F482879

General Info

Members Datasets Scaffolds Average Seq Length
836 328 1672 211

Family's Representative Sequence

Representative Sequence 3300010375|Ga0105239_10044659|Ga0105239_100446596
Length 231
Sequence MYGGFAISMADPPFCVKYAQAVIRVRLFAGLREQAGWSQRELDVATVADVWPALGLGEEPAGLLYAVNREYAEPDRELHNGDEVALIPPVSGGADDVLLTADPLSLDAAVRAAASDEAGAVATFVGTVRRQSRGREVTRLEYEAYAEMAEDVMAQLARDLEERYDLCAVAIHHRVGALAIGEASVVIAVSAPHRQDALAACKDAIDRLKETVPLWKKEVYEGGEEWIGRGS

Samples

Sample ID Description Type Environment
1 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
70 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
71 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
72 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
73 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
74 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
75 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
76 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
80 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
81 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
82 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
83 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
84 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
100 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
101 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
110 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
111 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
112 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
113 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
114 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
119 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
174 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
177 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
178 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
179 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
180 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
181 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
182 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
183 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
184 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
185 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
186 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
187 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
188 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
189 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
190 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
191 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
192 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
193 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
194 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
195 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
196 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
197 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
198 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
199 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
200 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
201 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
202 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
203 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
204 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
205 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
206 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
207 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
208 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
209 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
210 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
211 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
212 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
213 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
214 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
215 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
216 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
217 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
218 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
219 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
220 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
221 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
222 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
223 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
224 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
225 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
226 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
227 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
228 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
229 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
230 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
231 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
232 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
233 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
234 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
235 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
236 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
237 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
238 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
239 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
240 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
241 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
242 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
243 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
244 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
245 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
246 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
247 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
248 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
249 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
250 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
251 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
252 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
253 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
254 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
255 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
256 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
257 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
258 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
259 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
260 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
261 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
262 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
263 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
264 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
265 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
266 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
267 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
268 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
269 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
270 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
271 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
272 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
273 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
274 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
275 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
276 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
277 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
278 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
279 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
280 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
282 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
283 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
285 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
286 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
288 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
292 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
293 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
294 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
295 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
296 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
297 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
298 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
299 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
300 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
301 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
302 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
303 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
304 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
305 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
306 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
307 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
308 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
310 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
311 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
312 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
313 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
314 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
315 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
316 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
317 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
318 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
319 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
320 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
321 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
322 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
323 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
324 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
325 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
326 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
