3300025918 Ga0207662_10617621 Ga0207662_106176211 173
534 3300025925 Ga0207650_10016378 Ga0207650_1001637810 173
535 3300025926 Ga0207659_10281980 Ga0207659_102819802 173
536 3300025940 Ga0207691_10351045 Ga0207691_103510452 173
537 3300025942 Ga0207689_10375899 Ga0207689_103758991 173
538 3300025944 Ga0207661_10057404 Ga0207661_100574046 173
539 3300025944 Ga0207661_10151347 Ga0207661_101513473 173
540 3300025949 Ga0207667_10000358 Ga0207667_1000035816 173
541 3300025960 Ga0207651_10274524 Ga0207651_102745242 173
542 3300025960 Ga0207651_10307280 Ga0207651_103072802 173
543 3300026023 Ga0207677_10174178 Ga0207677_101741784 173
544 3300026035 Ga0207703_10263798 Ga0207703_102637982 173
545 3300026089 Ga0207648_10390627 Ga0207648_103906272 173
546 3300026116 Ga0207674_10057822 Ga0207674_100578225 173
547 3300026118 Ga0207675_100560357 Ga0207675_1005603573 173
548 3300026142 Ga0207698_10158112 Ga0207698_101581123 173
549 3300027364 Ga0209967_1000358 Ga0209967_10003589 173
550 3300027378 Ga0209981_1039323 Ga0209981_10393232 173
551 3300027395 Ga0209996_1014019 Ga0209996_10140192 173
552 3300027462 Ga0210000_1012354 Ga0210000_10123543 173
553 3300027471 Ga0209995_1001135 Ga0209995_10011354 173
554 3300027526 Ga0209968_1001973 Ga0209968_10019733 173
555 3300027543 Ga0209999_1008412 Ga0209999_10084124 173
556 3300028380 Ga0268265_10215412 Ga0268265_102154122 173
557 3300031548 Ga0307408_100171421 Ga0307408_1001714212 173
558 3300031731 Ga0307405_10084665 Ga0307405_100846652 173
559 3300031731 Ga0307405_10560462 Ga0307405_105604622 173
560 3300031852 Ga0307410_10069857 Ga0307410_100698574 173
561 3300031903 Ga0307407_10287024 Ga0307407_102870243 173
562 3300032002 Ga0307416_100408942 Ga0307416_1004089422 173
563 3300032002 Ga0307416_100509346 Ga0307416_1005093463 173
564 3300032002 Ga0307416_100751083 Ga0307416_1007510832 173
565 3300032005 Ga0307411_10035780 Ga0307411_100357803 173
566 3300032005 Ga0307411_10116566 Ga0307411_101165663 173
567 3300034819 Ga0373958_0006655 Ga0373958_0006655_748_1281 173
568 3300035092 Ga0373952_0143843 Ga0373952_0143843_33_566 173
569 3300035111 Ga0373923_0037762 Ga0373923_0037762_763_1296 173
570 3300035112 Ga0373932_0122931 Ga0373932_0122931_189_722 173
571 3300035119 Ga0373956_0004261 Ga0373956_0004261_4263_4796 173
572 3300035172 Ga0373955_0002904 Ga0373955_0002904_4331_4864 173
573 3300035691 Ga0373931_0127927 Ga0373931_0127927_151_684 173
574 3300035724 Ga0373933_0029527 Ga0373933_0029527_1008_1541 173
575 3300036401 Ga0373937_0002498 Ga0373937_0002498_7418_7951 173
576 3300041441 Ga0451787_677116 Ga0451787_677116_159_692 173
577 3300042156 Ga0439446_0005512 Ga0439446_0005512_569_1102 173
578 3300042435 Ga0439434_0125201 Ga0439434_0125201_16_549 173
579 3300042436 Ga0439435_0000723 Ga0439435_0000723_613_1146 173
580 3300046491 Ga0495584_0281352 Ga0495584_0281352_109_642 173
581 3300046528 Ga0495642_0040298 Ga0495642_0040298_1263_1796 173
582 3300046559 Ga0495667_0007843 Ga0495667_0007843_6149_6682 173
583 3300046615 Ga0495656_0335825 Ga0495656_0335825_84_617 173
584 3300046664 Ga0495659_0042767 Ga0495659_0042767_426_959 173
