F482958
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 837 | 341 | 830 | 173 |
Family's Representative Sequence
| Representative Sequence | 3300049522|Ga0501299_100846|Ga0501299_100846_81_659 |
| Length | 192 |
| Sequence | MALAAKFSASSRERAMSRIAKYPVPVPKGVEVNLAGGSIAVKGPLGAIARPADPNVGVQKEGENIVFKALGNSNHANAMSGTMRALVAGMVTGVTKGFEKRLALVGVGFRAQAQGDKLSLALGYSHPVVHQMPKGIKVATPTQTEIVISGVDKQLVGQVAAEVRAYRPPEPYKGKGVRYRDEVIVLKETKKK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2547132130 | Stenotrophomonas maltophilia RR-10 | Isolate | Unclassified |
| 2 | 2747842428 | Stenotrophomonas sp. WCS2014-113 | Isolate | Unclassified |
| 3 | 2765235840 | Stenotrophomonas maltophilia AA1 | Isolate | Unclassified |
| 4 | 2816332141 | Stenotrophomonas muris 1190 (v2) (version 2) | Isolate | Unclassified |
| 5 | 2842391507 | Stenotrophomonas maltophilia SEMIA 4027 | Isolate | Nodule |
| 6 | 2919134579 | Stenotrophomonas geniculata 1733 | Isolate | Rhizosphere |
| 7 | 2961064222 | Stenotrophomonas maltophilia EP13 | Isolate | Unclassified |
| 8 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 9 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 10 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 11 | 3300002863 | Avena fatua rhizosphere microbial communities - H2_Bulk_Litter_12 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 12 | 3300002868 | Avena fatua rhizosphere microbial communities - H2_Bulk_Litter_10 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 13 | 3300002870 | Avena fatua rhizosphere microbial communities - H1_Bulk_Litter_6 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 14 | 3300002872 | Avena fatua rhizosphere microbial communities - H1_Bulk_Litter_5 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 15 | 3300003163 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 16 | 3300003300 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 17 | 3300003305 | Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 18 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 19 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 20 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 21 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 22 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 23 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 24 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 29 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 32 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 44 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 55 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 57 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 59 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 65 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 67 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 68 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 69 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 71 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 72 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 73 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 74 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 75 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 76 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 77 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 78 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 79 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 80 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 81 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 83 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 84 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 85 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 86 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 87 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 89 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 90 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 116 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 117 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 118 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 119 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 120 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 121 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 122 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 123 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 124 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 125 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 191 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 194 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 195 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 196 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 197 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 198 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 199 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 200 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 201 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 202 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 203 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 204 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 205 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 206 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 207 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 208 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 209 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 210 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 211 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 212 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 213 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 214 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 215 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 216 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 217 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 218 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 219 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 220 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 221 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 222 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 223 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 224 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 225 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 226 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 227 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 228 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 229 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 230 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 231 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 232 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 233 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 234 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 235 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 236 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 237 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 238 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 239 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 240 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 241 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 242 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 243 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 244 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 245 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 246 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 247 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 248 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 249 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 250 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 251 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 252 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 253 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 254 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 255 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 256 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 284 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 285 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 286 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 287 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 288 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 289 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 290 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 291 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 292 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 293 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 294 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 295 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 298 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 319 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 322 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 327 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 328 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 330 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 331 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 333 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 334 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 335 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 336 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 339 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 340 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.58 |
| Metatranscriptomes | 3.58 |
| Isolates | 0.84 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.48 |
| Nodule | 0.12 |
| Rhizoplane | 2.99 |
| Rhizosphere | 95.1 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.31 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1001432 | 3300001904 | Bacteria | 4372 |
| 2 | JGI24741J21665_1002594 | 3300001915 | Bacteria | 4630 |
| 3 | JGI24741J21665_1003527 | 3300001915 | Bacteria | 3707 |
| 4 | JGI24741J21665_1005405 | 3300001915 | Bacteria | 2678 |
| 5 | JGI24740J21852_10000021 | 3300001979 | Bacteria | 53145 |
| 6 | JGI24740J21852_10035979 | 3300001979 | Bacteria | 1542 |
| 7 | Ga0006769J43182_106839 | 3300002863 | Bacteria | 957 |
| 8 | Ga0006767J43181_103125 | 3300002868 | Bacteria | 8971 |
| 9 | Ga0006763J43179_104103 | 3300002870 | Bacteria | 8906 |
| 10 | Ga0006762J43184_103419 | 3300002872 | Bacteria | 7285 |
| 11 | Ga0006759J45824_1006649 | 3300003163 | Bacteria | 16605 |
| 12 | Ga0006758J48902_1009034 | 3300003300 | Bacteria | 9061 |
| 13 | Ga0006770J48903_1038246 | 3300003305 | Bacteria | 2122 |
| 14 | rootH1_10188922 | 3300003323 | Bacteria | 2269 |
| 15 | Ga0032354_1009872 | 3300003693 | Bacteria | 14763 |
| 16 | Ga0055536_1017591 | 3300003781 | Bacteria | 2331 |
| 17 | Ga0058692_1000785 | 3300003856 | Bacteria | 12735 |
| 18 | Ga0058863_11635206 | 3300004799 | Bacteria | 797 |
| 19 | Ga0058862_10077182 | 3300004803 | Bacteria | 1541 |
| 20 | Ga0058862_12882013 | 3300004803 | Bacteria | 1687 |
| 21 | Ga0070658_10030484 | 3300005327 | Bacteria | 4333 |
| 22 | Ga0070658_10235420 | 3300005327 | Bacteria | 1551 |
| 23 | Ga0070676_10018293 | 3300005328 | Bacteria | 3881 |
| 24 | Ga0070683_100004175 | 3300005329 | Bacteria | 11835 |
| 25 | Ga0070683_100171208 | 3300005329 | Bacteria | 2061 |
| 26 | Ga0070683_100414698 | 3300005329 | Bacteria | 1284 |
| 27 | Ga0070690_100006945 | 3300005330 | Bacteria | 6443 |
| 28 | Ga0070690_100030946 | 3300005330 | Bacteria | 3331 |
| 29 | Ga0070690_100147431 | 3300005330 | Bacteria | 1602 |
| 30 | Ga0068869_100175044 | 3300005334 | Bacteria | 1679 |
| 31 | Ga0068869_100731884 | 3300005334 | Bacteria | 846 |
| 32 | Ga0070680_100038408 | 3300005336 | Bacteria | 3872 |
| 33 | Ga0070680_100134858 | 3300005336 | Bacteria | 2067 |
| 34 | Ga0070680_100193212 | 3300005336 | Bacteria | 1715 |
| 35 | Ga0070680_100246153 | 3300005336 | Bacteria | 1511 |
| 36 | Ga0070680_100361640 | 3300005336 | Bacteria | 1234 |
| 37 | Ga0070682_100004587 | 3300005337 | Bacteria | 7681 |
| 38 | Ga0070682_100005710 | 3300005337 | Bacteria | 6936 |
| 39 | Ga0070682_100220158 | 3300005337 | Bacteria | 1350 |
| 40 | Ga0070682_100458803 | 3300005337 | Bacteria | 978 |
| 41 | Ga0070682_100788564 | 3300005337 | Bacteria | 771 |
| 42 | Ga0068868_100141043 | 3300005338 | Bacteria | 1978 |
| 43 | Ga0068868_100203129 | 3300005338 | Bacteria | 1653 |
| 44 | Ga0070660_100213139 | 3300005339 | Bacteria | 1568 |
| 45 | Ga0070660_100422572 | 3300005339 | Bacteria | 1104 |
| 46 | Ga0070689_100061460 | 3300005340 | Bacteria | 2922 |
| 47 | Ga0070689_100122321 | 3300005340 | Bacteria | 2079 |
| 48 | Ga0070689_100148496 | 3300005340 | Bacteria | 1889 |
| 49 | Ga0070689_100181334 | 3300005340 | Bacteria | 1710 |
| 50 | Ga0070691_10035321 | 3300005341 | Bacteria | 2353 |
| 51 | Ga0070691_10069454 | 3300005341 | Bacteria | 1707 |
| 52 | Ga0070691_10070502 | 3300005341 | Bacteria | 1695 |
| 53 | Ga0070687_100030365 | 3300005343 | Bacteria | 2641 |
| 54 | Ga0070687_100102888 | 3300005343 | Bacteria | 1602 |
| 55 | Ga0070687_100158248 | 3300005343 | Bacteria | 1336 |
| 56 | Ga0070661_100035059 | 3300005344 | Bacteria | 3642 |
| 57 | Ga0070661_100308916 | 3300005344 | Bacteria | 1232 |
| 58 | Ga0070661_100383406 | 3300005344 | Bacteria | 1108 |
| 59 | Ga0070692_10097842 | 3300005345 | Bacteria | 1604 |
| 60 | Ga0070692_10121246 | 3300005345 | Bacteria | 1458 |
| 61 | Ga0070692_10187900 | 3300005345 | Bacteria | 1201 |
| 62 | Ga0070692_10266435 | 3300005345 | Bacteria | 1032 |
| 63 | Ga0070668_100028739 | 3300005347 | Bacteria | 4219 |
| 64 | Ga0070668_100056723 | 3300005347 | Bacteria | 3026 |
| 65 | Ga0070669_100008256 | 3300005353 | Bacteria | 7434 |
| 66 | Ga0070675_100049635 | 3300005354 | Bacteria | 3445 |
| 67 | Ga0070675_100244545 | 3300005354 | Bacteria | 1568 |
| 68 | Ga0070674_100007457 | 3300005356 | Bacteria | 6453 |
| 69 | Ga0070674_100145445 | 3300005356 | Bacteria | 1784 |
| 70 | Ga0070674_100483983 | 3300005356 | Bacteria | 1028 |
| 71 | Ga0070673_100133910 | 3300005364 | Bacteria | 2083 |
| 72 | Ga0070673_100172506 | 3300005364 | Bacteria | 1847 |
| 73 | Ga0070673_100229659 | 3300005364 | Bacteria | 1609 |
| 74 | Ga0070673_100238981 | 3300005364 | Bacteria | 1579 |
| 75 | Ga0070673_100270803 | 3300005364 | Bacteria | 1486 |
| 76 | Ga0070673_100289316 | 3300005364 | Bacteria | 1439 |
| 77 | Ga0070688_100050485 | 3300005365 | Bacteria | 2591 |
| 78 | Ga0070688_100055298 | 3300005365 | Bacteria | 2489 |
| 79 | Ga0070688_100077192 | 3300005365 | Bacteria | 2145 |
| 80 | Ga0070688_100084618 | 3300005365 | Bacteria | 2060 |
| 81 | Ga0070688_100195933 | 3300005365 | Bacteria | 1410 |
| 82 | Ga0070659_100010672 | 3300005366 | Bacteria | 6766 |
| 83 | Ga0070659_100158561 | 3300005366 | Bacteria | 1849 |
| 84 | Ga0070659_100233463 | 3300005366 | Bacteria | 1520 |
| 85 | Ga0070659_100376913 | 3300005366 | Bacteria | 1194 |
| 86 | Ga0070659_100656636 | 3300005366 | Bacteria | 904 |
| 87 | Ga0070667_101162910 | 3300005367 | Bacteria | 722 |
| 88 | Ga0070701_10351515 | 3300005438 | Bacteria | 921 |
| 89 | Ga0070701_10395258 | 3300005438 | Bacteria | 875 |