327 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
328 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.28
Metatranscriptomes 0.72
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.48
Nodule 0
Rhizoplane 12.92
Rhizosphere 86.24
Stem 0
Stem Tuber 0
Unclassified 8.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105239_10044659 3300010375 Bacteria 4857
2 JGI24751J29686_10014635 3300002459 Bacteria 1618
3 JGI25406J46586_10053215 3300003203 Bacteria 1345
4 JGI25407J50210_10000770 3300003373 Bacteria 6751
5 Ga0070658_10350605 3300005327 Bacteria 1263
6 Ga0070658_10674471 3300005327 Bacteria 897
7 Ga0070676_10441138 3300005328 Bacteria 914
8 Ga0070683_100013511 3300005329 Bacteria 7123
9 Ga0070683_100026943 3300005329 Bacteria 5180
10 Ga0070683_100047293 3300005329 Bacteria 3975
11 Ga0070683_100090017 3300005329 Bacteria 2881
12 Ga0070683_100093890 3300005329 Bacteria 2819
13 Ga0070683_100107591 3300005329 Bacteria 2629
14 Ga0070683_100126091 3300005329 Bacteria 2420
15 Ga0070683_100188032 3300005329 Bacteria 1961
16 Ga0070683_100212043 3300005329 Bacteria 1840
17 Ga0070690_100019595 3300005330 Bacteria 4109
18 Ga0070690_100034526 3300005330 Bacteria 3169
19 Ga0070670_100007727 3300005331 Bacteria 9144
20 Ga0070670_100191050 3300005331 Bacteria 1779
21 Ga0070670_100518669 3300005331 Bacteria 1061
22 Ga0070677_10058660 3300005333 Bacteria 1581
23 Ga0070677_10186806 3300005333 Unclassified 991
24 Ga0068869_100029542 3300005334 Bacteria 3842
25 Ga0068869_100755134 3300005334 Bacteria 833
26 Ga0070680_100039196 3300005336 Bacteria 3834
27 Ga0070680_100062948 3300005336 Bacteria 3039
28 Ga0070680_100071052 3300005336 Bacteria 2860
29 Ga0070680_100084186 3300005336 Bacteria 2626
30 Ga0070680_100110932 3300005336 Bacteria 2283
31 Ga0070682_100045949 3300005337 Bacteria 2709
32 Ga0068868_100029440 3300005338 Bacteria 4205
33 Ga0068868_100040408 3300005338 Bacteria 3630
34 Ga0068868_100059846 3300005338 Bacteria 3014
35 Ga0068868_100086877 3300005338 Bacteria 2515
36 Ga0070660_100122232 3300005339 Bacteria 2078
37 Ga0070660_100186203 3300005339 Bacteria 1681
38 Ga0070660_100389158 3300005339 Bacteria 1152
39 Ga0070660_100664619 3300005339 Bacteria 873
40 Ga0070689_100014951 3300005340 Bacteria 5650
41 Ga0070689_100020156 3300005340 Bacteria 4945
42 Ga0070691_10078402 3300005341 Bacteria 1613
43 Ga0070687_100077154 3300005343 Bacteria 1807
44 Ga0070661_100027680 3300005344 Bacteria 4084
45 Ga0070668_100291126 3300005347 Bacteria 1367
46 Ga0070668_100585297 3300005347 Bacteria 975
47 Ga0070669_100241960 3300005353 Bacteria 1434
48 Ga0070671_100074414 3300005355 Bacteria 2838
49 Ga0070671_100085697 3300005355 Bacteria 2636
50 Ga0070671_100242059 3300005355 Bacteria 1532
51 Ga0070674_100004980 3300005356 Bacteria 7615
52 Ga0070674_100005962 3300005356 Bacteria 7084
53 Ga0070674_100059685 3300005356 Bacteria 2656
54 Ga0070673_100210876 3300005364 Bacteria 1677
55 Ga0070673_100589466 3300005364 Bacteria 1013
56 Ga0070688_100024520 3300005365 Bacteria 3560
57 Ga0070659_100051870 3300005366 Bacteria 3225
58 Ga0070709_10127352 3300005434 Bacteria 1734
59 Ga0070714_100184212 3300005435 Bacteria 1902
60 Ga0070714_100287713 3300005435 Bacteria 1529
61 Ga0070713_100301499 3300005436 Bacteria 1475
62 Ga0070710_10013945 3300005437 Bacteria 4036
63 Ga0070710_10405742 3300005437 Unclassified 914
64 Ga0070701_10005292 3300005438 Bacteria 5315
65 Ga0070701_10038856 3300005438 Bacteria 2411
66 Ga0070711_100007272 3300005439 Bacteria 6729
67 Ga0070705_100117116 3300005440 Bacteria 1713
68 Ga0070705_100201468 3300005440 Bacteria 1365
69 Ga0070700_100003305 3300005441 Bacteria 8313
70 Ga0070700_100026488 3300005441 Bacteria 3424
71 Ga0070700_100048276 3300005441 Bacteria 2638
72 Ga0070694_100111249 3300005444 Bacteria 1951
73 Ga0070708_100039060 3300005445 Bacteria 4150
74 Ga0070663_100024955 3300005455 Bacteria 4031
75 Ga0070663_100171550 3300005455 Bacteria 1677
76 Ga0070663_100371220 3300005455 Unclassified 1163
77 Ga0070678_100023954 3300005456 Bacteria 4077
78 Ga0070678_100027885 3300005456 Bacteria 3842
79 Ga0070662_100199148 3300005457 Bacteria 1588
80 Ga0070662_100268052 3300005457 Bacteria 1378
81 Ga0070662_100503178 3300005457 Bacteria 1011
82 Ga0070681_10007560 3300005458 Bacteria 10619
83 Ga0070681_10174916 3300005458 Bacteria 2068
84 Ga0068867_100101821 3300005459 Bacteria 2195
85 Ga0068867_100125999 3300005459 Bacteria 1985
86 Ga0068867_100292808 3300005459 Bacteria 1339
87 Ga0070685_10005360 3300005466 Bacteria 6501
88 Ga0070707_100026060 3300005468 Bacteria 5548
89 Ga0070698_100031331 3300005471 Bacteria 5514
90 Ga0070699_100106492 3300005518 Bacteria 2460
91 Ga0070699_100167127 3300005518 Bacteria 1949
92 Ga0070679_100009976 3300005530 Bacteria 8990
93 Ga0070679_100147751 3300005530 Bacteria 2328
94 Ga0070679_100176844 3300005530 Bacteria 2107
95 Ga0070684_100002263 3300005535 Bacteria 14169
96 Ga0070684_100007411 3300005535 Bacteria 8526
97 Ga0070684_100022623 3300005535 Bacteria 5246
98 Ga0070684_100045412 3300005535 Bacteria 3804
99 Ga0070684_100049522 3300005535 Bacteria 3646
100 Ga0070684_100149299 3300005535 Bacteria 2117
101 Ga0070684_100176819 3300005535 Bacteria 1940
102 Ga0070684_100351701 3300005535 Bacteria 1355
103 Ga0070697_100170300 3300005536 Bacteria 1843
104 Ga0068853_100082054 3300005539 Bacteria 2824
105 Ga0070672_100082022 3300005543 Bacteria 2587
106 Ga0070672_100226380 3300005543 Bacteria 1570
107 Ga0070686_100014705 3300005544 Bacteria 4517
108 Ga0070686_100028968 3300005544 Bacteria 3362
109 Ga0070686_100047377 3300005544 Bacteria 2718
110 Ga0070686_100113152 3300005544 Bacteria 1852
111 Ga0070686_100446279 3300005544 Bacteria 993
112 Ga0070695_100172524 3300005545 Bacteria 1526
113 Ga0070695_100176033 3300005545 Bacteria 1512
114 Ga0070696_100061405 3300005546 Bacteria 2629
115 Ga0070696_100260016 3300005546 Bacteria 1316
116 Ga0070693_100015854 3300005547 Bacteria 3888
117 Ga0070693_100027344 3300005547 Bacteria 3090
118 Ga0070693_100047295 3300005547 Bacteria 2447
119 Ga0070693_100165864 3300005547 Bacteria 1411
120 Ga0070665_100048803 3300005548 Bacteria 4249
121 Ga0070665_100089131 3300005548 Bacteria 3091
122 Ga0070704_100204659 3300005549 Bacteria 1596
123 Ga0070704_100279763 3300005549 Bacteria 1382
124 Ga0068855_100065227 3300005563 Bacteria 4245
125 Ga0068855_100169056 3300005563 Bacteria 2477
126 Ga0068855_100269473 3300005563 Bacteria 1894
127 Ga0068855_100420102 3300005563 Unclassified 1463
128 Ga0070664_100216694 3300005564 Bacteria 1712
129 Ga0068857_100086654 3300005577 Bacteria 2801
130 Ga0068857_100414155 3300005577 Bacteria 1256
131 Ga0068854_100031564 3300005578 Bacteria 3683
132 Ga0068854_100104565 3300005578 Bacteria 2127
133 Ga0068854_100139840 3300005578 Bacteria 1857
134 Ga0068856_100016763 3300005614 Bacteria 7098
135 Ga0068856_100019584 3300005614 Bacteria 6570
136 Ga0068856_100056424 3300005614 Bacteria 3875
137 Ga0068856_100060833 3300005614 Bacteria 3730
138 Ga0068856_100074879 3300005614 Bacteria 3353
139 Ga0068856_100383067 3300005614 Archaea 1426
140 Ga0068852_100010955 3300005616 Bacteria 6797
141 Ga0068852_100074113 3300005616 Bacteria 2996
142 Ga0068852_100122054 3300005616 Bacteria 2387
143 Ga0068852_100349586 3300005616 Bacteria 1443
144 Ga0068859_100258369 3300005617 Bacteria 1833
145 Ga0068864_100064733 3300005618 Bacteria 3171
146 Ga0068864_100064875 3300005618 Bacteria 3168
147 Ga0068866_10003296 3300005718 Bacteria 6632
148 Ga0068870_10067468 3300005840 Bacteria 1941
149 Ga0068863_100150822 3300005841 Bacteria 2224
150 Ga0068863_100366295 3300005841 Unclassified 1406
151 Ga0068860_100085016 3300005843 Bacteria 3009
152 Ga0068860_100154709 3300005843 Unclassified 2210
153 Ga0068860_100366644 3300005843 Bacteria 1420
154 Ga0081455_10022186 3300005937 Bacteria 5939
155 Ga0081455_10078046 3300005937 Bacteria 2722
156 Ga0081455_10128328 3300005937 Bacteria 1987
157 Ga0081455_10192377 3300005937 Bacteria 1535
158 Ga0081455_10241138 3300005937 Bacteria 1328
159 Ga0081538_10000093 3300005981 Bacteria 86826
160 Ga0081538_10000917 3300005981 Bacteria 31782
161 Ga0081538_10009114 3300005981 Bacteria 8325
162 Ga0081539_10000363 3300005985 Bacteria 99391
163 Ga0075365_10059341 3300006038 Bacteria 2550
164 Ga0075363_100180801 3300006048 Unclassified 1200
165 Ga0075364_10023031 3300006051 Bacteria 3940
166 Ga0070716_100011235 3300006173 Bacteria 4508
167 Ga0070716_100098021 3300006173 Bacteria 1790
168 Ga0070712_100075562 3300006175 Bacteria 2423
169 Ga0070712_100089854 3300006175 Bacteria 2248
170 Ga0097621_100017526 3300006237 Bacteria 5440
171 Ga0097621_100236415 3300006237 Bacteria 1596
172 Ga0097621_100263428 3300006237 Bacteria 1513
173 Ga0068871_100024455 3300006358 Bacteria 4685
174 Ga0068871_100053110 3300006358 Bacteria 3284
175 Ga0068871_100135211 3300006358 Bacteria 2093
176 Ga0068871_100217609 3300006358 Bacteria 1654
177 Ga0075428_100055596 3300006844 Bacteria 4336
178 Ga0075428_100218272 3300006844 Bacteria 2060
179 Ga0075428_100313518 3300006844 Bacteria 1686
180 Ga0075430_100061646 3300006846 Bacteria 3151
181 Ga0075430_100086585 3300006846 Bacteria 2622
182 Ga0075430_100157756 3300006846 Unclassified 1889
183 Ga0075431_100052231 3300006847 Bacteria 4214
184 Ga0075431_100074243 3300006847 Unclassified 3509
185 Ga0075433_10182918 3300006852 Bacteria 1865
186 Ga0075434_100001851 3300006871 Bacteria 18258
187 Ga0075434_100008655 3300006871 Bacteria 9476
188 Ga0075434_100042760 3300006871 Bacteria 4492
189 Ga0075434_100310345 3300006871 Unclassified 1598
190 Ga0075434_100611575 3300006871 Unclassified 1109
191 Ga0075429_100034302 3300006880 Bacteria 4409
192 Ga0075429_100183319 3300006880 Bacteria 1835
193 Ga0068865_100009060 3300006881 Bacteria 6156
194 Ga0068865_100030396 3300006881 Bacteria 3593
195 Ga0068865_100179268 3300006881 Bacteria 1630
196 Ga0068865_100184091 3300006881 Bacteria 1610
197 Ga0075436_100009503 3300006914 Bacteria 6651
198 Ga0075436_100024409 3300006914 Bacteria 4156
199 Ga0097620_100258337 3300006931 Bacteria 1833
200 Ga0075435_100033567 3300007076 Bacteria 4059
201 Ga0075435_100088796 3300007076 Bacteria 2548