585 3300047319 Ga0495674_0305483 Ga0495674_0305483_544_1077 173
586 3300047471 Ga0495684_0605913 Ga0495684_0605913_80_613 173
587 3300049514 Ga0501291_007417 Ga0501291_007417_629_1162 173
588 3300049514 Ga0501291_017783 Ga0501291_017783_498_1031 173
589 3300049522 Ga0501299_100846 Ga0501299_100846_81_659 173
590 3300049568 Ga0501031_0085694 Ga0501031_0085694_1037_1570 173
591 3300049575 Ga0501039_0074777 Ga0501039_0074777_603_1136 173
592 3300049576 Ga0501040_0175961 Ga0501040_0175961_820_1353 173
593 3300049577 Ga0501041_0100601 Ga0501041_0100601_575_1108 173
594 3300049577 Ga0501041_0478164 Ga0501041_0478164_60_593 173
595 3300049578 Ga0501042_0161937 Ga0501042_0161937_867_1400 173
596 3300049579 Ga0501043_0126658 Ga0501043_0126658_631_1164 173
597 3300049582 Ga0501048_0112107 Ga0501048_0112107_733_1266 173
598 3300049582 Ga0501048_0129189 Ga0501048_0129189_307_840 173
599 3300049584 Ga0501068_0033481 Ga0501068_0033481_1389_1922 173
600 3300049587 Ga0501071_0125408 Ga0501071_0125408_865_1398 173
601 3300049588 Ga0501072_0030599 Ga0501072_0030599_3545_4078 173
602 3300049588 Ga0501072_0051854 Ga0501072_0051854_1782_2315 173
603 3300049588 Ga0501072_0574872 Ga0501072_0574872_159_692 173
604 3300049589 Ga0501073_0008056 Ga0501073_0008056_3886_4419 173
605 3300049591 Ga0501075_0024398 Ga0501075_0024398_3364_3897 173
606 3300049591 Ga0501075_0207545 Ga0501075_0207545_340_873 173
607 3300049591 Ga0501075_0521002 Ga0501075_0521002_134_667 173
608 3300049592 Ga0501076_0047645 Ga0501076_0047645_2286_2819 173
609 3300049592 Ga0501076_0254546 Ga0501076_0254546_144_677 173
610 3300049592 Ga0501076_0454623 Ga0501076_0454623_413_946 173
611 3300049593 Ga0501077_0037441 Ga0501077_0037441_2324_2857 173
612 3300049593 Ga0501077_0129475 Ga0501077_0129475_821_1354 173
613 3300049661 Ga0501217_008735 Ga0501217_008735_669_1202 173
614 3300049741 Ga0501079_0223511 Ga0501079_0223511_848_1381 173
615 3300049741 Ga0501079_0370757 Ga0501079_0370757_577_1110 173
616 3300049742 Ga0501080_0001428 Ga0501080_0001428_15243_15776 173
617 3300049742 Ga0501080_0365193 Ga0501080_0365193_561_1094 173
618 3300049743 Ga0501081_0031168 Ga0501081_0031168_2480_3013 173
619 3300049743 Ga0501081_0153632 Ga0501081_0153632_488_1021 173
620 3300049770 Ga0501273_019264 Ga0501273_019264_140_673 173
621 3300049779 Ga0501283_018878 Ga0501283_018878_388_921 173
622 3300049824 Ga0501045_0754090 Ga0501045_0754090_166_699 173
623 3300050507 nmdc:mga05p37_139147_c1 nmdc:mga05p37_139147_c1_1170_1703 173
624 3300050507 nmdc:mga05p37_367510_c1 nmdc:mga05p37_367510_c1_846_1388 173
625 3300050510 nmdc:mga06r32_49740_c1 nmdc:mga06r32_49740_c1_20_553 173
626 3300050511 nmdc:mga08y16_108089_c1 nmdc:mga08y16_108089_c1_2075_2608 173
627 3300050511 nmdc:mga08y16_257425_c1 nmdc:mga08y16_257425_c1_624_1157 173
628 3300054114 Ga0501084_0111217 Ga0501084_0111217_1395_1928 173
629 3300054114 Ga0501084_0159890 Ga0501084_0159890_945_1478 173
630 3300059426 Ga0590077_027417 Ga0590077_027417_596_1129 173
631 3300060353 Ga0501082_1060100 Ga0501082_1060100_39_572 173