| 90 | Ga0070705_100046738 | 3300005440 | Bacteria | 2498 |
| 91 | Ga0070700_100008581 | 3300005441 | Bacteria | 5568 |
| 92 | Ga0070700_100042432 | 3300005441 | Bacteria | 2793 |
| 93 | Ga0070708_100536975 | 3300005445 | Bacteria | 1103 |
| 94 | Ga0070663_100054376 | 3300005455 | Bacteria | 2861 |
| 95 | Ga0070678_100050282 | 3300005456 | Bacteria | 3014 |
| 96 | Ga0070662_100346748 | 3300005457 | Bacteria | 1216 |
| 97 | Ga0070681_10046978 | 3300005458 | Bacteria | 4316 |
| 98 | Ga0070681_10133625 | 3300005458 | Bacteria | 2412 |
| 99 | Ga0070681_10138345 | 3300005458 | Bacteria | 2365 |
| 100 | Ga0070681_10428714 | 3300005458 | Bacteria | 1234 |
| 101 | Ga0070681_10447670 | 3300005458 | Bacteria | 1203 |
| 102 | Ga0068867_100016292 | 3300005459 | Bacteria | 5278 |
| 103 | Ga0068867_100021915 | 3300005459 | Bacteria | 4562 |
| 104 | Ga0070685_10033482 | 3300005466 | Bacteria | 2887 |
| 105 | Ga0070679_100033803 | 3300005530 | Bacteria | 5063 |
| 106 | Ga0070679_100046691 | 3300005530 | Bacteria | 4317 |
| 107 | Ga0070679_100057568 | 3300005530 | Bacteria | 3874 |
| 108 | Ga0070679_100202672 | 3300005530 | Bacteria | 1949 |
| 109 | Ga0070679_100424735 | 3300005530 | Bacteria | 1274 |
| 110 | Ga0070679_100448761 | 3300005530 | Bacteria | 1234 |
| 111 | Ga0070679_100576876 | 3300005530 | Bacteria | 1068 |
| 112 | Ga0070684_100034321 | 3300005535 | Bacteria | 4337 |
| 113 | Ga0070684_100186707 | 3300005535 | Bacteria | 1885 |
| 114 | Ga0070684_100246367 | 3300005535 | Bacteria | 1633 |
| 115 | Ga0070684_100254645 | 3300005535 | Bacteria | 1605 |
| 116 | Ga0070684_100332896 | 3300005535 | Bacteria | 1395 |
| 117 | Ga0070684_100419938 | 3300005535 | Bacteria | 1234 |
| 118 | Ga0070684_100556689 | 3300005535 | Bacteria | 1064 |
| 119 | Ga0068853_100002850 | 3300005539 | Bacteria | 13105 |
| 120 | Ga0068853_100003768 | 3300005539 | Bacteria | 11627 |
| 121 | Ga0068853_100110968 | 3300005539 | Bacteria | 2436 |
| 122 | Ga0068853_100267160 | 3300005539 | Bacteria | 1574 |
| 123 | Ga0068853_100560009 | 3300005539 | Bacteria | 1083 |
| 124 | Ga0068853_101341539 | 3300005539 | Bacteria | 691 |
| 125 | Ga0070672_100064132 | 3300005543 | Bacteria | 2902 |
| 126 | Ga0070672_100064690 | 3300005543 | Bacteria | 2890 |
| 127 | Ga0070672_100204397 | 3300005543 | Bacteria | 1652 |
| 128 | Ga0070672_100450237 | 3300005543 | Bacteria | 1109 |
| 129 | Ga0070686_100006132 | 3300005544 | Bacteria | 6673 |
| 130 | Ga0070686_100008053 | 3300005544 | Bacteria | 5887 |
| 131 | Ga0070686_100350856 | 3300005544 | Bacteria | 1108 |
| 132 | Ga0070696_100006375 | 3300005546 | Bacteria | 7892 |
| 133 | Ga0070696_100050189 | 3300005546 | Bacteria | 2900 |
| 134 | Ga0070696_100848669 | 3300005546 | Bacteria | 755 |
| 135 | Ga0070696_101373913 | 3300005546 | Bacteria | 601 |
| 136 | Ga0070693_100010949 | 3300005547 | Bacteria | 4558 |
| 137 | Ga0070693_100259652 | 3300005547 | Bacteria | 1155 |
| 138 | Ga0070704_100325887 | 3300005549 | Bacteria | 1288 |
| 139 | Ga0068855_100004696 | 3300005563 | Bacteria | 16698 |
| 140 | Ga0068855_100006029 | 3300005563 | Bacteria | 14785 |
| 141 | Ga0068855_100021141 | 3300005563 | Bacteria | 7802 |
| 142 | Ga0068855_100067646 | 3300005563 | Bacteria | 4160 |
| 143 | Ga0068855_100223754 | 3300005563 | Bacteria | 2109 |
| 144 | Ga0070664_100070218 | 3300005564 | Bacteria | 2999 |
| 145 | Ga0068857_100117726 | 3300005577 | Bacteria | 2391 |
| 146 | Ga0068854_100008257 | 3300005578 | Bacteria | 6684 |
| 147 | Ga0068854_100047152 | 3300005578 | Bacteria | 3070 |
| 148 | Ga0068854_100256109 | 3300005578 | Bacteria | 1399 |
| 149 | Ga0068854_100696532 | 3300005578 | Bacteria | 876 |
| 150 | Ga0068856_100078416 | 3300005614 | Bacteria | 3275 |
| 151 | Ga0068856_100084913 | 3300005614 | Bacteria | 3145 |
| 152 | Ga0068856_100090766 | 3300005614 | Bacteria | 3039 |
| 153 | Ga0068856_100182072 | 3300005614 | Bacteria | 2114 |
| 154 | Ga0068856_100238892 | 3300005614 | Bacteria | 1832 |
| 155 | Ga0068856_100657568 | 3300005614 | Bacteria | 1068 |
| 156 | Ga0068856_100700014 | 3300005614 | Bacteria | 1033 |
| 157 | Ga0070702_100141947 | 3300005615 | Bacteria | 1531 |
| 158 | Ga0068852_100020534 | 3300005616 | Bacteria | 5254 |
| 159 | Ga0068852_100039943 | 3300005616 | Bacteria | 3954 |
| 160 | Ga0068852_100171595 | 3300005616 | Bacteria | 2033 |
| 161 | Ga0068852_100675542 | 3300005616 | Bacteria | 1042 |
| 162 | Ga0068852_101538692 | 3300005616 | Bacteria | 687 |
| 163 | Ga0068859_100158427 | 3300005617 | Bacteria | 2342 |
| 164 | Ga0068859_100622992 | 3300005617 | Bacteria | 1172 |
| 165 | Ga0068864_100528194 | 3300005618 | Bacteria | 1138 |
| 166 | Ga0068864_100593828 | 3300005618 | Bacteria | 1074 |
| 167 | Ga0068864_100595292 | 3300005618 | Bacteria | 1073 |
| 168 | Ga0068866_10035746 | 3300005718 | Bacteria | 2429 |
| 169 | Ga0068861_100088764 | 3300005719 | Bacteria | 2435 |
| 170 | Ga0068851_10015238 | 3300005834 | Bacteria | 3660 |
| 171 | Ga0068851_10371974 | 3300005834 | Bacteria | 835 |
| 172 | Ga0068870_10292690 | 3300005840 | Bacteria | 1025 |
| 173 | Ga0068860_100357814 | 3300005843 | Bacteria | 1438 |
| 174 | Ga0068862_100038391 | 3300005844 | Bacteria | 4061 |
| 175 | Ga0068862_100203189 | 3300005844 | Bacteria | 1787 |
| 176 | Ga0068862_101006302 | 3300005844 | Bacteria | 824 |
| 177 | Ga0081538_10106324 | 3300005981 | Bacteria | 1393 |
| 178 | Ga0081539_10051462 | 3300005985 | Bacteria | 2320 |
| 179 | Ga0097621_100001348 | 3300006237 | Bacteria | 16895 |
| 180 | Ga0068871_100000763 | 3300006358 | Bacteria | 21687 |
| 181 | Ga0068871_100256492 | 3300006358 | Bacteria | 1524 |
| 182 | Ga0075428_100022001 | 3300006844 | Bacteria | 7058 |
| 183 | Ga0075428_100249709 | 3300006844 | Bacteria | 1912 |
| 184 | Ga0075428_100538806 | 3300006844 | Bacteria | 1248 |
| 185 | Ga0075428_100861603 | 3300006844 | Bacteria | 962 |
| 186 | Ga0075428_100903512 | 3300006844 | Bacteria | 937 |
| 187 | Ga0075430_100018107 | 3300006846 | Bacteria | 5994 |
| 188 | Ga0075430_100536529 | 3300006846 | Bacteria | 965 |
| 189 | Ga0075431_100033449 | 3300006847 | Bacteria | 5298 |
| 190 | Ga0068865_100218603 | 3300006881 | Bacteria | 1488 |
| 191 | Ga0097620_100158439 | 3300006931 | Bacteria | 2342 |
| 192 | Ga0097620_100623014 | 3300006931 | Bacteria | 1172 |
| 193 | Ga0075435_100114268 | 3300007076 | Bacteria | 2247 |
| 194 | Ga0099794_10043462 | 3300007265 | Bacteria | 2145 |
| 195 | Ga0105240_10060137 | 3300009093 | Bacteria | 4737 |
| 196 | Ga0105240_10212412 | 3300009093 | Bacteria | 2260 |
| 197 | Ga0105240_10391090 | 3300009093 | Bacteria | 1568 |
| 198 | Ga0105240_10582943 | 3300009093 | Bacteria | 1234 |
| 199 | Ga0111539_10058961 | 3300009094 | Bacteria | 4554 |
| 200 | Ga0111539_10214617 | 3300009094 | Bacteria | 2242 |
| 201 | Ga0111539_10432969 | 3300009094 | Bacteria | 1532 |
| 202 | Ga0111539_10640704 | 3300009094 | Bacteria | 1237 |
| 203 | Ga0114129_10126592 | 3300009147 | Bacteria | 3512 |
| 204 | Ga0114129_10144198 | 3300009147 | Bacteria | 3263 |
| 205 | Ga0114129_10513346 | 3300009147 | Bacteria | 1563 |
| 206 | Ga0114129_11191028 | 3300009147 | Bacteria | 949 |
| 207 | Ga0114129_11259091 | 3300009147 | Bacteria | 919 |
| 208 | Ga0105243_10010767 | 3300009148 | Bacteria | 6922 |
| 209 | Ga0105243_10214065 | 3300009148 | Bacteria | 1698 |
| 210 | Ga0105243_10917973 | 3300009148 | Bacteria | 872 |
| 211 | Ga0105241_10112994 | 3300009174 | Bacteria | 2177 |
| 212 | Ga0105241_10435095 | 3300009174 | Bacteria | 1157 |
| 213 | Ga0105241_10448524 | 3300009174 | Bacteria | 1141 |
| 214 | Ga0105242_10218702 | 3300009176 | Bacteria | 1701 |
| 215 | Ga0105248_10057742 | 3300009177 | Bacteria | 4356 |
| 216 | Ga0105248_10745197 | 3300009177 | Bacteria | 1105 |
| 217 | Ga0105248_10746019 | 3300009177 | Bacteria | 1105 |
| 218 | Ga0105237_10002220 | 3300009545 | Bacteria | 24289 |
| 219 | Ga0105237_10365407 | 3300009545 | Bacteria | 1447 |
| 220 | Ga0105237_10441781 | 3300009545 | Bacteria | 1307 |
| 221 | Ga0105237_10885161 | 3300009545 | Bacteria | 900 |
| 222 | Ga0105238_10022051 | 3300009551 | Bacteria | 6491 |
| 223 | Ga0105238_10037314 | 3300009551 | Bacteria | 4940 |
| 224 | Ga0105238_10042550 | 3300009551 | Bacteria | 4599 |
| 225 | Ga0105249_10010299 | 3300009553 | Bacteria | 8213 |
| 226 | Ga0105249_10246729 | 3300009553 | Bacteria | 1768 |
| 227 | Ga0105239_10413902 | 3300010375 | Bacteria | 1526 |
| 228 | Ga0105239_11217999 | 3300010375 | Bacteria | 868 |
| 229 | Ga0105239_11300654 | 3300010375 | Bacteria | 839 |
| 230 | Ga0105246_11242083 | 3300011119 | Bacteria | 688 |
| 231 | Ga0157373_10025259 | 3300013100 | Bacteria | 4299 |
| 232 | Ga0157373_10104415 | 3300013100 | Bacteria | 1993 |
| 233 | Ga0157373_10124104 | 3300013100 | Bacteria | 1816 |
| 234 | Ga0157371_10011870 | 3300013102 | Bacteria | 6686 |
| 235 | Ga0157371_10122492 | 3300013102 | Bacteria | 1849 |
| 236 | Ga0157371_10249901 | 3300013102 | Bacteria | 1277 |
| 237 | Ga0157371_10393985 | 3300013102 | Bacteria | 1013 |
| 238 | Ga0157371_10525154 | 3300013102 | Bacteria | 876 |
| 239 | Ga0157371_10620889 | 3300013102 | Bacteria | 805 |
| 240 | Ga0157370_10060742 | 3300013104 | Bacteria | 3587 |
| 241 | Ga0157370_10125442 | 3300013104 | Bacteria | 2396 |
| 242 | Ga0157370_10233935 | 3300013104 | Bacteria | 1700 |
| 243 | Ga0157370_10299241 | 3300013104 | Bacteria | 1485 |
| 244 | Ga0157370_10431838 | 3300013104 | Bacteria | 1211 |
| 245 | Ga0157369_10025057 | 3300013105 | Bacteria | 6626 |
| 246 | Ga0157369_10163977 | 3300013105 | Bacteria | 2344 |
| 247 | Ga0157369_10245732 | 3300013105 | Bacteria | 1868 |
| 248 | Ga0157369_10719878 | 3300013105 | Bacteria | 1027 |
| 249 | Ga0157369_11711022 | 3300013105 | Bacteria | 639 |
| 250 | Ga0157374_10039567 | 3300013296 | Bacteria | 4339 |
| 251 | Ga0157374_10079651 | 3300013296 | Bacteria | 3105 |
| 252 | Ga0157378_10352400 | 3300013297 | Bacteria | 1438 |
| 253 | Ga0157378_11670393 | 3300013297 | Bacteria | 683 |
| 254 | Ga0163162_10118214 | 3300013306 | Bacteria | 2752 |
| 255 | Ga0163162_10566535 | 3300013306 | Bacteria | 1263 |
| 256 | Ga0157372_10022741 | 3300013307 | Bacteria | 6786 |
| 257 | Ga0157372_10073028 | 3300013307 | Bacteria | 3866 |
| 258 | Ga0157372_10121630 | 3300013307 | Bacteria | 2999 |
| 259 | Ga0157372_10144665 | 3300013307 | Bacteria | 2741 |
| 260 | Ga0157372_10434420 | 3300013307 | Bacteria | 1530 |
| 261 | Ga0157372_10748996 | 3300013307 | Bacteria | 1136 |
| 262 | Ga0157375_10202649 | 3300013308 | Bacteria | 2140 |
| 263 | Ga0157375_10272772 | 3300013308 | Bacteria | 1854 |
| 264 | Ga0157375_10472260 | 3300013308 | Bacteria | 1419 |
| 265 | Ga0157380_10033551 | 3300014326 | Bacteria | 3953 |
| 266 | Ga0157377_10015531 | 3300014745 | Bacteria | 3898 |
| 267 | Ga0157377_10576000 | 3300014745 | Bacteria | 799 |
| 268 | Ga0157379_10049835 | 3300014968 | Bacteria | 3739 |
| 269 | Ga0157376_10130727 | 3300014969 | Bacteria | 2240 |
| 270 | Ga0197907_10443089 | 3300020069 | Bacteria | 4382 |
| 271 | Ga0206356_10188034 | 3300020070 | Bacteria | 1048 |
| 272 | Ga0206356_10645239 | 3300020070 | Bacteria | 1262 |
| 273 | Ga0206356_11464639 | 3300020070 | Bacteria | 1101 |
| 274 | Ga0206356_11779262 | 3300020070 | Bacteria | 5478 |
| 275 | Ga0206351_10126906 | 3300020077 | Bacteria | 1547 |
| 276 | Ga0206352_11092907 | 3300020078 | Bacteria | 7966 |
| 277 | Ga0206352_11285822 | 3300020078 | Bacteria | 3267 |
| 278 | Ga0206350_10904125 | 3300020080 | Bacteria | 1603 |
| 279 | Ga0206354_10159778 | 3300020081 | Bacteria | 7584 |
| 280 | Ga0206354_10693867 | 3300020081 | Bacteria | 1011 |
| 281 | Ga0206354_10843824 | 3300020081 | Bacteria | 4618 |
| 282 | Ga0206353_10129542 | 3300020082 | Bacteria | 10452 |
| 283 | Ga0206353_10595977 | 3300020082 | Bacteria | 1433 |
| 284 | Ga0206353_10961318 | 3300020082 | Bacteria | 1235 |
| 285 | Ga0154015_1153700 | 3300020610 | Bacteria | 2305 |
| 286 | Ga0154015_1332456 | 3300020610 | Bacteria | 2064 |
| 287 | Ga0213876_10165535 | 3300021384 | Bacteria | 1176 |
| 288 | Ga0224712_10053363 | 3300022467 | Bacteria | 1582 |
| 289 | Ga0224712_10525145 | 3300022467 | Bacteria | 574 |
| 290 | Ga0209676_1004379 | 3300025292 | Bacteria | 7893 |
| 291 | Ga0209050_1017914 | 3300025298 | Bacteria | 2789 |
| 292 | Ga0209257_1024354 | 3300025304 | Bacteria | 2098 |
| 293 | Ga0207697_10069394 | 3300025315 | Bacteria | 1475 |
| 294 | Ga0207656_10009267 | 3300025321 | Bacteria | 3652 |
| 295 | Ga0207656_10388191 | 3300025321 | Bacteria | 701 |
| 296 | Ga0207653_10038952 | 3300025885 | Bacteria | 1554 |
| 297 | Ga0207692_10032528 | 3300025898 | Bacteria | 2508 |
| 298 | Ga0207642_10023568 | 3300025899 | Bacteria | 2461 |
| 299 | Ga0207680_10145936 | 3300025903 | Bacteria | 1573 |
| 300 | Ga0207647_10036662 | 3300025904 | Bacteria | 3114 |
| 301 | Ga0207647_10266696 | 3300025904 | Bacteria | 979 |
| 302 | Ga0207647_10266916 | 3300025904 | Bacteria | 979 |
| 303 | Ga0207647_10379288 | 3300025904 | Bacteria | 798 |
| 304 | Ga0207645_10021058 | 3300025907 | Bacteria | 4257 |
| 305 | Ga0207645_10082768 | 3300025907 | Bacteria | 2057 |
| 306 | Ga0207643_10011769 | 3300025908 | Bacteria | 4722 |
| 307 | Ga0207705_10004273 | 3300025909 | Bacteria | 10819 |
| 308 | Ga0207705_10006472 | 3300025909 | Bacteria | 8676 |
| 309 | Ga0207705_10011179 | 3300025909 | Bacteria | 6507 |
| 310 | Ga0207705_10013911 | 3300025909 | Bacteria | 5802 |
| 311 | Ga0207654_10149686 | 3300025911 | Bacteria | 1497 |
| 312 | Ga0207654_10910828 | 3300025911 | Bacteria | 638 |
| 313 | Ga0207707_10000201 | 3300025912 | Bacteria | 63617 |
| 314 | Ga0207707_10000210 | 3300025912 | Bacteria | 62292 |
| 315 | Ga0207707_10001339 | 3300025912 | Bacteria | 22957 |
| 316 | Ga0207707_10006555 | 3300025912 | Bacteria | 10160 |
| 317 | Ga0207707_10010320 | 3300025912 | Bacteria | 8104 |
| 318 | Ga0207707_10366855 | 3300025912 | Bacteria | 1239 |
| 319 | Ga0207695_10006299 | 3300025913 | Bacteria | 15447 |
| 320 | Ga0207695_10022941 | 3300025913 | Bacteria | 7069 |
| 321 | Ga0207695_10044284 | 3300025913 | Bacteria | 4735 |
| 322 | Ga0207695_10044738 | 3300025913 | Bacteria | 4707 |
| 323 | Ga0207695_10109993 | 3300025913 | Bacteria | 2736 |
| 324 | Ga0207671_10000510 | 3300025914 | Bacteria | 52543 |
| 325 | Ga0207671_10006782 | 3300025914 | Bacteria | 10121 |
| 326 | Ga0207663_10110382 | 3300025916 | Bacteria | 1865 |
| 327 | Ga0207663_10916137 | 3300025916 | Bacteria | 701 |
| 328 | Ga0207660_10000360 | 3300025917 | Bacteria | 29709 |
| 329 | Ga0207660_10005835 | 3300025917 | Bacteria | 7991 |
| 330 | Ga0207660_10009553 | 3300025917 | Bacteria | 6278 |
| 331 | Ga0207660_10041771 | 3300025917 | Bacteria | 3215 |
| 332 | Ga0207660_10093040 | 3300025917 | Bacteria | 2239 |
| 333 | Ga0207660_10215847 | 3300025917 | Bacteria | 1504 |
| 334 | Ga0207660_10281695 | 3300025917 | Bacteria | 1319 |
| 335 | Ga0207660_10717801 | 3300025917 | Bacteria | 815 |
| 336 | Ga0207662_10009139 | 3300025918 | Bacteria | 5448 |
| 337 | Ga0207662_10036126 | 3300025918 | Bacteria | 2887 |
| 338 | Ga0207662_10055422 | 3300025918 | Bacteria | 2366 |
| 339 | Ga0207662_10119311 | 3300025918 | Bacteria | 1653 |
| 340 | Ga0207662_10617621 | 3300025918 | Bacteria | 755 |
| 341 | Ga0207657_10057043 | 3300025919 | Bacteria | 3368 |
| 342 | Ga0207657_10108254 | 3300025919 | Bacteria | 2298 |