202 Ga0075435_100189719 3300007076 Bacteria 1739
203 Ga0105240_10320960 3300009093 Bacteria 1765
204 Ga0105240_10347429 3300009093 Archaea 1683
205 Ga0111539_10010806 3300009094 Bacteria 11493
206 Ga0111539_10016408 3300009094 Bacteria 9184
207 Ga0111539_10375452 3300009094 Unclassified 1655
208 Ga0111539_10420010 3300009094 Unclassified 1558
209 Ga0111539_10935127 3300009094 Bacteria 1008
210 Ga0111539_11170066 3300009094 Bacteria 893
211 Ga0105245_10023127 3300009098 Bacteria 5454
212 Ga0105245_10024081 3300009098 Bacteria 5345
213 Ga0105245_10026917 3300009098 Bacteria 5063
214 Ga0105245_10075223 3300009098 Bacteria 3074
215 Ga0105245_10082758 3300009098 Bacteria 2936
216 Ga0105245_10090493 3300009098 Bacteria 2815
217 Ga0105245_10121076 3300009098 Bacteria 2445
218 Ga0105245_10146812 3300009098 Bacteria 2226
219 Ga0105245_10154705 3300009098 Unclassified 2171
220 Ga0105245_10353198 3300009098 Bacteria 1457
221 Ga0105245_10527894 3300009098 Bacteria 1200
222 Ga0105245_10867518 3300009098 Unclassified 943
223 Ga0105245_11154827 3300009098 Unclassified 821
224 Ga0114129_10063811 3300009147 Bacteria 5141
225 Ga0114129_10141717 3300009147 Bacteria 3294
226 Ga0114129_10245538 3300009147 Bacteria 2405
227 Ga0114129_10603390 3300009147 Unclassified 1422
228 Ga0105243_10041511 3300009148 Bacteria 3598
229 Ga0105243_10068542 3300009148 Bacteria 2859
230 Ga0105243_10070713 3300009148 Bacteria 2819
231 Ga0105243_10168419 3300009148 Bacteria 1895
232 Ga0105243_10911210 3300009148 Bacteria 875
233 Ga0105241_10033872 3300009174 Bacteria 3836
234 Ga0105242_10156276 3300009176 Bacteria 1992
235 Ga0105242_10374476 3300009176 Bacteria 1322
236 Ga0105242_10677604 3300009176 Unclassified 1006
237 Ga0105248_10829601 3300009177 Bacteria 1043
238 Ga0105248_11169934 3300009177 Unclassified 869
239 Ga0105238_10053698 3300009551 Bacteria 4049
240 Ga0105238_10080991 3300009551 Bacteria 3236
241 Ga0105238_10154092 3300009551 Bacteria 2273
242 Ga0105249_10020480 3300009553 Bacteria 5912
243 Ga0105249_10727637 3300009553 Unclassified 1054
244 Ga0105239_10033267 3300010375 Bacteria 5662
245 Ga0105239_10065163 3300010375 Bacteria 4001
246 Ga0105239_10778058 3300010375 Bacteria 1096
247 Ga0105246_10025404 3300011119 Bacteria 3861
248 Ga0105246_10093388 3300011119 Bacteria 2173
249 Ga0105246_10368011 3300011119 Bacteria 1183
250 Ga0157371_10180653 3300013102 Bacteria 1509
251 Ga0157370_10595452 3300013104 Bacteria 1012
252 Ga0157369_10001698 3300013105 Bacteria 26844
253 Ga0157369_10106646 3300013105 Bacteria 2981
254 Ga0157369_10382484 3300013105 Unclassified 1461
255 Ga0157374_10020244 3300013296 Bacteria 5901
256 Ga0157374_10409028 3300013296 Unclassified 1354
257 Ga0157374_10600161 3300013296 Bacteria 1111
258 Ga0157378_10638218 3300013297 Bacteria 1079
259 Ga0157378_10978548 3300013297 Bacteria 879
260 Ga0163162_10255507 3300013306 Bacteria 1884
261 Ga0157372_10054897 3300013307 Bacteria 4447
262 Ga0157372_10068217 3300013307 Bacteria 3998
263 Ga0157372_10109005 3300013307 Bacteria 3170
264 Ga0157372_10827883 3300013307 Bacteria 1075
265 Ga0157375_10032725 3300013308 Bacteria 4933
266 Ga0157375_10545270 3300013308 Unclassified 1322
267 Ga0157375_10564957 3300013308 Bacteria 1298
268 Ga0157375_10656884 3300013308 Bacteria 1204
269 Ga0157375_10765692 3300013308 Bacteria 1116
270 Ga0157375_11256566 3300013308 Unclassified 870
271 Ga0163163_10009258 3300014325 Bacteria 8784
272 Ga0163163_10196739 3300014325 Bacteria 2064
273 Ga0157380_10116230 3300014326 Bacteria 2257
274 Ga0157380_10825902 3300014326 Bacteria 946
275 Ga0157380_10892964 3300014326 Bacteria 914
276 Ga0157377_10007410 3300014745 Bacteria 5297
277 Ga0157377_10042506 3300014745 Bacteria 2524
278 Ga0157377_10067162 3300014745 Unclassified 2064
279 Ga0157379_10090083 3300014968 Bacteria 2752
280 Ga0157376_10271269 3300014969 Bacteria 1594
281 Ga0157376_10687097 3300014969 Unclassified 1027
282 Ga0163161_10069647 3300017792 Bacteria 2571
283 Ga0163161_10154831 3300017792 Bacteria 1744
284 Ga0197907_10787494 3300020069 Bacteria 1944
285 Ga0206356_10690906 3300020070 Bacteria 997
286 Ga0206354_10493040 3300020081 Bacteria 1723
287 Ga0206354_11181411 3300020081 Bacteria 2405
288 Ga0206353_10682305 3300020082 Bacteria 3065
289 Ga0206353_11563311 3300020082 Unclassified 2475
290 Ga0213876_10173606 3300021384 Bacteria 1147
291 Ga0207653_10045403 3300025885 Bacteria 1451
292 Ga0207682_10131711 3300025893 Unclassified 1117
293 Ga0207692_10006352 3300025898 Bacteria 4791
294 Ga0207692_10074306 3300025898 Bacteria 1801
295 Ga0207642_10006027 3300025899 Bacteria 4004
296 Ga0207642_10006211 3300025899 Bacteria 3958
297 Ga0207642_10079263 3300025899 Bacteria 1590
298 Ga0207642_10114279 3300025899 Bacteria 1380
299 Ga0207688_10013509 3300025901 Bacteria 4437
300 Ga0207688_10040384 3300025901 Bacteria 2593
301 Ga0207688_10330089 3300025901 Bacteria 937
302 Ga0207685_10183672 3300025905 Bacteria 971
303 Ga0207645_10129437 3300025907 Bacteria 1642
304 Ga0207643_10006336 3300025908 Bacteria 6338
305 Ga0207705_10187184 3300025909 Bacteria 1564
306 Ga0207684_10081383 3300025910 Bacteria 2756
307 Ga0207654_10034181 3300025911 Bacteria 2823
308 Ga0207654_10340525 3300025911 Bacteria 1030
309 Ga0207654_10389089 3300025911 Bacteria 967
310 Ga0207707_10015519 3300025912 Bacteria 6635
311 Ga0207707_10020859 3300025912 Bacteria 5723
312 Ga0207693_10002227 3300025915 Bacteria 16886
313 Ga0207693_10107738 3300025915 Bacteria 2186
314 Ga0207693_10134809 3300025915 Bacteria 1941
315 Ga0207693_10185444 3300025915 Bacteria 1638
316 Ga0207663_10102392 3300025916 Bacteria 1926
317 Ga0207660_10014082 3300025917 Bacteria 5251
318 Ga0207660_10174227 3300025917 Bacteria 1667
319 Ga0207660_10533787 3300025917 Bacteria 953
320 Ga0207662_10030533 3300025918 Bacteria 3128
321 Ga0207662_10103164 3300025918 Bacteria 1769
322 Ga0207657_10039192 3300025919 Bacteria 4212
323 Ga0207657_10579652 3300025919 Bacteria 876
324 Ga0207657_10650851 3300025919 Bacteria 820
325 Ga0207649_10041202 3300025920 Bacteria 2811
326 Ga0207652_10012862 3300025921 Bacteria 6767
327 Ga0207652_10078373 3300025921 Bacteria 2885
328 Ga0207652_10202229 3300025921 Bacteria 1788
329 Ga0207652_10300395 3300025921 Bacteria 1449
330 Ga0207652_10409002 3300025921 Bacteria 1224
331 Ga0207681_10386858 3300025923 Bacteria 1127
332 Ga0207694_10237139 3300025924 Bacteria 1490
333 Ga0207694_10341585 3300025924 Bacteria 1238
334 Ga0207694_10345114 3300025924 Bacteria 1232
335 Ga0207650_10016944 3300025925 Bacteria 5096
336 Ga0207659_10104562 3300025926 Bacteria 2141
337 Ga0207659_10405487 3300025926 Bacteria 1141
338 Ga0207687_10022683 3300025927 Bacteria 4180
339 Ga0207687_10027614 3300025927 Bacteria 3810
340 Ga0207687_10029173 3300025927 Bacteria 3709
341 Ga0207687_10070197 3300025927 Bacteria 2500
342 Ga0207687_10109983 3300025927 Bacteria 2043
343 Ga0207687_10363695 3300025927 Bacteria 1181
344 Ga0207700_10000028 3300025928 Bacteria 135555
345 Ga0207700_10221860 3300025928 Unclassified 1603
346 Ga0207664_10176568 3300025929 Bacteria 1832
347 Ga0207664_10396316 3300025929 Unclassified 1227
348 Ga0207664_10784449 3300025929 Unclassified 857
349 Ga0207644_10056530 3300025931 Bacteria 2832
350 Ga0207644_10064384 3300025931 Bacteria 2664
351 Ga0207690_10086333 3300025932 Bacteria 2205
352 Ga0207706_10051097 3300025933 Bacteria 3651
353 Ga0207706_10074971 3300025933 Bacteria 2975
354 Ga0207706_10239430 3300025933 Unclassified 1586
355 Ga0207706_10407067 3300025933 Bacteria 1179
356 Ga0207706_10711986 3300025933 Bacteria 857
357 Ga0207686_10180867 3300025934 Bacteria 1495
358 Ga0207709_10037539 3300025935 Bacteria 2880
359 Ga0207709_10109083 3300025935 Bacteria 1847
360 Ga0207709_10156559 3300025935 Bacteria 1584
361 Ga0207670_10059903 3300025936 Bacteria 2591
362 Ga0207669_10014396 3300025937 Bacteria 3963
363 Ga0207704_10032807 3300025938 Bacteria 2944
364 Ga0207665_10016464 3300025939 Bacteria 4854
365 Ga0207665_10070940 3300025939 Bacteria 2378
366 Ga0207691_10008423 3300025940 Bacteria 9905
367 Ga0207711_10236339 3300025941 Bacteria 1675
368 Ga0207689_10026029 3300025942 Bacteria 4898
369 Ga0207689_10377512 3300025942 Bacteria 1180
370 Ga0207689_10529991 3300025942 Bacteria 988
371 Ga0207689_10611576 3300025942 Bacteria 917
372 Ga0207661_10006079 3300025944 Bacteria 8523
373 Ga0207661_10036005 3300025944 Bacteria 3861
374 Ga0207661_10063063 3300025944 Bacteria 3001
375 Ga0207661_10139743 3300025944 Bacteria 2083
376 Ga0207661_10151254 3300025944 Bacteria 2006
377 Ga0207661_10273858 3300025944 Bacteria 1507
378 Ga0207661_10807737 3300025944 Unclassified 863
379 Ga0207679_10034083 3300025945 Bacteria 3589
380 Ga0207679_10221029 3300025945 Bacteria 1594
381 Ga0207679_10364172 3300025945 Bacteria 1263
382 Ga0207667_10165119 3300025949 Bacteria 2276
383 Ga0207667_10251091 3300025949 Bacteria 1809
384 Ga0207667_10394999 3300025949 Unclassified 1408
385 Ga0207667_10519289 3300025949 Bacteria 1206
386 Ga0207667_10880642 3300025949 Bacteria 888
387 Ga0207651_10688704 3300025960 Bacteria 900
388 Ga0207712_10104656 3300025961 Bacteria 2111
389 Ga0207712_10616945 3300025961 Unclassified 940
390 Ga0207668_10323397 3300025972 Bacteria 1281
391 Ga0207668_10344644 3300025972 Bacteria 1244
392 Ga0207640_10011193 3300025981 Bacteria 5073
393 Ga0207640_10100021 3300025981 Bacteria 2031
394 Ga0207677_10029329 3300026023 Bacteria 3495
395 Ga0207677_10104612 3300026023 Bacteria 2093
396 Ga0207677_10122539 3300026023 Bacteria 1959
397 Ga0207677_10195183 3300026023 Unclassified 1604
398 Ga0207677_10616520 3300026023 Bacteria 954
399 Ga0207678_10075875 3300026067 Bacteria 2879
400 Ga0207678_10079945 3300026067 Bacteria 2799
401 Ga0207678_10084591 3300026067 Bacteria 2712
402 Ga0207678_10147832 3300026067 Bacteria 2006
403 Ga0207678_10360243 3300026067 Bacteria 1255
404 Ga0207708_10016076 3300026075 Bacteria 5620
405 Ga0207708_10022412 3300026075 Bacteria 4770
406 Ga0207708_10033742 3300026075 Bacteria 3890
407 Ga0207708_10084149 3300026075 Bacteria 2446
408 Ga0207708_10188994 3300026075 Bacteria 1639
409 Ga0207702_10080039 3300026078 Bacteria 2834
410 Ga0207702_10119051 3300026078 Bacteria 2360