632 3300061734 Ga0530510_0538474 Ga0530510_0538474_125_658 173
633 3300061734 Ga0530510_0875769 Ga0530510_0875769_18_551 173
634 3300001904 JGI24736J21556_1001432 JGI24736J21556_10014326 174
635 3300001915 JGI24741J21665_1002594 JGI24741J21665_10025946 174
636 3300001915 JGI24741J21665_1003527 JGI24741J21665_10035275 174
637 3300001915 JGI24741J21665_1005405 JGI24741J21665_10054052 174
638 3300001979 JGI24740J21852_10000021 JGI24740J21852_1000002151 174
639 3300001979 JGI24740J21852_10035979 JGI24740J21852_100359794 174
640 3300004803 Ga0058862_12882013 Ga0058862_128820133 174
641 3300005327 Ga0070658_10235420 Ga0070658_102354202 174
642 3300005329 Ga0070683_100171208 Ga0070683_1001712083 174
643 3300005329 Ga0070683_100414698 Ga0070683_1004146982 174
644 3300005336 Ga0070680_100134858 Ga0070680_1001348583 174
645 3300005336 Ga0070680_100193212 Ga0070680_1001932123 174
646 3300005336 Ga0070680_100361640 Ga0070680_1003616403 174
647 3300005337 Ga0070682_100005710 Ga0070682_1000057106 174
648 3300005337 Ga0070682_100220158 Ga0070682_1002201582 174
649 3300005339 Ga0070660_100213139 Ga0070660_1002131392 174
650 3300005341 Ga0070691_10035321 Ga0070691_100353215 174
651 3300005341 Ga0070691_10069454 Ga0070691_100694542 174
652 3300005341 Ga0070691_10070502 Ga0070691_100705023 174
653 3300005344 Ga0070661_100035059 Ga0070661_1000350593 174
654 3300005344 Ga0070661_100308916 Ga0070661_1003089163 174
655 3300005344 Ga0070661_100383406 Ga0070661_1003834061 174
656 3300005345 Ga0070692_10097842 Ga0070692_100978423 174
657 3300005345 Ga0070692_10121246 Ga0070692_101212463 174
658 3300005345 Ga0070692_10187900 Ga0070692_101879003 174
659 3300005366 Ga0070659_100158561 Ga0070659_1001585612 174
660 3300005366 Ga0070659_100233463 Ga0070659_1002334632 174
661 3300005366 Ga0070659_100376913 Ga0070659_1003769131 174
662 3300005366 Ga0070659_100656636 Ga0070659_1006566362 174
663 3300005457 Ga0070662_100346748 Ga0070662_1003467482 174
664 3300005458 Ga0070681_10428714 Ga0070681_104287142 174
665 3300005458 Ga0070681_10447670 Ga0070681_104476702 174
666 3300005530 Ga0070679_100046691 Ga0070679_1000466915 174
667 3300005530 Ga0070679_100424735 Ga0070679_1004247351 174
668 3300005530 Ga0070679_100448761 Ga0070679_1004487613 174
669 3300005530 Ga0070679_100576876 Ga0070679_1005768761 174
670 3300005535 Ga0070684_100332896 Ga0070684_1003328963 174
671 3300005535 Ga0070684_100419938 Ga0070684_1004199382 174
672 3300005539 Ga0068853_100110968 Ga0068853_1001109682 174
673 3300005539 Ga0068853_100267160 Ga0068853_1002671603 174
674 3300005539 Ga0068853_100560009 Ga0068853_1005600092 174
675 3300005539 Ga0068853_101341539 Ga0068853_1013415392 174
676 3300005546 Ga0070696_100006375 Ga0070696_1000063758 174
677 3300005546 Ga0070696_101373913 Ga0070696_1013739131 174
678 3300005547 Ga0070693_100010949 Ga0070693_1000109493 174
679 3300005564 Ga0070664_100070218 Ga0070664_1000702186 174
680 3300005578 Ga0068854_100047152 Ga0068854_1000471521 174
681 3300005578 Ga0068854_100696532 Ga0068854_1006965322 174
682 3300005614 Ga0068856_100090766 Ga0068856_1000907661 174