| 343 | Ga0207657_10226429 | 3300025919 | Bacteria | 1496 |
| 344 | Ga0207657_10475918 | 3300025919 | Bacteria | 979 |
| 345 | Ga0207657_10533527 | 3300025919 | Bacteria | 918 |
| 346 | Ga0207657_11036117 | 3300025919 | Bacteria | 629 |
| 347 | Ga0207649_10002213 | 3300025920 | Bacteria | 10987 |
| 348 | Ga0207649_10030130 | 3300025920 | Bacteria | 3210 |
| 349 | Ga0207649_10155028 | 3300025920 | Bacteria | 1581 |
| 350 | Ga0207649_10291796 | 3300025920 | Bacteria | 1189 |
| 351 | Ga0207652_10002222 | 3300025921 | Bacteria | 16561 |
| 352 | Ga0207652_10004193 | 3300025921 | Bacteria | 11761 |
| 353 | Ga0207652_10005745 | 3300025921 | Bacteria | 10069 |
| 354 | Ga0207652_10011010 | 3300025921 | Bacteria | 7292 |
| 355 | Ga0207652_10013571 | 3300025921 | Bacteria | 6590 |
| 356 | Ga0207652_10073451 | 3300025921 | Bacteria | 2976 |
| 357 | Ga0207652_10149440 | 3300025921 | Bacteria | 2091 |
| 358 | Ga0207652_10585895 | 3300025921 | Bacteria | 1001 |
| 359 | Ga0207681_10002742 | 3300025923 | Bacteria | 11146 |
| 360 | Ga0207681_10003287 | 3300025923 | Bacteria | 10121 |
| 361 | Ga0207694_10025532 | 3300025924 | Bacteria | 4490 |
| 362 | Ga0207694_10069504 | 3300025924 | Bacteria | 2751 |
| 363 | Ga0207694_10069793 | 3300025924 | Bacteria | 2745 |
| 364 | Ga0207650_10016378 | 3300025925 | Bacteria | 5182 |
| 365 | Ga0207659_10199373 | 3300025926 | Bacteria | 1597 |
| 366 | Ga0207659_10281980 | 3300025926 | Bacteria | 1358 |
| 367 | Ga0207700_10155768 | 3300025928 | Bacteria | 1893 |
| 368 | Ga0207690_10003289 | 3300025932 | Bacteria | 9676 |
| 369 | Ga0207690_10005316 | 3300025932 | Bacteria | 7589 |
| 370 | Ga0207690_10078622 | 3300025932 | Bacteria | 2296 |
| 371 | Ga0207706_10019518 | 3300025933 | Bacteria | 6098 |
| 372 | Ga0207709_10007251 | 3300025935 | Bacteria | 6185 |
| 373 | Ga0207670_10017436 | 3300025936 | Bacteria | 4341 |
| 374 | Ga0207670_10156028 | 3300025936 | Bacteria | 1699 |
| 375 | Ga0207670_10398206 | 3300025936 | Bacteria | 1100 |
| 376 | Ga0207670_10509207 | 3300025936 | Bacteria | 978 |
| 377 | Ga0207669_10266219 | 3300025937 | Bacteria | 1285 |
| 378 | Ga0207704_10003227 | 3300025938 | Bacteria | 7388 |
| 379 | Ga0207704_10003857 | 3300025938 | Bacteria | 6810 |
| 380 | Ga0207691_10028424 | 3300025940 | Bacteria | 5236 |
| 381 | Ga0207691_10230106 | 3300025940 | Bacteria | 1605 |
| 382 | Ga0207691_10351045 | 3300025940 | Bacteria | 1262 |
| 383 | Ga0207711_10129621 | 3300025941 | Bacteria | 2260 |
| 384 | Ga0207689_10375899 | 3300025942 | Bacteria | 1183 |
| 385 | Ga0207689_10449004 | 3300025942 | Bacteria | 1077 |
| 386 | Ga0207661_10004252 | 3300025944 | Bacteria | 10024 |
| 387 | Ga0207661_10007008 | 3300025944 | Bacteria | 7997 |
| 388 | Ga0207661_10015870 | 3300025944 | Bacteria | 5548 |
| 389 | Ga0207661_10057404 | 3300025944 | Bacteria | 3130 |
| 390 | Ga0207661_10058289 | 3300025944 | Bacteria | 3107 |
| 391 | Ga0207661_10070548 | 3300025944 | Bacteria | 2853 |
| 392 | Ga0207661_10139755 | 3300025944 | Bacteria | 2083 |
| 393 | Ga0207661_10151347 | 3300025944 | Bacteria | 2006 |
| 394 | Ga0207661_10779862 | 3300025944 | Bacteria | 880 |
| 395 | Ga0207679_10007471 | 3300025945 | Bacteria | 6936 |
| 396 | Ga0207679_10027652 | 3300025945 | Bacteria | 3925 |
| 397 | Ga0207667_10000358 | 3300025949 | Bacteria | 61982 |
| 398 | Ga0207667_10008758 | 3300025949 | Bacteria | 11990 |
| 399 | Ga0207667_10009904 | 3300025949 | Bacteria | 11181 |
| 400 | Ga0207667_10010803 | 3300025949 | Bacteria | 10649 |
| 401 | Ga0207667_10012000 | 3300025949 | Bacteria | 10029 |
| 402 | Ga0207667_10087997 | 3300025949 | Bacteria | 3212 |
| 403 | Ga0207667_10135136 | 3300025949 | Bacteria | 2539 |
| 404 | Ga0207667_10136064 | 3300025949 | Bacteria | 2530 |
| 405 | Ga0207651_10021221 | 3300025960 | Bacteria | 3941 |
| 406 | Ga0207651_10045826 | 3300025960 | Bacteria | 2935 |
| 407 | Ga0207651_10141959 | 3300025960 | Bacteria | 1856 |
| 408 | Ga0207651_10228346 | 3300025960 | Bacteria | 1509 |
| 409 | Ga0207651_10274524 | 3300025960 | Bacteria | 1390 |
| 410 | Ga0207651_10307280 | 3300025960 | Bacteria | 1321 |
| 411 | Ga0207712_10007287 | 3300025961 | Bacteria | 6976 |
| 412 | Ga0207668_10028961 | 3300025972 | Bacteria | 3626 |
| 413 | Ga0207640_10002025 | 3300025981 | Bacteria | 10946 |
| 414 | Ga0207640_10003985 | 3300025981 | Bacteria | 7977 |
| 415 | Ga0207640_10004259 | 3300025981 | Bacteria | 7741 |
| 416 | Ga0207640_10038078 | 3300025981 | Bacteria | 3032 |
| 417 | Ga0207640_10103079 | 3300025981 | Bacteria | 2005 |
| 418 | Ga0207640_10811543 | 3300025981 | Bacteria | 811 |
| 419 | Ga0207640_10911377 | 3300025981 | Bacteria | 768 |
| 420 | Ga0207658_10219118 | 3300025986 | Bacteria | 1600 |
| 421 | Ga0207658_10895431 | 3300025986 | Bacteria | 808 |
| 422 | Ga0207658_10938842 | 3300025986 | Bacteria | 788 |
| 423 | Ga0207677_10174178 | 3300026023 | Bacteria | 1686 |
| 424 | Ga0207677_10391051 | 3300026023 | Bacteria | 1176 |
| 425 | Ga0207703_10263798 | 3300026035 | Bacteria | 1558 |
| 426 | Ga0207703_10960747 | 3300026035 | Bacteria | 819 |
| 427 | Ga0207639_10000231 | 3300026041 | Bacteria | 41634 |
| 428 | Ga0207639_10005667 | 3300026041 | Bacteria | 8449 |
| 429 | Ga0207639_10008268 | 3300026041 | Bacteria | 7129 |
| 430 | Ga0207639_10018424 | 3300026041 | Bacteria | 4960 |
| 431 | Ga0207639_10064484 | 3300026041 | Bacteria | 2840 |
| 432 | Ga0207639_10595924 | 3300026041 | Bacteria | 1019 |
| 433 | Ga0207678_10018442 | 3300026067 | Bacteria | 6128 |
| 434 | Ga0207678_10033539 | 3300026067 | Bacteria | 4472 |
| 435 | Ga0207678_10056807 | 3300026067 | Bacteria | 3368 |
| 436 | Ga0207678_10584235 | 3300026067 | Bacteria | 979 |
| 437 | Ga0207678_11355407 | 3300026067 | Bacteria | 629 |
| 438 | Ga0207678_11423702 | 3300026067 | Bacteria | 613 |
| 439 | Ga0207708_10057714 | 3300026075 | Bacteria | 2962 |
| 440 | Ga0207702_10006690 | 3300026078 | Bacteria | 9905 |
| 441 | Ga0207702_10078446 | 3300026078 | Bacteria | 2859 |
| 442 | Ga0207702_10100543 | 3300026078 | Bacteria | 2551 |
| 443 | Ga0207702_10106909 | 3300026078 | Bacteria | 2480 |
| 444 | Ga0207702_11198523 | 3300026078 | Bacteria | 753 |
| 445 | Ga0207648_10008885 | 3300026089 | Bacteria | 9673 |
| 446 | Ga0207648_10011154 | 3300026089 | Bacteria | 8479 |
| 447 | Ga0207648_10390627 | 3300026089 | Bacteria | 1259 |
| 448 | Ga0207648_11182781 | 3300026089 | Bacteria | 718 |
| 449 | Ga0207676_10460360 | 3300026095 | Bacteria | 1201 |
| 450 | Ga0207676_10716842 | 3300026095 | Bacteria | 970 |
| 451 | Ga0207676_11361061 | 3300026095 | Bacteria | 705 |
| 452 | Ga0207674_10057822 | 3300026116 | Bacteria | 3931 |
| 453 | Ga0207674_10301678 | 3300026116 | Bacteria | 1551 |
| 454 | Ga0207674_10358305 | 3300026116 | Bacteria | 1410 |
| 455 | Ga0207675_100004342 | 3300026118 | Bacteria | 13698 |
| 456 | Ga0207675_100013850 | 3300026118 | Bacteria | 7520 |
| 457 | Ga0207675_100560357 | 3300026118 | Bacteria | 1143 |
| 458 | Ga0207675_100995031 | 3300026118 | Bacteria | 857 |
| 459 | Ga0207683_10094403 | 3300026121 | Bacteria | 2666 |
| 460 | Ga0207683_10277095 | 3300026121 | Bacteria | 1533 |
| 461 | Ga0207698_10003169 | 3300026142 | Bacteria | 9865 |
| 462 | Ga0207698_10053564 | 3300026142 | Bacteria | 3098 |
| 463 | Ga0207698_10158112 | 3300026142 | Bacteria | 1978 |
| 464 | Ga0207698_10179531 | 3300026142 | Bacteria | 1874 |
| 465 | Ga0207698_10300931 | 3300026142 | Bacteria | 1493 |
| 466 | Ga0209967_1000358 | 3300027364 | Bacteria | 6044 |
| 467 | Ga0209981_1039323 | 3300027378 | Bacteria | 705 |
| 468 | Ga0209996_1014019 | 3300027395 | Bacteria | 1088 |
| 469 | Ga0210000_1012354 | 3300027462 | Bacteria | 1269 |
| 470 | Ga0209995_1001135 | 3300027471 | Bacteria | 4092 |
| 471 | Ga0209968_1001973 | 3300027526 | Bacteria | 3121 |
| 472 | Ga0209999_1008412 | 3300027543 | Bacteria | 1859 |
| 473 | Ga0209998_10037285 | 3300027717 | Bacteria | 1094 |
| 474 | Ga0207428_10017611 | 3300027907 | Bacteria | 6126 |
| 475 | Ga0207428_10061701 | 3300027907 | Bacteria | 2967 |
| 476 | Ga0268265_10000858 | 3300028380 | Bacteria | 28507 |
| 477 | Ga0268265_10034866 | 3300028380 | Bacteria | 3671 |
| 478 | Ga0268265_10215412 | 3300028380 | Bacteria | 1676 |
| 479 | Ga0268264_10581208 | 3300028381 | Bacteria | 1102 |
| 480 | Ga0265337_1006282 | 3300028556 | Bacteria | 4606 |
| 481 | Ga0265326_10006368 | 3300028558 | Bacteria | 3677 |
| 482 | Ga0265319_1000335 | 3300028563 | Bacteria | 34634 |
| 483 | Ga0265319_1139301 | 3300028563 | Bacteria | 753 |
| 484 | Ga0265318_10000169 | 3300028577 | Bacteria | 57590 |
| 485 | Ga0265318_10001647 | 3300028577 | Bacteria | 12876 |
| 486 | Ga0265323_10065335 | 3300028653 | Bacteria | 1255 |
| 487 | Ga0265336_10002452 | 3300028666 | Bacteria | 7638 |
| 488 | Ga0265336_10031393 | 3300028666 | Bacteria | 1650 |
| 489 | Ga0265336_10069504 | 3300028666 | Bacteria | 1053 |
| 490 | Ga0265336_10087446 | 3300028666 | Bacteria | 929 |
| 491 | Ga0307515_10600584 | 3300028794 | Bacteria | 711 |
| 492 | Ga0265338_10001810 | 3300028800 | Bacteria | 33582 |
| 493 | Ga0265338_10013017 | 3300028800 | Bacteria | 9435 |
| 494 | Ga0265338_10191950 | 3300028800 | Bacteria | 1547 |
| 495 | Ga0265338_10554871 | 3300028800 | Bacteria | 804 |
| 496 | Ga0265338_10681489 | 3300028800 | Bacteria | 711 |
| 497 | Ga0265330_10000068 | 3300031235 | Bacteria | 90225 |
| 498 | Ga0265330_10001241 | 3300031235 | Bacteria | 14953 |
| 499 | Ga0265332_10001607 | 3300031238 | Bacteria | 12385 |
| 500 | Ga0265332_10040797 | 3300031238 | Bacteria | 2009 |
| 501 | Ga0265332_10047768 | 3300031238 | Bacteria | 1842 |
| 502 | Ga0265328_10000172 | 3300031239 | Bacteria | 29964 |
| 503 | Ga0265328_10000528 | 3300031239 | Bacteria | 17832 |
| 504 | Ga0265320_10000069 | 3300031240 | Bacteria | 90253 |
| 505 | Ga0265320_10010819 | 3300031240 | Bacteria | 5405 |
| 506 | Ga0265320_10213635 | 3300031240 | Bacteria | 860 |
| 507 | Ga0265325_10079690 | 3300031241 | Bacteria | 1630 |
| 508 | Ga0265329_10045049 | 3300031242 | Bacteria | 1410 |
| 509 | Ga0265329_10066059 | 3300031242 | Bacteria | 1144 |
| 510 | Ga0265340_10010589 | 3300031247 | Bacteria | 4930 |
| 511 | Ga0265340_10067657 | 3300031247 | Bacteria | 1697 |
| 512 | Ga0265339_10002072 | 3300031249 | Bacteria | 14690 |
| 513 | Ga0265339_10006807 | 3300031249 | Bacteria | 7455 |
| 514 | Ga0265339_10242013 | 3300031249 | Bacteria | 876 |
| 515 | Ga0265339_10322278 | 3300031249 | Bacteria | 733 |
| 516 | Ga0265331_10000149 | 3300031250 | Bacteria | 90395 |
| 517 | Ga0265331_10026117 | 3300031250 | Bacteria | 2941 |
| 518 | Ga0265316_10004187 | 3300031344 | Bacteria | 14418 |
| 519 | Ga0265316_10007181 | 3300031344 | Bacteria | 10525 |
| 520 | Ga0265316_10017518 | 3300031344 | Bacteria | 6186 |
| 521 | Ga0265316_10029372 | 3300031344 | Bacteria | 4523 |
| 522 | Ga0307509_10246925 | 3300031507 | Bacteria | 1572 |
| 523 | Ga0307408_100171421 | 3300031548 | Bacteria | 1733 |
| 524 | Ga0265313_10000812 | 3300031595 | Bacteria | 31563 |
| 525 | Ga0265313_10015631 | 3300031595 | Bacteria | 4407 |
| 526 | Ga0265313_10036999 | 3300031595 | Bacteria | 2446 |
| 527 | Ga0265313_10057584 | 3300031595 | Bacteria | 1834 |
| 528 | Ga0265314_10000191 | 3300031711 | Bacteria | 91214 |
| 529 | Ga0265314_10001397 | 3300031711 | Bacteria | 27067 |
| 530 | Ga0265314_10004534 | 3300031711 | Bacteria | 12837 |
| 531 | Ga0265314_10086729 | 3300031711 | Bacteria | 2048 |
| 532 | Ga0265314_10137646 | 3300031711 | Bacteria | 1514 |
| 533 | Ga0265342_10001254 | 3300031712 | Bacteria | 23972 |
| 534 | Ga0265342_10001889 | 3300031712 | Bacteria | 18879 |
| 535 | Ga0265342_10006711 | 3300031712 | Bacteria | 8527 |
| 536 | Ga0265342_10013077 | 3300031712 | Bacteria | 5587 |
| 537 | Ga0316578_10315561 | 3300031728 | Bacteria | 934 |
| 538 | Ga0307405_10084665 | 3300031731 | Bacteria | 2082 |
| 539 | Ga0307405_10560462 | 3300031731 | Bacteria | 926 |
| 540 | Ga0307410_10069857 | 3300031852 | Bacteria | 2431 |
| 541 | Ga0307407_10287024 | 3300031903 | Bacteria | 1142 |
| 542 | Ga0307416_100408942 | 3300032002 | Bacteria | 1397 |
| 543 | Ga0307416_100509346 | 3300032002 | Bacteria | 1269 |
| 544 | Ga0307416_100751083 | 3300032002 | Bacteria | 1068 |
| 545 | Ga0307411_10035780 | 3300032005 | Bacteria | 3105 |
| 546 | Ga0307411_10116566 | 3300032005 | Bacteria | 1923 |
| 547 | Ga0373950_0000002 | 3300034818 | Bacteria | 933559 |
| 548 | Ga0373950_0000057 | 3300034818 | Bacteria | 72831 |
| 549 | Ga0373958_0006655 | 3300034819 | Bacteria | 1810 |
| 550 | Ga0373926_0265212 | 3300035083 | Bacteria | 667 |
| 551 | Ga0373952_0025211 | 3300035092 | Bacteria | 1283 |
| 552 | Ga0373952_0143843 | 3300035092 | Bacteria | 664 |
| 553 | Ga0373923_0037762 | 3300035111 | Bacteria | 1977 |
| 554 | Ga0373923_0223919 | 3300035111 | Bacteria | 875 |
| 555 | Ga0373932_0122931 | 3300035112 | Bacteria | 867 |
| 556 | Ga0373932_0305649 | 3300035112 | Bacteria | 595 |
| 557 | Ga0373936_0091362 | 3300035113 | Bacteria | 1277 |
| 558 | Ga0373936_0267227 | 3300035113 | Bacteria | 767 |
| 559 | Ga0373953_0319184 | 3300035117 | Bacteria | 679 |
| 560 | Ga0373954_0014604 | 3300035118 | Bacteria | 3502 |
| 561 | Ga0373954_0028117 | 3300035118 | Bacteria | 2583 |
| 562 | Ga0373954_0048783 | 3300035118 | Bacteria | 1984 |
| 563 | Ga0373954_0061842 | 3300035118 | Bacteria | 1768 |
| 564 | Ga0373954_0073523 | 3300035118 | Bacteria | 1627 |
| 565 | Ga0373956_0004261 | 3300035119 | Bacteria | 5747 |
| 566 | Ga0373956_0023587 | 3300035119 | Bacteria | 2642 |
| 567 | Ga0373956_0112149 | 3300035119 | Bacteria | 1270 |
| 568 | Ga0373957_0045467 | 3300035120 | Bacteria | 1664 |
| 569 | Ga0373946_0032634 | 3300035171 | Bacteria | 2092 |
| 570 | Ga0373955_0002904 | 3300035172 | Bacteria | 7521 |
| 571 | Ga0373955_0206647 | 3300035172 | Bacteria | 1170 |
| 572 | Ga0373955_0417050 | 3300035172 | Bacteria | 816 |
| 573 | Ga0373961_0100306 | 3300035241 | Bacteria | 937 |
| 574 | Ga0373924_0028722 | 3300035410 | Bacteria | 2218 |
| 575 | Ga0373931_0041283 | 3300035691 | Bacteria | 2423 |
| 576 | Ga0373931_0127927 | 3300035691 | Bacteria | 1459 |
| 577 | Ga0373935_0199170 | 3300035692 | Bacteria | 1383 |
| 578 | Ga0373933_0029527 | 3300035724 | Bacteria | 3171 |
| 579 | Ga0373933_0063865 | 3300035724 | Bacteria | 2226 |
| 580 | Ga0373933_0069385 | 3300035724 | Bacteria | 2142 |
| 581 | Ga0373933_0125719 | 3300035724 | Bacteria | 1608 |
| 582 | Ga0373933_0206114 | 3300035724 | Bacteria | 1259 |
| 583 | Ga0373933_0675627 | 3300035724 | Unclassified | 679 |
| 584 | Ga0373937_0002498 | 3300036401 | Bacteria | 15273 |
| 585 | Ga0373937_0025601 | 3300036401 | Bacteria | 5328 |
| 586 | Ga0373937_0183070 | 3300036401 | Bacteria | 1967 |
| 587 | Ga0316582_0075143 | 3300036647 | Bacteria | 2195 |
| 588 | Ga0373925_0587993 | 3300037068 | Bacteria | 916 |
| 589 | Ga0395899_0182864 | 3300037312 | Bacteria | 1470 |
| 590 | Ga0395900_0015556 | 3300037418 | Bacteria | 7754 |
| 591 | Ga0395900_0153997 | 3300037418 | Bacteria | 2348 |
| 592 | Ga0395898_0034826 | 3300037466 | Bacteria | 5012 |
| 593 | Ga0395898_0118682 | 3300037466 | Bacteria | 2534 |
| 594 | Ga0395901_0020479 | 3300038443 | Bacteria | 6769 |
| 595 | Ga0395901_0966513 | 3300038443 | Bacteria | 829 |
| 596 | Ga0436365_0027917 | 3300039437 | Bacteria | 1050 |
| 597 | Ga0436365_1643703 | 3300039437 | Bacteria | 2607 |
| 598 | Ga0451787_677116 | 3300041441 | Bacteria | 714 |