411 Ga0207702_10201809 3300026078 Bacteria 1844
412 Ga0207702_10238868 3300026078 Bacteria 1701
413 Ga0207641_10304650 3300026088 Bacteria 1506
414 Ga0207641_10660975 3300026088 Bacteria 1027
415 Ga0207648_10001618 3300026089 Bacteria 24692
416 Ga0207648_10027846 3300026089 Bacteria 5014
417 Ga0207648_10184700 3300026089 Bacteria 1846
418 Ga0207648_10328856 3300026089 Bacteria 1374
419 Ga0207648_10437068 3300026089 Unclassified 1190
420 Ga0207648_10671302 3300026089 Bacteria 959
421 Ga0207674_10011223 3300026116 Bacteria 10068
422 Ga0207674_10256794 3300026116 Bacteria 1695
423 Ga0207675_100019600 3300026118 Bacteria 6313
424 Ga0207675_100020260 3300026118 Bacteria 6201
425 Ga0207675_100088815 3300026118 Bacteria 2903
426 Ga0207675_100291051 3300026118 Bacteria 1589
427 Ga0207675_100562717 3300026118 Bacteria 1140
428 Ga0207683_10005786 3300026121 Bacteria 10599
429 Ga0207683_10023914 3300026121 Bacteria 5257
430 Ga0207683_10024330 3300026121 Bacteria 5214
431 Ga0207683_10028840 3300026121 Bacteria 4802
432 Ga0207683_10028930 3300026121 Bacteria 4795
433 Ga0207683_10036902 3300026121 Bacteria 4256
434 Ga0207428_10002578 3300027907 Bacteria 18097
435 Ga0207428_10133040 3300027907 Bacteria 1902
436 Ga0207428_10298528 3300027907 Bacteria 1192
437 Ga0268266_10212816 3300028379 Bacteria 1773
438 Ga0268266_11114546 3300028379 Unclassified 763
439 Ga0268265_10242349 3300028380 Bacteria 1592
440 Ga0265318_10037183 3300028577 Bacteria 1865
441 Ga0265338_10129398 3300028800 Bacteria 1997
442 Ga0307408_100476957 3300031548 Bacteria 1087
443 Ga0307408_100513371 3300031548 Unclassified 1051
444 Ga0307405_10000763 3300031731 Bacteria 12575
445 Ga0307405_10359396 3300031731 Unclassified 1126
446 Ga0307413_10726688 3300031824 Bacteria 827
447 Ga0307410_10030123 3300031852 Bacteria 3464
448 Ga0307406_10002380 3300031901 Bacteria 10220
449 Ga0307406_10084650 3300031901 Bacteria 2118
450 Ga0307406_10240866 3300031901 Bacteria 1357
451 Ga0307407_10002086 3300031903 Bacteria 7660
452 Ga0307412_10176038 3300031911 Bacteria 1604
453 Ga0307409_100452512 3300031995 Bacteria 1239
454 Ga0307409_100901063 3300031995 Unclassified 898
455 Ga0307416_100061199 3300032002 Bacteria 3071
456 Ga0307416_100234962 3300032002 Bacteria 1771
457 Ga0307416_100522864 3300032002 Bacteria 1255
458 Ga0307414_10011153 3300032004 Bacteria 5258
459 Ga0307415_100011986 3300032126 Bacteria 4992
460 Ga0373928_0040147 3300035084 Bacteria 1072
461 Ga0373944_0011271 3300035089 Bacteria 2446
462 Ga0373951_0045506 3300035091 Unclassified 1068
463 Ga0373943_0008346 3300035170 Bacteria 4649
464 Ga0373943_0155318 3300035170 Bacteria 1242
465 Ga0373946_0097326 3300035171 Bacteria 1313
466 Ga0373931_0075531 3300035691 Bacteria 1848
467 Ga0373927_0063413 3300035695 Bacteria 2390
468 Ga0373947_0001800 3300035725 Bacteria 13104
469 Ga0373925_0235356 3300037068 Bacteria 1465
470 Ga0395899_0010469 3300037312 Bacteria 7102
471 Ga0395899_0056130 3300037312 Bacteria 2911
472 Ga0395899_0089903 3300037312 Bacteria 2227
473 Ga0395899_0183006 3300037312 Bacteria 1470
474 Ga0395900_0005641 3300037418 Bacteria 13092
475 Ga0395900_0034902 3300037418 Bacteria 5181
476 Ga0395900_0103933 3300037418 Bacteria 2918
477 Ga0395900_0109143 3300037418 Bacteria 2843
478 Ga0395900_0116757 3300037418 Bacteria 2738
479 Ga0395900_0321796 3300037418 Bacteria 1527
480 Ga0395900_0583692 3300037418 Bacteria 1059
481 Ga0395898_0012333 3300037466 Bacteria 8839
482 Ga0395898_0018348 3300037466 Bacteria 7134
483 Ga0395898_0042686 3300037466 Bacteria 4473
484 Ga0395898_0185978 3300037466 Bacteria 1985
485 Ga0395898_0196252 3300037466 Bacteria 1928
486 Ga0395898_0325954 3300037466 Bacteria 1465
487 Ga0395898_0784231 3300037466 Unclassified 894
488 Ga0395905_0002820 3300037471 Bacteria 19050
489 Ga0395905_0018242 3300037471 Bacteria 6661
490 Ga0395905_0065878 3300037471 Bacteria 3392
491 Ga0395905_0440253 3300037471 Unclassified 1201
492 Ga0395901_0021008 3300038443 Bacteria 6687
493 Ga0395901_0083306 3300038443 Bacteria 3343
494 Ga0395901_0136099 3300038443 Bacteria 2582
495 Ga0395901_0165855 3300038443 Bacteria 2319
496 Ga0395901_0341237 3300038443 Bacteria 1547
497 Ga0395901_0360676 3300038443 Bacteria 1499
498 Ga0436365_1717107 3300039437 Bacteria 2487
499 Ga0436363_1306718 3300039450 Bacteria 946
500 Ga0439451_049687 3300042009 Unclassified 840
501 Ga0466966_0147010 3300044684 Bacteria 1438
502 Ga0466963_0011804 3300044694 Bacteria 5329
503 Ga0466963_0064000 3300044694 Bacteria 2463
504 Ga0466964_0038383 3300044706 Unclassified 1925
505 Ga0466971_0012859 3300044719 Bacteria 3670
506 Ga0466968_0132144 3300044735 Bacteria 1137
507 Ga0466957_0209412 3300044842 Bacteria 1283
508 Ga0466960_0027536 3300044901 Bacteria 2593
509 Ga0466960_0051920 3300044901 Bacteria 1982
510 Ga0466960_0413369 3300044901 Bacteria 779
511 Ga0451576_0039365 3300045051 Bacteria 5004
512 Ga0451576_0070400 3300045051 Bacteria 3641
513 Ga0451576_0288864 3300045051 Bacteria 1714
514 Ga0466958_0047901 3300045836 Bacteria 2581
515 Ga0466958_0051946 3300045836 Bacteria 2483
516 Ga0466967_0015805 3300045976 Bacteria 5930
517 Ga0466967_0026415 3300045976 Bacteria 4809
518 Ga0466967_0074387 3300045976 Bacteria 3051
519 Ga0495603_0040882 3300046455 Bacteria 2774
520 Ga0495603_0262672 3300046455 Bacteria 993
521 Ga0495629_0004153 3300046459 Bacteria 10868
522 Ga0495629_0611126 3300046459 Unclassified 728
523 Ga0495641_0000850 3300046461 Bacteria 26094
524 Ga0495651_0021532 3300046462 Bacteria 5011
525 Ga0495651_0233273 3300046462 Bacteria 1266
526 Ga0495651_0283601 3300046462 Bacteria 1118
527 Ga0495653_0096292 3300046463 Bacteria 2152
528 Ga0495580_0179818 3300046472 Bacteria 1461
529 Ga0495582_0000054 3300046473 Bacteria 57496
530 Ga0495605_0229636 3300046474 Bacteria 800
531 Ga0495639_0000608 3300046475 Bacteria 16665
532 Ga0495639_0026258 3300046475 Bacteria 2573
533 Ga0495662_0007155 3300046476 Bacteria 5529
534 Ga0495584_0078101 3300046491 Bacteria 1665
535 Ga0495594_0060192 3300046499 Bacteria 2100
536 Ga0495607_0046643 3300046501 Bacteria 2543
537 Ga0495608_0058926 3300046511 Bacteria 2530
538 Ga0495608_0223848 3300046511 Bacteria 1179
539 Ga0495618_0257340 3300046514 Bacteria 1094
540 Ga0495630_0006532 3300046517 Bacteria 8304
541 Ga0495630_0099611 3300046517 Bacteria 2199
542 Ga0495630_0901591 3300046517 Unclassified 673
543 Ga0495631_0045678 3300046518 Bacteria 1928
544 Ga0495663_0081187 3300046525 Bacteria 1044
545 Ga0495666_0083864 3300046526 Bacteria 1506
546 Ga0495642_0035217 3300046528 Bacteria 2019
547 Ga0495652_0516051 3300046529 Unclassified 826
548 Ga0495640_0151385 3300046533 Bacteria 1490
549 Ga0495586_0077937 3300046535 Bacteria 1818
550 Ga0495587_0084487 3300046536 Bacteria 1838
551 Ga0495587_0186313 3300046536 Bacteria 1176
552 Ga0495609_0184828 3300046538 Unclassified 876
553 Ga0495667_0037023 3300046559 Bacteria 3253
554 Ga0495667_0063607 3300046559 Bacteria 2415
555 Ga0495656_0355838 3300046615 Bacteria 759
556 Ga0495668_0355221 3300046616 Bacteria 804
557 Ga0495635_0015770 3300046663 Bacteria 5278
558 Ga0495635_0358885 3300046663 Bacteria 971
559 Ga0495659_0057466 3300046664 Bacteria 1429
560 Ga0495659_0077257 3300046664 Unclassified 1257
561 Ga0495657_0070907 3300046675 Bacteria 2277
562 Ga0495646_0089793 3300046680 Bacteria 1777
563 Ga0495647_0012862 3300046681 Bacteria 2888
564 Ga0495658_0001151 3300046683 Bacteria 13968
565 Ga0495658_0519893 3300046683 Bacteria 762
566 Ga0495613_0015631 3300046689 Bacteria 5648
567 Ga0495613_0139580 3300046689 Bacteria 1732
568 Ga0495624_0019148 3300046690 Bacteria 4572
569 Ga0495600_0017106 3300046809 Bacteria 4610
570 Ga0495600_0197960 3300046809 Bacteria 1291
571 Ga0495581_0001507 3300047315 Bacteria 12964
572 Ga0495604_0277326 3300047317 Bacteria 1134
573 Ga0495674_0066250 3300047319 Bacteria 3134
574 Ga0495674_0122635 3300047319 Bacteria 2194
575 Ga0495676_0001978 3300047321 Bacteria 18008
576 Ga0495676_0012780 3300047321 Bacteria 7550
577 Ga0495680_0007171 3300047322 Bacteria 10267
578 Ga0495675_0219417 3300047444 Bacteria 1152
579 Ga0495677_0031065 3300047445 Bacteria 1944
580 Ga0495677_0209213 3300047445 Bacteria 759
581 Ga0495684_0355666 3300047471 Unclassified 1038
582 Ga0495593_0010033 3300047673 Bacteria 5488
583 Ga0495614_0005102 3300048089 Bacteria 5926
584 Ga0496100_0006635 3300048903 Bacteria 6326
585 Ga0496100_0052242 3300048903 Bacteria 2656
586 Ga0496100_0079903 3300048903 Bacteria 2205
587 Ga0496100_0143567 3300048903 Bacteria 1695
588 Ga0496100_0181469 3300048903 Bacteria 1522
589 Ga0496100_0848239 3300048903 Unclassified 716
590 Ga0496100_1264702 3300048903 Unclassified 582
591 Ga0496101_0002853 3300048904 Bacteria 10621
592 Ga0496101_0007728 3300048904 Bacteria 6987
593 Ga0496101_0014724 3300048904 Bacteria 5262
594 Ga0496101_0023646 3300048904 Bacteria 4247
595 Ga0496101_0038763 3300048904 Bacteria 3385
596 Ga0496101_0068102 3300048904 Bacteria 2601
597 Ga0496101_0161190 3300048904 Bacteria 1720
598 Ga0496101_0209372 3300048904 Bacteria 1510
599 Ga0496102_0090721 3300048905 Bacteria 2828
600 Ga0496102_0206556 3300048905 Bacteria 1852
601 Ga0496102_0509105 3300048905 Bacteria 1126
602 Ga0496102_0581264 3300048905 Bacteria 1043
603 Ga0496103_0002848 3300048906 Bacteria 10756
604 Ga0496103_0192402 3300048906 Bacteria 1312
605 Ga0496104_0000261 3300048907 Bacteria 46523
606 Ga0496104_0005537 3300048907 Bacteria 11063
607 Ga0496104_0019952 3300048907 Bacteria 6138
608 Ga0496104_0021669 3300048907 Bacteria 5902
609 Ga0496104_0062208 3300048907 Bacteria 3539
610 Ga0496104_0112553 3300048907 Bacteria 2610
611 Ga0496104_0149135 3300048907 Bacteria 2246
612 Ga0496104_0631403 3300048907 Bacteria 980
613 Ga0496105_0000341 3300048908 Bacteria 30641
614 Ga0496105_0000489 3300048908 Bacteria 26072
615 Ga0496105_0106462 3300048908 Bacteria 2315
616 Ga0496105_0229308 3300048908 Bacteria 1509
617 Ga0496105_0432799 3300048908 Bacteria 1040
618 Ga0496106_0009087 3300048909 Bacteria 7343
619 Ga0496106_0056290 3300048909 Bacteria 2972
620 Ga0496106_0099407 3300048909 Unclassified 2255
621 Ga0496106_0113899 3300048909 Bacteria 2108