683 3300005614 Ga0068856_100182072 Ga0068856_1001820721 174
684 3300005614 Ga0068856_100657568 Ga0068856_1006575682 174
685 3300005616 Ga0068852_100020534 Ga0068852_10002053410 174
686 3300005616 Ga0068852_100039943 Ga0068852_1000399439 174
687 3300005616 Ga0068852_101538692 Ga0068852_1015386922 174
688 3300005834 Ga0068851_10015238 Ga0068851_100152386 174
689 3300005834 Ga0068851_10371974 Ga0068851_103719741 174
690 3300009093 Ga0105240_10060137 Ga0105240_100601374 174
691 3300009093 Ga0105240_10391090 Ga0105240_103910903 174
692 3300009093 Ga0105240_10582943 Ga0105240_105829431 174
693 3300009174 Ga0105241_10112994 Ga0105241_101129942 174
694 3300009174 Ga0105241_10448524 Ga0105241_104485242 174
695 3300009545 Ga0105237_10365407 Ga0105237_103654072 174
696 3300009545 Ga0105237_10441781 Ga0105237_104417812 174
697 3300009551 Ga0105238_10042550 Ga0105238_100425506 174
698 3300013100 Ga0157373_10025259 Ga0157373_100252598 174
699 3300013102 Ga0157371_10122492 Ga0157371_101224922 174
700 3300013102 Ga0157371_10249901 Ga0157371_102499013 174
701 3300013102 Ga0157371_10393985 Ga0157371_103939852 174
702 3300013102 Ga0157371_10525154 Ga0157371_105251541 174
703 3300013102 Ga0157371_10620889 Ga0157371_106208892 174
704 3300013104 Ga0157370_10060742 Ga0157370_100607425 174
705 3300013104 Ga0157370_10431838 Ga0157370_104318383 174
706 3300013105 Ga0157369_10025057 Ga0157369_100250579 174
707 3300013105 Ga0157369_10163977 Ga0157369_101639773 174
708 3300013105 Ga0157369_10719878 Ga0157369_107198782 174
709 3300013105 Ga0157369_11711022 Ga0157369_117110221 174
710 3300013307 Ga0157372_10073028 Ga0157372_100730282 174
711 3300013307 Ga0157372_10121630 Ga0157372_101216305 174
712 3300013307 Ga0157372_10434420 Ga0157372_104344203 174
713 3300013307 Ga0157372_10748996 Ga0157372_107489962 174
714 3300020069 Ga0197907_10443089 Ga0197907_104430896 174
715 3300020070 Ga0206356_10645239 Ga0206356_106452393 174
716 3300020070 Ga0206356_11779262 Ga0206356_117792626 174
717 3300020077 Ga0206351_10126906 Ga0206351_101269062 174
718 3300020078 Ga0206352_11092907 Ga0206352_1109290717 174
719 3300020080 Ga0206350_10904125 Ga0206350_109041253 174
720 3300020081 Ga0206354_10159778 Ga0206354_1015977813 174
721 3300020081 Ga0206354_10693867 Ga0206354_106938672 174
722 3300020081 Ga0206354_10843824 Ga0206354_108438248 174
723 3300020082 Ga0206353_10129542 Ga0206353_101295426 174
724 3300020082 Ga0206353_10595977 Ga0206353_105959772 174
725 3300020082 Ga0206353_10961318 Ga0206353_109613181 174
726 3300020610 Ga0154015_1153700 Ga0154015_11537005 174
727 3300020610 Ga0154015_1332456 Ga0154015_13324563 174
728 3300022467 Ga0224712_10053363 Ga0224712_100533633 174
729 3300022467 Ga0224712_10525145 Ga0224712_105251451 174
730 3300025321 Ga0207656_10009267 Ga0207656_100092674 174
731 3300025321 Ga0207656_10388191 Ga0207656_103881911 174
732 3300025904 Ga0207647_10036662 Ga0207647_100366626 174
733 3300025904 Ga0207647_10266696 Ga0207647_102666961 174
734 3300025904 Ga0207647_10266916 Ga0207647_102669162 174
735 3300025909 Ga0207705_10004273 Ga0207705_1000427318 174