| 599 | Ga0451802_1249106 | 3300041460 | Bacteria | 1612 |
| 600 | Ga0439446_0005512 | 3300042156 | Bacteria | 3257 |
| 601 | Ga0439434_0125201 | 3300042435 | Bacteria | 840 |
| 602 | Ga0439435_0000723 | 3300042436 | Bacteria | 5528 |
| 603 | Ga0451577_0001597 | 3300042876 | Bacteria | 29525 |
| 604 | Ga0451577_0045788 | 3300042876 | Bacteria | 3915 |
| 605 | Ga0451577_0242446 | 3300042876 | Bacteria | 1631 |
| 606 | Ga0453684_0000116 | 3300044712 | Bacteria | 352304 |
| 607 | Ga0453684_0000194 | 3300044712 | Bacteria | 265783 |
| 608 | Ga0453684_0019106 | 3300044712 | Bacteria | 10459 |
| 609 | Ga0453684_0034156 | 3300044712 | Bacteria | 7068 |
| 610 | Ga0453684_0236326 | 3300044712 | Bacteria | 2106 |
| 611 | Ga0453684_0550428 | 3300044712 | Bacteria | 1271 |
| 612 | Ga0453684_0576757 | 3300044712 | Bacteria | 1236 |
| 613 | Ga0453684_0589304 | 3300044712 | Unclassified | 1220 |
| 614 | Ga0453684_1143788 | 3300044712 | Bacteria | 820 |
| 615 | Ga0466967_0699277 | 3300045976 | Bacteria | 1004 |
| 616 | Ga0495629_0291700 | 3300046459 | Bacteria | 1118 |
| 617 | Ga0495641_0078650 | 3300046461 | Bacteria | 1478 |
| 618 | Ga0495582_0087478 | 3300046473 | Bacteria | 1735 |
| 619 | Ga0495662_0097335 | 3300046476 | Bacteria | 1438 |
| 620 | Ga0495664_0005945 | 3300046477 | Bacteria | 6720 |
| 621 | Ga0495584_0281352 | 3300046491 | Bacteria | 845 |
| 622 | Ga0495630_0165382 | 3300046517 | Bacteria | 1684 |
| 623 | Ga0495642_0040298 | 3300046528 | Bacteria | 1897 |
| 624 | Ga0495586_0043692 | 3300046535 | Bacteria | 2413 |
| 625 | Ga0495587_0249500 | 3300046536 | Bacteria | 998 |
| 626 | Ga0495621_0019581 | 3300046539 | Bacteria | 2212 |
| 627 | Ga0495667_0007843 | 3300046559 | Bacteria | 7235 |
| 628 | Ga0495656_0335825 | 3300046615 | Bacteria | 781 |
| 629 | Ga0495668_0318683 | 3300046616 | Bacteria | 853 |
| 630 | Ga0495634_0000649 | 3300046642 | Bacteria | 33746 |
| 631 | Ga0495659_0042767 | 3300046664 | Bacteria | 1623 |
| 632 | Ga0495657_0102867 | 3300046675 | Bacteria | 1818 |
| 633 | Ga0495647_0023213 | 3300046681 | Bacteria | 2248 |
| 634 | Ga0495658_0246579 | 3300046683 | Bacteria | 1123 |
| 635 | Ga0495669_0106277 | 3300046684 | Bacteria | 1307 |
| 636 | Ga0495613_0706878 | 3300046689 | Bacteria | 663 |
| 637 | Ga0495624_0077788 | 3300046690 | Bacteria | 2058 |
| 638 | Ga0495674_0001336 | 3300047319 | Bacteria | 24042 |
| 639 | Ga0495674_0305483 | 3300047319 | Bacteria | 1299 |
| 640 | Ga0495676_0133580 | 3300047321 | Bacteria | 1788 |
| 641 | Ga0495680_0717460 | 3300047322 | Bacteria | 659 |
| 642 | Ga0495684_0175430 | 3300047471 | Bacteria | 1591 |
| 643 | Ga0495684_0605913 | 3300047471 | Bacteria | 738 |
| 644 | Ga0495615_0036745 | 3300048090 | Bacteria | 1203 |
| 645 | Ga0496100_0003660 | 3300048903 | Bacteria | 8042 |
| 646 | Ga0496100_0801097 | 3300048903 | Bacteria | 738 |
| 647 | Ga0496101_0046745 | 3300048904 | Bacteria | 3105 |
| 648 | Ga0496104_0091762 | 3300048907 | Bacteria | 2904 |
| 649 | Ga0496104_0626947 | 3300048907 | Bacteria | 985 |
| 650 | Ga0496104_0863714 | 3300048907 | Bacteria | 810 |
| 651 | Ga0496106_0035630 | 3300048909 | Bacteria | 3721 |
| 652 | Ga0496108_0011674 | 3300048911 | Bacteria | 7148 |
| 653 | Ga0496109_0099816 | 3300048912 | Bacteria | 2693 |
| 654 | Ga0496109_0935874 | 3300048912 | Bacteria | 804 |
| 655 | Ga0496110_0328255 | 3300048913 | Bacteria | 1394 |
| 656 | Ga0496112_0030222 | 3300048915 | Bacteria | 5242 |
| 657 | Ga0496114_0000386 | 3300048917 | Bacteria | 32590 |
| 658 | Ga0496114_0006073 | 3300048917 | Bacteria | 9506 |
| 659 | Ga0496114_0068408 | 3300048917 | Bacteria | 2981 |
| 660 | Ga0496114_0234351 | 3300048917 | Bacteria | 1613 |
| 661 | Ga0496114_0265781 | 3300048917 | Bacteria | 1511 |
| 662 | Ga0496114_0417919 | 3300048917 | Bacteria | 1188 |
| 663 | Ga0496115_0030301 | 3300048918 | Bacteria | 4255 |
| 664 | Ga0496115_0059367 | 3300048918 | Bacteria | 3080 |
| 665 | Ga0496115_0239629 | 3300048918 | Bacteria | 1495 |
| 666 | Ga0496115_0302381 | 3300048918 | Bacteria | 1311 |
| 667 | Ga0496115_0882893 | 3300048918 | Bacteria | 690 |
| 668 | Ga0501291_007417 | 3300049514 | Bacteria | 1485 |
| 669 | Ga0501291_017783 | 3300049514 | Bacteria | 1099 |
| 670 | Ga0501299_100846 | 3300049522 | Bacteria | 670 |
| 671 | Ga0501031_0085694 | 3300049568 | Bacteria | 2054 |
| 672 | Ga0501032_0081732 | 3300049569 | Bacteria | 2150 |
| 673 | Ga0501032_0250066 | 3300049569 | Bacteria | 1151 |
| 674 | Ga0501033_0112132 | 3300049570 | Bacteria | 1984 |
| 675 | Ga0501033_0126838 | 3300049570 | Bacteria | 1850 |
| 676 | Ga0501033_0203952 | 3300049570 | Bacteria | 1412 |
| 677 | Ga0501033_0669759 | 3300049570 | Bacteria | 708 |
| 678 | Ga0501034_0000037 | 3300049571 | Bacteria | 239254 |
| 679 | Ga0501034_0008263 | 3300049571 | Bacteria | 11016 |
| 680 | Ga0501034_0347244 | 3300049571 | Bacteria | 1413 |
| 681 | Ga0501034_0368469 | 3300049571 | Bacteria | 1363 |
| 682 | Ga0501036_0101300 | 3300049572 | Bacteria | 2436 |
| 683 | Ga0501036_0244241 | 3300049572 | Bacteria | 1505 |
| 684 | Ga0501036_0333348 | 3300049572 | Bacteria | 1267 |
| 685 | Ga0501037_0003640 | 3300049573 | Bacteria | 11182 |
| 686 | Ga0501037_0009833 | 3300049573 | Bacteria | 7020 |
| 687 | Ga0501037_0179035 | 3300049573 | Bacteria | 1505 |
| 688 | Ga0501037_0255880 | 3300049573 | Bacteria | 1224 |
| 689 | Ga0501038_0416404 | 3300049574 | Bacteria | 1037 |
| 690 | Ga0501039_0074777 | 3300049575 | Bacteria | 2633 |
| 691 | Ga0501039_0178645 | 3300049575 | Bacteria | 1669 |
| 692 | Ga0501039_0577354 | 3300049575 | Bacteria | 882 |
| 693 | Ga0501040_0175961 | 3300049576 | Bacteria | 1516 |
| 694 | Ga0501041_0100601 | 3300049577 | Bacteria | 1789 |
| 695 | Ga0501041_0478164 | 3300049577 | Bacteria | 792 |
| 696 | Ga0501042_0161937 | 3300049578 | Bacteria | 1614 |
| 697 | Ga0501043_0002483 | 3300049579 | Bacteria | 15600 |
| 698 | Ga0501043_0024041 | 3300049579 | Bacteria | 4781 |
| 699 | Ga0501043_0126658 | 3300049579 | Bacteria | 2003 |
| 700 | Ga0501043_0201720 | 3300049579 | Bacteria | 1544 |
| 701 | Ga0501046_0000751 | 3300049580 | Bacteria | 31319 |
| 702 | Ga0501046_0400806 | 3300049580 | Bacteria | 991 |
| 703 | Ga0501047_0000053 | 3300049581 | Bacteria | 150440 |
| 704 | Ga0501047_0013042 | 3300049581 | Bacteria | 7872 |
| 705 | Ga0501047_0225379 | 3300049581 | Bacteria | 1729 |
| 706 | Ga0501048_0001235 | 3300049582 | Bacteria | 19382 |
| 707 | Ga0501048_0112107 | 3300049582 | Bacteria | 1926 |
| 708 | Ga0501048_0129189 | 3300049582 | Bacteria | 1787 |
| 709 | Ga0501067_0000339 | 3300049583 | Bacteria | 25485 |
| 710 | Ga0501067_0003773 | 3300049583 | Bacteria | 8357 |
| 711 | Ga0501067_0160812 | 3300049583 | Bacteria | 1251 |
| 712 | Ga0501067_0165225 | 3300049583 | Bacteria | 1232 |
| 713 | Ga0501067_0197172 | 3300049583 | Bacteria | 1121 |
| 714 | Ga0501068_0001718 | 3300049584 | Bacteria | 11652 |
| 715 | Ga0501068_0031405 | 3300049584 | Bacteria | 3154 |
| 716 | Ga0501068_0033481 | 3300049584 | Bacteria | 3060 |
| 717 | Ga0501069_0009337 | 3300049585 | Bacteria | 5178 |
| 718 | Ga0501069_0015342 | 3300049585 | Bacteria | 4105 |
| 719 | Ga0501069_0185040 | 3300049585 | Bacteria | 1204 |
| 720 | Ga0501070_0005205 | 3300049586 | Bacteria | 11084 |
| 721 | Ga0501070_0006574 | 3300049586 | Bacteria | 9894 |
| 722 | Ga0501070_0007053 | 3300049586 | Bacteria | 9559 |
| 723 | Ga0501070_0008005 | 3300049586 | Bacteria | 8949 |
| 724 | Ga0501070_0011369 | 3300049586 | Bacteria | 7523 |
| 725 | Ga0501070_0053065 | 3300049586 | Bacteria | 3364 |
| 726 | Ga0501070_0059869 | 3300049586 | Bacteria | 3157 |
| 727 | Ga0501070_0085817 | 3300049586 | Bacteria | 2606 |
| 728 | Ga0501070_0173000 | 3300049586 | Bacteria | 1778 |
| 729 | Ga0501070_0753105 | 3300049586 | Bacteria | 767 |
| 730 | Ga0501070_1098754 | 3300049586 | Bacteria | 613 |
| 731 | Ga0501071_0004109 | 3300049587 | Bacteria | 9201 |
| 732 | Ga0501071_0125408 | 3300049587 | Bacteria | 1905 |
| 733 | Ga0501071_0263177 | 3300049587 | Bacteria | 1303 |
| 734 | Ga0501072_0002806 | 3300049588 | Bacteria | 13074 |
| 735 | Ga0501072_0030599 | 3300049588 | Bacteria | 4211 |
| 736 | Ga0501072_0051854 | 3300049588 | Bacteria | 3230 |
| 737 | Ga0501072_0574872 | 3300049588 | Bacteria | 889 |
| 738 | Ga0501073_0001831 | 3300049589 | Bacteria | 15830 |
| 739 | Ga0501073_0003382 | 3300049589 | Bacteria | 11991 |
| 740 | Ga0501073_0005323 | 3300049589 | Bacteria | 9649 |
| 741 | Ga0501073_0005367 | 3300049589 | Bacteria | 9602 |
| 742 | Ga0501073_0008056 | 3300049589 | Bacteria | 7819 |
| 743 | Ga0501073_0101363 | 3300049589 | Bacteria | 1999 |
| 744 | Ga0501073_0147856 | 3300049589 | Bacteria | 1628 |
| 745 | Ga0501073_0185329 | 3300049589 | Bacteria | 1440 |
| 746 | Ga0501073_0331562 | 3300049589 | Bacteria | 1050 |
| 747 | Ga0501073_0576657 | 3300049589 | Bacteria | 777 |
| 748 | Ga0501074_0000980 | 3300049590 | Bacteria | 18498 |
| 749 | Ga0501074_0026506 | 3300049590 | Bacteria | 4202 |
| 750 | Ga0501074_0029541 | 3300049590 | Bacteria | 3970 |
| 751 | Ga0501074_0051564 | 3300049590 | Bacteria | 2969 |
| 752 | Ga0501074_0189502 | 3300049590 | Bacteria | 1467 |
| 753 | Ga0501074_0933708 | 3300049590 | Bacteria | 610 |
| 754 | Ga0501075_0024398 | 3300049591 | Bacteria | 4434 |
| 755 | Ga0501075_0207545 | 3300049591 | Bacteria | 1494 |
| 756 | Ga0501075_0216701 | 3300049591 | Bacteria | 1460 |
| 757 | Ga0501075_0521002 | 3300049591 | Bacteria | 907 |
| 758 | Ga0501076_0047645 | 3300049592 | Bacteria | 3389 |
| 759 | Ga0501076_0254546 | 3300049592 | Bacteria | 1437 |
| 760 | Ga0501076_0329518 | 3300049592 | Bacteria | 1252 |
| 761 | Ga0501076_0454623 | 3300049592 | Bacteria | 1054 |
| 762 | Ga0501076_1471983 | 3300049592 | Bacteria | 559 |
| 763 | Ga0501077_0037441 | 3300049593 | Bacteria | 3089 |
| 764 | Ga0501077_0129475 | 3300049593 | Bacteria | 1600 |
| 765 | Ga0501077_0156314 | 3300049593 | Bacteria | 1447 |
| 766 | Ga0501077_0282312 | 3300049593 | Bacteria | 1057 |
| 767 | Ga0501217_008735 | 3300049661 | Bacteria | 2195 |
| 768 | Ga0501079_0000174 | 3300049741 | Bacteria | 36202 |
| 769 | Ga0501079_0039556 | 3300049741 | Bacteria | 3637 |
| 770 | Ga0501079_0092127 | 3300049741 | Bacteria | 2348 |
| 771 | Ga0501079_0223511 | 3300049741 | Bacteria | 1471 |
| 772 | Ga0501079_0279849 | 3300049741 | Bacteria | 1305 |
| 773 | Ga0501079_0370757 | 3300049741 | Bacteria | 1122 |
| 774 | Ga0501080_0001428 | 3300049742 | Bacteria | 20060 |
| 775 | Ga0501080_0002282 | 3300049742 | Bacteria | 16696 |
| 776 | Ga0501080_0007066 | 3300049742 | Bacteria | 10138 |
| 777 | Ga0501080_0046155 | 3300049742 | Bacteria | 4058 |
| 778 | Ga0501080_0062816 | 3300049742 | Bacteria | 3456 |
| 779 | Ga0501080_0077933 | 3300049742 | Bacteria | 3082 |
| 780 | Ga0501080_0348082 | 3300049742 | Bacteria | 1338 |
| 781 | Ga0501080_0365193 | 3300049742 | Bacteria | 1302 |
| 782 | Ga0501080_0730968 | 3300049742 | Bacteria | 872 |
| 783 | Ga0501081_0014431 | 3300049743 | Bacteria | 5211 |
| 784 | Ga0501081_0031168 | 3300049743 | Bacteria | 3613 |
| 785 | Ga0501081_0153632 | 3300049743 | Bacteria | 1655 |
| 786 | Ga0501081_0256912 | 3300049743 | Bacteria | 1276 |
| 787 | Ga0501083_0006838 | 3300049744 | Bacteria | 8096 |
| 788 | Ga0501083_0020228 | 3300049744 | Bacteria | 4631 |
| 789 | Ga0501083_0073859 | 3300049744 | Bacteria | 2267 |
| 790 | Ga0501083_0169543 | 3300049744 | Bacteria | 1427 |
| 791 | Ga0501083_0261830 | 3300049744 | Bacteria | 1125 |
| 792 | Ga0501273_019264 | 3300049770 | Bacteria | 914 |
| 793 | Ga0501283_018878 | 3300049779 | Bacteria | 1088 |
| 794 | Ga0501035_0009970 | 3300049822 | Bacteria | 8817 |
| 795 | Ga0501035_0074733 | 3300049822 | Bacteria | 2997 |
| 796 | Ga0501035_0189691 | 3300049822 | Bacteria | 1767 |
| 797 | Ga0501035_0243400 | 3300049822 | Bacteria | 1529 |
| 798 | Ga0501035_0287348 | 3300049822 | Unclassified | 1388 |
| 799 | Ga0501044_0006317 | 3300049823 | Bacteria | 13104 |
| 800 | Ga0501044_0121516 | 3300049823 | Bacteria | 2612 |
| 801 | Ga0501044_0145476 | 3300049823 | Bacteria | 2356 |
| 802 | Ga0501044_0215426 | 3300049823 | Bacteria | 1873 |
| 803 | Ga0501044_1365185 | 3300049823 | Bacteria | 574 |
| 804 | Ga0501044_1484791 | 3300049823 | Bacteria | 543 |
| 805 | Ga0501045_0157271 | 3300049824 | Bacteria | 1691 |
| 806 | Ga0501045_0754090 | 3300049824 | Bacteria | 717 |
| 807 | nmdc:mga05p37_139147_c1 | 3300050507 | Bacteria | 2975 |
| 808 | nmdc:mga05p37_367510_c1 | 3300050507 | Bacteria | 1689 |
| 809 | nmdc:mga05p37_579843_c1 | 3300050507 | Bacteria | 1270 |
| 810 | nmdc:mga09592_1124905_c1 | 3300050508 | Bacteria | 652 |
| 811 | nmdc:mga09592_619973_c1 | 3300050508 | Bacteria | 926 |
| 812 | nmdc:mga0qj67_72554_c1 | 3300050509 | Bacteria | 2749 |
| 813 | nmdc:mga06r32_49740_c1 | 3300050510 | Bacteria | 4010 |
| 814 | nmdc:mga08y16_108089_c1 | 3300050511 | Bacteria | 2896 |
| 815 | nmdc:mga08y16_20950_c1 | 3300050511 | Bacteria | 6902 |
| 816 | nmdc:mga08y16_257425_c1 | 3300050511 | Bacteria | 1803 |
| 817 | Ga0495601_0016503 | 3300053077 | Bacteria | 4476 |
| 818 | Ga0495595_0360633 | 3300053084 | Bacteria | 734 |
| 819 | Ga0501084_0000022 | 3300054114 | Bacteria | 145804 |
| 820 | Ga0501084_0111217 | 3300054114 | Bacteria | 2302 |
| 821 | Ga0501084_0159890 | 3300054114 | Bacteria | 1900 |
| 822 | Ga0501084_0271147 | 3300054114 | Bacteria | 1433 |
| 823 | Ga0501084_1025194 | 3300054114 | Bacteria | 693 |
| 824 | Ga0590077_027417 | 3300059426 | Bacteria | 1234 |
| 825 | Ga0501082_0006072 | 3300060353 | Bacteria | 10487 |
| 826 | Ga0501082_0010049 | 3300060353 | Bacteria | 8154 |
| 827 | Ga0501082_0622644 | 3300060353 | Bacteria | 944 |
| 828 | Ga0501082_1060100 | 3300060353 | Bacteria | 709 |
| 829 | Ga0530510_0538474 | 3300061734 | Bacteria | 886 |
| 830 | Ga0530510_0875769 | 3300061734 | Bacteria | 686 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035724 | Ga0373933_0675627 | Ga0373933_0675627_45_506 | 135 |
| 2 | 3300049823 | Ga0501044_1484791 | Ga0501044_1484791_100_525 | 138 |
| 3 | 3300005614 | Ga0068856_100238892 | Ga0068856_1002388923 | 141 |
| 4 | 3300044712 | Ga0453684_0550428 | Ga0453684_0550428_511_1056 | 146 |
| 5 | 3300028563 | Ga0265319_1139301 | Ga0265319_11393012 | 150 |
| 6 | 3300028577 | Ga0265318_10000169 | Ga0265318_1000016916 | 150 |
| 7 | 3300031235 | Ga0265330_10000068 | Ga0265330_1000006885 | 150 |
| 8 | 3300031238 | Ga0265332_10001607 | Ga0265332_1000160716 | 150 |
| 9 | 3300031239 | Ga0265328_10000528 | Ga0265328_1000052813 | 150 |
| 10 | 3300031240 | Ga0265320_10000069 | Ga0265320_1000006916 | 150 |
| 11 | 3300031241 | Ga0265325_10079690 | Ga0265325_100796903 | 150 |
| 12 | 3300031242 | Ga0265329_10066059 | Ga0265329_100660592 | 150 |
| 13 | 3300031250 | Ga0265331_10000149 | Ga0265331_1000014985 | 150 |
| 14 | 3300031344 | Ga0265316_10007181 | Ga0265316_1000718111 | 150 |
| 15 | 3300031595 | Ga0265313_10000812 | Ga0265313_1000081211 | 150 |
| 16 | 3300031711 | Ga0265314_10000191 | Ga0265314_1000019186 | 150 |
| 17 | 3300031712 | Ga0265342_10006711 | Ga0265342_100067113 | 150 |
| 18 | 3300005336 | Ga0070680_100246153 | Ga0070680_1002461533 | 151 |
| 19 | 3300005458 | Ga0070681_10133625 | Ga0070681_101336254 | 151 |
| 20 | 3300005530 | Ga0070679_100202672 | Ga0070679_1002026721 | 151 |
| 21 | 3300025912 | Ga0207707_10006555 | Ga0207707_1000655510 | 151 |
| 22 | 3300025917 | Ga0207660_10215847 | Ga0207660_102158472 | 151 |