622 Ga0496106_0297114 3300048909 Bacteria 1295
623 Ga0496106_0778695 3300048909 Unclassified 759
624 Ga0496107_0002143 3300048910 Bacteria 12664
625 Ga0496107_0003268 3300048910 Bacteria 10805
626 Ga0496107_0029143 3300048910 Bacteria 3925
627 Ga0496107_0032884 3300048910 Bacteria 3708
628 Ga0496107_0052381 3300048910 Bacteria 2944
629 Ga0496107_0091743 3300048910 Bacteria 2220
630 Ga0496107_0128782 3300048910 Bacteria 1868
631 Ga0496107_0147328 3300048910 Bacteria 1741
632 Ga0496107_0227916 3300048910 Bacteria 1386
633 Ga0496108_0007200 3300048911 Bacteria 9019
634 Ga0496108_0023336 3300048911 Bacteria 5089
635 Ga0496108_0070061 3300048911 Bacteria 2959
636 Ga0496108_0084511 3300048911 Bacteria 2693
637 Ga0496108_0115761 3300048911 Bacteria 2296
638 Ga0496108_0115931 3300048911 Bacteria 2294
639 Ga0496108_0152234 3300048911 Bacteria 1996
640 Ga0496108_0218221 3300048911 Unclassified 1657
641 Ga0496109_0000301 3300048912 Bacteria 46624
642 Ga0496109_0007517 3300048912 Bacteria 9230
643 Ga0496109_0015256 3300048912 Bacteria 6689
644 Ga0496109_0018133 3300048912 Bacteria 6181
645 Ga0496109_0028696 3300048912 Bacteria 4980
646 Ga0496109_0058691 3300048912 Bacteria 3515
647 Ga0496109_0077625 3300048912 Bacteria 3056
648 Ga0496109_0111816 3300048912 Bacteria 2540
649 Ga0496109_0188717 3300048912 Bacteria 1936
650 Ga0496109_0564728 3300048912 Bacteria 1073
651 Ga0496109_0643051 3300048912 Bacteria 997
652 Ga0496109_0643562 3300048912 Bacteria 997
653 Ga0496110_0000221 3300048913 Bacteria 36767
654 Ga0496110_0008818 3300048913 Bacteria 8123
655 Ga0496110_0011717 3300048913 Bacteria 7194
656 Ga0496110_0011876 3300048913 Bacteria 7153
657 Ga0496110_0028246 3300048913 Bacteria 4816
658 Ga0496110_0046383 3300048913 Bacteria 3802
659 Ga0496110_0059256 3300048913 Bacteria 3374
660 Ga0496110_0080714 3300048913 Bacteria 2899
661 Ga0496110_0139428 3300048913 Bacteria 2192
662 Ga0496110_0467391 3300048913 Bacteria 1149
663 Ga0496111_0000132 3300048914 Bacteria 33010
664 Ga0496111_0001079 3300048914 Bacteria 15053
665 Ga0496111_0001218 3300048914 Bacteria 14367
666 Ga0496111_0029353 3300048914 Bacteria 3906
667 Ga0496111_0042088 3300048914 Bacteria 3279
668 Ga0496111_0178400 3300048914 Archaea 1579
669 Ga0496112_0003185 3300048915 Bacteria 13491
670 Ga0496112_0055832 3300048915 Bacteria 3885
671 Ga0496112_0865720 3300048915 Archaea 827
672 Ga0496112_1273153 3300048915 Bacteria 651
673 Ga0496113_0013269 3300048916 Bacteria 5576
674 Ga0496113_0031188 3300048916 Bacteria 3866
675 Ga0496113_0052525 3300048916 Bacteria 3044
676 Ga0496113_0119987 3300048916 Bacteria 2055
677 Ga0496113_0364064 3300048916 Bacteria 1160
678 Ga0496113_0686111 3300048916 Unclassified 818
679 Ga0496114_0000801 3300048917 Bacteria 23525
680 Ga0496114_0001557 3300048917 Bacteria 17405
681 Ga0496114_0004524 3300048917 Bacteria 10794
682 Ga0496114_0019844 3300048917 Bacteria 5450
683 Ga0496114_0220629 3300048917 Bacteria 1664
684 Ga0496114_0435352 3300048917 Bacteria 1161
685 Ga0496114_1078594 3300048917 Bacteria 688
686 Ga0496115_0016111 3300048918 Bacteria 5684
687 Ga0496115_0048676 3300048918 Bacteria 3391
688 Ga0496115_0135703 3300048918 Unclassified 2029
689 Ga0496115_0144913 3300048918 Bacteria 1960
690 Ga0496115_0161679 3300048918 Bacteria 1850
691 Ga0496115_0355954 3300048918 Bacteria 1193
692 Ga0501291_003751 3300049514 Bacteria 1907
693 Ga0501032_0086882 3300049569 Bacteria 2078
694 Ga0501032_0537053 3300049569 Bacteria 746
695 Ga0501036_0012707 3300049572 Bacteria 6986
696 Ga0501036_0159180 3300049572 Bacteria 1904
697 Ga0501036_0475263 3300049572 Bacteria 1041
698 Ga0501036_0769762 3300049572 Bacteria 793
699 Ga0501037_0014381 3300049573 Bacteria 5825
700 Ga0501038_0015192 3300049574 Bacteria 7002
701 Ga0501038_0721431 3300049574 Bacteria 745
702 Ga0501039_0049672 3300049575 Bacteria 3243
703 Ga0501039_0102879 3300049575 Bacteria 2229
704 Ga0501040_0004638 3300049576 Bacteria 8918
705 Ga0501040_0009087 3300049576 Bacteria 6468
706 Ga0501040_0111173 3300049576 Bacteria 1916
707 Ga0501040_0118586 3300049576 Bacteria 1856
708 Ga0501040_0163336 3300049576 Bacteria 1575
709 Ga0501040_0880088 3300049576 Bacteria 649
710 Ga0501041_0072069 3300049577 Bacteria 2122
711 Ga0501042_0067921 3300049578 Bacteria 2549
712 Ga0501042_0117208 3300049578 Bacteria 1917
713 Ga0501042_0133421 3300049578 Bacteria 1790
714 Ga0501042_0177617 3300049578 Bacteria 1536
715 Ga0501043_0010486 3300049579 Bacteria 7257
716 Ga0501046_0000122 3300049580 Bacteria 82617
717 Ga0501046_0483453 3300049580 Bacteria 888
718 Ga0501047_0191857 3300049581 Bacteria 1906
719 Ga0501048_0047065 3300049582 Bacteria 3078
720 Ga0501048_0075289 3300049582 Bacteria 2381
721 Ga0501067_0007826 3300049583 Bacteria 5942
722 Ga0501067_0053221 3300049583 Bacteria 2243
723 Ga0501067_0147343 3300049583 Unclassified 1311
724 Ga0501068_0000426 3300049584 Bacteria 21367
725 Ga0501068_0006032 3300049584 Bacteria 6658
726 Ga0501069_0000061 3300049585 Bacteria 61031
727 Ga0501069_0002211 3300049585 Bacteria 9804
728 Ga0501069_0004456 3300049585 Bacteria 7232
729 Ga0501069_0026501 3300049585 Bacteria 3174
730 Ga0501069_0070306 3300049585 Bacteria 1960
731 Ga0501069_0088767 3300049585 Bacteria 1748
732 Ga0501069_0169956 3300049585 Bacteria 1257
733 Ga0501070_0005391 3300049586 Bacteria 10906
734 Ga0501070_0666336 3300049586 Bacteria 825
735 Ga0501071_0054999 3300049587 Bacteria 2872
736 Ga0501071_0067747 3300049587 Bacteria 2596
737 Ga0501071_0127145 3300049587 Archaea 1892
738 Ga0501071_0134567 3300049587 Bacteria 1838
739 Ga0501071_0146708 3300049587 Bacteria 1759
740 Ga0501072_0132704 3300049588 Bacteria 1985
741 Ga0501072_0409306 3300049588 Unclassified 1076
742 Ga0501072_0809853 3300049588 Unclassified 733
743 Ga0501073_0008113 3300049589 Bacteria 7790
744 Ga0501074_0052612 3300049590 Bacteria 2939
745 Ga0501074_0132415 3300049590 Bacteria 1783
746 Ga0501074_0174795 3300049590 Bacteria 1532
747 Ga0501074_0434795 3300049590 Bacteria 931
748 Ga0501075_0031794 3300049591 Bacteria 3920
749 Ga0501075_0037435 3300049591 Bacteria 3625
750 Ga0501075_0295884 3300049591 Bacteria 1233
751 Ga0501075_0562232 3300049591 Unclassified 870
752 Ga0501076_0031889 3300049592 Bacteria 4112
753 Ga0501076_0060351 3300049592 Bacteria 3017
754 Ga0501076_0095054 3300049592 Bacteria 2400
755 Ga0501076_0177160 3300049592 Bacteria 1738
756 Ga0501077_0018438 3300049593 Bacteria 4416
757 Ga0501077_0040409 3300049593 Bacteria 2971
758 Ga0501079_0024424 3300049741 Bacteria 4637
759 Ga0501079_0043908 3300049741 Bacteria 3450
760 Ga0501079_0359240 3300049741 Archaea 1141
761 Ga0501079_0403011 3300049741 Bacteria 1073
762 Ga0501079_0830379 3300049741 Bacteria 728
763 Ga0501080_0033905 3300049742 Bacteria 4766
764 Ga0501080_0047211 3300049742 Bacteria 4008
765 Ga0501080_0208580 3300049742 Bacteria 1791
766 Ga0501080_0383847 3300049742 Bacteria 1265
767 Ga0501081_0016426 3300049743 Bacteria 4894
768 Ga0501081_0037706 3300049743 Bacteria 3299
769 Ga0501081_0162934 3300049743 Bacteria 1607
770 Ga0501081_0733245 3300049743 Bacteria 742
771 Ga0501083_0001412 3300049744 Bacteria 16364
772 Ga0501083_0170660 3300049744 Unclassified 1422
773 Ga0501035_0015492 3300049822 Bacteria 7033
774 Ga0501035_0211555 3300049822 Unclassified 1659
775 Ga0501044_0008263 3300049823 Bacteria 11414
776 Ga0501045_0045496 3300049824 Bacteria 3195
777 Ga0501045_0071314 3300049824 Bacteria 2557
778 Ga0501045_0193709 3300049824 Bacteria 1515
779 Ga0501045_0353619 3300049824 Archaea 1093
780 nmdc:mga0yw44_109382_c1 3300050492 Bacteria 1769
781 nmdc:mga05p37_174992_c1 3300050507 Bacteria 2615
782 nmdc:mga05p37_202575_c1 3300050507 Bacteria 2402
783 nmdc:mga05p37_28507_c1 3300050507 Bacteria 6808
784 nmdc:mga05p37_77421_c1 3300050507 Bacteria 4094
785 nmdc:mga09592_150544_c1 3300050508 Bacteria 2007
786 nmdc:mga09592_337950_c1 3300050508 Bacteria 1304
787 nmdc:mga09592_760081_c1 3300050508 Unclassified 822
788 nmdc:mga0qj67_379788_c1 3300050509 Bacteria 1141
789 nmdc:mga0qj67_52311_c1 3300050509 Bacteria 3232
790 nmdc:mga0qj67_61560_c1 3300050509 Bacteria 2980
791 nmdc:mga06r32_29294_c1 3300050510 Bacteria 5158
792 nmdc:mga08y16_29379_c1 3300050511 Bacteria 5793
793 nmdc:mga08y16_54582_c2 3300050511 Bacteria 3659
794 nmdc:mga08y16_689951_c1 3300050511 Bacteria 1022
795 nmdc:mga08y16_81094_c1 3300050511 Bacteria 3383
796 nmdc:mga0n895_1117356_c1 3300050512 Bacteria 765
797 nmdc:mga0n895_33689_c1 3300050512 Bacteria 4924
798 nmdc:mga0n895_414195_c1 3300050512 Bacteria 1362
799 nmdc:mga0n895_45639_c2 3300050512 Unclassified 2631
800 nmdc:mga0n895_62016_c1 3300050512 Bacteria 3693
801 nmdc:mga0rr50_211525_c1 3300050513 Bacteria 1598
802 nmdc:mga0rr50_214993_c1 3300050513 Bacteria 1585
803 nmdc:mga0rr50_223194_c1 3300050513 Bacteria 1557
804 nmdc:mga0rr50_250903_c1 3300050513 Bacteria 1470
805 nmdc:mga0rr50_321089_c1 3300050513 Unclassified 1298
806 nmdc:mga08x19_20101_c1 3300050514 Bacteria 4110
807 nmdc:mga08x19_38349_c1 3300050514 Bacteria 3044
808 nmdc:mga0a205_178237_c1 3300050515 Bacteria 2020
809 nmdc:mga0a205_189372_c1 3300050515 Bacteria 1950
810 nmdc:mga0a205_293360_c1 3300050515 Unclassified 1500
811 nmdc:mga0a205_649978_c1 3300050515 Bacteria 906
812 Ga0495655_0082696 3300053083 Bacteria 921
813 Ga0495619_0016537 3300053085 Bacteria 4670
814 Ga0495619_0251256 3300053085 Bacteria 1225
815 Ga0495619_0357840 3300053085 Bacteria 1009
816 Ga0501084_0053093 3300054114 Bacteria 3390
817 Ga0501084_0065694 3300054114 Bacteria 3036
818 Ga0501084_0072431 3300054114 Bacteria 2886
819 Ga0501084_0111464 3300054114 Bacteria 2299
820 Ga0501084_0134960 3300054114 Bacteria 2078
821 Ga0501084_0544832 3300054114 Bacteria 980
822 Ga0501084_0618861 3300054114 Bacteria 915
823 Ga0590074_002113 3300059423 Bacteria 3254
824 Ga0590075_033943 3300059424 Unclassified 1297
825 Ga0590077_062931 3300059426 Unclassified 842
826 Ga0501082_0006325 3300060353 Bacteria 10272
827 Ga0501082_0048383 3300060353 Bacteria 3665
828 Ga0501082_0128487 3300060353 Bacteria 2198
829 Ga0501082_0225639 3300060353 Bacteria 1630
830 Ga0501082_0358988 3300060353 Bacteria 1271
831 Ga0466962_0027603 3300061719 Bacteria 2724