736 3300025909 Ga0207705_10006472 Ga0207705_100064729 174
737 3300025909 Ga0207705_10011179 Ga0207705_100111792 174
738 3300025909 Ga0207705_10013911 Ga0207705_100139111 174
739 3300025911 Ga0207654_10910828 Ga0207654_109108281 174
740 3300025912 Ga0207707_10000210 Ga0207707_1000021018 174
741 3300025912 Ga0207707_10001339 Ga0207707_1000133918 174
742 3300025912 Ga0207707_10010320 Ga0207707_100103206 174
743 3300025912 Ga0207707_10366855 Ga0207707_103668553 174
744 3300025913 Ga0207695_10006299 Ga0207695_1000629918 174
745 3300025913 Ga0207695_10022941 Ga0207695_100229413 174
746 3300025913 Ga0207695_10044284 Ga0207695_100442848 174
747 3300025913 Ga0207695_10044738 Ga0207695_100447388 174
748 3300025917 Ga0207660_10000360 Ga0207660_1000036031 174
749 3300025917 Ga0207660_10005835 Ga0207660_1000583512 174
750 3300025917 Ga0207660_10009553 Ga0207660_100095536 174
751 3300025917 Ga0207660_10041771 Ga0207660_100417711 174
752 3300025917 Ga0207660_10093040 Ga0207660_100930404 174
753 3300025919 Ga0207657_10057043 Ga0207657_100570432 174
754 3300025919 Ga0207657_10475918 Ga0207657_104759181 174
755 3300025919 Ga0207657_11036117 Ga0207657_110361171 174
756 3300025920 Ga0207649_10002213 Ga0207649_1000221318 174
757 3300025920 Ga0207649_10030130 Ga0207649_100301305 174
758 3300025920 Ga0207649_10155028 Ga0207649_101550283 174
759 3300025920 Ga0207649_10291796 Ga0207649_102917963 174
760 3300025921 Ga0207652_10004193 Ga0207652_1000419310 174
761 3300025921 Ga0207652_10005745 Ga0207652_1000574514 174
762 3300025921 Ga0207652_10013571 Ga0207652_100135716 174
763 3300025921 Ga0207652_10149440 Ga0207652_101494404 174
764 3300025921 Ga0207652_10585895 Ga0207652_105858952 174
765 3300025924 Ga0207694_10025532 Ga0207694_100255329 174
766 3300025932 Ga0207690_10003289 Ga0207690_1000328918 174
767 3300025932 Ga0207690_10005316 Ga0207690_100053163 174
768 3300025932 Ga0207690_10078622 Ga0207690_100786225 174
769 3300025933 Ga0207706_10019518 Ga0207706_1001951810 174
770 3300025944 Ga0207661_10004252 Ga0207661_1000425218 174
771 3300025944 Ga0207661_10015870 Ga0207661_100158708 174
772 3300025944 Ga0207661_10058289 Ga0207661_100582891 174
773 3300025944 Ga0207661_10139755 Ga0207661_101397552 174
774 3300025944 Ga0207661_10779862 Ga0207661_107798622 174
775 3300025945 Ga0207679_10007471 Ga0207679_1000747110 174
776 3300025945 Ga0207679_10027652 Ga0207679_100276522 174
777 3300025949 Ga0207667_10008758 Ga0207667_100087588 174
778 3300025949 Ga0207667_10009904 Ga0207667_100099047 174
779 3300025949 Ga0207667_10010803 Ga0207667_1001080318 174
780 3300025949 Ga0207667_10135136 Ga0207667_101351363 174
781 3300025981 Ga0207640_10002025 Ga0207640_100020256 174
782 3300025981 Ga0207640_10003985 Ga0207640_1000398512 174
783 3300025981 Ga0207640_10004259 Ga0207640_100042599 174
784 3300025981 Ga0207640_10103079 Ga0207640_101030793 174
785 3300026041 Ga0207639_10000231 Ga0207639_1000023122 174
786 3300026041 Ga0207639_10008268 Ga0207639_100082686 174
787 3300026041 Ga0207639_10018424 Ga0207639_100184245 174
788 3300026067 Ga0207678_10018442 Ga0207678_100184426 174