| 23 | 3300025921 | Ga0207652_10011010 | Ga0207652_100110106 | 151 |
| 24 | 3300028666 | Ga0265336_10031393 | Ga0265336_100313934 | 152 |
| 25 | 3300031247 | Ga0265340_10010589 | Ga0265340_100105898 | 152 |
| 26 | 3300031249 | Ga0265339_10322278 | Ga0265339_103222781 | 152 |
| 27 | 3300041460 | Ga0451802_1249106 | Ga0451802_1249106_760_1305 | 152 |
| 28 | 3300028653 | Ga0265323_10065335 | Ga0265323_100653353 | 153 |
| 29 | 3300044712 | Ga0453684_0019106 | Ga0453684_0019106_2098_2646 | 153 |
| 30 | 3300044712 | Ga0453684_0576757 | Ga0453684_0576757_238_786 | 153 |
| 31 | 3300054114 | Ga0501084_0271147 | Ga0501084_0271147_835_1389 | 153 |
| 32 | 3300004799 | Ga0058863_11635206 | Ga0058863_116352061 | 154 |
| 33 | 3300004803 | Ga0058862_10077182 | Ga0058862_100771823 | 154 |
| 34 | 3300005336 | Ga0070680_100038408 | Ga0070680_1000384082 | 154 |
| 35 | 3300005445 | Ga0070708_100536975 | Ga0070708_1005369752 | 154 |
| 36 | 3300005455 | Ga0070663_100054376 | Ga0070663_1000543763 | 154 |
| 37 | 3300005458 | Ga0070681_10046978 | Ga0070681_100469789 | 154 |
| 38 | 3300005530 | Ga0070679_100033803 | Ga0070679_1000338037 | 154 |
| 39 | 3300005530 | Ga0070679_100057568 | Ga0070679_1000575689 | 154 |
| 40 | 3300005563 | Ga0068855_100004696 | Ga0068855_10000469624 | 154 |
| 41 | 3300005563 | Ga0068855_100067646 | Ga0068855_1000676462 | 154 |
| 42 | 3300005578 | Ga0068854_100008257 | Ga0068854_1000082576 | 154 |
| 43 | 3300005614 | Ga0068856_100084913 | Ga0068856_1000849134 | 154 |
| 44 | 3300009545 | Ga0105237_10002220 | Ga0105237_1000222024 | 154 |
| 45 | 3300010375 | Ga0105239_11217999 | Ga0105239_112179991 | 154 |
| 46 | 3300013100 | Ga0157373_10124104 | Ga0157373_101241043 | 154 |
| 47 | 3300013104 | Ga0157370_10125442 | Ga0157370_101254423 | 154 |
| 48 | 3300013104 | Ga0157370_10299241 | Ga0157370_102992412 | 154 |
| 49 | 3300013105 | Ga0157369_10245732 | Ga0157369_102457322 | 154 |
| 50 | 3300013307 | Ga0157372_10022741 | Ga0157372_100227419 | 154 |
| 51 | 3300020070 | Ga0206356_10188034 | Ga0206356_101880342 | 154 |
| 52 | 3300020078 | Ga0206352_11285822 | Ga0206352_112858225 | 154 |
| 53 | 3300025912 | Ga0207707_10000201 | Ga0207707_1000020115 | 154 |
| 54 | 3300025914 | Ga0207671_10000510 | Ga0207671_1000051017 | 154 |
| 55 | 3300025914 | Ga0207671_10006782 | Ga0207671_100067824 | 154 |
| 56 | 3300025917 | Ga0207660_10281695 | Ga0207660_102816952 | 154 |
| 57 | 3300025921 | Ga0207652_10002222 | Ga0207652_1000222210 | 154 |
| 58 | 3300025921 | Ga0207652_10073451 | Ga0207652_100734516 | 154 |
| 59 | 3300025949 | Ga0207667_10087997 | Ga0207667_100879976 | 154 |
| 60 | 3300025949 | Ga0207667_10136064 | Ga0207667_101360643 | 154 |
| 61 | 3300025981 | Ga0207640_10038078 | Ga0207640_100380785 | 154 |
| 62 | 3300026067 | Ga0207678_10033539 | Ga0207678_100335396 | 154 |
| 63 | 3300026078 | Ga0207702_10100543 | Ga0207702_101005433 | 154 |
| 64 | 3300028800 | Ga0265338_10681489 | Ga0265338_106814891 | 154 |
| 65 | 3300031595 | Ga0265313_10057584 | Ga0265313_100575842 | 154 |
| 66 | 3300045976 | Ga0466967_0699277 | Ga0466967_0699277_264_815 | 154 |
| 67 | 3300049569 | Ga0501032_0081732 | Ga0501032_0081732_687_1211 | 154 |
| 68 | 3300049570 | Ga0501033_0126838 | Ga0501033_0126838_1295_1819 | 154 |
| 69 | 3300049571 | Ga0501034_0347244 | Ga0501034_0347244_237_761 | 154 |
| 70 | 3300049572 | Ga0501036_0333348 | Ga0501036_0333348_512_1036 | 154 |
| 71 | 3300049574 | Ga0501038_0416404 | Ga0501038_0416404_469_993 | 154 |
| 72 | 3300049575 | Ga0501039_0577354 | Ga0501039_0577354_338_862 | 154 |
| 73 | 3300049579 | Ga0501043_0201720 | Ga0501043_0201720_477_1001 | 154 |
| 74 | 3300049580 | Ga0501046_0400806 | Ga0501046_0400806_318_842 | 154 |
| 75 | 3300049589 | Ga0501073_0101363 | Ga0501073_0101363_973_1497 | 154 |
| 76 | 3300049742 | Ga0501080_0062816 | Ga0501080_0062816_2805_3329 | 154 |
| 77 | 3300049822 | Ga0501035_0074733 | Ga0501035_0074733_1644_2168 | 154 |
| 78 | 3300049823 | Ga0501044_1365185 | Ga0501044_1365185_21_545 | 154 |
| 79 | 3300005353 | Ga0070669_100008256 | Ga0070669_10000825612 | 155 |
| 80 | 3300005354 | Ga0070675_100244545 | Ga0070675_1002445452 | 155 |
| 81 | 3300005356 | Ga0070674_100145445 | Ga0070674_1001454453 | 155 |
| 82 | 3300005364 | Ga0070673_100238981 | Ga0070673_1002389813 | 155 |
| 83 | 3300005438 | Ga0070701_10395258 | Ga0070701_103952582 | 155 |
| 84 | 3300005441 | Ga0070700_100008581 | Ga0070700_1000085816 | 155 |
| 85 | 3300005459 | Ga0068867_100021915 | Ga0068867_1000219152 | 155 |
| 86 | 3300005543 | Ga0070672_100204397 | Ga0070672_1002043972 | 155 |
| 87 | 3300005549 | Ga0070704_100325887 | Ga0070704_1003258871 | 155 |
| 88 | 3300005840 | Ga0068870_10292690 | Ga0068870_102926902 | 155 |
| 89 | 3300005844 | Ga0068862_100038391 | Ga0068862_1000383912 | 155 |
| 90 | 3300009148 | Ga0105243_10010767 | Ga0105243_100107679 | 155 |
| 91 | 3300009176 | Ga0105242_10218702 | Ga0105242_102187024 | 155 |
| 92 | 3300009553 | Ga0105249_10010299 | Ga0105249_1001029912 | 155 |
| 93 | 3300013306 | Ga0163162_10566535 | Ga0163162_105665352 | 155 |
| 94 | 3300014326 | Ga0157380_10033551 | Ga0157380_100335518 | 155 |
| 95 | 3300025885 | Ga0207653_10038952 | Ga0207653_100389523 | 155 |
| 96 | 3300025923 | Ga0207681_10003287 | Ga0207681_1000328718 | 155 |
| 97 | 3300025926 | Ga0207659_10199373 | Ga0207659_101993732 | 155 |
| 98 | 3300025935 | Ga0207709_10007251 | Ga0207709_100072519 | 155 |
| 99 | 3300025937 | Ga0207669_10266219 | Ga0207669_102662192 | 155 |
| 100 | 3300025938 | Ga0207704_10003227 | Ga0207704_100032274 | 155 |
| 101 | 3300025940 | Ga0207691_10028424 | Ga0207691_1002842411 | 155 |
| 102 | 3300025960 | Ga0207651_10141959 | Ga0207651_101419592 | 155 |
| 103 | 3300025961 | Ga0207712_10007287 | Ga0207712_100072876 | 155 |
| 104 | 3300025981 | Ga0207640_10911377 | Ga0207640_109113771 | 155 |
| 105 | 3300026075 | Ga0207708_10057714 | Ga0207708_100577146 | 155 |
| 106 | 3300026089 | Ga0207648_10008885 | Ga0207648_1000888517 | 155 |
| 107 | 3300026118 | Ga0207675_100004342 | Ga0207675_10000434218 | 155 |
| 108 | 3300027907 | Ga0207428_10061701 | Ga0207428_100617014 | 155 |
| 109 | 3300028380 | Ga0268265_10000858 | Ga0268265_100008586 | 155 |
| 110 | 3300048918 | Ga0496115_0239629 | Ga0496115_0239629_549_1076 | 155 |
| 111 | 3300005343 | Ga0070687_100158248 | Ga0070687_1001582482 | 156 |
| 112 | 3300005347 | Ga0070668_100056723 | Ga0070668_1000567236 | 156 |
| 113 | 3300005546 | Ga0070696_100848669 | Ga0070696_1008486691 | 156 |
| 114 | 3300006844 | Ga0075428_100249709 | Ga0075428_1002497093 | 156 |
| 115 | 3300009147 | Ga0114129_11259091 | Ga0114129_112590912 | 156 |
| 116 | 3300013308 | Ga0157375_10272772 | Ga0157375_102727722 | 156 |
| 117 | 3300025918 | Ga0207662_10055422 | Ga0207662_100554223 | 156 |
| 118 | 3300025936 | Ga0207670_10509207 | Ga0207670_105092072 | 156 |
| 119 | 3300026089 | Ga0207648_11182781 | Ga0207648_111827812 | 156 |
| 120 | 3300026121 | Ga0207683_10277095 | Ga0207683_102770953 | 156 |
| 121 | 3300046539 | Ga0495621_0019581 | Ga0495621_0019581_505_1038 | 156 |
| 122 | 3300046684 | Ga0495669_0106277 | Ga0495669_0106277_677_1210 | 156 |
| 123 | 3300048090 | Ga0495615_0036745 | Ga0495615_0036745_378_911 | 156 |
| 124 | 3300050507 | nmdc:mga05p37_579843_c1 | nmdc:mga05p37_579843_c1_155_688 | 156 |
| 125 | 3300050508 | nmdc:mga09592_619973_c1 | nmdc:mga09592_619973_c1_157_690 | 156 |
| 126 | 3300009094 | Ga0111539_10058961 | Ga0111539_100589616 | 157 |
| 127 | 3300035083 | Ga0373926_0265212 | Ga0373926_0265212_17_529 | 157 |
| 128 | 3300035118 | Ga0373954_0014604 | Ga0373954_0014604_2418_2933 | 157 |
| 129 | 3300035119 | Ga0373956_0112149 | Ga0373956_0112149_750_1259 | 157 |
| 130 | 3300035120 | Ga0373957_0045467 | Ga0373957_0045467_149_664 | 157 |
| 131 | 3300035410 | Ga0373924_0028722 | Ga0373924_0028722_1629_2144 | 157 |
| 132 | 3300035724 | Ga0373933_0063865 | Ga0373933_0063865_85_600 | 157 |
| 133 | 3300036401 | Ga0373937_0025601 | Ga0373937_0025601_3736_4251 | 157 |
| 134 | 3300047471 | Ga0495684_0175430 | Ga0495684_0175430_992_1501 | 157 |
| 135 | 3300048907 | Ga0496104_0091762 | Ga0496104_0091762_790_1299 | 157 |
| 136 | 3300048911 | Ga0496108_0011674 | Ga0496108_0011674_1041_1589 | 157 |
| 137 | 3300048912 | Ga0496109_0935874 | Ga0496109_0935874_179_727 | 157 |
| 138 | 3300048917 | Ga0496114_0265781 | Ga0496114_0265781_430_939 | 157 |
| 139 | 3300048918 | Ga0496115_0059367 | Ga0496115_0059367_2431_2943 | 157 |
| 140 | 3300005614 | Ga0068856_100700014 | Ga0068856_1007000142 | 158 |
| 141 | 3300006844 | Ga0075428_100903512 | Ga0075428_1009035122 | 158 |
| 142 | 3300006846 | Ga0075430_100018107 | Ga0075430_1000181075 | 158 |
| 143 | 3300013296 | Ga0157374_10039567 | Ga0157374_1003956710 | 158 |
| 144 | 3300014968 | Ga0157379_10049835 | Ga0157379_100498356 | 158 |
| 145 | 3300048917 | Ga0496114_0068408 | Ga0496114_0068408_1968_2513 | 158 |
| 146 | 3300048918 | Ga0496115_0882893 | Ga0496115_0882893_109_654 | 158 |
| 147 | 3300050509 | nmdc:mga0qj67_72554_c1 | nmdc:mga0qj67_72554_c1_1578_2111 | 158 |
| 148 | 3300005578 | Ga0068854_100256109 | Ga0068854_1002561093 | 160 |
| 149 | 3300009093 | Ga0105240_10212412 | Ga0105240_102124123 | 160 |
| 150 | 3300013308 | Ga0157375_10202649 | Ga0157375_102026495 | 160 |
| 151 | 3300035113 | Ga0373936_0267227 | Ga0373936_0267227_138_665 | 160 |
| 152 | 3300035172 | Ga0373955_0417050 | Ga0373955_0417050_239_796 | 160 |
| 153 | 3300048917 | Ga0496114_0417919 | Ga0496114_0417919_172_699 | 160 |
| 154 | 3300049583 | Ga0501067_0165225 | Ga0501067_0165225_221_769 | 160 |
| 155 | 3300049592 | Ga0501076_1471983 | Ga0501076_1471983_10_492 | 160 |
| 156 | 3300010375 | Ga0105239_11300654 | Ga0105239_113006542 | 161 |
| 157 | 3300028556 | Ga0265337_1006282 | Ga0265337_10062825 | 161 |
| 158 | 3300034818 | Ga0373950_0000002 | Ga0373950_0000002_6744_7265 | 161 |
| 159 | 3300034818 | Ga0373950_0000057 | Ga0373950_0000057_71498_72016 | 161 |
| 160 | 3300039437 | Ga0436365_0027917 | Ga0436365_0027917_522_1022 | 161 |
| 161 | 3300048917 | Ga0496114_0234351 | Ga0496114_0234351_152_670 | 161 |
| 162 | 3300049570 | Ga0501033_0203952 | Ga0501033_0203952_44_577 | 161 |
| 163 | 3300049571 | Ga0501034_0000037 | Ga0501034_0000037_164884_165402 | 161 |
| 164 | 3300049572 | Ga0501036_0101300 | Ga0501036_0101300_1795_2313 | 161 |
| 165 | 3300049572 | Ga0501036_0244241 | Ga0501036_0244241_490_1008 | 161 |
| 166 | 3300049573 | Ga0501037_0255880 | Ga0501037_0255880_630_1163 | 161 |
| 167 | 3300049575 | Ga0501039_0178645 | Ga0501039_0178645_482_1015 | 161 |
| 168 | 3300049579 | Ga0501043_0002483 | Ga0501043_0002483_6885_7403 | 161 |
| 169 | 3300049580 | Ga0501046_0000751 | Ga0501046_0000751_28194_28712 | 161 |
| 170 | 3300049581 | Ga0501047_0000053 | Ga0501047_0000053_45361_45879 | 161 |
| 171 | 3300049582 | Ga0501048_0001235 | Ga0501048_0001235_6370_6888 | 161 |
| 172 | 3300049583 | Ga0501067_0000339 | Ga0501067_0000339_1541_2062 | 161 |
| 173 | 3300049583 | Ga0501067_0160812 | Ga0501067_0160812_45_563 | 161 |
| 174 | 3300049584 | Ga0501068_0001718 | Ga0501068_0001718_10375_10893 | 161 |
| 175 | 3300049584 | Ga0501068_0031405 | Ga0501068_0031405_2254_2775 | 161 |
| 176 | 3300049585 | Ga0501069_0185040 | Ga0501069_0185040_235_756 | 161 |
| 177 | 3300049586 | Ga0501070_0007053 | Ga0501070_0007053_2157_2675 | 161 |
| 178 | 3300049588 | Ga0501072_0002806 | Ga0501072_0002806_5672_6190 | 161 |
| 179 | 3300049589 | Ga0501073_0005323 | Ga0501073_0005323_6690_7211 | 161 |
| 180 | 3300049589 | Ga0501073_0005367 | Ga0501073_0005367_4843_5361 | 161 |
| 181 | 3300049589 | Ga0501073_0185329 | Ga0501073_0185329_407_928 | 161 |
| 182 | 3300049589 | Ga0501073_0331562 | Ga0501073_0331562_400_921 | 161 |
| 183 | 3300049590 | Ga0501074_0026506 | Ga0501074_0026506_1869_2387 | 161 |
| 184 | 3300049590 | Ga0501074_0051564 | Ga0501074_0051564_375_896 | 161 |
| 185 | 3300049590 | Ga0501074_0189502 | Ga0501074_0189502_136_657 | 161 |
| 186 | 3300049591 | Ga0501075_0216701 | Ga0501075_0216701_824_1357 | 161 |
| 187 | 3300049592 | Ga0501076_0329518 | Ga0501076_0329518_11_544 | 161 |
| 188 | 3300049741 | Ga0501079_0000174 | Ga0501079_0000174_21560_22078 | 161 |
| 189 | 3300049741 | Ga0501079_0039556 | Ga0501079_0039556_2893_3426 | 161 |
| 190 | 3300049742 | Ga0501080_0007066 | Ga0501080_0007066_2736_3254 | 161 |
| 191 | 3300049742 | Ga0501080_0077933 | Ga0501080_0077933_2231_2752 | 161 |
| 192 | 3300049742 | Ga0501080_0730968 | Ga0501080_0730968_236_769 | 161 |
| 193 | 3300049743 | Ga0501081_0256912 | Ga0501081_0256912_655_1188 | 161 |
| 194 | 3300049744 | Ga0501083_0006838 | Ga0501083_0006838_4971_5489 | 161 |
| 195 | 3300049744 | Ga0501083_0020228 | Ga0501083_0020228_3641_4162 | 161 |
| 196 | 3300049744 | Ga0501083_0169543 | Ga0501083_0169543_266_799 | 161 |
| 197 | 3300049744 | Ga0501083_0261830 | Ga0501083_0261830_141_662 | 161 |
| 198 | 3300049823 | Ga0501044_0215426 | Ga0501044_0215426_865_1383 | 161 |
| 199 | 3300049824 | Ga0501045_0157271 | Ga0501045_0157271_648_1181 | 161 |
| 200 | 3300054114 | Ga0501084_0000022 | Ga0501084_0000022_104534_105052 | 161 |
| 201 | 3300054114 | Ga0501084_1025194 | Ga0501084_1025194_30_563 | 161 |
| 202 | 3300060353 | Ga0501082_0006072 | Ga0501082_0006072_3128_3646 | 161 |
| 203 | 3300060353 | Ga0501082_0622644 | Ga0501082_0622644_362_883 | 161 |
| 204 | 3300028558 | Ga0265326_10006368 | Ga0265326_100063681 | 162 |
| 205 | 3300028563 | Ga0265319_1000335 | Ga0265319_100033531 | 162 |
| 206 | 3300028577 | Ga0265318_10001647 | Ga0265318_1000164716 | 162 |
| 207 | 3300028800 | Ga0265338_10013017 | Ga0265338_1001301713 | 162 |
| 208 | 3300035117 | Ga0373953_0319184 | Ga0373953_0319184_61_618 | 163 |
| 209 | 3300035241 | Ga0373961_0100306 | Ga0373961_0100306_13_543 | 163 |
| 210 | 3300047322 | Ga0495680_0717460 | Ga0495680_0717460_99_635 | 163 |
| 211 | 3300048917 | Ga0496114_0006073 | Ga0496114_0006073_6775_7311 | 163 |
| 212 | 3300035092 | Ga0373952_0025211 | Ga0373952_0025211_505_1059 | 164 |
| 213 | 3300035172 | Ga0373955_0206647 | Ga0373955_0206647_81_611 | 164 |
| 214 | 3300046536 | Ga0495587_0249500 | Ga0495587_0249500_391_921 | 164 |
| 215 | 3300046689 | Ga0495613_0706878 | Ga0495613_0706878_16_546 | 164 |
| 216 | 3300048913 | Ga0496110_0328255 | Ga0496110_0328255_450_980 | 164 |
| 217 | 3300049585 | Ga0501069_0015342 | Ga0501069_0015342_1300_1851 | 164 |
| 218 | 3300049586 | Ga0501070_0005205 | Ga0501070_0005205_5592_6143 | 164 |
| 219 | 3300049741 | Ga0501079_0092127 | Ga0501079_0092127_433_984 | 164 |
| 220 | 3300049742 | Ga0501080_0348082 | Ga0501080_0348082_399_950 | 164 |
| 221 | 3300049743 | Ga0501081_0014431 | Ga0501081_0014431_2392_2943 | 164 |
| 222 | 3300049744 | Ga0501083_0073859 | Ga0501083_0073859_1324_1875 | 164 |
| 223 | 3300053084 | Ga0495595_0360633 | Ga0495595_0360633_35_589 | 164 |
| 224 | 3300060353 | Ga0501082_0010049 | Ga0501082_0010049_5573_6124 | 164 |
| 225 | 3300014745 | Ga0157377_10015531 | Ga0157377_100155313 | 165 |
| 226 | 3300050508 | nmdc:mga09592_1124905_c1 | nmdc:mga09592_1124905_c1_30_590 | 166 |
| 227 | 3300048907 | Ga0496104_0626947 | Ga0496104_0626947_139_696 | 167 |
| 228 | 3300005458 | Ga0070681_10138345 | Ga0070681_101383454 | 168 |
| 229 | 3300005535 | Ga0070684_100556689 | Ga0070684_1005566891 | 168 |
| 230 | 3300005544 | Ga0070686_100350856 | Ga0070686_1003508562 | 168 |