832 Ga0530510_0006274 3300061734 Bacteria 8272
833 Ga0530510_0056942 3300061734 Bacteria 2825
834 Ga0530510_0096219 3300061734 Bacteria 2164
835 Ga0530510_0329386 3300061734 Bacteria 1145
836 Ga0530510_0350031 3300061734 Unclassified 1110
837 Ga0105239_10044659
838 JGI24751J29686_10014635
839 JGI25406J46586_10053215
840 JGI25407J50210_10000770
841 Ga0070658_10350605
842 Ga0070658_10674471
843 Ga0070676_10441138
844 Ga0070683_100013511
845 Ga0070683_100026943
846 Ga0070683_100047293
847 Ga0070683_100090017
848 Ga0070683_100093890
849 Ga0070683_100107591
850 Ga0070683_100126091
851 Ga0070683_100188032
852 Ga0070683_100212043
853 Ga0070690_100019595
854 Ga0070690_100034526
855 Ga0070670_100007727
856 Ga0070670_100191050
857 Ga0070670_100518669
858 Ga0070677_10058660
859 Ga0070677_10186806
860 Ga0068869_100029542
861 Ga0068869_100755134
862 Ga0070680_100039196
863 Ga0070680_100062948
864 Ga0070680_100071052
865 Ga0070680_100084186
866 Ga0070680_100110932
867 Ga0070682_100045949
868 Ga0068868_100029440
869 Ga0068868_100040408
870 Ga0068868_100059846
871 Ga0068868_100086877
872 Ga0070660_100122232
873 Ga0070660_100186203
874 Ga0070660_100389158
875 Ga0070660_100664619
876 Ga0070689_100014951
877 Ga0070689_100020156
878 Ga0070691_10078402
879 Ga0070687_100077154
880 Ga0070661_100027680
881 Ga0070668_100291126
882 Ga0070668_100585297
883 Ga0070669_100241960
884 Ga0070671_100074414
885 Ga0070671_100085697
886 Ga0070671_100242059
887 Ga0070674_100004980
888 Ga0070674_100005962
889 Ga0070674_100059685
890 Ga0070673_100210876
891 Ga0070673_100589466
892 Ga0070688_100024520
893 Ga0070659_100051870
894 Ga0070709_10127352
895 Ga0070714_100184212
896 Ga0070714_100287713
897 Ga0070713_100301499
898 Ga0070710_10013945
899 Ga0070710_10405742
900 Ga0070701_10005292
901 Ga0070701_10038856
902 Ga0070711_100007272
903 Ga0070705_100117116
904 Ga0070705_100201468
905 Ga0070700_100003305
906 Ga0070700_100026488
907 Ga0070700_100048276
908 Ga0070694_100111249
909 Ga0070708_100039060
910 Ga0070663_100024955
911 Ga0070663_100171550
912 Ga0070663_100371220
913 Ga0070678_100023954
914 Ga0070678_100027885
915 Ga0070662_100199148
916 Ga0070662_100268052
917 Ga0070662_100503178
918 Ga0070681_10007560
919 Ga0070681_10174916
920 Ga0068867_100101821
921 Ga0068867_100125999
922 Ga0068867_100292808
923 Ga0070685_10005360
924 Ga0070707_100026060
925 Ga0070698_100031331
926 Ga0070699_100106492
927 Ga0070699_100167127
928 Ga0070679_100009976
929 Ga0070679_100147751
930 Ga0070679_100176844
931 Ga0070684_100002263
932 Ga0070684_100007411
933 Ga0070684_100022623
934 Ga0070684_100045412
935 Ga0070684_100049522
936 Ga0070684_100149299
937 Ga0070684_100176819
938 Ga0070684_100351701
939 Ga0070697_100170300
940 Ga0068853_100082054
941 Ga0070672_100082022
942 Ga0070672_100226380
943 Ga0070686_100014705
944 Ga0070686_100028968
945 Ga0070686_100047377
946 Ga0070686_100113152
947 Ga0070686_100446279
948 Ga0070695_100172524
949 Ga0070695_100176033
950 Ga0070696_100061405
951 Ga0070696_100260016
952 Ga0070693_100015854
953 Ga0070693_100027344
954 Ga0070693_100047295
955 Ga0070693_100165864
956 Ga0070665_100048803
957 Ga0070665_100089131
958 Ga0070704_100204659
959 Ga0070704_100279763
960 Ga0068855_100065227
961 Ga0068855_100169056
962 Ga0068855_100269473
963 Ga0068855_100420102
964 Ga0070664_100216694
965 Ga0068857_100086654
966 Ga0068857_100414155
967 Ga0068854_100031564
968 Ga0068854_100104565
969 Ga0068854_100139840
970 Ga0068856_100016763
971 Ga0068856_100019584
972 Ga0068856_100056424
973 Ga0068856_100060833
974 Ga0068856_100074879
975 Ga0068856_100383067
976 Ga0068852_100010955
977 Ga0068852_100074113
978 Ga0068852_100122054
979 Ga0068852_100349586
980 Ga0068859_100258369
981 Ga0068864_100064733
982 Ga0068864_100064875
983 Ga0068866_10003296
984 Ga0068870_10067468
985 Ga0068863_100150822
986 Ga0068863_100366295
987 Ga0068860_100085016
988 Ga0068860_100154709
989 Ga0068860_100366644
990 Ga0081455_10022186
991 Ga0081455_10078046
992 Ga0081455_10128328
993 Ga0081455_10192377
994 Ga0081455_10241138
995 Ga0081538_10000093
996 Ga0081538_10000917
997 Ga0081538_10009114
998 Ga0081539_10000363
999 Ga0075365_10059341
1000 Ga0075363_100180801
1001 Ga0075364_10023031
1002 Ga0070716_100011235
1003 Ga0070716_100098021
1004 Ga0070712_100075562
1005 Ga0070712_100089854
1006 Ga0097621_100017526
1007 Ga0097621_100236415
1008 Ga0097621_100263428
1009 Ga0068871_100024455
1010 Ga0068871_100053110
1011 Ga0068871_100135211
1012 Ga0068871_100217609
1013 Ga0075428_100055596
1014 Ga0075428_100218272
1015 Ga0075428_100313518
1016 Ga0075430_100061646
1017 Ga0075430_100086585
1018 Ga0075430_100157756
1019 Ga0075431_100052231
1020 Ga0075431_100074243
1021 Ga0075433_10182918
1022 Ga0075434_100001851
1023 Ga0075434_100008655
1024 Ga0075434_100042760
1025 Ga0075434_100310345
1026 Ga0075434_100611575
1027 Ga0075429_100034302
1028 Ga0075429_100183319
1029 Ga0068865_100009060
1030 Ga0068865_100030396
1031 Ga0068865_100179268
1032 Ga0068865_100184091
1033 Ga0075436_100009503
1034 Ga0075436_100024409
1035 Ga0097620_100258337
1036 Ga0075435_100033567
1037 Ga0075435_100088796
1038 Ga0075435_100189719
1039 Ga0105240_10320960
1040 Ga0105240_10347429
1041 Ga0111539_10010806
1042 Ga0111539_10016408
1043 Ga0111539_10375452
1044 Ga0111539_10420010
1045 Ga0111539_10935127
1046 Ga0111539_11170066
1047 Ga0105245_10023127
1048 Ga0105245_10024081
1049 Ga0105245_10026917
1050 Ga0105245_10075223
1051 Ga0105245_10082758
1052 Ga0105245_10090493
1053 Ga0105245_10121076
1054 Ga0105245_10146812
1055 Ga0105245_10154705
1056 Ga0105245_10353198
1057 Ga0105245_10527894
1058 Ga0105245_10867518
1059 Ga0105245_11154827
1060 Ga0114129_10063811
1061 Ga0114129_10141717
1062 Ga0114129_10245538
1063 Ga0114129_10603390
1064 Ga0105243_10041511
1065 Ga0105243_10068542
1066 Ga0105243_10070713
1067 Ga0105243_10168419
1068 Ga0105243_10911210
1069 Ga0105241_10033872
1070 Ga0105242_10156276
1071 Ga0105242_10374476
1072 Ga0105242_10677604
1073 Ga0105248_10829601
1074 Ga0105248_11169934
1075 Ga0105238_10053698
1076 Ga0105238_10080991
1077 Ga0105238_10154092
1078 Ga0105249_10020480
1079 Ga0105249_10727637
1080 Ga0105239_10033267
1081 Ga0105239_10065163
1082 Ga0105239_10778058
1083 Ga0105246_10025404
1084 Ga0105246_10093388
1085 Ga0105246_10368011
1086 Ga0157371_10180653
1087 Ga0157370_10595452
1088 Ga0157369_10001698
1089 Ga0157369_10106646
1090 Ga0157369_10382484
1091 Ga0157374_10020244
1092 Ga0157374_10409028
1093 Ga0157374_10600161
1094 Ga0157378_10638218
1095 Ga0157378_10978548
1096 Ga0163162_10255507
1097 Ga0157372_10054897
1098 Ga0157372_10068217
1099 Ga0157372_10109005
1100 Ga0157372_10827883
1101 Ga0157375_10032725
1102 Ga0157375_10545270
1103 Ga0157375_10564957
1104 Ga0157375_10656884
1105 Ga0157375_10765692
1106 Ga0157375_11256566
1107 Ga0163163_10009258
1108 Ga0163163_10196739
1109 Ga0157380_10116230
1110 Ga0157380_10825902
1111 Ga0157380_10892964
1112 Ga0157377_10007410
1113 Ga0157377_10042506
1114 Ga0157377_10067162
1115 Ga0157379_10090083
1116 Ga0157376_10271269
1117 Ga0157376_10687097
1118 Ga0163161_10069647
1119 Ga0163161_10154831
1120 Ga0197907_10787494
1121 Ga0206356_10690906
1122 Ga0206354_10493040
1123 Ga0206354_11181411
1124 Ga0206353_10682305
1125 Ga0206353_11563311
1126 Ga0213876_10173606
1127 Ga0207653_10045403
1128 Ga0207682_10131711
1129 Ga0207692_10006352
1130 Ga0207692_10074306
1131 Ga0207642_10006027
1132 Ga0207642_10006211
1133 Ga0207642_10079263
1134 Ga0207642_10114279
1135 Ga0207688_10013509
1136 Ga0207688_10040384
1137 Ga0207688_10330089
1138 Ga0207685_10183672
1139 Ga0207645_10129437
1140 Ga0207643_10006336
1141 Ga0207705_10187184
1142 Ga0207684_10081383
1143 Ga0207654_10034181
1144 Ga0207654_10340525
1145 Ga0207654_10389089
1146 Ga0207707_10015519
1147 Ga0207707_10020859
1148 Ga0207693_10002227
1149 Ga0207693_10107738
1150 Ga0207693_10134809
1151 Ga0207693_10185444
1152 Ga0207663_10102392
1153 Ga0207660_10014082
1154 Ga0207660_10174227
1155 Ga0207660_10533787
1156 Ga0207662_10030533
1157 Ga0207662_10103164
1158 Ga0207657_10039192
1159 Ga0207657_10579652
1160 Ga0207657_10650851
1161 Ga0207649_10041202
1162 Ga0207652_10012862
1163 Ga0207652_10078373
1164 Ga0207652_10202229
1165 Ga0207652_10300395
1166 Ga0207652_10409002
1167 Ga0207681_10386858
1168 Ga0207694_10237139
1169 Ga0207694_10341585
1170 Ga0207694_10345114
1171 Ga0207650_10016944
1172 Ga0207659_10104562
1173 Ga0207659_10405487
1174 Ga0207687_10022683
1175 Ga0207687_10027614
1176 Ga0207687_10029173
1177 Ga0207687_10070197
1178 Ga0207687_10109983
1179 Ga0207687_10363695
1180 Ga0207700_10000028
1181 Ga0207700_10221860
1182 Ga0207664_10176568
1183 Ga0207664_10396316
1184 Ga0207664_10784449
1185 Ga0207644_10056530
1186 Ga0207644_10064384
1187 Ga0207690_10086333
1188 Ga0207706_10051097
1189 Ga0207706_10074971
1190 Ga0207706_10239430
1191 Ga0207706_10407067
1192 Ga0207706_10711986
1193 Ga0207686_10180867
1194 Ga0207709_10037539
1195 Ga0207709_10109083
1196 Ga0207709_10156559
1197 Ga0207670_10059903
1198 Ga0207669_10014396
1199 Ga0207704_10032807
1200 Ga0207665_10016464
1201 Ga0207665_10070940
1202 Ga0207691_10008423
1203 Ga0207711_10236339
1204 Ga0207689_10026029
1205 Ga0207689_10377512
1206 Ga0207689_10529991
1207 Ga0207689_10611576
1208 Ga0207661_10006079
1209 Ga0207661_10036005
1210 Ga0207661_10063063
1211 Ga0207661_10139743
1212 Ga0207661_10151254
1213 Ga0207661_10273858
1214 Ga0207661_10807737
1215 Ga0207679_10034083
1216 Ga0207679_10221029
1217 Ga0207679_10364172
1218 Ga0207667_10165119
1219 Ga0207667_10251091
1220 Ga0207667_10394999
1221 Ga0207667_10519289
1222 Ga0207667_10880642
1223 Ga0207651_10688704
1224 Ga0207712_10104656
1225 Ga0207712_10616945
1226 Ga0207668_10323397
1227 Ga0207668_10344644
1228 Ga0207640_10011193
1229 Ga0207640_10100021
1230 Ga0207677_10029329
1231 Ga0207677_10104612
1232 Ga0207677_10122539
1233 Ga0207677_10195183
1234 Ga0207677_10616520
1235 Ga0207678_10075875
1236 Ga0207678_10079945
1237 Ga0207678_10084591
1238 Ga0207678_10147832
1239 Ga0207678_10360243
1240 Ga0207708_10016076
1241 Ga0207708_10022412
1242 Ga0207708_10033742
1243 Ga0207708_10084149
1244 Ga0207708_10188994