789 3300026067 Ga0207678_10056807 Ga0207678_100568072 174
790 3300026067 Ga0207678_10584235 Ga0207678_105842352 174
791 3300026067 Ga0207678_11355407 Ga0207678_113554071 174
792 3300026078 Ga0207702_10006690 Ga0207702_100066901 174
793 3300026078 Ga0207702_10078446 Ga0207702_100784466 174
794 3300026078 Ga0207702_10106909 Ga0207702_101069095 174
795 3300026116 Ga0207674_10301678 Ga0207674_103016781 174
796 3300026142 Ga0207698_10003169 Ga0207698_100031699 174
797 3300026142 Ga0207698_10053564 Ga0207698_100535646 174
798 3300026142 Ga0207698_10300931 Ga0207698_103009312 174
799 3300036647 Ga0316582_0075143 Ga0316582_0075143_37_570 174
800 3300037312 Ga0395899_0182864 Ga0395899_0182864_559_1083 174
801 3300037418 Ga0395900_0015556 Ga0395900_0015556_6402_6926 174
802 3300037418 Ga0395900_0153997 Ga0395900_0153997_71_595 174
803 3300037466 Ga0395898_0034826 Ga0395898_0034826_3469_3993 174
804 3300037466 Ga0395898_0118682 Ga0395898_0118682_475_999 174
805 3300038443 Ga0395901_0020479 Ga0395901_0020479_3469_3993 174
806 3300038443 Ga0395901_0966513 Ga0395901_0966513_244_768 174
807 3300049570 Ga0501033_0669759 Ga0501033_0669759_172_696 174
808 3300049571 Ga0501034_0368469 Ga0501034_0368469_554_1078 174
809 3300049573 Ga0501037_0009833 Ga0501037_0009833_5256_5780 174
810 3300049573 Ga0501037_0179035 Ga0501037_0179035_271_795 174
811 3300049581 Ga0501047_0013042 Ga0501047_0013042_3087_3611 174
812 3300049581 Ga0501047_0225379 Ga0501047_0225379_295_819 174
813 3300049585 Ga0501069_0009337 Ga0501069_0009337_25_549 174
814 3300049586 Ga0501070_0006574 Ga0501070_0006574_7415_7939 174
815 3300049586 Ga0501070_0008005 Ga0501070_0008005_1059_1583 174
816 3300049586 Ga0501070_0011369 Ga0501070_0011369_5269_5793 174
817 3300049586 Ga0501070_0053065 Ga0501070_0053065_153_677 174
818 3300049586 Ga0501070_0085817 Ga0501070_0085817_1745_2269 174
819 3300049586 Ga0501070_0173000 Ga0501070_0173000_192_716 174
820 3300049586 Ga0501070_0753105 Ga0501070_0753105_42_566 174
821 3300049586 Ga0501070_1098754 Ga0501070_1098754_14_538 174
822 3300049587 Ga0501071_0004109 Ga0501071_0004109_5744_6268 174
823 3300049587 Ga0501071_0263177 Ga0501071_0263177_16_540 174
824 3300049589 Ga0501073_0001831 Ga0501073_0001831_7968_8492 174
825 3300049589 Ga0501073_0147856 Ga0501073_0147856_429_953 174
826 3300049590 Ga0501074_0000980 Ga0501074_0000980_10802_11326 174
827 3300049590 Ga0501074_0029541 Ga0501074_0029541_740_1264 174
828 3300049590 Ga0501074_0933708 Ga0501074_0933708_27_551 174
829 3300049593 Ga0501077_0156314 Ga0501077_0156314_171_695 174
830 3300049593 Ga0501077_0282312 Ga0501077_0282312_474_998 174
831 3300049741 Ga0501079_0279849 Ga0501079_0279849_132_656 174
832 3300049742 Ga0501080_0002282 Ga0501080_0002282_7484_8008 174
833 3300049742 Ga0501080_0046155 Ga0501080_0046155_1717_2241 174
834 3300049822 Ga0501035_0189691 Ga0501035_0189691_317_841 174
835 3300049822 Ga0501035_0243400 Ga0501035_0243400_785_1309 174
836 3300049823 Ga0501044_0006317 Ga0501044_0006317_1170_1694 174
837 3300049823 Ga0501044_0145476 Ga0501044_0145476_624_1148 174