| 231 | 3300005618 | Ga0068864_100595292 | Ga0068864_1005952921 | 168 |
| 232 | 3300011119 | Ga0105246_11242083 | Ga0105246_112420831 | 168 |
| 233 | 3300025986 | Ga0207658_10895431 | Ga0207658_108954312 | 168 |
| 234 | 3300048915 | Ga0496112_0030222 | Ga0496112_0030222_1983_2540 | 168 |
| 235 | iso_pu_bacteria | 2547132130 | 2547502397 | 168 |
| 236 | iso_pu_bacteria | 2747842428 | 2747950342 | 168 |
| 237 | iso_pu_bacteria | 2765235840 | 2765577797 | 168 |
| 238 | iso_pu_bacteria | 2816332141 | 2816515860 | 168 |
| 239 | iso_pu_bacteria | 2842391507 | 2842394184 | 168 |
| 240 | iso_pu_bacteria | 2919134579 | 2919134921 | 168 |
| 241 | iso_pu_bacteria | 2961064222 | 2961068537 | 168 |
| 242 | 3300005345 | Ga0070692_10266435 | Ga0070692_102664352 | 169 |
| 243 | 3300005328 | Ga0070676_10018293 | Ga0070676_100182939 | 170 |
| 244 | 3300005330 | Ga0070690_100147431 | Ga0070690_1001474314 | 170 |
| 245 | 3300005334 | Ga0068869_100731884 | Ga0068869_1007318842 | 170 |
| 246 | 3300005340 | Ga0070689_100181334 | Ga0070689_1001813343 | 170 |
| 247 | 3300005347 | Ga0070668_100028739 | Ga0070668_1000287393 | 170 |
| 248 | 3300005356 | Ga0070674_100007457 | Ga0070674_10000745713 | 170 |
| 249 | 3300005365 | Ga0070688_100195933 | Ga0070688_1001959332 | 170 |
| 250 | 3300005438 | Ga0070701_10351515 | Ga0070701_103515152 | 170 |
| 251 | 3300005440 | Ga0070705_100046738 | Ga0070705_1000467385 | 170 |
| 252 | 3300005441 | Ga0070700_100042432 | Ga0070700_1000424322 | 170 |
| 253 | 3300005459 | Ga0068867_100016292 | Ga0068867_10001629210 | 170 |
| 254 | 3300005543 | Ga0070672_100064690 | Ga0070672_1000646906 | 170 |
| 255 | 3300005617 | Ga0068859_100622992 | Ga0068859_1006229922 | 170 |
| 256 | 3300005718 | Ga0068866_10035746 | Ga0068866_100357464 | 170 |
| 257 | 3300005719 | Ga0068861_100088764 | Ga0068861_1000887642 | 170 |
| 258 | 3300005844 | Ga0068862_101006302 | Ga0068862_1010063022 | 170 |
| 259 | 3300006881 | Ga0068865_100218603 | Ga0068865_1002186033 | 170 |
| 260 | 3300006931 | Ga0097620_100623014 | Ga0097620_1006230142 | 170 |
| 261 | 3300009148 | Ga0105243_10214065 | Ga0105243_102140654 | 170 |
| 262 | 3300009553 | Ga0105249_10246729 | Ga0105249_102467294 | 170 |
| 263 | 3300013306 | Ga0163162_10118214 | Ga0163162_101182146 | 170 |
| 264 | 3300025315 | Ga0207697_10069394 | Ga0207697_100693943 | 170 |
| 265 | 3300025907 | Ga0207645_10021058 | Ga0207645_100210582 | 170 |
| 266 | 3300025913 | Ga0207695_10109993 | Ga0207695_101099934 | 170 |
| 267 | 3300025919 | Ga0207657_10226429 | Ga0207657_102264292 | 170 |
| 268 | 3300025923 | Ga0207681_10002742 | Ga0207681_100027427 | 170 |
| 269 | 3300025936 | Ga0207670_10398206 | Ga0207670_103982063 | 170 |
| 270 | 3300025938 | Ga0207704_10003857 | Ga0207704_100038576 | 170 |
| 271 | 3300025942 | Ga0207689_10449004 | Ga0207689_104490043 | 170 |
| 272 | 3300025972 | Ga0207668_10028961 | Ga0207668_100289614 | 170 |
| 273 | 3300025981 | Ga0207640_10811543 | Ga0207640_108115431 | 170 |
| 274 | 3300025986 | Ga0207658_10219118 | Ga0207658_102191183 | 170 |
| 275 | 3300026023 | Ga0207677_10391051 | Ga0207677_103910513 | 170 |
| 276 | 3300026035 | Ga0207703_10960747 | Ga0207703_109607472 | 170 |
| 277 | 3300026089 | Ga0207648_10011154 | Ga0207648_100111545 | 170 |
| 278 | 3300026118 | Ga0207675_100013850 | Ga0207675_1000138502 | 170 |
| 279 | 3300027717 | Ga0209998_10037285 | Ga0209998_100372851 | 170 |
| 280 | 3300028380 | Ga0268265_10034866 | Ga0268265_100348662 | 170 |
| 281 | 3300028381 | Ga0268264_10581208 | Ga0268264_105812081 | 170 |
| 282 | 3300031240 | Ga0265320_10213635 | Ga0265320_102136352 | 170 |
| 283 | 3300031249 | Ga0265339_10002072 | Ga0265339_1000207220 | 170 |
| 284 | 3300031344 | Ga0265316_10029372 | Ga0265316_100293726 | 170 |
| 285 | 3300031595 | Ga0265313_10015631 | Ga0265313_100156319 | 170 |
| 286 | 3300031711 | Ga0265314_10137646 | Ga0265314_101376462 | 170 |
| 287 | 3300035112 | Ga0373932_0305649 | Ga0373932_0305649_24_581 | 170 |
| 288 | 3300048903 | Ga0496100_0003660 | Ga0496100_0003660_1820_2377 | 170 |
| 289 | 3300048904 | Ga0496101_0046745 | Ga0496101_0046745_1017_1574 | 170 |
| 290 | 3300048907 | Ga0496104_0863714 | Ga0496104_0863714_200_757 | 170 |
| 291 | 3300048909 | Ga0496106_0035630 | Ga0496106_0035630_1721_2278 | 170 |
| 292 | 3300048917 | Ga0496114_0000386 | Ga0496114_0000386_23922_24479 | 170 |
| 293 | 3300048918 | Ga0496115_0030301 | Ga0496115_0030301_2683_3240 | 170 |
| 294 | 3300049583 | Ga0501067_0003773 | Ga0501067_0003773_7431_7988 | 170 |
| 295 | 3300049583 | Ga0501067_0197172 | Ga0501067_0197172_225_782 | 170 |
| 296 | 3300049589 | Ga0501073_0003382 | Ga0501073_0003382_6218_6775 | 170 |
| 297 | 3300049589 | Ga0501073_0576657 | Ga0501073_0576657_193_750 | 170 |
| 298 | 3300049822 | Ga0501035_0287348 | Ga0501035_0287348_279_812 | 170 |
| 299 | 3300002863 | Ga0006769J43182_106839 | Ga0006769J43182_1068392 | 171 |
| 300 | 3300002868 | Ga0006767J43181_103125 | Ga0006767J43181_10312515 | 171 |
| 301 | 3300002870 | Ga0006763J43179_104103 | Ga0006763J43179_10410315 | 171 |
| 302 | 3300002872 | Ga0006762J43184_103419 | Ga0006762J43184_10341914 | 171 |
| 303 | 3300003163 | Ga0006759J45824_1006649 | Ga0006759J45824_100664917 | 171 |
| 304 | 3300003300 | Ga0006758J48902_1009034 | Ga0006758J48902_10090344 | 171 |
| 305 | 3300003305 | Ga0006770J48903_1038246 | Ga0006770J48903_10382464 | 171 |
| 306 | 3300003323 | rootH1_10188922 | rootH1_101889224 | 171 |
| 307 | 3300003693 | Ga0032354_1009872 | Ga0032354_100987216 | 171 |
| 308 | 3300005327 | Ga0070658_10030484 | Ga0070658_100304846 | 171 |
| 309 | 3300005329 | Ga0070683_100004175 | Ga0070683_10000417510 | 171 |
| 310 | 3300005330 | Ga0070690_100030946 | Ga0070690_1000309467 | 171 |
| 311 | 3300005337 | Ga0070682_100458803 | Ga0070682_1004588032 | 171 |
| 312 | 3300005337 | Ga0070682_100788564 | Ga0070682_1007885641 | 171 |
| 313 | 3300005338 | Ga0068868_100141043 | Ga0068868_1001410432 | 171 |
| 314 | 3300005339 | Ga0070660_100422572 | Ga0070660_1004225722 | 171 |
| 315 | 3300005340 | Ga0070689_100061460 | Ga0070689_1000614606 | 171 |
| 316 | 3300005340 | Ga0070689_100148496 | Ga0070689_1001484961 | 171 |
| 317 | 3300005343 | Ga0070687_100102888 | Ga0070687_1001028884 | 171 |
| 318 | 3300005354 | Ga0070675_100049635 | Ga0070675_1000496356 | 171 |
| 319 | 3300005356 | Ga0070674_100483983 | Ga0070674_1004839832 | 171 |
| 320 | 3300005364 | Ga0070673_100133910 | Ga0070673_1001339103 | 171 |
| 321 | 3300005364 | Ga0070673_100270803 | Ga0070673_1002708033 | 171 |
| 322 | 3300005364 | Ga0070673_100289316 | Ga0070673_1002893163 | 171 |
| 323 | 3300005365 | Ga0070688_100050485 | Ga0070688_1000504852 | 171 |
| 324 | 3300005365 | Ga0070688_100077192 | Ga0070688_1000771922 | 171 |
| 325 | 3300005365 | Ga0070688_100084618 | Ga0070688_1000846184 | 171 |
| 326 | 3300005367 | Ga0070667_101162910 | Ga0070667_1011629101 | 171 |
| 327 | 3300005456 | Ga0070678_100050282 | Ga0070678_1000502823 | 171 |
| 328 | 3300005466 | Ga0070685_10033482 | Ga0070685_100334824 | 171 |
| 329 | 3300005535 | Ga0070684_100034321 | Ga0070684_1000343211 | 171 |
| 330 | 3300005535 | Ga0070684_100186707 | Ga0070684_1001867074 | 171 |
| 331 | 3300005539 | Ga0068853_100002850 | Ga0068853_10000285013 | 171 |
| 332 | 3300005543 | Ga0070672_100064132 | Ga0070672_1000641326 | 171 |
| 333 | 3300005543 | Ga0070672_100450237 | Ga0070672_1004502372 | 171 |
| 334 | 3300005544 | Ga0070686_100006132 | Ga0070686_1000061322 | 171 |
| 335 | 3300005563 | Ga0068855_100223754 | Ga0068855_1002237543 | 171 |
| 336 | 3300005614 | Ga0068856_100078416 | Ga0068856_1000784163 | 171 |
| 337 | 3300005615 | Ga0070702_100141947 | Ga0070702_1001419473 | 171 |
| 338 | 3300005616 | Ga0068852_100675542 | Ga0068852_1006755422 | 171 |
| 339 | 3300005618 | Ga0068864_100528194 | Ga0068864_1005281942 | 171 |
| 340 | 3300005618 | Ga0068864_100593828 | Ga0068864_1005938282 | 171 |
| 341 | 3300005843 | Ga0068860_100357814 | Ga0068860_1003578143 | 171 |
| 342 | 3300006358 | Ga0068871_100256492 | Ga0068871_1002564923 | 171 |
| 343 | 3300006844 | Ga0075428_100861603 | Ga0075428_1008616032 | 171 |
| 344 | 3300009094 | Ga0111539_10214617 | Ga0111539_102146175 | 171 |
| 345 | 3300009147 | Ga0114129_10126592 | Ga0114129_101265923 | 171 |
| 346 | 3300009177 | Ga0105248_10745197 | Ga0105248_107451972 | 171 |
| 347 | 3300009545 | Ga0105237_10885161 | Ga0105237_108851612 | 171 |
| 348 | 3300009551 | Ga0105238_10022051 | Ga0105238_100220519 | 171 |
| 349 | 3300010375 | Ga0105239_10413902 | Ga0105239_104139024 | 171 |
| 350 | 3300013297 | Ga0157378_10352400 | Ga0157378_103524002 | 171 |
| 351 | 3300013297 | Ga0157378_11670393 | Ga0157378_116703931 | 171 |
| 352 | 3300014745 | Ga0157377_10576000 | Ga0157377_105760001 | 171 |
| 353 | 3300020070 | Ga0206356_11464639 | Ga0206356_114646392 | 171 |
| 354 | 3300025899 | Ga0207642_10023568 | Ga0207642_100235684 | 171 |
| 355 | 3300025904 | Ga0207647_10379288 | Ga0207647_103792882 | 171 |
| 356 | 3300025916 | Ga0207663_10110382 | Ga0207663_101103824 | 171 |
| 357 | 3300025916 | Ga0207663_10916137 | Ga0207663_109161371 | 171 |
| 358 | 3300025917 | Ga0207660_10717801 | Ga0207660_107178011 | 171 |
| 359 | 3300025918 | Ga0207662_10036126 | Ga0207662_100361266 | 171 |
| 360 | 3300025918 | Ga0207662_10119311 | Ga0207662_101193114 | 171 |
| 361 | 3300025919 | Ga0207657_10108254 | Ga0207657_101082544 | 171 |
| 362 | 3300025924 | Ga0207694_10069793 | Ga0207694_100697936 | 171 |
| 363 | 3300025928 | Ga0207700_10155768 | Ga0207700_101557682 | 171 |
| 364 | 3300025936 | Ga0207670_10017436 | Ga0207670_100174366 | 171 |
| 365 | 3300025936 | Ga0207670_10156028 | Ga0207670_101560283 | 171 |
| 366 | 3300025940 | Ga0207691_10230106 | Ga0207691_102301061 | 171 |
| 367 | 3300025944 | Ga0207661_10007008 | Ga0207661_1000700810 | 171 |
| 368 | 3300025944 | Ga0207661_10070548 | Ga0207661_100705484 | 171 |
| 369 | 3300025960 | Ga0207651_10021221 | Ga0207651_100212214 | 171 |
| 370 | 3300025960 | Ga0207651_10045826 | Ga0207651_100458264 | 171 |
| 371 | 3300025960 | Ga0207651_10228346 | Ga0207651_102283464 | 171 |
| 372 | 3300025986 | Ga0207658_10938842 | Ga0207658_109388422 | 171 |
| 373 | 3300026041 | Ga0207639_10005667 | Ga0207639_100056673 | 171 |
| 374 | 3300026041 | Ga0207639_10595924 | Ga0207639_105959242 | 171 |
| 375 | 3300026067 | Ga0207678_11423702 | Ga0207678_114237021 | 171 |
| 376 | 3300026078 | Ga0207702_11198523 | Ga0207702_111985231 | 171 |
| 377 | 3300026095 | Ga0207676_10460360 | Ga0207676_104603602 | 171 |
| 378 | 3300026095 | Ga0207676_10716842 | Ga0207676_107168422 | 171 |
| 379 | 3300026095 | Ga0207676_11361061 | Ga0207676_113610612 | 171 |
| 380 | 3300026118 | Ga0207675_100995031 | Ga0207675_1009950311 | 171 |
| 381 | 3300026121 | Ga0207683_10094403 | Ga0207683_100944032 | 171 |
| 382 | 3300026142 | Ga0207698_10179531 | Ga0207698_101795312 | 171 |
| 383 | 3300027907 | Ga0207428_10017611 | Ga0207428_100176116 | 171 |
| 384 | 3300028666 | Ga0265336_10002452 | Ga0265336_1000245212 | 171 |
| 385 | 3300028666 | Ga0265336_10069504 | Ga0265336_100695041 | 171 |
| 386 | 3300028666 | Ga0265336_10087446 | Ga0265336_100874462 | 171 |
| 387 | 3300028794 | Ga0307515_10600584 | Ga0307515_106005842 | 171 |
| 388 | 3300028800 | Ga0265338_10001810 | Ga0265338_1000181023 | 171 |
| 389 | 3300028800 | Ga0265338_10191950 | Ga0265338_101919502 | 171 |
| 390 | 3300028800 | Ga0265338_10554871 | Ga0265338_105548711 | 171 |
| 391 | 3300031238 | Ga0265332_10040797 | Ga0265332_100407972 | 171 |
| 392 | 3300031238 | Ga0265332_10047768 | Ga0265332_100477684 | 171 |
| 393 | 3300031239 | Ga0265328_10000172 | Ga0265328_1000017225 | 171 |
| 394 | 3300031240 | Ga0265320_10010819 | Ga0265320_100108198 | 171 |
| 395 | 3300031242 | Ga0265329_10045049 | Ga0265329_100450493 | 171 |
| 396 | 3300031247 | Ga0265340_10067657 | Ga0265340_100676573 | 171 |
| 397 | 3300031249 | Ga0265339_10006807 | Ga0265339_100068078 | 171 |
| 398 | 3300031249 | Ga0265339_10242013 | Ga0265339_102420131 | 171 |
| 399 | 3300031250 | Ga0265331_10026117 | Ga0265331_100261176 | 171 |
| 400 | 3300031344 | Ga0265316_10017518 | Ga0265316_100175187 | 171 |
| 401 | 3300031507 | Ga0307509_10246925 | Ga0307509_102469252 | 171 |
| 402 | 3300031595 | Ga0265313_10036999 | Ga0265313_100369992 | 171 |
| 403 | 3300031711 | Ga0265314_10001397 | Ga0265314_1000139714 | 171 |
| 404 | 3300031711 | Ga0265314_10004534 | Ga0265314_1000453417 | 171 |
| 405 | 3300031711 | Ga0265314_10086729 | Ga0265314_100867293 | 171 |
| 406 | 3300031712 | Ga0265342_10001254 | Ga0265342_1000125417 | 171 |
| 407 | 3300031712 | Ga0265342_10001889 | Ga0265342_1000188917 | 171 |
| 408 | 3300031712 | Ga0265342_10013077 | Ga0265342_100130776 | 171 |
| 409 | 3300031728 | Ga0316578_10315561 | Ga0316578_103155612 | 171 |
| 410 | 3300035111 | Ga0373923_0223919 | Ga0373923_0223919_201_755 | 171 |
| 411 | 3300035113 | Ga0373936_0091362 | Ga0373936_0091362_557_1111 | 171 |
| 412 | 3300035118 | Ga0373954_0028117 | Ga0373954_0028117_1184_1738 | 171 |
| 413 | 3300035118 | Ga0373954_0048783 | Ga0373954_0048783_790_1344 | 171 |
| 414 | 3300035118 | Ga0373954_0061842 | Ga0373954_0061842_265_816 | 171 |
| 415 | 3300035118 | Ga0373954_0073523 | Ga0373954_0073523_1057_1605 | 171 |
| 416 | 3300035119 | Ga0373956_0023587 | Ga0373956_0023587_115_669 | 171 |
| 417 | 3300035171 | Ga0373946_0032634 | Ga0373946_0032634_821_1375 | 171 |
| 418 | 3300035691 | Ga0373931_0041283 | Ga0373931_0041283_818_1387 | 171 |
| 419 | 3300035692 | Ga0373935_0199170 | Ga0373935_0199170_131_685 | 171 |
| 420 | 3300035724 | Ga0373933_0069385 | Ga0373933_0069385_1077_1631 | 171 |
| 421 | 3300035724 | Ga0373933_0125719 | Ga0373933_0125719_863_1414 | 171 |
| 422 | 3300035724 | Ga0373933_0206114 | Ga0373933_0206114_537_1088 | 171 |
| 423 | 3300036401 | Ga0373937_0183070 | Ga0373937_0183070_387_941 | 171 |
| 424 | 3300037068 | Ga0373925_0587993 | Ga0373925_0587993_92_646 | 171 |
| 425 | 3300042876 | Ga0451577_0242446 | Ga0451577_0242446_282_833 | 171 |
| 426 | 3300044712 | Ga0453684_0000116 | Ga0453684_0000116_252862_253413 | 171 |
| 427 | 3300044712 | Ga0453684_1143788 | Ga0453684_1143788_128_676 | 171 |
| 428 | 3300046476 | Ga0495662_0097335 | Ga0495662_0097335_21_575 | 171 |
| 429 | 3300046477 | Ga0495664_0005945 | Ga0495664_0005945_2019_2573 | 171 |
| 430 | 3300046517 | Ga0495630_0165382 | Ga0495630_0165382_803_1357 | 171 |
| 431 | 3300046535 | Ga0495586_0043692 | Ga0495586_0043692_34_588 | 171 |
| 432 | 3300046616 | Ga0495668_0318683 | Ga0495668_0318683_147_698 | 171 |
| 433 | 3300046642 | Ga0495634_0000649 | Ga0495634_0000649_6812_7366 | 171 |
| 434 | 3300046675 | Ga0495657_0102867 | Ga0495657_0102867_972_1526 | 171 |
| 435 | 3300047319 | Ga0495674_0001336 | Ga0495674_0001336_16705_17259 | 171 |
| 436 | 3300048903 | Ga0496100_0801097 | Ga0496100_0801097_126_680 | 171 |
| 437 | 3300048912 | Ga0496109_0099816 | Ga0496109_0099816_1140_1685 | 171 |
| 438 | 3300048918 | Ga0496115_0302381 | Ga0496115_0302381_93_647 | 171 |
| 439 | 3300050511 | nmdc:mga08y16_20950_c1 | nmdc:mga08y16_20950_c1_2652_3206 | 171 |
| 440 | 3300053077 | Ga0495601_0016503 | Ga0495601_0016503_3857_4411 | 171 |
| 441 | 3300003781 | Ga0055536_1017591 | Ga0055536_10175913 | 172 |
| 442 | 3300003856 | Ga0058692_1000785 | Ga0058692_100078517 | 172 |
| 443 | 3300005337 | Ga0070682_100004587 | Ga0070682_1000045872 | 172 |
| 444 | 3300005366 | Ga0070659_100010672 | Ga0070659_1000106722 | 172 |