1245 Ga0207702_10080039
1246 Ga0207702_10119051
1247 Ga0207702_10201809
1248 Ga0207702_10238868
1249 Ga0207641_10304650
1250 Ga0207641_10660975
1251 Ga0207648_10001618
1252 Ga0207648_10027846
1253 Ga0207648_10184700
1254 Ga0207648_10328856
1255 Ga0207648_10437068
1256 Ga0207648_10671302
1257 Ga0207674_10011223
1258 Ga0207674_10256794
1259 Ga0207675_100019600
1260 Ga0207675_100020260
1261 Ga0207675_100088815
1262 Ga0207675_100291051
1263 Ga0207675_100562717
1264 Ga0207683_10005786
1265 Ga0207683_10023914
1266 Ga0207683_10024330
1267 Ga0207683_10028840
1268 Ga0207683_10028930
1269 Ga0207683_10036902
1270 Ga0207428_10002578
1271 Ga0207428_10133040
1272 Ga0207428_10298528
1273 Ga0268266_10212816
1274 Ga0268266_11114546
1275 Ga0268265_10242349
1276 Ga0265318_10037183
1277 Ga0265338_10129398
1278 Ga0307408_100476957
1279 Ga0307408_100513371
1280 Ga0307405_10000763
1281 Ga0307405_10359396
1282 Ga0307413_10726688
1283 Ga0307410_10030123
1284 Ga0307406_10002380
1285 Ga0307406_10084650
1286 Ga0307406_10240866
1287 Ga0307407_10002086
1288 Ga0307412_10176038
1289 Ga0307409_100452512
1290 Ga0307409_100901063
1291 Ga0307416_100061199
1292 Ga0307416_100234962
1293 Ga0307416_100522864
1294 Ga0307414_10011153
1295 Ga0307415_100011986
1296 Ga0373928_0040147
1297 Ga0373944_0011271
1298 Ga0373951_0045506
1299 Ga0373943_0008346
1300 Ga0373943_0155318
1301 Ga0373946_0097326
1302 Ga0373931_0075531
1303 Ga0373927_0063413
1304 Ga0373947_0001800
1305 Ga0373925_0235356
1306 Ga0395899_0010469
1307 Ga0395899_0056130
1308 Ga0395899_0089903
1309 Ga0395899_0183006
1310 Ga0395900_0005641
1311 Ga0395900_0034902
1312 Ga0395900_0103933
1313 Ga0395900_0109143
1314 Ga0395900_0116757
1315 Ga0395900_0321796
1316 Ga0395900_0583692
1317 Ga0395898_0012333
1318 Ga0395898_0018348
1319 Ga0395898_0042686
1320 Ga0395898_0185978
1321 Ga0395898_0196252
1322 Ga0395898_0325954
1323 Ga0395898_0784231
1324 Ga0395905_0002820
1325 Ga0395905_0018242
1326 Ga0395905_0065878
1327 Ga0395905_0440253
1328 Ga0395901_0021008
1329 Ga0395901_0083306
1330 Ga0395901_0136099
1331 Ga0395901_0165855
1332 Ga0395901_0341237
1333 Ga0395901_0360676
1334 Ga0436365_1717107
1335 Ga0436363_1306718
1336 Ga0439451_049687
1337 Ga0466966_0147010
1338 Ga0466963_0011804
1339 Ga0466963_0064000
1340 Ga0466964_0038383
1341 Ga0466971_0012859
1342 Ga0466968_0132144
1343 Ga0466957_0209412
1344 Ga0466960_0027536
1345 Ga0466960_0051920
1346 Ga0466960_0413369
1347 Ga0451576_0039365
1348 Ga0451576_0070400
1349 Ga0451576_0288864
1350 Ga0466958_0047901
1351 Ga0466958_0051946
1352 Ga0466967_0015805
1353 Ga0466967_0026415
1354 Ga0466967_0074387
1355 Ga0495603_0040882
1356 Ga0495603_0262672
1357 Ga0495629_0004153
1358 Ga0495629_0611126
1359 Ga0495641_0000850
1360 Ga0495651_0021532
1361 Ga0495651_0233273
1362 Ga0495651_0283601
1363 Ga0495653_0096292
1364 Ga0495580_0179818
1365 Ga0495582_0000054
1366 Ga0495605_0229636
1367 Ga0495639_0000608
1368 Ga0495639_0026258
1369 Ga0495662_0007155
1370 Ga0495584_0078101
1371 Ga0495594_0060192
1372 Ga0495607_0046643
1373 Ga0495608_0058926
1374 Ga0495608_0223848
1375 Ga0495618_0257340
1376 Ga0495630_0006532
1377 Ga0495630_0099611
1378 Ga0495630_0901591
1379 Ga0495631_0045678
1380 Ga0495663_0081187
1381 Ga0495666_0083864
1382 Ga0495642_0035217
1383 Ga0495652_0516051
1384 Ga0495640_0151385
1385 Ga0495586_0077937
1386 Ga0495587_0084487
1387 Ga0495587_0186313
1388 Ga0495609_0184828
1389 Ga0495667_0037023
1390 Ga0495667_0063607
1391 Ga0495656_0355838
1392 Ga0495668_0355221
1393 Ga0495635_0015770
1394 Ga0495635_0358885
1395 Ga0495659_0057466
1396 Ga0495659_0077257
1397 Ga0495657_0070907
1398 Ga0495646_0089793
1399 Ga0495647_0012862
1400 Ga0495658_0001151
1401 Ga0495658_0519893
1402 Ga0495613_0015631
1403 Ga0495613_0139580
1404 Ga0495624_0019148
1405 Ga0495600_0017106
1406 Ga0495600_0197960
1407 Ga0495581_0001507
1408 Ga0495604_0277326
1409 Ga0495674_0066250
1410 Ga0495674_0122635
1411 Ga0495676_0001978
1412 Ga0495676_0012780
1413 Ga0495680_0007171
1414 Ga0495675_0219417
1415 Ga0495677_0031065
1416 Ga0495677_0209213
1417 Ga0495684_0355666
1418 Ga0495593_0010033
1419 Ga0495614_0005102
1420 Ga0496100_0006635
1421 Ga0496100_0052242
1422 Ga0496100_0079903
1423 Ga0496100_0143567
1424 Ga0496100_0181469
1425 Ga0496100_0848239
1426 Ga0496100_1264702
1427 Ga0496101_0002853
1428 Ga0496101_0007728
1429 Ga0496101_0014724
1430 Ga0496101_0023646
1431 Ga0496101_0038763
1432 Ga0496101_0068102
1433 Ga0496101_0161190
1434 Ga0496101_0209372
1435 Ga0496102_0090721
1436 Ga0496102_0206556
1437 Ga0496102_0509105
1438 Ga0496102_0581264
1439 Ga0496103_0002848
1440 Ga0496103_0192402
1441 Ga0496104_0000261
1442 Ga0496104_0005537
1443 Ga0496104_0019952
1444 Ga0496104_0021669
1445 Ga0496104_0062208
1446 Ga0496104_0112553
1447 Ga0496104_0149135
1448 Ga0496104_0631403
1449 Ga0496105_0000341
1450 Ga0496105_0000489
1451 Ga0496105_0106462
1452 Ga0496105_0229308
1453 Ga0496105_0432799
1454 Ga0496106_0009087
1455 Ga0496106_0056290
1456 Ga0496106_0099407
1457 Ga0496106_0113899
1458 Ga0496106_0297114
1459 Ga0496106_0778695
1460 Ga0496107_0002143
1461 Ga0496107_0003268
1462 Ga0496107_0029143
1463 Ga0496107_0032884
1464 Ga0496107_0052381
1465 Ga0496107_0091743
1466 Ga0496107_0128782
1467 Ga0496107_0147328
1468 Ga0496107_0227916
1469 Ga0496108_0007200
1470 Ga0496108_0023336
1471 Ga0496108_0070061
1472 Ga0496108_0084511
1473 Ga0496108_0115761
1474 Ga0496108_0115931
1475 Ga0496108_0152234
1476 Ga0496108_0218221
1477 Ga0496109_0000301
1478 Ga0496109_0007517
1479 Ga0496109_0015256
1480 Ga0496109_0018133
1481 Ga0496109_0028696
1482 Ga0496109_0058691
1483 Ga0496109_0077625
1484 Ga0496109_0111816
1485 Ga0496109_0188717
1486 Ga0496109_0564728
1487 Ga0496109_0643051
1488 Ga0496109_0643562
1489 Ga0496110_0000221
1490 Ga0496110_0008818
1491 Ga0496110_0011717
1492 Ga0496110_0011876
1493 Ga0496110_0028246
1494 Ga0496110_0046383
1495 Ga0496110_0059256
1496 Ga0496110_0080714
1497 Ga0496110_0139428
1498 Ga0496110_0467391
1499 Ga0496111_0000132
1500 Ga0496111_0001079
1501 Ga0496111_0001218
1502 Ga0496111_0029353
1503 Ga0496111_0042088
1504 Ga0496111_0178400
1505 Ga0496112_0003185
1506 Ga0496112_0055832
1507 Ga0496112_0865720
1508 Ga0496112_1273153
1509 Ga0496113_0013269
1510 Ga0496113_0031188
1511 Ga0496113_0052525
1512 Ga0496113_0119987
1513 Ga0496113_0364064
1514 Ga0496113_0686111
1515 Ga0496114_0000801
1516 Ga0496114_0001557
1517 Ga0496114_0004524
1518 Ga0496114_0019844
1519 Ga0496114_0220629
1520 Ga0496114_0435352
1521 Ga0496114_1078594
1522 Ga0496115_0016111
1523 Ga0496115_0048676
1524 Ga0496115_0135703
1525 Ga0496115_0144913
1526 Ga0496115_0161679
1527 Ga0496115_0355954
1528 Ga0501291_003751
1529 Ga0501032_0086882
1530 Ga0501032_0537053
1531 Ga0501036_0012707
1532 Ga0501036_0159180
1533 Ga0501036_0475263
1534 Ga0501036_0769762
1535 Ga0501037_0014381
1536 Ga0501038_0015192
1537 Ga0501038_0721431
1538 Ga0501039_0049672
1539 Ga0501039_0102879
1540 Ga0501040_0004638
1541 Ga0501040_0009087
1542 Ga0501040_0111173
1543 Ga0501040_0118586
1544 Ga0501040_0163336
1545 Ga0501040_0880088
1546 Ga0501041_0072069
1547 Ga0501042_0067921
1548 Ga0501042_0117208
1549 Ga0501042_0133421
1550 Ga0501042_0177617
1551 Ga0501043_0010486
1552 Ga0501046_0000122
1553 Ga0501046_0483453
1554 Ga0501047_0191857
1555 Ga0501048_0047065
1556 Ga0501048_0075289
1557 Ga0501067_0007826
1558 Ga0501067_0053221
1559 Ga0501067_0147343
1560 Ga0501068_0000426
1561 Ga0501068_0006032
1562 Ga0501069_0000061
1563 Ga0501069_0002211
1564 Ga0501069_0004456
1565 Ga0501069_0026501
1566 Ga0501069_0070306
1567 Ga0501069_0088767
1568 Ga0501069_0169956
1569 Ga0501070_0005391
1570 Ga0501070_0666336
1571 Ga0501071_0054999
1572 Ga0501071_0067747
1573 Ga0501071_0127145
1574 Ga0501071_0134567
1575 Ga0501071_0146708
1576 Ga0501072_0132704
1577 Ga0501072_0409306
1578 Ga0501072_0809853
1579 Ga0501073_0008113
1580 Ga0501074_0052612
1581 Ga0501074_0132415
1582 Ga0501074_0174795
1583 Ga0501074_0434795
1584 Ga0501075_0031794
1585 Ga0501075_0037435
1586 Ga0501075_0295884
1587 Ga0501075_0562232
1588 Ga0501076_0031889
1589 Ga0501076_0060351
1590 Ga0501076_0095054
1591 Ga0501076_0177160
1592 Ga0501077_0018438
1593 Ga0501077_0040409
1594 Ga0501079_0024424
1595 Ga0501079_0043908
1596 Ga0501079_0359240
1597 Ga0501079_0403011
1598 Ga0501079_0830379
1599 Ga0501080_0033905
1600 Ga0501080_0047211
1601 Ga0501080_0208580
1602 Ga0501080_0383847
1603 Ga0501081_0016426
1604 Ga0501081_0037706
1605 Ga0501081_0162934
1606 Ga0501081_0733245
1607 Ga0501083_0001412
1608 Ga0501083_0170660
1609 Ga0501035_0015492
1610 Ga0501035_0211555
1611 Ga0501044_0008263
1612 Ga0501045_0045496
1613 Ga0501045_0071314
1614 Ga0501045_0193709
1615 Ga0501045_0353619
1616 nmdc:mga0yw44_109382_c1
1617 nmdc:mga05p37_174992_c1
1618 nmdc:mga05p37_202575_c1
1619 nmdc:mga05p37_28507_c1
1620 nmdc:mga05p37_77421_c1
1621 nmdc:mga09592_150544_c1
1622 nmdc:mga09592_337950_c1
1623 nmdc:mga09592_760081_c1
1624 nmdc:mga0qj67_379788_c1
1625 nmdc:mga0qj67_52311_c1
1626 nmdc:mga0qj67_61560_c1
1627 nmdc:mga06r32_29294_c1
1628 nmdc:mga08y16_29379_c1
1629 nmdc:mga08y16_54582_c2
1630 nmdc:mga08y16_689951_c1
1631 nmdc:mga08y16_81094_c1
1632 nmdc:mga0n895_1117356_c1
1633 nmdc:mga0n895_33689_c1
1634 nmdc:mga0n895_414195_c1
1635 nmdc:mga0n895_45639_c2
1636 nmdc:mga0n895_62016_c1
1637 nmdc:mga0rr50_211525_c1
1638 nmdc:mga0rr50_214993_c1
1639 nmdc:mga0rr50_223194_c1
1640 nmdc:mga0rr50_250903_c1
1641 nmdc:mga0rr50_321089_c1
1642 nmdc:mga08x19_20101_c1
1643 nmdc:mga08x19_38349_c1
1644 nmdc:mga0a205_178237_c1
1645 nmdc:mga0a205_189372_c1
1646 nmdc:mga0a205_293360_c1
1647 nmdc:mga0a205_649978_c1
1648 Ga0495655_0082696
1649 Ga0495619_0016537
1650 Ga0495619_0251256
1651 Ga0495619_0357840
1652 Ga0501084_0053093
1653 Ga0501084_0065694
1654 Ga0501084_0072431
1655 Ga0501084_0111464
1656 Ga0501084_0134960
1657 Ga0501084_0544832
1658 Ga0501084_0618861
1659 Ga0590074_002113
1660 Ga0590075_033943
1661 Ga0590077_062931
1662 Ga0501082_0006325
1663 Ga0501082_0048383
1664 Ga0501082_0128487
1665 Ga0501082_0225639
1666 Ga0501082_0358988
1667 Ga0466962_0027603
1668 Ga0530510_0006274
1669 Ga0530510_0056942
1670 Ga0530510_0096219
1671 Ga0530510_0329386
1672 Ga0530510_0350031

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02391

MoaE

MoaE protein

99

211

0.96

PF02597

ThiS

ThiS family

25

93

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2q5w-assembly1.cif.gz_E the x-ray crystal structure of molybdopterin synthase from staphylococcus aureus 0.9435 74 206
4ap8-assembly1.cif.gz_A crystal structure of human molybdopterin synthase catalytic subunit (mocs2b) 0.9406 76 198
2wp4-assembly1.cif.gz_A crystal structure of rv3119 from mycobacterium tuberculosis 0.9334 77 196
1nvj-assembly1.cif.gz_B deletion mutant (delta 141) of molybdopterin synthase 0.9247 75 194
6jc0-assembly1.cif.gz_B structural analysis of molybdopterin synthases from two mycobacteria pathogens 0.9182 76 205
ID Description Score Start End Superfamily
af_P91500_195_340_3.90.1170.40 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit 0.9689 76 207 3.90.1170.40
af_Q86HF4_1_145_3.90.1170.40 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit 0.9481 76 208 3.90.1170.40
5mpoC00 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit 0.9357 75 198 3.90.1170.40
2qieK00 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit 0.9309 74 207 3.90.1170.40
2qieK00 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit 0.9113 74 207 3.90.1170.40
ID Description Score Start End GO Terms
AF-A0A151GLE3-F1-model_v4 Molybdenum cofactor synthesis protein 2b 0.9758 90 207 GO:0006777
AF-A0A3N5F992-F1-model_v4 Molybdenum cofactor biosynthesis protein MoaE 0.9749 76 206 GO:0006777
AF-R1EYC6-F1-model_v4 Molybdopterin synthase catalytic subunit (EC 2.8.1.12) (Common component for nitrate reductase and xanthine dehydrogenase protein H) (Molybdenum cofactor synthesis protein 2 large subunit) (Molybdenum cofactor synthesis protein 2B) (MOCS2B) 0.9746 76 207 GO:0006777
GO:0030366
GO:1990140
AF-A0A495ZJE1-F1-model_v4 Molybdenum cofactor biosynthesis protein MoaE 0.9742 78 207 GO:0006777
AF-A0A5N5D4U3-F1-model_v4 Molybdopterin synthase catalytic subunit (EC 2.8.1.12) (Common component for nitrate reductase and xanthine dehydrogenase protein H) (Molybdenum cofactor synthesis protein 2 large subunit) (Molybdenum cofactor synthesis protein 2B) (MOCS2B) 0.9739 76 207 GO:0006777
GO:0030366
GO:1990140

Map