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00347

Ribosomal_L6

Ribosomal protein L6

105

180

0.99

PF00347

Ribosomal_L6

Ribosomal protein L6

26

97

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
8fn2-assembly1.cif.gz_H the structure of a 50s ribosomal subunit in the lyme disease pathogen borreliella burgdorferi 0.9671 1 169
5x8t-assembly1.cif.gz_G structure of the 50s large subunit of chloroplast ribosome from spinach 0.9624 3 171
6v3b-assembly1.cif.gz_G cryo-em structure of the acinetobacter baumannii ribosome: 70s in empty state 0.9616 2 171
8cvm-assembly1.cif.gz_g cutibacterium acnes 50s ribosomal subunit with p-site trna and sarecycline bound in the local refined map 0.9564 2 174
3j9w-assembly1.cif.gz_BH cryo-em structure of the bacillus subtilis mifm-stalled ribosome complex 0.956 2 171
ID Description Score Start End Superfamily
af_Q09865_118_210_3.90.930.12 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9802 80 171 3.90.930.12
af_O21037_77_170_3.90.930.12 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9785 80 171 3.90.930.12
af_Q6AU10_7_103_3.90.930.12 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9699 82 174 3.90.930.12
af_Q09865_118_210_3.90.930.12 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9597 80 171 3.90.930.12
3knmH02 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9596 80 165 3.90.930.12
ID Description Score Start End GO Terms
AF-A0A2J1D431-F1-model_v4 deleted 0.9924 70 165
AF-X1G5X1-F1-model_v4 Large ribosomal subunit protein uL6 alpha-beta domain-containing protein 0.9916 79 151 GO:0002181
GO:0003735
GO:0019843
GO:0022625
AF-A0A2V5P1Y2-F1-model_v4 50S ribosomal protein L6 0.9911 78 171 GO:0002181
GO:0003735
GO:0019843
GO:0022625
AF-A0A358FVP3-F1-model_v4 50S ribosomal protein L6 0.9902 78 158 GO:0002181
GO:0003735
GO:0019843
GO:0022625
AF-A0A527GEM6-F1-model_v4 50S ribosomal protein L6 0.9895 83 157 GO:0002181
GO:0003735
GO:0019843
GO:0022625

Feature Viewer

pLDDT pTM Quality
84.01 0.74 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map