| 445 | 3300005539 | Ga0068853_100003768 | Ga0068853_10000376815 | 172 |
| 446 | 3300005563 | Ga0068855_100021141 | Ga0068855_10002114112 | 172 |
| 447 | 3300005985 | Ga0081539_10051462 | Ga0081539_100514622 | 172 |
| 448 | 3300006844 | Ga0075428_100538806 | Ga0075428_1005388063 | 172 |
| 449 | 3300009148 | Ga0105243_10917973 | Ga0105243_109179732 | 172 |
| 450 | 3300009174 | Ga0105241_10435095 | Ga0105241_104350952 | 172 |
| 451 | 3300009177 | Ga0105248_10057742 | Ga0105248_1005774210 | 172 |
| 452 | 3300009551 | Ga0105238_10037314 | Ga0105238_100373148 | 172 |
| 453 | 3300013100 | Ga0157373_10104415 | Ga0157373_101044153 | 172 |
| 454 | 3300013102 | Ga0157371_10011870 | Ga0157371_100118702 | 172 |
| 455 | 3300013104 | Ga0157370_10233935 | Ga0157370_102339353 | 172 |
| 456 | 3300013296 | Ga0157374_10079651 | Ga0157374_100796516 | 172 |
| 457 | 3300013307 | Ga0157372_10144665 | Ga0157372_101446652 | 172 |
| 458 | 3300013308 | Ga0157375_10472260 | Ga0157375_104722604 | 172 |
| 459 | 3300021384 | Ga0213876_10165535 | Ga0213876_101655352 | 172 |
| 460 | 3300025292 | Ga0209676_1004379 | Ga0209676_10043793 | 172 |
| 461 | 3300025298 | Ga0209050_1017914 | Ga0209050_10179143 | 172 |
| 462 | 3300025304 | Ga0209257_1024354 | Ga0209257_10243543 | 172 |
| 463 | 3300025911 | Ga0207654_10149686 | Ga0207654_101496863 | 172 |
| 464 | 3300025919 | Ga0207657_10533527 | Ga0207657_105335272 | 172 |
| 465 | 3300025924 | Ga0207694_10069504 | Ga0207694_100695046 | 172 |
| 466 | 3300025941 | Ga0207711_10129621 | Ga0207711_101296213 | 172 |
| 467 | 3300025949 | Ga0207667_10012000 | Ga0207667_100120008 | 172 |
| 468 | 3300026041 | Ga0207639_10064484 | Ga0207639_100644842 | 172 |
| 469 | 3300026116 | Ga0207674_10358305 | Ga0207674_103583052 | 172 |
| 470 | 3300031235 | Ga0265330_10001241 | Ga0265330_1000124118 | 172 |
| 471 | 3300031344 | Ga0265316_10004187 | Ga0265316_1000418717 | 172 |
| 472 | 3300039437 | Ga0436365_1643703 | Ga0436365_1643703_227_769 | 172 |
| 473 | 3300042876 | Ga0451577_0001597 | Ga0451577_0001597_10878_11414 | 172 |
| 474 | 3300042876 | Ga0451577_0045788 | Ga0451577_0045788_493_1029 | 172 |
| 475 | 3300044712 | Ga0453684_0000194 | Ga0453684_0000194_98896_99432 | 172 |
| 476 | 3300044712 | Ga0453684_0034156 | Ga0453684_0034156_5512_6048 | 172 |
| 477 | 3300044712 | Ga0453684_0236326 | Ga0453684_0236326_1052_1588 | 172 |
| 478 | 3300044712 | Ga0453684_0589304 | Ga0453684_0589304_645_1184 | 172 |
| 479 | 3300046459 | Ga0495629_0291700 | Ga0495629_0291700_213_749 | 172 |
| 480 | 3300046461 | Ga0495641_0078650 | Ga0495641_0078650_485_1021 | 172 |
| 481 | 3300046473 | Ga0495582_0087478 | Ga0495582_0087478_409_945 | 172 |
| 482 | 3300046681 | Ga0495647_0023213 | Ga0495647_0023213_952_1488 | 172 |
| 483 | 3300046683 | Ga0495658_0246579 | Ga0495658_0246579_468_1004 | 172 |
| 484 | 3300046690 | Ga0495624_0077788 | Ga0495624_0077788_861_1397 | 172 |
| 485 | 3300047321 | Ga0495676_0133580 | Ga0495676_0133580_797_1333 | 172 |
| 486 | 3300049569 | Ga0501032_0250066 | Ga0501032_0250066_254_781 | 172 |
| 487 | 3300049570 | Ga0501033_0112132 | Ga0501033_0112132_729_1256 | 172 |
| 488 | 3300049571 | Ga0501034_0008263 | Ga0501034_0008263_2698_3225 | 172 |
| 489 | 3300049573 | Ga0501037_0003640 | Ga0501037_0003640_698_1225 | 172 |
| 490 | 3300049579 | Ga0501043_0024041 | Ga0501043_0024041_552_1079 | 172 |
| 491 | 3300049586 | Ga0501070_0059869 | Ga0501070_0059869_878_1405 | 172 |
| 492 | 3300049822 | Ga0501035_0009970 | Ga0501035_0009970_2819_3346 | 172 |
| 493 | 3300049823 | Ga0501044_0121516 | Ga0501044_0121516_494_1021 | 172 |
| 494 | 3300005330 | Ga0070690_100006945 | Ga0070690_10000694511 | 173 |
| 495 | 3300005334 | Ga0068869_100175044 | Ga0068869_1001750441 | 173 |
| 496 | 3300005338 | Ga0068868_100203129 | Ga0068868_1002031291 | 173 |
| 497 | 3300005340 | Ga0070689_100122321 | Ga0070689_1001223212 | 173 |
| 498 | 3300005343 | Ga0070687_100030365 | Ga0070687_1000303651 | 173 |
| 499 | 3300005364 | Ga0070673_100172506 | Ga0070673_1001725063 | 173 |
| 500 | 3300005364 | Ga0070673_100229659 | Ga0070673_1002296592 | 173 |
| 501 | 3300005365 | Ga0070688_100055298 | Ga0070688_1000552984 | 173 |
| 502 | 3300005535 | Ga0070684_100246367 | Ga0070684_1002463673 | 173 |
| 503 | 3300005535 | Ga0070684_100254645 | Ga0070684_1002546452 | 173 |
| 504 | 3300005544 | Ga0070686_100008053 | Ga0070686_10000805310 | 173 |
| 505 | 3300005546 | Ga0070696_100050189 | Ga0070696_1000501893 | 173 |
| 506 | 3300005547 | Ga0070693_100259652 | Ga0070693_1002596522 | 173 |
| 507 | 3300005563 | Ga0068855_100006029 | Ga0068855_10000602916 | 173 |
| 508 | 3300005577 | Ga0068857_100117726 | Ga0068857_1001177264 | 173 |
| 509 | 3300005616 | Ga0068852_100171595 | Ga0068852_1001715953 | 173 |
| 510 | 3300005617 | Ga0068859_100158427 | Ga0068859_1001584272 | 173 |
| 511 | 3300005844 | Ga0068862_100203189 | Ga0068862_1002031892 | 173 |
| 512 | 3300005981 | Ga0081538_10106324 | Ga0081538_101063242 | 173 |
| 513 | 3300006237 | Ga0097621_100001348 | Ga0097621_10000134816 | 173 |
| 514 | 3300006358 | Ga0068871_100000763 | Ga0068871_10000076316 | 173 |
| 515 | 3300006844 | Ga0075428_100022001 | Ga0075428_1000220016 | 173 |
| 516 | 3300006846 | Ga0075430_100536529 | Ga0075430_1005365292 | 173 |
| 517 | 3300006847 | Ga0075431_100033449 | Ga0075431_1000334494 | 173 |
| 518 | 3300006931 | Ga0097620_100158439 | Ga0097620_1001584392 | 173 |
| 519 | 3300007076 | Ga0075435_100114268 | Ga0075435_1001142683 | 173 |
| 520 | 3300007265 | Ga0099794_10043462 | Ga0099794_100434622 | 173 |
| 521 | 3300009094 | Ga0111539_10432969 | Ga0111539_104329692 | 173 |
| 522 | 3300009094 | Ga0111539_10640704 | Ga0111539_106407042 | 173 |
| 523 | 3300009147 | Ga0114129_10144198 | Ga0114129_101441984 | 173 |
| 524 | 3300009147 | Ga0114129_10513346 | Ga0114129_105133463 | 173 |
| 525 | 3300009147 | Ga0114129_11191028 | Ga0114129_111910282 | 173 |
| 526 | 3300009177 | Ga0105248_10746019 | Ga0105248_107460192 | 173 |
| 527 | 3300014969 | Ga0157376_10130727 | Ga0157376_101307274 | 173 |
| 528 | 3300025898 | Ga0207692_10032528 | Ga0207692_100325283 | 173 |
| 529 | 3300025903 | Ga0207680_10145936 | Ga0207680_101459363 | 173 |
| 530 | 3300025907 | Ga0207645_10082768 | Ga0207645_100827684 | 173 |
| 531 | 3300025908 | Ga0207643_10011769 | Ga0207643_100117697 | 173 |
| 532 | 3300025918 | Ga0207662_10009139 | Ga0207662_100091396 | 173 |
| 533 | 3300025918 | Ga0207662_10617621 | Ga0207662_106176211 | 173 |
| 534 | 3300025925 | Ga0207650_10016378 | Ga0207650_1001637810 | 173 |
| 535 | 3300025926 | Ga0207659_10281980 | Ga0207659_102819802 | 173 |
| 536 | 3300025940 | Ga0207691_10351045 | Ga0207691_103510452 | 173 |
| 537 | 3300025942 | Ga0207689_10375899 | Ga0207689_103758991 | 173 |
| 538 | 3300025944 | Ga0207661_10057404 | Ga0207661_100574046 | 173 |
| 539 | 3300025944 | Ga0207661_10151347 | Ga0207661_101513473 | 173 |
| 540 | 3300025949 | Ga0207667_10000358 | Ga0207667_1000035816 | 173 |
| 541 | 3300025960 | Ga0207651_10274524 | Ga0207651_102745242 | 173 |
| 542 | 3300025960 | Ga0207651_10307280 | Ga0207651_103072802 | 173 |
| 543 | 3300026023 | Ga0207677_10174178 | Ga0207677_101741784 | 173 |
| 544 | 3300026035 | Ga0207703_10263798 | Ga0207703_102637982 | 173 |
| 545 | 3300026089 | Ga0207648_10390627 | Ga0207648_103906272 | 173 |
| 546 | 3300026116 | Ga0207674_10057822 | Ga0207674_100578225 | 173 |
| 547 | 3300026118 | Ga0207675_100560357 | Ga0207675_1005603573 | 173 |
| 548 | 3300026142 | Ga0207698_10158112 | Ga0207698_101581123 | 173 |
| 549 | 3300027364 | Ga0209967_1000358 | Ga0209967_10003589 | 173 |
| 550 | 3300027378 | Ga0209981_1039323 | Ga0209981_10393232 | 173 |
| 551 | 3300027395 | Ga0209996_1014019 | Ga0209996_10140192 | 173 |
| 552 | 3300027462 | Ga0210000_1012354 | Ga0210000_10123543 | 173 |
| 553 | 3300027471 | Ga0209995_1001135 | Ga0209995_10011354 | 173 |
| 554 | 3300027526 | Ga0209968_1001973 | Ga0209968_10019733 | 173 |
| 555 | 3300027543 | Ga0209999_1008412 | Ga0209999_10084124 | 173 |
| 556 | 3300028380 | Ga0268265_10215412 | Ga0268265_102154122 | 173 |
| 557 | 3300031548 | Ga0307408_100171421 | Ga0307408_1001714212 | 173 |
| 558 | 3300031731 | Ga0307405_10084665 | Ga0307405_100846652 | 173 |
| 559 | 3300031731 | Ga0307405_10560462 | Ga0307405_105604622 | 173 |
| 560 | 3300031852 | Ga0307410_10069857 | Ga0307410_100698574 | 173 |
| 561 | 3300031903 | Ga0307407_10287024 | Ga0307407_102870243 | 173 |
| 562 | 3300032002 | Ga0307416_100408942 | Ga0307416_1004089422 | 173 |
| 563 | 3300032002 | Ga0307416_100509346 | Ga0307416_1005093463 | 173 |
| 564 | 3300032002 | Ga0307416_100751083 | Ga0307416_1007510832 | 173 |
| 565 | 3300032005 | Ga0307411_10035780 | Ga0307411_100357803 | 173 |
| 566 | 3300032005 | Ga0307411_10116566 | Ga0307411_101165663 | 173 |
| 567 | 3300034819 | Ga0373958_0006655 | Ga0373958_0006655_748_1281 | 173 |
| 568 | 3300035092 | Ga0373952_0143843 | Ga0373952_0143843_33_566 | 173 |
| 569 | 3300035111 | Ga0373923_0037762 | Ga0373923_0037762_763_1296 | 173 |
| 570 | 3300035112 | Ga0373932_0122931 | Ga0373932_0122931_189_722 | 173 |
| 571 | 3300035119 | Ga0373956_0004261 | Ga0373956_0004261_4263_4796 | 173 |
| 572 | 3300035172 | Ga0373955_0002904 | Ga0373955_0002904_4331_4864 | 173 |
| 573 | 3300035691 | Ga0373931_0127927 | Ga0373931_0127927_151_684 | 173 |
| 574 | 3300035724 | Ga0373933_0029527 | Ga0373933_0029527_1008_1541 | 173 |
| 575 | 3300036401 | Ga0373937_0002498 | Ga0373937_0002498_7418_7951 | 173 |
| 576 | 3300041441 | Ga0451787_677116 | Ga0451787_677116_159_692 | 173 |
| 577 | 3300042156 | Ga0439446_0005512 | Ga0439446_0005512_569_1102 | 173 |
| 578 | 3300042435 | Ga0439434_0125201 | Ga0439434_0125201_16_549 | 173 |
| 579 | 3300042436 | Ga0439435_0000723 | Ga0439435_0000723_613_1146 | 173 |
| 580 | 3300046491 | Ga0495584_0281352 | Ga0495584_0281352_109_642 | 173 |
| 581 | 3300046528 | Ga0495642_0040298 | Ga0495642_0040298_1263_1796 | 173 |
| 582 | 3300046559 | Ga0495667_0007843 | Ga0495667_0007843_6149_6682 | 173 |
| 583 | 3300046615 | Ga0495656_0335825 | Ga0495656_0335825_84_617 | 173 |
| 584 | 3300046664 | Ga0495659_0042767 | Ga0495659_0042767_426_959 | 173 |
| 585 | 3300047319 | Ga0495674_0305483 | Ga0495674_0305483_544_1077 | 173 |
| 586 | 3300047471 | Ga0495684_0605913 | Ga0495684_0605913_80_613 | 173 |
| 587 | 3300049514 | Ga0501291_007417 | Ga0501291_007417_629_1162 | 173 |
| 588 | 3300049514 | Ga0501291_017783 | Ga0501291_017783_498_1031 | 173 |
| 589 | 3300049522 | Ga0501299_100846 | Ga0501299_100846_81_659 | 173 |
| 590 | 3300049568 | Ga0501031_0085694 | Ga0501031_0085694_1037_1570 | 173 |
| 591 | 3300049575 | Ga0501039_0074777 | Ga0501039_0074777_603_1136 | 173 |
| 592 | 3300049576 | Ga0501040_0175961 | Ga0501040_0175961_820_1353 | 173 |
| 593 | 3300049577 | Ga0501041_0100601 | Ga0501041_0100601_575_1108 | 173 |
| 594 | 3300049577 | Ga0501041_0478164 | Ga0501041_0478164_60_593 | 173 |
| 595 | 3300049578 | Ga0501042_0161937 | Ga0501042_0161937_867_1400 | 173 |
| 596 | 3300049579 | Ga0501043_0126658 | Ga0501043_0126658_631_1164 | 173 |
| 597 | 3300049582 | Ga0501048_0112107 | Ga0501048_0112107_733_1266 | 173 |
| 598 | 3300049582 | Ga0501048_0129189 | Ga0501048_0129189_307_840 | 173 |
| 599 | 3300049584 | Ga0501068_0033481 | Ga0501068_0033481_1389_1922 | 173 |
| 600 | 3300049587 | Ga0501071_0125408 | Ga0501071_0125408_865_1398 | 173 |
| 601 | 3300049588 | Ga0501072_0030599 | Ga0501072_0030599_3545_4078 | 173 |
| 602 | 3300049588 | Ga0501072_0051854 | Ga0501072_0051854_1782_2315 | 173 |
| 603 | 3300049588 | Ga0501072_0574872 | Ga0501072_0574872_159_692 | 173 |
| 604 | 3300049589 | Ga0501073_0008056 | Ga0501073_0008056_3886_4419 | 173 |
| 605 | 3300049591 | Ga0501075_0024398 | Ga0501075_0024398_3364_3897 | 173 |
| 606 | 3300049591 | Ga0501075_0207545 | Ga0501075_0207545_340_873 | 173 |
| 607 | 3300049591 | Ga0501075_0521002 | Ga0501075_0521002_134_667 | 173 |
| 608 | 3300049592 | Ga0501076_0047645 | Ga0501076_0047645_2286_2819 | 173 |
| 609 | 3300049592 | Ga0501076_0254546 | Ga0501076_0254546_144_677 | 173 |
| 610 | 3300049592 | Ga0501076_0454623 | Ga0501076_0454623_413_946 | 173 |
| 611 | 3300049593 | Ga0501077_0037441 | Ga0501077_0037441_2324_2857 | 173 |
| 612 | 3300049593 | Ga0501077_0129475 | Ga0501077_0129475_821_1354 | 173 |
| 613 | 3300049661 | Ga0501217_008735 | Ga0501217_008735_669_1202 | 173 |
| 614 | 3300049741 | Ga0501079_0223511 | Ga0501079_0223511_848_1381 | 173 |
| 615 | 3300049741 | Ga0501079_0370757 | Ga0501079_0370757_577_1110 | 173 |
| 616 | 3300049742 | Ga0501080_0001428 | Ga0501080_0001428_15243_15776 | 173 |
| 617 | 3300049742 | Ga0501080_0365193 | Ga0501080_0365193_561_1094 | 173 |
| 618 | 3300049743 | Ga0501081_0031168 | Ga0501081_0031168_2480_3013 | 173 |
| 619 | 3300049743 | Ga0501081_0153632 | Ga0501081_0153632_488_1021 | 173 |
| 620 | 3300049770 | Ga0501273_019264 | Ga0501273_019264_140_673 | 173 |
| 621 | 3300049779 | Ga0501283_018878 | Ga0501283_018878_388_921 | 173 |
| 622 | 3300049824 | Ga0501045_0754090 | Ga0501045_0754090_166_699 | 173 |
| 623 | 3300050507 | nmdc:mga05p37_139147_c1 | nmdc:mga05p37_139147_c1_1170_1703 | 173 |
| 624 | 3300050507 | nmdc:mga05p37_367510_c1 | nmdc:mga05p37_367510_c1_846_1388 | 173 |
| 625 | 3300050510 | nmdc:mga06r32_49740_c1 | nmdc:mga06r32_49740_c1_20_553 | 173 |
| 626 | 3300050511 | nmdc:mga08y16_108089_c1 | nmdc:mga08y16_108089_c1_2075_2608 | 173 |
| 627 | 3300050511 | nmdc:mga08y16_257425_c1 | nmdc:mga08y16_257425_c1_624_1157 | 173 |
| 628 | 3300054114 | Ga0501084_0111217 | Ga0501084_0111217_1395_1928 | 173 |
| 629 | 3300054114 | Ga0501084_0159890 | Ga0501084_0159890_945_1478 | 173 |
| 630 | 3300059426 | Ga0590077_027417 | Ga0590077_027417_596_1129 | 173 |
| 631 | 3300060353 | Ga0501082_1060100 | Ga0501082_1060100_39_572 | 173 |
| 632 | 3300061734 | Ga0530510_0538474 | Ga0530510_0538474_125_658 | 173 |
| 633 | 3300061734 | Ga0530510_0875769 | Ga0530510_0875769_18_551 | 173 |
| 634 | 3300001904 | JGI24736J21556_1001432 | JGI24736J21556_10014326 | 174 |
| 635 | 3300001915 | JGI24741J21665_1002594 | JGI24741J21665_10025946 | 174 |
| 636 | 3300001915 | JGI24741J21665_1003527 | JGI24741J21665_10035275 | 174 |
| 637 | 3300001915 | JGI24741J21665_1005405 | JGI24741J21665_10054052 | 174 |
| 638 | 3300001979 | JGI24740J21852_10000021 | JGI24740J21852_1000002151 | 174 |
| 639 | 3300001979 | JGI24740J21852_10035979 | JGI24740J21852_100359794 | 174 |
| 640 | 3300004803 | Ga0058862_12882013 | Ga0058862_128820133 | 174 |
| 641 | 3300005327 | Ga0070658_10235420 | Ga0070658_102354202 | 174 |
| 642 | 3300005329 | Ga0070683_100171208 | Ga0070683_1001712083 | 174 |
| 643 | 3300005329 | Ga0070683_100414698 | Ga0070683_1004146982 | 174 |
| 644 | 3300005336 | Ga0070680_100134858 | Ga0070680_1001348583 | 174 |
| 645 | 3300005336 | Ga0070680_100193212 | Ga0070680_1001932123 | 174 |
| 646 | 3300005336 | Ga0070680_100361640 | Ga0070680_1003616403 | 174 |
| 647 | 3300005337 | Ga0070682_100005710 | Ga0070682_1000057106 | 174 |
| 648 | 3300005337 | Ga0070682_100220158 | Ga0070682_1002201582 | 174 |
| 649 | 3300005339 | Ga0070660_100213139 | Ga0070660_1002131392 | 174 |
| 650 | 3300005341 | Ga0070691_10035321 | Ga0070691_100353215 | 174 |
| 651 | 3300005341 | Ga0070691_10069454 | Ga0070691_100694542 | 174 |
| 652 | 3300005341 | Ga0070691_10070502 | Ga0070691_100705023 | 174 |
| 653 | 3300005344 | Ga0070661_100035059 | Ga0070661_1000350593 | 174 |
| 654 | 3300005344 | Ga0070661_100308916 | Ga0070661_1003089163 | 174 |
| 655 | 3300005344 | Ga0070661_100383406 | Ga0070661_1003834061 | 174 |
| 656 | 3300005345 | Ga0070692_10097842 | Ga0070692_100978423 | 174 |
| 657 | 3300005345 | Ga0070692_10121246 | Ga0070692_101212463 | 174 |
| 658 | 3300005345 | Ga0070692_10187900 | Ga0070692_101879003 | 174 |
| 659 | 3300005366 | Ga0070659_100158561 | Ga0070659_1001585612 | 174 |
| 660 | 3300005366 | Ga0070659_100233463 | Ga0070659_1002334632 | 174 |
| 661 | 3300005366 | Ga0070659_100376913 | Ga0070659_1003769131 | 174 |
| 662 | 3300005366 | Ga0070659_100656636 | Ga0070659_1006566362 | 174 |
| 663 | 3300005457 | Ga0070662_100346748 | Ga0070662_1003467482 | 174 |
| 664 | 3300005458 | Ga0070681_10428714 | Ga0070681_104287142 | 174 |
| 665 | 3300005458 | Ga0070681_10447670 | Ga0070681_104476702 | 174 |
| 666 | 3300005530 | Ga0070679_100046691 | Ga0070679_1000466915 | 174 |
| 667 | 3300005530 | Ga0070679_100424735 | Ga0070679_1004247351 | 174 |
| 668 | 3300005530 | Ga0070679_100448761 | Ga0070679_1004487613 | 174 |
| 669 | 3300005530 | Ga0070679_100576876 | Ga0070679_1005768761 | 174 |
| 670 | 3300005535 | Ga0070684_100332896 | Ga0070684_1003328963 | 174 |
| 671 | 3300005535 | Ga0070684_100419938 | Ga0070684_1004199382 | 174 |
| 672 | 3300005539 | Ga0068853_100110968 | Ga0068853_1001109682 | 174 |
| 673 | 3300005539 | Ga0068853_100267160 | Ga0068853_1002671603 | 174 |
| 674 | 3300005539 | Ga0068853_100560009 | Ga0068853_1005600092 | 174 |
| 675 | 3300005539 | Ga0068853_101341539 | Ga0068853_1013415392 | 174 |
| 676 | 3300005546 | Ga0070696_100006375 | Ga0070696_1000063758 | 174 |
| 677 | 3300005546 | Ga0070696_101373913 | Ga0070696_1013739131 | 174 |
| 678 | 3300005547 | Ga0070693_100010949 | Ga0070693_1000109493 | 174 |
| 679 | 3300005564 | Ga0070664_100070218 | Ga0070664_1000702186 | 174 |
| 680 | 3300005578 | Ga0068854_100047152 | Ga0068854_1000471521 | 174 |
| 681 | 3300005578 | Ga0068854_100696532 | Ga0068854_1006965322 | 174 |
| 682 | 3300005614 | Ga0068856_100090766 | Ga0068856_1000907661 | 174 |
| 683 | 3300005614 | Ga0068856_100182072 | Ga0068856_1001820721 | 174 |
| 684 | 3300005614 | Ga0068856_100657568 | Ga0068856_1006575682 | 174 |
| 685 | 3300005616 | Ga0068852_100020534 | Ga0068852_10002053410 | 174 |
| 686 | 3300005616 | Ga0068852_100039943 | Ga0068852_1000399439 | 174 |
| 687 | 3300005616 | Ga0068852_101538692 | Ga0068852_1015386922 | 174 |
| 688 | 3300005834 | Ga0068851_10015238 | Ga0068851_100152386 | 174 |
| 689 | 3300005834 | Ga0068851_10371974 | Ga0068851_103719741 | 174 |
| 690 | 3300009093 | Ga0105240_10060137 | Ga0105240_100601374 | 174 |
| 691 | 3300009093 | Ga0105240_10391090 | Ga0105240_103910903 | 174 |
| 692 | 3300009093 | Ga0105240_10582943 | Ga0105240_105829431 | 174 |
| 693 | 3300009174 | Ga0105241_10112994 | Ga0105241_101129942 | 174 |
| 694 | 3300009174 | Ga0105241_10448524 | Ga0105241_104485242 | 174 |
| 695 | 3300009545 | Ga0105237_10365407 | Ga0105237_103654072 | 174 |
| 696 | 3300009545 | Ga0105237_10441781 | Ga0105237_104417812 | 174 |
| 697 | 3300009551 | Ga0105238_10042550 | Ga0105238_100425506 | 174 |
| 698 | 3300013100 | Ga0157373_10025259 | Ga0157373_100252598 | 174 |
| 699 | 3300013102 | Ga0157371_10122492 | Ga0157371_101224922 | 174 |
| 700 | 3300013102 | Ga0157371_10249901 | Ga0157371_102499013 | 174 |
| 701 | 3300013102 | Ga0157371_10393985 | Ga0157371_103939852 | 174 |
| 702 | 3300013102 | Ga0157371_10525154 | Ga0157371_105251541 | 174 |
| 703 | 3300013102 | Ga0157371_10620889 | Ga0157371_106208892 | 174 |
| 704 | 3300013104 | Ga0157370_10060742 | Ga0157370_100607425 | 174 |
| 705 | 3300013104 | Ga0157370_10431838 | Ga0157370_104318383 | 174 |
| 706 | 3300013105 | Ga0157369_10025057 | Ga0157369_100250579 | 174 |
| 707 | 3300013105 | Ga0157369_10163977 | Ga0157369_101639773 | 174 |
| 708 | 3300013105 | Ga0157369_10719878 | Ga0157369_107198782 | 174 |
| 709 | 3300013105 | Ga0157369_11711022 | Ga0157369_117110221 | 174 |
| 710 | 3300013307 | Ga0157372_10073028 | Ga0157372_100730282 | 174 |
| 711 | 3300013307 | Ga0157372_10121630 | Ga0157372_101216305 | 174 |
| 712 | 3300013307 | Ga0157372_10434420 | Ga0157372_104344203 | 174 |
| 713 | 3300013307 | Ga0157372_10748996 | Ga0157372_107489962 | 174 |
| 714 | 3300020069 | Ga0197907_10443089 | Ga0197907_104430896 | 174 |
| 715 | 3300020070 | Ga0206356_10645239 | Ga0206356_106452393 | 174 |
| 716 | 3300020070 | Ga0206356_11779262 | Ga0206356_117792626 | 174 |
| 717 | 3300020077 | Ga0206351_10126906 | Ga0206351_101269062 | 174 |
| 718 | 3300020078 | Ga0206352_11092907 | Ga0206352_1109290717 | 174 |
| 719 | 3300020080 | Ga0206350_10904125 | Ga0206350_109041253 | 174 |
| 720 | 3300020081 | Ga0206354_10159778 | Ga0206354_1015977813 | 174 |
| 721 | 3300020081 | Ga0206354_10693867 | Ga0206354_106938672 | 174 |
| 722 | 3300020081 | Ga0206354_10843824 | Ga0206354_108438248 | 174 |
| 723 | 3300020082 | Ga0206353_10129542 | Ga0206353_101295426 | 174 |
| 724 | 3300020082 | Ga0206353_10595977 | Ga0206353_105959772 | 174 |
| 725 | 3300020082 | Ga0206353_10961318 | Ga0206353_109613181 | 174 |
| 726 | 3300020610 | Ga0154015_1153700 | Ga0154015_11537005 | 174 |
| 727 | 3300020610 | Ga0154015_1332456 | Ga0154015_13324563 | 174 |
| 728 | 3300022467 | Ga0224712_10053363 | Ga0224712_100533633 | 174 |
| 729 | 3300022467 | Ga0224712_10525145 | Ga0224712_105251451 | 174 |
| 730 | 3300025321 | Ga0207656_10009267 | Ga0207656_100092674 | 174 |
| 731 | 3300025321 | Ga0207656_10388191 | Ga0207656_103881911 | 174 |
| 732 | 3300025904 | Ga0207647_10036662 | Ga0207647_100366626 | 174 |
| 733 | 3300025904 | Ga0207647_10266696 | Ga0207647_102666961 | 174 |
| 734 | 3300025904 | Ga0207647_10266916 | Ga0207647_102669162 | 174 |
| 735 | 3300025909 | Ga0207705_10004273 | Ga0207705_1000427318 | 174 |
| 736 | 3300025909 | Ga0207705_10006472 | Ga0207705_100064729 | 174 |
| 737 | 3300025909 | Ga0207705_10011179 | Ga0207705_100111792 | 174 |
| 738 | 3300025909 | Ga0207705_10013911 | Ga0207705_100139111 | 174 |
| 739 | 3300025911 | Ga0207654_10910828 | Ga0207654_109108281 | 174 |
| 740 | 3300025912 | Ga0207707_10000210 | Ga0207707_1000021018 | 174 |
| 741 | 3300025912 | Ga0207707_10001339 | Ga0207707_1000133918 | 174 |
| 742 | 3300025912 | Ga0207707_10010320 | Ga0207707_100103206 | 174 |
| 743 | 3300025912 | Ga0207707_10366855 | Ga0207707_103668553 | 174 |
| 744 | 3300025913 | Ga0207695_10006299 | Ga0207695_1000629918 | 174 |
| 745 | 3300025913 | Ga0207695_10022941 | Ga0207695_100229413 | 174 |
| 746 | 3300025913 | Ga0207695_10044284 | Ga0207695_100442848 | 174 |
| 747 | 3300025913 | Ga0207695_10044738 | Ga0207695_100447388 | 174 |
| 748 | 3300025917 | Ga0207660_10000360 | Ga0207660_1000036031 | 174 |
| 749 | 3300025917 | Ga0207660_10005835 | Ga0207660_1000583512 | 174 |
| 750 | 3300025917 | Ga0207660_10009553 | Ga0207660_100095536 | 174 |
| 751 | 3300025917 | Ga0207660_10041771 | Ga0207660_100417711 | 174 |
| 752 | 3300025917 | Ga0207660_10093040 | Ga0207660_100930404 | 174 |
| 753 | 3300025919 | Ga0207657_10057043 | Ga0207657_100570432 | 174 |
| 754 | 3300025919 | Ga0207657_10475918 | Ga0207657_104759181 | 174 |
| 755 | 3300025919 | Ga0207657_11036117 | Ga0207657_110361171 | 174 |
| 756 | 3300025920 | Ga0207649_10002213 | Ga0207649_1000221318 | 174 |
| 757 | 3300025920 | Ga0207649_10030130 | Ga0207649_100301305 | 174 |
| 758 | 3300025920 | Ga0207649_10155028 | Ga0207649_101550283 | 174 |
| 759 | 3300025920 | Ga0207649_10291796 | Ga0207649_102917963 | 174 |
| 760 | 3300025921 | Ga0207652_10004193 | Ga0207652_1000419310 | 174 |
| 761 | 3300025921 | Ga0207652_10005745 | Ga0207652_1000574514 | 174 |
| 762 | 3300025921 | Ga0207652_10013571 | Ga0207652_100135716 | 174 |
| 763 | 3300025921 | Ga0207652_10149440 | Ga0207652_101494404 | 174 |
| 764 | 3300025921 | Ga0207652_10585895 | Ga0207652_105858952 | 174 |
| 765 | 3300025924 | Ga0207694_10025532 | Ga0207694_100255329 | 174 |
| 766 | 3300025932 | Ga0207690_10003289 | Ga0207690_1000328918 | 174 |
| 767 | 3300025932 | Ga0207690_10005316 | Ga0207690_100053163 | 174 |
| 768 | 3300025932 | Ga0207690_10078622 | Ga0207690_100786225 | 174 |
| 769 | 3300025933 | Ga0207706_10019518 | Ga0207706_1001951810 | 174 |
| 770 | 3300025944 | Ga0207661_10004252 | Ga0207661_1000425218 | 174 |
| 771 | 3300025944 | Ga0207661_10015870 | Ga0207661_100158708 | 174 |
| 772 | 3300025944 | Ga0207661_10058289 | Ga0207661_100582891 | 174 |
| 773 | 3300025944 | Ga0207661_10139755 | Ga0207661_101397552 | 174 |
| 774 | 3300025944 | Ga0207661_10779862 | Ga0207661_107798622 | 174 |
| 775 | 3300025945 | Ga0207679_10007471 | Ga0207679_1000747110 | 174 |
| 776 | 3300025945 | Ga0207679_10027652 | Ga0207679_100276522 | 174 |
| 777 | 3300025949 | Ga0207667_10008758 | Ga0207667_100087588 | 174 |
| 778 | 3300025949 | Ga0207667_10009904 | Ga0207667_100099047 | 174 |
| 779 | 3300025949 | Ga0207667_10010803 | Ga0207667_1001080318 | 174 |
| 780 | 3300025949 | Ga0207667_10135136 | Ga0207667_101351363 | 174 |
| 781 | 3300025981 | Ga0207640_10002025 | Ga0207640_100020256 | 174 |
| 782 | 3300025981 | Ga0207640_10003985 | Ga0207640_1000398512 | 174 |
| 783 | 3300025981 | Ga0207640_10004259 | Ga0207640_100042599 | 174 |
| 784 | 3300025981 | Ga0207640_10103079 | Ga0207640_101030793 | 174 |
| 785 | 3300026041 | Ga0207639_10000231 | Ga0207639_1000023122 | 174 |
| 786 | 3300026041 | Ga0207639_10008268 | Ga0207639_100082686 | 174 |
| 787 | 3300026041 | Ga0207639_10018424 | Ga0207639_100184245 | 174 |
| 788 | 3300026067 | Ga0207678_10018442 | Ga0207678_100184426 | 174 |
| 789 | 3300026067 | Ga0207678_10056807 | Ga0207678_100568072 | 174 |
| 790 | 3300026067 | Ga0207678_10584235 | Ga0207678_105842352 | 174 |
| 791 | 3300026067 | Ga0207678_11355407 | Ga0207678_113554071 | 174 |
| 792 | 3300026078 | Ga0207702_10006690 | Ga0207702_100066901 | 174 |
| 793 | 3300026078 | Ga0207702_10078446 | Ga0207702_100784466 | 174 |
| 794 | 3300026078 | Ga0207702_10106909 | Ga0207702_101069095 | 174 |
| 795 | 3300026116 | Ga0207674_10301678 | Ga0207674_103016781 | 174 |
| 796 | 3300026142 | Ga0207698_10003169 | Ga0207698_100031699 | 174 |
| 797 | 3300026142 | Ga0207698_10053564 | Ga0207698_100535646 | 174 |
| 798 | 3300026142 | Ga0207698_10300931 | Ga0207698_103009312 | 174 |
| 799 | 3300036647 | Ga0316582_0075143 | Ga0316582_0075143_37_570 | 174 |
| 800 | 3300037312 | Ga0395899_0182864 | Ga0395899_0182864_559_1083 | 174 |
| 801 | 3300037418 | Ga0395900_0015556 | Ga0395900_0015556_6402_6926 | 174 |
| 802 | 3300037418 | Ga0395900_0153997 | Ga0395900_0153997_71_595 | 174 |
| 803 | 3300037466 | Ga0395898_0034826 | Ga0395898_0034826_3469_3993 | 174 |
| 804 | 3300037466 | Ga0395898_0118682 | Ga0395898_0118682_475_999 | 174 |
| 805 | 3300038443 | Ga0395901_0020479 | Ga0395901_0020479_3469_3993 | 174 |
| 806 | 3300038443 | Ga0395901_0966513 | Ga0395901_0966513_244_768 | 174 |
| 807 | 3300049570 | Ga0501033_0669759 | Ga0501033_0669759_172_696 | 174 |
| 808 | 3300049571 | Ga0501034_0368469 | Ga0501034_0368469_554_1078 | 174 |
| 809 | 3300049573 | Ga0501037_0009833 | Ga0501037_0009833_5256_5780 | 174 |
| 810 | 3300049573 | Ga0501037_0179035 | Ga0501037_0179035_271_795 | 174 |
| 811 | 3300049581 | Ga0501047_0013042 | Ga0501047_0013042_3087_3611 | 174 |
| 812 | 3300049581 | Ga0501047_0225379 | Ga0501047_0225379_295_819 | 174 |
| 813 | 3300049585 | Ga0501069_0009337 | Ga0501069_0009337_25_549 | 174 |
| 814 | 3300049586 | Ga0501070_0006574 | Ga0501070_0006574_7415_7939 | 174 |
| 815 | 3300049586 | Ga0501070_0008005 | Ga0501070_0008005_1059_1583 | 174 |
| 816 | 3300049586 | Ga0501070_0011369 | Ga0501070_0011369_5269_5793 | 174 |
| 817 | 3300049586 | Ga0501070_0053065 | Ga0501070_0053065_153_677 | 174 |
| 818 | 3300049586 | Ga0501070_0085817 | Ga0501070_0085817_1745_2269 | 174 |
| 819 | 3300049586 | Ga0501070_0173000 | Ga0501070_0173000_192_716 | 174 |
| 820 | 3300049586 | Ga0501070_0753105 | Ga0501070_0753105_42_566 | 174 |
| 821 | 3300049586 | Ga0501070_1098754 | Ga0501070_1098754_14_538 | 174 |
| 822 | 3300049587 | Ga0501071_0004109 | Ga0501071_0004109_5744_6268 | 174 |
| 823 | 3300049587 | Ga0501071_0263177 | Ga0501071_0263177_16_540 | 174 |
| 824 | 3300049589 | Ga0501073_0001831 | Ga0501073_0001831_7968_8492 | 174 |
| 825 | 3300049589 | Ga0501073_0147856 | Ga0501073_0147856_429_953 | 174 |
| 826 | 3300049590 | Ga0501074_0000980 | Ga0501074_0000980_10802_11326 | 174 |
| 827 | 3300049590 | Ga0501074_0029541 | Ga0501074_0029541_740_1264 | 174 |
| 828 | 3300049590 | Ga0501074_0933708 | Ga0501074_0933708_27_551 | 174 |
| 829 | 3300049593 | Ga0501077_0156314 | Ga0501077_0156314_171_695 | 174 |
| 830 | 3300049593 | Ga0501077_0282312 | Ga0501077_0282312_474_998 | 174 |
| 831 | 3300049741 | Ga0501079_0279849 | Ga0501079_0279849_132_656 | 174 |
| 832 | 3300049742 | Ga0501080_0002282 | Ga0501080_0002282_7484_8008 | 174 |
| 833 | 3300049742 | Ga0501080_0046155 | Ga0501080_0046155_1717_2241 | 174 |
| 834 | 3300049822 | Ga0501035_0189691 | Ga0501035_0189691_317_841 | 174 |
| 835 | 3300049822 | Ga0501035_0243400 | Ga0501035_0243400_785_1309 | 174 |
| 836 | 3300049823 | Ga0501044_0006317 | Ga0501044_0006317_1170_1694 | 174 |
| 837 | 3300049823 | Ga0501044_0145476 | Ga0501044_0145476_624_1148 | 174 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8fn2-assembly1.cif.gz_H | the structure of a 50s ribosomal subunit in the lyme disease pathogen borreliella burgdorferi | 0.9671 | 1 | 169 |
| 5x8t-assembly1.cif.gz_G | structure of the 50s large subunit of chloroplast ribosome from spinach | 0.9624 | 3 | 171 |
| 6v3b-assembly1.cif.gz_G | cryo-em structure of the acinetobacter baumannii ribosome: 70s in empty state | 0.9616 | 2 | 171 |
| 8cvm-assembly1.cif.gz_g | cutibacterium acnes 50s ribosomal subunit with p-site trna and sarecycline bound in the local refined map | 0.9564 | 2 | 174 |
| 3j9w-assembly1.cif.gz_BH | cryo-em structure of the bacillus subtilis mifm-stalled ribosome complex | 0.956 | 2 | 171 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q09865_118_210_3.90.930.12 | Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 | 0.9802 | 80 | 171 | 3.90.930.12 |
| af_O21037_77_170_3.90.930.12 | Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 | 0.9785 | 80 | 171 | 3.90.930.12 |
| af_Q6AU10_7_103_3.90.930.12 | Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 | 0.9699 | 82 | 174 | 3.90.930.12 |
| af_Q09865_118_210_3.90.930.12 | Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 | 0.9597 | 80 | 171 | 3.90.930.12 |
| 3knmH02 | Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 | 0.9596 | 80 | 165 | 3.90.930.12 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2J1D431-F1-model_v4 | deleted | 0.9924 | 70 | 165 |
|
| AF-X1G5X1-F1-model_v4 | Large ribosomal subunit protein uL6 alpha-beta domain-containing protein | 0.9916 | 79 | 151 |
GO:0002181
GO:0003735 GO:0019843 GO:0022625 |
| AF-A0A2V5P1Y2-F1-model_v4 | 50S ribosomal protein L6 | 0.9911 | 78 | 171 |
GO:0002181
GO:0003735 GO:0019843 GO:0022625 |
| AF-A0A358FVP3-F1-model_v4 | 50S ribosomal protein L6 | 0.9902 | 78 | 158 |
GO:0002181
GO:0003735 GO:0019843 GO:0022625 |
| AF-A0A527GEM6-F1-model_v4 | 50S ribosomal protein L6 | 0.9895 | 83 | 157 |
GO:0002181
GO:0003735 GO:0019843 GO:0022625 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar