F482879
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 836 | 328 | 1672 | 211 |
Family's Representative Sequence
| Representative Sequence | 3300010375|Ga0105239_10044659|Ga0105239_100446596 |
| Length | 231 |
| Sequence | MYGGFAISMADPPFCVKYAQAVIRVRLFAGLREQAGWSQRELDVATVADVWPALGLGEEPAGLLYAVNREYAEPDRELHNGDEVALIPPVSGGADDVLLTADPLSLDAAVRAAASDEAGAVATFVGTVRRQSRGREVTRLEYEAYAEMAEDVMAQLARDLEERYDLCAVAIHHRVGALAIGEASVVIAVSAPHRQDALAACKDAIDRLKETVPLWKKEVYEGGEEWIGRGS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 2 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 3 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 4 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 42 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 50 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 58 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 60 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 61 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 62 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 63 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 64 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 65 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 66 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 67 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 68 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 69 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 70 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 71 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 72 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 73 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 74 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 75 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 79 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 80 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 81 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 82 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 83 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 84 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 85 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 86 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 87 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 89 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 115 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 116 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 117 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 118 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 119 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 174 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 177 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 178 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 179 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 180 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 181 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 182 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 183 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 184 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 185 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 186 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 187 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 188 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 189 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 190 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 191 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 192 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 193 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 194 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 195 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 196 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 197 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 198 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 199 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 200 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 201 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 202 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 203 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 204 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 205 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 206 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 207 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 208 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 209 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 210 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 211 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 212 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 213 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 214 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 215 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 216 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 264 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 265 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 266 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 267 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 268 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 269 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 270 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 271 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 272 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 273 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 274 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 275 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 276 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 277 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 278 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 279 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 280 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 298 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 311 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 317 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 319 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 324 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 325 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 326 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 328 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.28 |
| Metatranscriptomes | 0.72 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.48 |
| Nodule | 0 |
| Rhizoplane | 12.92 |
| Rhizosphere | 86.24 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.61 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0105239_10044659 | 3300010375 | Bacteria | 4857 |
| 2 | JGI24751J29686_10014635 | 3300002459 | Bacteria | 1618 |
| 3 | JGI25406J46586_10053215 | 3300003203 | Bacteria | 1345 |
| 4 | JGI25407J50210_10000770 | 3300003373 | Bacteria | 6751 |
| 5 | Ga0070658_10350605 | 3300005327 | Bacteria | 1263 |
| 6 | Ga0070658_10674471 | 3300005327 | Bacteria | 897 |
| 7 | Ga0070676_10441138 | 3300005328 | Bacteria | 914 |
| 8 | Ga0070683_100013511 | 3300005329 | Bacteria | 7123 |
| 9 | Ga0070683_100026943 | 3300005329 | Bacteria | 5180 |
| 10 | Ga0070683_100047293 | 3300005329 | Bacteria | 3975 |
| 11 | Ga0070683_100090017 | 3300005329 | Bacteria | 2881 |
| 12 | Ga0070683_100093890 | 3300005329 | Bacteria | 2819 |
| 13 | Ga0070683_100107591 | 3300005329 | Bacteria | 2629 |
| 14 | Ga0070683_100126091 | 3300005329 | Bacteria | 2420 |
| 15 | Ga0070683_100188032 | 3300005329 | Bacteria | 1961 |
| 16 | Ga0070683_100212043 | 3300005329 | Bacteria | 1840 |
| 17 | Ga0070690_100019595 | 3300005330 | Bacteria | 4109 |
| 18 | Ga0070690_100034526 | 3300005330 | Bacteria | 3169 |
| 19 | Ga0070670_100007727 | 3300005331 | Bacteria | 9144 |
| 20 | Ga0070670_100191050 | 3300005331 | Bacteria | 1779 |
| 21 | Ga0070670_100518669 | 3300005331 | Bacteria | 1061 |
| 22 | Ga0070677_10058660 | 3300005333 | Bacteria | 1581 |
| 23 | Ga0070677_10186806 | 3300005333 | Unclassified | 991 |
| 24 | Ga0068869_100029542 | 3300005334 | Bacteria | 3842 |
| 25 | Ga0068869_100755134 | 3300005334 | Bacteria | 833 |
| 26 | Ga0070680_100039196 | 3300005336 | Bacteria | 3834 |
| 27 | Ga0070680_100062948 | 3300005336 | Bacteria | 3039 |
| 28 | Ga0070680_100071052 | 3300005336 | Bacteria | 2860 |
| 29 | Ga0070680_100084186 | 3300005336 | Bacteria | 2626 |
| 30 | Ga0070680_100110932 | 3300005336 | Bacteria | 2283 |
| 31 | Ga0070682_100045949 | 3300005337 | Bacteria | 2709 |
| 32 | Ga0068868_100029440 | 3300005338 | Bacteria | 4205 |
| 33 | Ga0068868_100040408 | 3300005338 | Bacteria | 3630 |
| 34 | Ga0068868_100059846 | 3300005338 | Bacteria | 3014 |
| 35 | Ga0068868_100086877 | 3300005338 | Bacteria | 2515 |
| 36 | Ga0070660_100122232 | 3300005339 | Bacteria | 2078 |
| 37 | Ga0070660_100186203 | 3300005339 | Bacteria | 1681 |
| 38 | Ga0070660_100389158 | 3300005339 | Bacteria | 1152 |
| 39 | Ga0070660_100664619 | 3300005339 | Bacteria | 873 |
| 40 | Ga0070689_100014951 | 3300005340 | Bacteria | 5650 |
| 41 | Ga0070689_100020156 | 3300005340 | Bacteria | 4945 |
| 42 | Ga0070691_10078402 | 3300005341 | Bacteria | 1613 |
| 43 | Ga0070687_100077154 | 3300005343 | Bacteria | 1807 |
| 44 | Ga0070661_100027680 | 3300005344 | Bacteria | 4084 |
| 45 | Ga0070668_100291126 | 3300005347 | Bacteria | 1367 |
| 46 | Ga0070668_100585297 | 3300005347 | Bacteria | 975 |
| 47 | Ga0070669_100241960 | 3300005353 | Bacteria | 1434 |
| 48 | Ga0070671_100074414 | 3300005355 | Bacteria | 2838 |
| 49 | Ga0070671_100085697 | 3300005355 | Bacteria | 2636 |
| 50 | Ga0070671_100242059 | 3300005355 | Bacteria | 1532 |
| 51 | Ga0070674_100004980 | 3300005356 | Bacteria | 7615 |
| 52 | Ga0070674_100005962 | 3300005356 | Bacteria | 7084 |
| 53 | Ga0070674_100059685 | 3300005356 | Bacteria | 2656 |
| 54 | Ga0070673_100210876 | 3300005364 | Bacteria | 1677 |
| 55 | Ga0070673_100589466 | 3300005364 | Bacteria | 1013 |
| 56 | Ga0070688_100024520 | 3300005365 | Bacteria | 3560 |
| 57 | Ga0070659_100051870 | 3300005366 | Bacteria | 3225 |
| 58 | Ga0070709_10127352 | 3300005434 | Bacteria | 1734 |
| 59 | Ga0070714_100184212 | 3300005435 | Bacteria | 1902 |
| 60 | Ga0070714_100287713 | 3300005435 | Bacteria | 1529 |
| 61 | Ga0070713_100301499 | 3300005436 | Bacteria | 1475 |
| 62 | Ga0070710_10013945 | 3300005437 | Bacteria | 4036 |
| 63 | Ga0070710_10405742 | 3300005437 | Unclassified | 914 |
| 64 | Ga0070701_10005292 | 3300005438 | Bacteria | 5315 |
| 65 | Ga0070701_10038856 | 3300005438 | Bacteria | 2411 |
| 66 | Ga0070711_100007272 | 3300005439 | Bacteria | 6729 |
| 67 | Ga0070705_100117116 | 3300005440 | Bacteria | 1713 |
| 68 | Ga0070705_100201468 | 3300005440 | Bacteria | 1365 |
| 69 | Ga0070700_100003305 | 3300005441 | Bacteria | 8313 |
| 70 | Ga0070700_100026488 | 3300005441 | Bacteria | 3424 |
| 71 | Ga0070700_100048276 | 3300005441 | Bacteria | 2638 |
| 72 | Ga0070694_100111249 | 3300005444 | Bacteria | 1951 |
| 73 | Ga0070708_100039060 | 3300005445 | Bacteria | 4150 |
| 74 | Ga0070663_100024955 | 3300005455 | Bacteria | 4031 |
| 75 | Ga0070663_100171550 | 3300005455 | Bacteria | 1677 |
| 76 | Ga0070663_100371220 | 3300005455 | Unclassified | 1163 |
| 77 | Ga0070678_100023954 | 3300005456 | Bacteria | 4077 |
| 78 | Ga0070678_100027885 | 3300005456 | Bacteria | 3842 |
| 79 | Ga0070662_100199148 | 3300005457 | Bacteria | 1588 |
| 80 | Ga0070662_100268052 | 3300005457 | Bacteria | 1378 |
| 81 | Ga0070662_100503178 | 3300005457 | Bacteria | 1011 |
| 82 | Ga0070681_10007560 | 3300005458 | Bacteria | 10619 |
| 83 | Ga0070681_10174916 | 3300005458 | Bacteria | 2068 |
| 84 | Ga0068867_100101821 | 3300005459 | Bacteria | 2195 |
| 85 | Ga0068867_100125999 | 3300005459 | Bacteria | 1985 |
| 86 | Ga0068867_100292808 | 3300005459 | Bacteria | 1339 |
| 87 | Ga0070685_10005360 | 3300005466 | Bacteria | 6501 |
| 88 | Ga0070707_100026060 | 3300005468 | Bacteria | 5548 |
| 89 | Ga0070698_100031331 | 3300005471 | Bacteria | 5514 |
| 90 | Ga0070699_100106492 | 3300005518 | Bacteria | 2460 |
| 91 | Ga0070699_100167127 | 3300005518 | Bacteria | 1949 |
| 92 | Ga0070679_100009976 | 3300005530 | Bacteria | 8990 |
| 93 | Ga0070679_100147751 | 3300005530 | Bacteria | 2328 |
| 94 | Ga0070679_100176844 | 3300005530 | Bacteria | 2107 |
| 95 | Ga0070684_100002263 | 3300005535 | Bacteria | 14169 |
| 96 | Ga0070684_100007411 | 3300005535 | Bacteria | 8526 |
| 97 | Ga0070684_100022623 | 3300005535 | Bacteria | 5246 |
| 98 | Ga0070684_100045412 | 3300005535 | Bacteria | 3804 |
| 99 | Ga0070684_100049522 | 3300005535 | Bacteria | 3646 |
| 100 | Ga0070684_100149299 | 3300005535 | Bacteria | 2117 |
| 101 | Ga0070684_100176819 | 3300005535 | Bacteria | 1940 |
| 102 | Ga0070684_100351701 | 3300005535 | Bacteria | 1355 |
| 103 | Ga0070697_100170300 | 3300005536 | Bacteria | 1843 |
| 104 | Ga0068853_100082054 | 3300005539 | Bacteria | 2824 |
| 105 | Ga0070672_100082022 | 3300005543 | Bacteria | 2587 |
| 106 | Ga0070672_100226380 | 3300005543 | Bacteria | 1570 |
| 107 | Ga0070686_100014705 | 3300005544 | Bacteria | 4517 |
| 108 | Ga0070686_100028968 | 3300005544 | Bacteria | 3362 |
| 109 | Ga0070686_100047377 | 3300005544 | Bacteria | 2718 |
| 110 | Ga0070686_100113152 | 3300005544 | Bacteria | 1852 |
| 111 | Ga0070686_100446279 | 3300005544 | Bacteria | 993 |
| 112 | Ga0070695_100172524 | 3300005545 | Bacteria | 1526 |
| 113 | Ga0070695_100176033 | 3300005545 | Bacteria | 1512 |
| 114 | Ga0070696_100061405 | 3300005546 | Bacteria | 2629 |
| 115 | Ga0070696_100260016 | 3300005546 | Bacteria | 1316 |
| 116 | Ga0070693_100015854 | 3300005547 | Bacteria | 3888 |
| 117 | Ga0070693_100027344 | 3300005547 | Bacteria | 3090 |
| 118 | Ga0070693_100047295 | 3300005547 | Bacteria | 2447 |
| 119 | Ga0070693_100165864 | 3300005547 | Bacteria | 1411 |
| 120 | Ga0070665_100048803 | 3300005548 | Bacteria | 4249 |
| 121 | Ga0070665_100089131 | 3300005548 | Bacteria | 3091 |
| 122 | Ga0070704_100204659 | 3300005549 | Bacteria | 1596 |
| 123 | Ga0070704_100279763 | 3300005549 | Bacteria | 1382 |
| 124 | Ga0068855_100065227 | 3300005563 | Bacteria | 4245 |
| 125 | Ga0068855_100169056 | 3300005563 | Bacteria | 2477 |
| 126 | Ga0068855_100269473 | 3300005563 | Bacteria | 1894 |
| 127 | Ga0068855_100420102 | 3300005563 | Unclassified | 1463 |
| 128 | Ga0070664_100216694 | 3300005564 | Bacteria | 1712 |
| 129 | Ga0068857_100086654 | 3300005577 | Bacteria | 2801 |
| 130 | Ga0068857_100414155 | 3300005577 | Bacteria | 1256 |
| 131 | Ga0068854_100031564 | 3300005578 | Bacteria | 3683 |
| 132 | Ga0068854_100104565 | 3300005578 | Bacteria | 2127 |
| 133 | Ga0068854_100139840 | 3300005578 | Bacteria | 1857 |
| 134 | Ga0068856_100016763 | 3300005614 | Bacteria | 7098 |
| 135 | Ga0068856_100019584 | 3300005614 | Bacteria | 6570 |
| 136 | Ga0068856_100056424 | 3300005614 | Bacteria | 3875 |
| 137 | Ga0068856_100060833 | 3300005614 | Bacteria | 3730 |
| 138 | Ga0068856_100074879 | 3300005614 | Bacteria | 3353 |
| 139 | Ga0068856_100383067 | 3300005614 | Archaea | 1426 |
| 140 | Ga0068852_100010955 | 3300005616 | Bacteria | 6797 |
| 141 | Ga0068852_100074113 | 3300005616 | Bacteria | 2996 |
| 142 | Ga0068852_100122054 | 3300005616 | Bacteria | 2387 |
| 143 | Ga0068852_100349586 | 3300005616 | Bacteria | 1443 |
| 144 | Ga0068859_100258369 | 3300005617 | Bacteria | 1833 |
| 145 | Ga0068864_100064733 | 3300005618 | Bacteria | 3171 |
| 146 | Ga0068864_100064875 | 3300005618 | Bacteria | 3168 |
| 147 | Ga0068866_10003296 | 3300005718 | Bacteria | 6632 |
| 148 | Ga0068870_10067468 | 3300005840 | Bacteria | 1941 |
| 149 | Ga0068863_100150822 | 3300005841 | Bacteria | 2224 |
| 150 | Ga0068863_100366295 | 3300005841 | Unclassified | 1406 |
| 151 | Ga0068860_100085016 | 3300005843 | Bacteria | 3009 |
| 152 | Ga0068860_100154709 | 3300005843 | Unclassified | 2210 |
| 153 | Ga0068860_100366644 | 3300005843 | Bacteria | 1420 |
| 154 | Ga0081455_10022186 | 3300005937 | Bacteria | 5939 |
| 155 | Ga0081455_10078046 | 3300005937 | Bacteria | 2722 |
| 156 | Ga0081455_10128328 | 3300005937 | Bacteria | 1987 |
| 157 | Ga0081455_10192377 | 3300005937 | Bacteria | 1535 |
| 158 | Ga0081455_10241138 | 3300005937 | Bacteria | 1328 |
| 159 | Ga0081538_10000093 | 3300005981 | Bacteria | 86826 |
| 160 | Ga0081538_10000917 | 3300005981 | Bacteria | 31782 |
| 161 | Ga0081538_10009114 | 3300005981 | Bacteria | 8325 |
| 162 | Ga0081539_10000363 | 3300005985 | Bacteria | 99391 |
| 163 | Ga0075365_10059341 | 3300006038 | Bacteria | 2550 |
| 164 | Ga0075363_100180801 | 3300006048 | Unclassified | 1200 |
| 165 | Ga0075364_10023031 | 3300006051 | Bacteria | 3940 |
| 166 | Ga0070716_100011235 | 3300006173 | Bacteria | 4508 |
| 167 | Ga0070716_100098021 | 3300006173 | Bacteria | 1790 |
| 168 | Ga0070712_100075562 | 3300006175 | Bacteria | 2423 |
| 169 | Ga0070712_100089854 | 3300006175 | Bacteria | 2248 |
| 170 | Ga0097621_100017526 | 3300006237 | Bacteria | 5440 |
| 171 | Ga0097621_100236415 | 3300006237 | Bacteria | 1596 |
| 172 | Ga0097621_100263428 | 3300006237 | Bacteria | 1513 |
| 173 | Ga0068871_100024455 | 3300006358 | Bacteria | 4685 |
| 174 | Ga0068871_100053110 | 3300006358 | Bacteria | 3284 |
| 175 | Ga0068871_100135211 | 3300006358 | Bacteria | 2093 |
| 176 | Ga0068871_100217609 | 3300006358 | Bacteria | 1654 |
| 177 | Ga0075428_100055596 | 3300006844 | Bacteria | 4336 |
| 178 | Ga0075428_100218272 | 3300006844 | Bacteria | 2060 |
| 179 | Ga0075428_100313518 | 3300006844 | Bacteria | 1686 |
| 180 | Ga0075430_100061646 | 3300006846 | Bacteria | 3151 |
| 181 | Ga0075430_100086585 | 3300006846 | Bacteria | 2622 |
| 182 | Ga0075430_100157756 | 3300006846 | Unclassified | 1889 |
| 183 | Ga0075431_100052231 | 3300006847 | Bacteria | 4214 |
| 184 | Ga0075431_100074243 | 3300006847 | Unclassified | 3509 |
| 185 | Ga0075433_10182918 | 3300006852 | Bacteria | 1865 |
| 186 | Ga0075434_100001851 | 3300006871 | Bacteria | 18258 |
| 187 | Ga0075434_100008655 | 3300006871 | Bacteria | 9476 |
| 188 | Ga0075434_100042760 | 3300006871 | Bacteria | 4492 |
| 189 | Ga0075434_100310345 | 3300006871 | Unclassified | 1598 |
| 190 | Ga0075434_100611575 | 3300006871 | Unclassified | 1109 |
| 191 | Ga0075429_100034302 | 3300006880 | Bacteria | 4409 |
| 192 | Ga0075429_100183319 | 3300006880 | Bacteria | 1835 |
| 193 | Ga0068865_100009060 | 3300006881 | Bacteria | 6156 |
| 194 | Ga0068865_100030396 | 3300006881 | Bacteria | 3593 |
| 195 | Ga0068865_100179268 | 3300006881 | Bacteria | 1630 |
| 196 | Ga0068865_100184091 | 3300006881 | Bacteria | 1610 |
| 197 | Ga0075436_100009503 | 3300006914 | Bacteria | 6651 |
| 198 | Ga0075436_100024409 | 3300006914 | Bacteria | 4156 |
| 199 | Ga0097620_100258337 | 3300006931 | Bacteria | 1833 |
| 200 | Ga0075435_100033567 | 3300007076 | Bacteria | 4059 |
| 201 | Ga0075435_100088796 | 3300007076 | Bacteria | 2548 |
| 202 | Ga0075435_100189719 | 3300007076 | Bacteria | 1739 |
| 203 | Ga0105240_10320960 | 3300009093 | Bacteria | 1765 |
| 204 | Ga0105240_10347429 | 3300009093 | Archaea | 1683 |
| 205 | Ga0111539_10010806 | 3300009094 | Bacteria | 11493 |
| 206 | Ga0111539_10016408 | 3300009094 | Bacteria | 9184 |
| 207 | Ga0111539_10375452 | 3300009094 | Unclassified | 1655 |
| 208 | Ga0111539_10420010 | 3300009094 | Unclassified | 1558 |
| 209 | Ga0111539_10935127 | 3300009094 | Bacteria | 1008 |
| 210 | Ga0111539_11170066 | 3300009094 | Bacteria | 893 |
| 211 | Ga0105245_10023127 | 3300009098 | Bacteria | 5454 |
| 212 | Ga0105245_10024081 | 3300009098 | Bacteria | 5345 |
| 213 | Ga0105245_10026917 | 3300009098 | Bacteria | 5063 |
| 214 | Ga0105245_10075223 | 3300009098 | Bacteria | 3074 |
| 215 | Ga0105245_10082758 | 3300009098 | Bacteria | 2936 |
| 216 | Ga0105245_10090493 | 3300009098 | Bacteria | 2815 |
| 217 | Ga0105245_10121076 | 3300009098 | Bacteria | 2445 |
| 218 | Ga0105245_10146812 | 3300009098 | Bacteria | 2226 |
| 219 | Ga0105245_10154705 | 3300009098 | Unclassified | 2171 |
| 220 | Ga0105245_10353198 | 3300009098 | Bacteria | 1457 |
| 221 | Ga0105245_10527894 | 3300009098 | Bacteria | 1200 |
| 222 | Ga0105245_10867518 | 3300009098 | Unclassified | 943 |
| 223 | Ga0105245_11154827 | 3300009098 | Unclassified | 821 |
| 224 | Ga0114129_10063811 | 3300009147 | Bacteria | 5141 |
| 225 | Ga0114129_10141717 | 3300009147 | Bacteria | 3294 |
| 226 | Ga0114129_10245538 | 3300009147 | Bacteria | 2405 |
| 227 | Ga0114129_10603390 | 3300009147 | Unclassified | 1422 |
| 228 | Ga0105243_10041511 | 3300009148 | Bacteria | 3598 |
| 229 | Ga0105243_10068542 | 3300009148 | Bacteria | 2859 |
| 230 | Ga0105243_10070713 | 3300009148 | Bacteria | 2819 |
| 231 | Ga0105243_10168419 | 3300009148 | Bacteria | 1895 |
| 232 | Ga0105243_10911210 | 3300009148 | Bacteria | 875 |
| 233 | Ga0105241_10033872 | 3300009174 | Bacteria | 3836 |
| 234 | Ga0105242_10156276 | 3300009176 | Bacteria | 1992 |
| 235 | Ga0105242_10374476 | 3300009176 | Bacteria | 1322 |
| 236 | Ga0105242_10677604 | 3300009176 | Unclassified | 1006 |
| 237 | Ga0105248_10829601 | 3300009177 | Bacteria | 1043 |
| 238 | Ga0105248_11169934 | 3300009177 | Unclassified | 869 |
| 239 | Ga0105238_10053698 | 3300009551 | Bacteria | 4049 |
| 240 | Ga0105238_10080991 | 3300009551 | Bacteria | 3236 |
| 241 | Ga0105238_10154092 | 3300009551 | Bacteria | 2273 |
| 242 | Ga0105249_10020480 | 3300009553 | Bacteria | 5912 |
| 243 | Ga0105249_10727637 | 3300009553 | Unclassified | 1054 |
| 244 | Ga0105239_10033267 | 3300010375 | Bacteria | 5662 |
| 245 | Ga0105239_10065163 | 3300010375 | Bacteria | 4001 |
| 246 | Ga0105239_10778058 | 3300010375 | Bacteria | 1096 |
| 247 | Ga0105246_10025404 | 3300011119 | Bacteria | 3861 |
| 248 | Ga0105246_10093388 | 3300011119 | Bacteria | 2173 |
| 249 | Ga0105246_10368011 | 3300011119 | Bacteria | 1183 |
| 250 | Ga0157371_10180653 | 3300013102 | Bacteria | 1509 |
| 251 | Ga0157370_10595452 | 3300013104 | Bacteria | 1012 |
| 252 | Ga0157369_10001698 | 3300013105 | Bacteria | 26844 |
| 253 | Ga0157369_10106646 | 3300013105 | Bacteria | 2981 |
| 254 | Ga0157369_10382484 | 3300013105 | Unclassified | 1461 |
| 255 | Ga0157374_10020244 | 3300013296 | Bacteria | 5901 |
| 256 | Ga0157374_10409028 | 3300013296 | Unclassified | 1354 |
| 257 | Ga0157374_10600161 | 3300013296 | Bacteria | 1111 |
| 258 | Ga0157378_10638218 | 3300013297 | Bacteria | 1079 |
| 259 | Ga0157378_10978548 | 3300013297 | Bacteria | 879 |
| 260 | Ga0163162_10255507 | 3300013306 | Bacteria | 1884 |
| 261 | Ga0157372_10054897 | 3300013307 | Bacteria | 4447 |
| 262 | Ga0157372_10068217 | 3300013307 | Bacteria | 3998 |
| 263 | Ga0157372_10109005 | 3300013307 | Bacteria | 3170 |
| 264 | Ga0157372_10827883 | 3300013307 | Bacteria | 1075 |
| 265 | Ga0157375_10032725 | 3300013308 | Bacteria | 4933 |
| 266 | Ga0157375_10545270 | 3300013308 | Unclassified | 1322 |
| 267 | Ga0157375_10564957 | 3300013308 | Bacteria | 1298 |
| 268 | Ga0157375_10656884 | 3300013308 | Bacteria | 1204 |
| 269 | Ga0157375_10765692 | 3300013308 | Bacteria | 1116 |
| 270 | Ga0157375_11256566 | 3300013308 | Unclassified | 870 |
| 271 | Ga0163163_10009258 | 3300014325 | Bacteria | 8784 |
| 272 | Ga0163163_10196739 | 3300014325 | Bacteria | 2064 |
| 273 | Ga0157380_10116230 | 3300014326 | Bacteria | 2257 |
| 274 | Ga0157380_10825902 | 3300014326 | Bacteria | 946 |
| 275 | Ga0157380_10892964 | 3300014326 | Bacteria | 914 |
| 276 | Ga0157377_10007410 | 3300014745 | Bacteria | 5297 |
| 277 | Ga0157377_10042506 | 3300014745 | Bacteria | 2524 |
| 278 | Ga0157377_10067162 | 3300014745 | Unclassified | 2064 |
| 279 | Ga0157379_10090083 | 3300014968 | Bacteria | 2752 |
| 280 | Ga0157376_10271269 | 3300014969 | Bacteria | 1594 |
| 281 | Ga0157376_10687097 | 3300014969 | Unclassified | 1027 |
| 282 | Ga0163161_10069647 | 3300017792 | Bacteria | 2571 |
| 283 | Ga0163161_10154831 | 3300017792 | Bacteria | 1744 |
| 284 | Ga0197907_10787494 | 3300020069 | Bacteria | 1944 |
| 285 | Ga0206356_10690906 | 3300020070 | Bacteria | 997 |
| 286 | Ga0206354_10493040 | 3300020081 | Bacteria | 1723 |
| 287 | Ga0206354_11181411 | 3300020081 | Bacteria | 2405 |
| 288 | Ga0206353_10682305 | 3300020082 | Bacteria | 3065 |
| 289 | Ga0206353_11563311 | 3300020082 | Unclassified | 2475 |
| 290 | Ga0213876_10173606 | 3300021384 | Bacteria | 1147 |
| 291 | Ga0207653_10045403 | 3300025885 | Bacteria | 1451 |
| 292 | Ga0207682_10131711 | 3300025893 | Unclassified | 1117 |
| 293 | Ga0207692_10006352 | 3300025898 | Bacteria | 4791 |
| 294 | Ga0207692_10074306 | 3300025898 | Bacteria | 1801 |
| 295 | Ga0207642_10006027 | 3300025899 | Bacteria | 4004 |
| 296 | Ga0207642_10006211 | 3300025899 | Bacteria | 3958 |
| 297 | Ga0207642_10079263 | 3300025899 | Bacteria | 1590 |
| 298 | Ga0207642_10114279 | 3300025899 | Bacteria | 1380 |
| 299 | Ga0207688_10013509 | 3300025901 | Bacteria | 4437 |
| 300 | Ga0207688_10040384 | 3300025901 | Bacteria | 2593 |
| 301 | Ga0207688_10330089 | 3300025901 | Bacteria | 937 |
| 302 | Ga0207685_10183672 | 3300025905 | Bacteria | 971 |
| 303 | Ga0207645_10129437 | 3300025907 | Bacteria | 1642 |
| 304 | Ga0207643_10006336 | 3300025908 | Bacteria | 6338 |
| 305 | Ga0207705_10187184 | 3300025909 | Bacteria | 1564 |
| 306 | Ga0207684_10081383 | 3300025910 | Bacteria | 2756 |
| 307 | Ga0207654_10034181 | 3300025911 | Bacteria | 2823 |
| 308 | Ga0207654_10340525 | 3300025911 | Bacteria | 1030 |
| 309 | Ga0207654_10389089 | 3300025911 | Bacteria | 967 |
| 310 | Ga0207707_10015519 | 3300025912 | Bacteria | 6635 |
| 311 | Ga0207707_10020859 | 3300025912 | Bacteria | 5723 |
| 312 | Ga0207693_10002227 | 3300025915 | Bacteria | 16886 |
| 313 | Ga0207693_10107738 | 3300025915 | Bacteria | 2186 |
| 314 | Ga0207693_10134809 | 3300025915 | Bacteria | 1941 |
| 315 | Ga0207693_10185444 | 3300025915 | Bacteria | 1638 |
| 316 | Ga0207663_10102392 | 3300025916 | Bacteria | 1926 |
| 317 | Ga0207660_10014082 | 3300025917 | Bacteria | 5251 |
| 318 | Ga0207660_10174227 | 3300025917 | Bacteria | 1667 |
| 319 | Ga0207660_10533787 | 3300025917 | Bacteria | 953 |
| 320 | Ga0207662_10030533 | 3300025918 | Bacteria | 3128 |
| 321 | Ga0207662_10103164 | 3300025918 | Bacteria | 1769 |
| 322 | Ga0207657_10039192 | 3300025919 | Bacteria | 4212 |
| 323 | Ga0207657_10579652 | 3300025919 | Bacteria | 876 |
| 324 | Ga0207657_10650851 | 3300025919 | Bacteria | 820 |
| 325 | Ga0207649_10041202 | 3300025920 | Bacteria | 2811 |
| 326 | Ga0207652_10012862 | 3300025921 | Bacteria | 6767 |
| 327 | Ga0207652_10078373 | 3300025921 | Bacteria | 2885 |
| 328 | Ga0207652_10202229 | 3300025921 | Bacteria | 1788 |
| 329 | Ga0207652_10300395 | 3300025921 | Bacteria | 1449 |
| 330 | Ga0207652_10409002 | 3300025921 | Bacteria | 1224 |
| 331 | Ga0207681_10386858 | 3300025923 | Bacteria | 1127 |
| 332 | Ga0207694_10237139 | 3300025924 | Bacteria | 1490 |
| 333 | Ga0207694_10341585 | 3300025924 | Bacteria | 1238 |
| 334 | Ga0207694_10345114 | 3300025924 | Bacteria | 1232 |
| 335 | Ga0207650_10016944 | 3300025925 | Bacteria | 5096 |
| 336 | Ga0207659_10104562 | 3300025926 | Bacteria | 2141 |
| 337 | Ga0207659_10405487 | 3300025926 | Bacteria | 1141 |
| 338 | Ga0207687_10022683 | 3300025927 | Bacteria | 4180 |
| 339 | Ga0207687_10027614 | 3300025927 | Bacteria | 3810 |
| 340 | Ga0207687_10029173 | 3300025927 | Bacteria | 3709 |
| 341 | Ga0207687_10070197 | 3300025927 | Bacteria | 2500 |
| 342 | Ga0207687_10109983 | 3300025927 | Bacteria | 2043 |
| 343 | Ga0207687_10363695 | 3300025927 | Bacteria | 1181 |
| 344 | Ga0207700_10000028 | 3300025928 | Bacteria | 135555 |
| 345 | Ga0207700_10221860 | 3300025928 | Unclassified | 1603 |
| 346 | Ga0207664_10176568 | 3300025929 | Bacteria | 1832 |
| 347 | Ga0207664_10396316 | 3300025929 | Unclassified | 1227 |
| 348 | Ga0207664_10784449 | 3300025929 | Unclassified | 857 |
| 349 | Ga0207644_10056530 | 3300025931 | Bacteria | 2832 |
| 350 | Ga0207644_10064384 | 3300025931 | Bacteria | 2664 |
| 351 | Ga0207690_10086333 | 3300025932 | Bacteria | 2205 |
| 352 | Ga0207706_10051097 | 3300025933 | Bacteria | 3651 |
| 353 | Ga0207706_10074971 | 3300025933 | Bacteria | 2975 |
| 354 | Ga0207706_10239430 | 3300025933 | Unclassified | 1586 |
| 355 | Ga0207706_10407067 | 3300025933 | Bacteria | 1179 |
| 356 | Ga0207706_10711986 | 3300025933 | Bacteria | 857 |
| 357 | Ga0207686_10180867 | 3300025934 | Bacteria | 1495 |
| 358 | Ga0207709_10037539 | 3300025935 | Bacteria | 2880 |
| 359 | Ga0207709_10109083 | 3300025935 | Bacteria | 1847 |
| 360 | Ga0207709_10156559 | 3300025935 | Bacteria | 1584 |
| 361 | Ga0207670_10059903 | 3300025936 | Bacteria | 2591 |
| 362 | Ga0207669_10014396 | 3300025937 | Bacteria | 3963 |
| 363 | Ga0207704_10032807 | 3300025938 | Bacteria | 2944 |
| 364 | Ga0207665_10016464 | 3300025939 | Bacteria | 4854 |
| 365 | Ga0207665_10070940 | 3300025939 | Bacteria | 2378 |
| 366 | Ga0207691_10008423 | 3300025940 | Bacteria | 9905 |
| 367 | Ga0207711_10236339 | 3300025941 | Bacteria | 1675 |
| 368 | Ga0207689_10026029 | 3300025942 | Bacteria | 4898 |
| 369 | Ga0207689_10377512 | 3300025942 | Bacteria | 1180 |
| 370 | Ga0207689_10529991 | 3300025942 | Bacteria | 988 |
| 371 | Ga0207689_10611576 | 3300025942 | Bacteria | 917 |
| 372 | Ga0207661_10006079 | 3300025944 | Bacteria | 8523 |
| 373 | Ga0207661_10036005 | 3300025944 | Bacteria | 3861 |
| 374 | Ga0207661_10063063 | 3300025944 | Bacteria | 3001 |
| 375 | Ga0207661_10139743 | 3300025944 | Bacteria | 2083 |
| 376 | Ga0207661_10151254 | 3300025944 | Bacteria | 2006 |
| 377 | Ga0207661_10273858 | 3300025944 | Bacteria | 1507 |
| 378 | Ga0207661_10807737 | 3300025944 | Unclassified | 863 |
| 379 | Ga0207679_10034083 | 3300025945 | Bacteria | 3589 |
| 380 | Ga0207679_10221029 | 3300025945 | Bacteria | 1594 |
| 381 | Ga0207679_10364172 | 3300025945 | Bacteria | 1263 |
| 382 | Ga0207667_10165119 | 3300025949 | Bacteria | 2276 |
| 383 | Ga0207667_10251091 | 3300025949 | Bacteria | 1809 |
| 384 | Ga0207667_10394999 | 3300025949 | Unclassified | 1408 |
| 385 | Ga0207667_10519289 | 3300025949 | Bacteria | 1206 |
| 386 | Ga0207667_10880642 | 3300025949 | Bacteria | 888 |
| 387 | Ga0207651_10688704 | 3300025960 | Bacteria | 900 |
| 388 | Ga0207712_10104656 | 3300025961 | Bacteria | 2111 |
| 389 | Ga0207712_10616945 | 3300025961 | Unclassified | 940 |
| 390 | Ga0207668_10323397 | 3300025972 | Bacteria | 1281 |
| 391 | Ga0207668_10344644 | 3300025972 | Bacteria | 1244 |
| 392 | Ga0207640_10011193 | 3300025981 | Bacteria | 5073 |
| 393 | Ga0207640_10100021 | 3300025981 | Bacteria | 2031 |
| 394 | Ga0207677_10029329 | 3300026023 | Bacteria | 3495 |
| 395 | Ga0207677_10104612 | 3300026023 | Bacteria | 2093 |
| 396 | Ga0207677_10122539 | 3300026023 | Bacteria | 1959 |
| 397 | Ga0207677_10195183 | 3300026023 | Unclassified | 1604 |
| 398 | Ga0207677_10616520 | 3300026023 | Bacteria | 954 |
| 399 | Ga0207678_10075875 | 3300026067 | Bacteria | 2879 |
| 400 | Ga0207678_10079945 | 3300026067 | Bacteria | 2799 |
| 401 | Ga0207678_10084591 | 3300026067 | Bacteria | 2712 |
| 402 | Ga0207678_10147832 | 3300026067 | Bacteria | 2006 |
| 403 | Ga0207678_10360243 | 3300026067 | Bacteria | 1255 |
| 404 | Ga0207708_10016076 | 3300026075 | Bacteria | 5620 |
| 405 | Ga0207708_10022412 | 3300026075 | Bacteria | 4770 |
| 406 | Ga0207708_10033742 | 3300026075 | Bacteria | 3890 |
| 407 | Ga0207708_10084149 | 3300026075 | Bacteria | 2446 |
| 408 | Ga0207708_10188994 | 3300026075 | Bacteria | 1639 |
| 409 | Ga0207702_10080039 | 3300026078 | Bacteria | 2834 |
| 410 | Ga0207702_10119051 | 3300026078 | Bacteria | 2360 |
| 411 | Ga0207702_10201809 | 3300026078 | Bacteria | 1844 |
| 412 | Ga0207702_10238868 | 3300026078 | Bacteria | 1701 |
| 413 | Ga0207641_10304650 | 3300026088 | Bacteria | 1506 |
| 414 | Ga0207641_10660975 | 3300026088 | Bacteria | 1027 |
| 415 | Ga0207648_10001618 | 3300026089 | Bacteria | 24692 |
| 416 | Ga0207648_10027846 | 3300026089 | Bacteria | 5014 |
| 417 | Ga0207648_10184700 | 3300026089 | Bacteria | 1846 |
| 418 | Ga0207648_10328856 | 3300026089 | Bacteria | 1374 |
| 419 | Ga0207648_10437068 | 3300026089 | Unclassified | 1190 |
| 420 | Ga0207648_10671302 | 3300026089 | Bacteria | 959 |
| 421 | Ga0207674_10011223 | 3300026116 | Bacteria | 10068 |
| 422 | Ga0207674_10256794 | 3300026116 | Bacteria | 1695 |
| 423 | Ga0207675_100019600 | 3300026118 | Bacteria | 6313 |
| 424 | Ga0207675_100020260 | 3300026118 | Bacteria | 6201 |
| 425 | Ga0207675_100088815 | 3300026118 | Bacteria | 2903 |
| 426 | Ga0207675_100291051 | 3300026118 | Bacteria | 1589 |
| 427 | Ga0207675_100562717 | 3300026118 | Bacteria | 1140 |
| 428 | Ga0207683_10005786 | 3300026121 | Bacteria | 10599 |
| 429 | Ga0207683_10023914 | 3300026121 | Bacteria | 5257 |
| 430 | Ga0207683_10024330 | 3300026121 | Bacteria | 5214 |
| 431 | Ga0207683_10028840 | 3300026121 | Bacteria | 4802 |
| 432 | Ga0207683_10028930 | 3300026121 | Bacteria | 4795 |
| 433 | Ga0207683_10036902 | 3300026121 | Bacteria | 4256 |
| 434 | Ga0207428_10002578 | 3300027907 | Bacteria | 18097 |
| 435 | Ga0207428_10133040 | 3300027907 | Bacteria | 1902 |
| 436 | Ga0207428_10298528 | 3300027907 | Bacteria | 1192 |
| 437 | Ga0268266_10212816 | 3300028379 | Bacteria | 1773 |
| 438 | Ga0268266_11114546 | 3300028379 | Unclassified | 763 |
| 439 | Ga0268265_10242349 | 3300028380 | Bacteria | 1592 |
| 440 | Ga0265318_10037183 | 3300028577 | Bacteria | 1865 |
| 441 | Ga0265338_10129398 | 3300028800 | Bacteria | 1997 |
| 442 | Ga0307408_100476957 | 3300031548 | Bacteria | 1087 |
| 443 | Ga0307408_100513371 | 3300031548 | Unclassified | 1051 |
| 444 | Ga0307405_10000763 | 3300031731 | Bacteria | 12575 |
| 445 | Ga0307405_10359396 | 3300031731 | Unclassified | 1126 |
| 446 | Ga0307413_10726688 | 3300031824 | Bacteria | 827 |
| 447 | Ga0307410_10030123 | 3300031852 | Bacteria | 3464 |
| 448 | Ga0307406_10002380 | 3300031901 | Bacteria | 10220 |
| 449 | Ga0307406_10084650 | 3300031901 | Bacteria | 2118 |
| 450 | Ga0307406_10240866 | 3300031901 | Bacteria | 1357 |
| 451 | Ga0307407_10002086 | 3300031903 | Bacteria | 7660 |
| 452 | Ga0307412_10176038 | 3300031911 | Bacteria | 1604 |
| 453 | Ga0307409_100452512 | 3300031995 | Bacteria | 1239 |
| 454 | Ga0307409_100901063 | 3300031995 | Unclassified | 898 |
| 455 | Ga0307416_100061199 | 3300032002 | Bacteria | 3071 |
| 456 | Ga0307416_100234962 | 3300032002 | Bacteria | 1771 |
| 457 | Ga0307416_100522864 | 3300032002 | Bacteria | 1255 |
| 458 | Ga0307414_10011153 | 3300032004 | Bacteria | 5258 |
| 459 | Ga0307415_100011986 | 3300032126 | Bacteria | 4992 |
| 460 | Ga0373928_0040147 | 3300035084 | Bacteria | 1072 |
| 461 | Ga0373944_0011271 | 3300035089 | Bacteria | 2446 |
| 462 | Ga0373951_0045506 | 3300035091 | Unclassified | 1068 |
| 463 | Ga0373943_0008346 | 3300035170 | Bacteria | 4649 |
| 464 | Ga0373943_0155318 | 3300035170 | Bacteria | 1242 |
| 465 | Ga0373946_0097326 | 3300035171 | Bacteria | 1313 |
| 466 | Ga0373931_0075531 | 3300035691 | Bacteria | 1848 |
| 467 | Ga0373927_0063413 | 3300035695 | Bacteria | 2390 |
| 468 | Ga0373947_0001800 | 3300035725 | Bacteria | 13104 |
| 469 | Ga0373925_0235356 | 3300037068 | Bacteria | 1465 |
| 470 | Ga0395899_0010469 | 3300037312 | Bacteria | 7102 |
| 471 | Ga0395899_0056130 | 3300037312 | Bacteria | 2911 |
| 472 | Ga0395899_0089903 | 3300037312 | Bacteria | 2227 |
| 473 | Ga0395899_0183006 | 3300037312 | Bacteria | 1470 |
| 474 | Ga0395900_0005641 | 3300037418 | Bacteria | 13092 |
| 475 | Ga0395900_0034902 | 3300037418 | Bacteria | 5181 |
| 476 | Ga0395900_0103933 | 3300037418 | Bacteria | 2918 |
| 477 | Ga0395900_0109143 | 3300037418 | Bacteria | 2843 |
| 478 | Ga0395900_0116757 | 3300037418 | Bacteria | 2738 |
| 479 | Ga0395900_0321796 | 3300037418 | Bacteria | 1527 |
| 480 | Ga0395900_0583692 | 3300037418 | Bacteria | 1059 |
| 481 | Ga0395898_0012333 | 3300037466 | Bacteria | 8839 |
| 482 | Ga0395898_0018348 | 3300037466 | Bacteria | 7134 |
| 483 | Ga0395898_0042686 | 3300037466 | Bacteria | 4473 |
| 484 | Ga0395898_0185978 | 3300037466 | Bacteria | 1985 |
| 485 | Ga0395898_0196252 | 3300037466 | Bacteria | 1928 |
| 486 | Ga0395898_0325954 | 3300037466 | Bacteria | 1465 |
| 487 | Ga0395898_0784231 | 3300037466 | Unclassified | 894 |
| 488 | Ga0395905_0002820 | 3300037471 | Bacteria | 19050 |
| 489 | Ga0395905_0018242 | 3300037471 | Bacteria | 6661 |
| 490 | Ga0395905_0065878 | 3300037471 | Bacteria | 3392 |
| 491 | Ga0395905_0440253 | 3300037471 | Unclassified | 1201 |
| 492 | Ga0395901_0021008 | 3300038443 | Bacteria | 6687 |
| 493 | Ga0395901_0083306 | 3300038443 | Bacteria | 3343 |
| 494 | Ga0395901_0136099 | 3300038443 | Bacteria | 2582 |
| 495 | Ga0395901_0165855 | 3300038443 | Bacteria | 2319 |
| 496 | Ga0395901_0341237 | 3300038443 | Bacteria | 1547 |
| 497 | Ga0395901_0360676 | 3300038443 | Bacteria | 1499 |
| 498 | Ga0436365_1717107 | 3300039437 | Bacteria | 2487 |
| 499 | Ga0436363_1306718 | 3300039450 | Bacteria | 946 |
| 500 | Ga0439451_049687 | 3300042009 | Unclassified | 840 |
| 501 | Ga0466966_0147010 | 3300044684 | Bacteria | 1438 |
| 502 | Ga0466963_0011804 | 3300044694 | Bacteria | 5329 |
| 503 | Ga0466963_0064000 | 3300044694 | Bacteria | 2463 |
| 504 | Ga0466964_0038383 | 3300044706 | Unclassified | 1925 |
| 505 | Ga0466971_0012859 | 3300044719 | Bacteria | 3670 |
| 506 | Ga0466968_0132144 | 3300044735 | Bacteria | 1137 |
| 507 | Ga0466957_0209412 | 3300044842 | Bacteria | 1283 |
| 508 | Ga0466960_0027536 | 3300044901 | Bacteria | 2593 |
| 509 | Ga0466960_0051920 | 3300044901 | Bacteria | 1982 |
| 510 | Ga0466960_0413369 | 3300044901 | Bacteria | 779 |
| 511 | Ga0451576_0039365 | 3300045051 | Bacteria | 5004 |
| 512 | Ga0451576_0070400 | 3300045051 | Bacteria | 3641 |
| 513 | Ga0451576_0288864 | 3300045051 | Bacteria | 1714 |
| 514 | Ga0466958_0047901 | 3300045836 | Bacteria | 2581 |
| 515 | Ga0466958_0051946 | 3300045836 | Bacteria | 2483 |
| 516 | Ga0466967_0015805 | 3300045976 | Bacteria | 5930 |
| 517 | Ga0466967_0026415 | 3300045976 | Bacteria | 4809 |
| 518 | Ga0466967_0074387 | 3300045976 | Bacteria | 3051 |
| 519 | Ga0495603_0040882 | 3300046455 | Bacteria | 2774 |
| 520 | Ga0495603_0262672 | 3300046455 | Bacteria | 993 |
| 521 | Ga0495629_0004153 | 3300046459 | Bacteria | 10868 |
| 522 | Ga0495629_0611126 | 3300046459 | Unclassified | 728 |
| 523 | Ga0495641_0000850 | 3300046461 | Bacteria | 26094 |
| 524 | Ga0495651_0021532 | 3300046462 | Bacteria | 5011 |
| 525 | Ga0495651_0233273 | 3300046462 | Bacteria | 1266 |
| 526 | Ga0495651_0283601 | 3300046462 | Bacteria | 1118 |
| 527 | Ga0495653_0096292 | 3300046463 | Bacteria | 2152 |
| 528 | Ga0495580_0179818 | 3300046472 | Bacteria | 1461 |
| 529 | Ga0495582_0000054 | 3300046473 | Bacteria | 57496 |
| 530 | Ga0495605_0229636 | 3300046474 | Bacteria | 800 |
| 531 | Ga0495639_0000608 | 3300046475 | Bacteria | 16665 |
| 532 | Ga0495639_0026258 | 3300046475 | Bacteria | 2573 |
| 533 | Ga0495662_0007155 | 3300046476 | Bacteria | 5529 |
| 534 | Ga0495584_0078101 | 3300046491 | Bacteria | 1665 |
| 535 | Ga0495594_0060192 | 3300046499 | Bacteria | 2100 |
| 536 | Ga0495607_0046643 | 3300046501 | Bacteria | 2543 |
| 537 | Ga0495608_0058926 | 3300046511 | Bacteria | 2530 |
| 538 | Ga0495608_0223848 | 3300046511 | Bacteria | 1179 |
| 539 | Ga0495618_0257340 | 3300046514 | Bacteria | 1094 |
| 540 | Ga0495630_0006532 | 3300046517 | Bacteria | 8304 |
| 541 | Ga0495630_0099611 | 3300046517 | Bacteria | 2199 |
| 542 | Ga0495630_0901591 | 3300046517 | Unclassified | 673 |
| 543 | Ga0495631_0045678 | 3300046518 | Bacteria | 1928 |
| 544 | Ga0495663_0081187 | 3300046525 | Bacteria | 1044 |
| 545 | Ga0495666_0083864 | 3300046526 | Bacteria | 1506 |
| 546 | Ga0495642_0035217 | 3300046528 | Bacteria | 2019 |
| 547 | Ga0495652_0516051 | 3300046529 | Unclassified | 826 |
| 548 | Ga0495640_0151385 | 3300046533 | Bacteria | 1490 |
| 549 | Ga0495586_0077937 | 3300046535 | Bacteria | 1818 |
| 550 | Ga0495587_0084487 | 3300046536 | Bacteria | 1838 |
| 551 | Ga0495587_0186313 | 3300046536 | Bacteria | 1176 |
| 552 | Ga0495609_0184828 | 3300046538 | Unclassified | 876 |
| 553 | Ga0495667_0037023 | 3300046559 | Bacteria | 3253 |
| 554 | Ga0495667_0063607 | 3300046559 | Bacteria | 2415 |
| 555 | Ga0495656_0355838 | 3300046615 | Bacteria | 759 |
| 556 | Ga0495668_0355221 | 3300046616 | Bacteria | 804 |
| 557 | Ga0495635_0015770 | 3300046663 | Bacteria | 5278 |
| 558 | Ga0495635_0358885 | 3300046663 | Bacteria | 971 |
| 559 | Ga0495659_0057466 | 3300046664 | Bacteria | 1429 |
| 560 | Ga0495659_0077257 | 3300046664 | Unclassified | 1257 |
| 561 | Ga0495657_0070907 | 3300046675 | Bacteria | 2277 |
| 562 | Ga0495646_0089793 | 3300046680 | Bacteria | 1777 |
| 563 | Ga0495647_0012862 | 3300046681 | Bacteria | 2888 |
| 564 | Ga0495658_0001151 | 3300046683 | Bacteria | 13968 |
| 565 | Ga0495658_0519893 | 3300046683 | Bacteria | 762 |
| 566 | Ga0495613_0015631 | 3300046689 | Bacteria | 5648 |
| 567 | Ga0495613_0139580 | 3300046689 | Bacteria | 1732 |
| 568 | Ga0495624_0019148 | 3300046690 | Bacteria | 4572 |
| 569 | Ga0495600_0017106 | 3300046809 | Bacteria | 4610 |
| 570 | Ga0495600_0197960 | 3300046809 | Bacteria | 1291 |
| 571 | Ga0495581_0001507 | 3300047315 | Bacteria | 12964 |
| 572 | Ga0495604_0277326 | 3300047317 | Bacteria | 1134 |
| 573 | Ga0495674_0066250 | 3300047319 | Bacteria | 3134 |
| 574 | Ga0495674_0122635 | 3300047319 | Bacteria | 2194 |
| 575 | Ga0495676_0001978 | 3300047321 | Bacteria | 18008 |
| 576 | Ga0495676_0012780 | 3300047321 | Bacteria | 7550 |
| 577 | Ga0495680_0007171 | 3300047322 | Bacteria | 10267 |
| 578 | Ga0495675_0219417 | 3300047444 | Bacteria | 1152 |
| 579 | Ga0495677_0031065 | 3300047445 | Bacteria | 1944 |
| 580 | Ga0495677_0209213 | 3300047445 | Bacteria | 759 |
| 581 | Ga0495684_0355666 | 3300047471 | Unclassified | 1038 |
| 582 | Ga0495593_0010033 | 3300047673 | Bacteria | 5488 |
| 583 | Ga0495614_0005102 | 3300048089 | Bacteria | 5926 |
| 584 | Ga0496100_0006635 | 3300048903 | Bacteria | 6326 |
| 585 | Ga0496100_0052242 | 3300048903 | Bacteria | 2656 |
| 586 | Ga0496100_0079903 | 3300048903 | Bacteria | 2205 |
| 587 | Ga0496100_0143567 | 3300048903 | Bacteria | 1695 |
| 588 | Ga0496100_0181469 | 3300048903 | Bacteria | 1522 |
| 589 | Ga0496100_0848239 | 3300048903 | Unclassified | 716 |
| 590 | Ga0496100_1264702 | 3300048903 | Unclassified | 582 |
| 591 | Ga0496101_0002853 | 3300048904 | Bacteria | 10621 |
| 592 | Ga0496101_0007728 | 3300048904 | Bacteria | 6987 |
| 593 | Ga0496101_0014724 | 3300048904 | Bacteria | 5262 |
| 594 | Ga0496101_0023646 | 3300048904 | Bacteria | 4247 |
| 595 | Ga0496101_0038763 | 3300048904 | Bacteria | 3385 |
| 596 | Ga0496101_0068102 | 3300048904 | Bacteria | 2601 |
| 597 | Ga0496101_0161190 | 3300048904 | Bacteria | 1720 |
| 598 | Ga0496101_0209372 | 3300048904 | Bacteria | 1510 |
| 599 | Ga0496102_0090721 | 3300048905 | Bacteria | 2828 |
| 600 | Ga0496102_0206556 | 3300048905 | Bacteria | 1852 |
| 601 | Ga0496102_0509105 | 3300048905 | Bacteria | 1126 |
| 602 | Ga0496102_0581264 | 3300048905 | Bacteria | 1043 |
| 603 | Ga0496103_0002848 | 3300048906 | Bacteria | 10756 |
| 604 | Ga0496103_0192402 | 3300048906 | Bacteria | 1312 |
| 605 | Ga0496104_0000261 | 3300048907 | Bacteria | 46523 |
| 606 | Ga0496104_0005537 | 3300048907 | Bacteria | 11063 |
| 607 | Ga0496104_0019952 | 3300048907 | Bacteria | 6138 |
| 608 | Ga0496104_0021669 | 3300048907 | Bacteria | 5902 |
| 609 | Ga0496104_0062208 | 3300048907 | Bacteria | 3539 |
| 610 | Ga0496104_0112553 | 3300048907 | Bacteria | 2610 |
| 611 | Ga0496104_0149135 | 3300048907 | Bacteria | 2246 |
| 612 | Ga0496104_0631403 | 3300048907 | Bacteria | 980 |
| 613 | Ga0496105_0000341 | 3300048908 | Bacteria | 30641 |
| 614 | Ga0496105_0000489 | 3300048908 | Bacteria | 26072 |
| 615 | Ga0496105_0106462 | 3300048908 | Bacteria | 2315 |
| 616 | Ga0496105_0229308 | 3300048908 | Bacteria | 1509 |
| 617 | Ga0496105_0432799 | 3300048908 | Bacteria | 1040 |
| 618 | Ga0496106_0009087 | 3300048909 | Bacteria | 7343 |
| 619 | Ga0496106_0056290 | 3300048909 | Bacteria | 2972 |
| 620 | Ga0496106_0099407 | 3300048909 | Unclassified | 2255 |
| 621 | Ga0496106_0113899 | 3300048909 | Bacteria | 2108 |
| 622 | Ga0496106_0297114 | 3300048909 | Bacteria | 1295 |
| 623 | Ga0496106_0778695 | 3300048909 | Unclassified | 759 |
| 624 | Ga0496107_0002143 | 3300048910 | Bacteria | 12664 |
| 625 | Ga0496107_0003268 | 3300048910 | Bacteria | 10805 |
| 626 | Ga0496107_0029143 | 3300048910 | Bacteria | 3925 |
| 627 | Ga0496107_0032884 | 3300048910 | Bacteria | 3708 |
| 628 | Ga0496107_0052381 | 3300048910 | Bacteria | 2944 |
| 629 | Ga0496107_0091743 | 3300048910 | Bacteria | 2220 |
| 630 | Ga0496107_0128782 | 3300048910 | Bacteria | 1868 |
| 631 | Ga0496107_0147328 | 3300048910 | Bacteria | 1741 |
| 632 | Ga0496107_0227916 | 3300048910 | Bacteria | 1386 |
| 633 | Ga0496108_0007200 | 3300048911 | Bacteria | 9019 |
| 634 | Ga0496108_0023336 | 3300048911 | Bacteria | 5089 |
| 635 | Ga0496108_0070061 | 3300048911 | Bacteria | 2959 |
| 636 | Ga0496108_0084511 | 3300048911 | Bacteria | 2693 |
| 637 | Ga0496108_0115761 | 3300048911 | Bacteria | 2296 |
| 638 | Ga0496108_0115931 | 3300048911 | Bacteria | 2294 |
| 639 | Ga0496108_0152234 | 3300048911 | Bacteria | 1996 |
| 640 | Ga0496108_0218221 | 3300048911 | Unclassified | 1657 |
| 641 | Ga0496109_0000301 | 3300048912 | Bacteria | 46624 |
| 642 | Ga0496109_0007517 | 3300048912 | Bacteria | 9230 |
| 643 | Ga0496109_0015256 | 3300048912 | Bacteria | 6689 |
| 644 | Ga0496109_0018133 | 3300048912 | Bacteria | 6181 |
| 645 | Ga0496109_0028696 | 3300048912 | Bacteria | 4980 |
| 646 | Ga0496109_0058691 | 3300048912 | Bacteria | 3515 |
| 647 | Ga0496109_0077625 | 3300048912 | Bacteria | 3056 |
| 648 | Ga0496109_0111816 | 3300048912 | Bacteria | 2540 |
| 649 | Ga0496109_0188717 | 3300048912 | Bacteria | 1936 |
| 650 | Ga0496109_0564728 | 3300048912 | Bacteria | 1073 |
| 651 | Ga0496109_0643051 | 3300048912 | Bacteria | 997 |
| 652 | Ga0496109_0643562 | 3300048912 | Bacteria | 997 |
| 653 | Ga0496110_0000221 | 3300048913 | Bacteria | 36767 |
| 654 | Ga0496110_0008818 | 3300048913 | Bacteria | 8123 |
| 655 | Ga0496110_0011717 | 3300048913 | Bacteria | 7194 |
| 656 | Ga0496110_0011876 | 3300048913 | Bacteria | 7153 |
| 657 | Ga0496110_0028246 | 3300048913 | Bacteria | 4816 |
| 658 | Ga0496110_0046383 | 3300048913 | Bacteria | 3802 |
| 659 | Ga0496110_0059256 | 3300048913 | Bacteria | 3374 |
| 660 | Ga0496110_0080714 | 3300048913 | Bacteria | 2899 |
| 661 | Ga0496110_0139428 | 3300048913 | Bacteria | 2192 |
| 662 | Ga0496110_0467391 | 3300048913 | Bacteria | 1149 |
| 663 | Ga0496111_0000132 | 3300048914 | Bacteria | 33010 |
| 664 | Ga0496111_0001079 | 3300048914 | Bacteria | 15053 |
| 665 | Ga0496111_0001218 | 3300048914 | Bacteria | 14367 |
| 666 | Ga0496111_0029353 | 3300048914 | Bacteria | 3906 |
| 667 | Ga0496111_0042088 | 3300048914 | Bacteria | 3279 |
| 668 | Ga0496111_0178400 | 3300048914 | Archaea | 1579 |
| 669 | Ga0496112_0003185 | 3300048915 | Bacteria | 13491 |
| 670 | Ga0496112_0055832 | 3300048915 | Bacteria | 3885 |
| 671 | Ga0496112_0865720 | 3300048915 | Archaea | 827 |
| 672 | Ga0496112_1273153 | 3300048915 | Bacteria | 651 |
| 673 | Ga0496113_0013269 | 3300048916 | Bacteria | 5576 |
| 674 | Ga0496113_0031188 | 3300048916 | Bacteria | 3866 |
| 675 | Ga0496113_0052525 | 3300048916 | Bacteria | 3044 |
| 676 | Ga0496113_0119987 | 3300048916 | Bacteria | 2055 |
| 677 | Ga0496113_0364064 | 3300048916 | Bacteria | 1160 |
| 678 | Ga0496113_0686111 | 3300048916 | Unclassified | 818 |
| 679 | Ga0496114_0000801 | 3300048917 | Bacteria | 23525 |
| 680 | Ga0496114_0001557 | 3300048917 | Bacteria | 17405 |
| 681 | Ga0496114_0004524 | 3300048917 | Bacteria | 10794 |
| 682 | Ga0496114_0019844 | 3300048917 | Bacteria | 5450 |
| 683 | Ga0496114_0220629 | 3300048917 | Bacteria | 1664 |
| 684 | Ga0496114_0435352 | 3300048917 | Bacteria | 1161 |
| 685 | Ga0496114_1078594 | 3300048917 | Bacteria | 688 |
| 686 | Ga0496115_0016111 | 3300048918 | Bacteria | 5684 |
| 687 | Ga0496115_0048676 | 3300048918 | Bacteria | 3391 |
| 688 | Ga0496115_0135703 | 3300048918 | Unclassified | 2029 |
| 689 | Ga0496115_0144913 | 3300048918 | Bacteria | 1960 |
| 690 | Ga0496115_0161679 | 3300048918 | Bacteria | 1850 |
| 691 | Ga0496115_0355954 | 3300048918 | Bacteria | 1193 |
| 692 | Ga0501291_003751 | 3300049514 | Bacteria | 1907 |
| 693 | Ga0501032_0086882 | 3300049569 | Bacteria | 2078 |
| 694 | Ga0501032_0537053 | 3300049569 | Bacteria | 746 |
| 695 | Ga0501036_0012707 | 3300049572 | Bacteria | 6986 |
| 696 | Ga0501036_0159180 | 3300049572 | Bacteria | 1904 |
| 697 | Ga0501036_0475263 | 3300049572 | Bacteria | 1041 |
| 698 | Ga0501036_0769762 | 3300049572 | Bacteria | 793 |
| 699 | Ga0501037_0014381 | 3300049573 | Bacteria | 5825 |
| 700 | Ga0501038_0015192 | 3300049574 | Bacteria | 7002 |
| 701 | Ga0501038_0721431 | 3300049574 | Bacteria | 745 |
| 702 | Ga0501039_0049672 | 3300049575 | Bacteria | 3243 |
| 703 | Ga0501039_0102879 | 3300049575 | Bacteria | 2229 |
| 704 | Ga0501040_0004638 | 3300049576 | Bacteria | 8918 |
| 705 | Ga0501040_0009087 | 3300049576 | Bacteria | 6468 |
| 706 | Ga0501040_0111173 | 3300049576 | Bacteria | 1916 |
| 707 | Ga0501040_0118586 | 3300049576 | Bacteria | 1856 |
| 708 | Ga0501040_0163336 | 3300049576 | Bacteria | 1575 |
| 709 | Ga0501040_0880088 | 3300049576 | Bacteria | 649 |
| 710 | Ga0501041_0072069 | 3300049577 | Bacteria | 2122 |
| 711 | Ga0501042_0067921 | 3300049578 | Bacteria | 2549 |
| 712 | Ga0501042_0117208 | 3300049578 | Bacteria | 1917 |
| 713 | Ga0501042_0133421 | 3300049578 | Bacteria | 1790 |
| 714 | Ga0501042_0177617 | 3300049578 | Bacteria | 1536 |
| 715 | Ga0501043_0010486 | 3300049579 | Bacteria | 7257 |
| 716 | Ga0501046_0000122 | 3300049580 | Bacteria | 82617 |
| 717 | Ga0501046_0483453 | 3300049580 | Bacteria | 888 |
| 718 | Ga0501047_0191857 | 3300049581 | Bacteria | 1906 |
| 719 | Ga0501048_0047065 | 3300049582 | Bacteria | 3078 |
| 720 | Ga0501048_0075289 | 3300049582 | Bacteria | 2381 |
| 721 | Ga0501067_0007826 | 3300049583 | Bacteria | 5942 |
| 722 | Ga0501067_0053221 | 3300049583 | Bacteria | 2243 |
| 723 | Ga0501067_0147343 | 3300049583 | Unclassified | 1311 |
| 724 | Ga0501068_0000426 | 3300049584 | Bacteria | 21367 |
| 725 | Ga0501068_0006032 | 3300049584 | Bacteria | 6658 |
| 726 | Ga0501069_0000061 | 3300049585 | Bacteria | 61031 |
| 727 | Ga0501069_0002211 | 3300049585 | Bacteria | 9804 |
| 728 | Ga0501069_0004456 | 3300049585 | Bacteria | 7232 |
| 729 | Ga0501069_0026501 | 3300049585 | Bacteria | 3174 |
| 730 | Ga0501069_0070306 | 3300049585 | Bacteria | 1960 |
| 731 | Ga0501069_0088767 | 3300049585 | Bacteria | 1748 |
| 732 | Ga0501069_0169956 | 3300049585 | Bacteria | 1257 |
| 733 | Ga0501070_0005391 | 3300049586 | Bacteria | 10906 |
| 734 | Ga0501070_0666336 | 3300049586 | Bacteria | 825 |
| 735 | Ga0501071_0054999 | 3300049587 | Bacteria | 2872 |
| 736 | Ga0501071_0067747 | 3300049587 | Bacteria | 2596 |
| 737 | Ga0501071_0127145 | 3300049587 | Archaea | 1892 |
| 738 | Ga0501071_0134567 | 3300049587 | Bacteria | 1838 |
| 739 | Ga0501071_0146708 | 3300049587 | Bacteria | 1759 |
| 740 | Ga0501072_0132704 | 3300049588 | Bacteria | 1985 |
| 741 | Ga0501072_0409306 | 3300049588 | Unclassified | 1076 |
| 742 | Ga0501072_0809853 | 3300049588 | Unclassified | 733 |
| 743 | Ga0501073_0008113 | 3300049589 | Bacteria | 7790 |
| 744 | Ga0501074_0052612 | 3300049590 | Bacteria | 2939 |
| 745 | Ga0501074_0132415 | 3300049590 | Bacteria | 1783 |
| 746 | Ga0501074_0174795 | 3300049590 | Bacteria | 1532 |
| 747 | Ga0501074_0434795 | 3300049590 | Bacteria | 931 |
| 748 | Ga0501075_0031794 | 3300049591 | Bacteria | 3920 |
| 749 | Ga0501075_0037435 | 3300049591 | Bacteria | 3625 |
| 750 | Ga0501075_0295884 | 3300049591 | Bacteria | 1233 |
| 751 | Ga0501075_0562232 | 3300049591 | Unclassified | 870 |
| 752 | Ga0501076_0031889 | 3300049592 | Bacteria | 4112 |
| 753 | Ga0501076_0060351 | 3300049592 | Bacteria | 3017 |
| 754 | Ga0501076_0095054 | 3300049592 | Bacteria | 2400 |
| 755 | Ga0501076_0177160 | 3300049592 | Bacteria | 1738 |
| 756 | Ga0501077_0018438 | 3300049593 | Bacteria | 4416 |
| 757 | Ga0501077_0040409 | 3300049593 | Bacteria | 2971 |
| 758 | Ga0501079_0024424 | 3300049741 | Bacteria | 4637 |
| 759 | Ga0501079_0043908 | 3300049741 | Bacteria | 3450 |
| 760 | Ga0501079_0359240 | 3300049741 | Archaea | 1141 |
| 761 | Ga0501079_0403011 | 3300049741 | Bacteria | 1073 |
| 762 | Ga0501079_0830379 | 3300049741 | Bacteria | 728 |
| 763 | Ga0501080_0033905 | 3300049742 | Bacteria | 4766 |
| 764 | Ga0501080_0047211 | 3300049742 | Bacteria | 4008 |
| 765 | Ga0501080_0208580 | 3300049742 | Bacteria | 1791 |
| 766 | Ga0501080_0383847 | 3300049742 | Bacteria | 1265 |
| 767 | Ga0501081_0016426 | 3300049743 | Bacteria | 4894 |
| 768 | Ga0501081_0037706 | 3300049743 | Bacteria | 3299 |
| 769 | Ga0501081_0162934 | 3300049743 | Bacteria | 1607 |
| 770 | Ga0501081_0733245 | 3300049743 | Bacteria | 742 |
| 771 | Ga0501083_0001412 | 3300049744 | Bacteria | 16364 |
| 772 | Ga0501083_0170660 | 3300049744 | Unclassified | 1422 |
| 773 | Ga0501035_0015492 | 3300049822 | Bacteria | 7033 |
| 774 | Ga0501035_0211555 | 3300049822 | Unclassified | 1659 |
| 775 | Ga0501044_0008263 | 3300049823 | Bacteria | 11414 |
| 776 | Ga0501045_0045496 | 3300049824 | Bacteria | 3195 |
| 777 | Ga0501045_0071314 | 3300049824 | Bacteria | 2557 |
| 778 | Ga0501045_0193709 | 3300049824 | Bacteria | 1515 |
| 779 | Ga0501045_0353619 | 3300049824 | Archaea | 1093 |
| 780 | nmdc:mga0yw44_109382_c1 | 3300050492 | Bacteria | 1769 |
| 781 | nmdc:mga05p37_174992_c1 | 3300050507 | Bacteria | 2615 |
| 782 | nmdc:mga05p37_202575_c1 | 3300050507 | Bacteria | 2402 |
| 783 | nmdc:mga05p37_28507_c1 | 3300050507 | Bacteria | 6808 |
| 784 | nmdc:mga05p37_77421_c1 | 3300050507 | Bacteria | 4094 |
| 785 | nmdc:mga09592_150544_c1 | 3300050508 | Bacteria | 2007 |
| 786 | nmdc:mga09592_337950_c1 | 3300050508 | Bacteria | 1304 |
| 787 | nmdc:mga09592_760081_c1 | 3300050508 | Unclassified | 822 |
| 788 | nmdc:mga0qj67_379788_c1 | 3300050509 | Bacteria | 1141 |
| 789 | nmdc:mga0qj67_52311_c1 | 3300050509 | Bacteria | 3232 |
| 790 | nmdc:mga0qj67_61560_c1 | 3300050509 | Bacteria | 2980 |
| 791 | nmdc:mga06r32_29294_c1 | 3300050510 | Bacteria | 5158 |
| 792 | nmdc:mga08y16_29379_c1 | 3300050511 | Bacteria | 5793 |
| 793 | nmdc:mga08y16_54582_c2 | 3300050511 | Bacteria | 3659 |
| 794 | nmdc:mga08y16_689951_c1 | 3300050511 | Bacteria | 1022 |
| 795 | nmdc:mga08y16_81094_c1 | 3300050511 | Bacteria | 3383 |
| 796 | nmdc:mga0n895_1117356_c1 | 3300050512 | Bacteria | 765 |
| 797 | nmdc:mga0n895_33689_c1 | 3300050512 | Bacteria | 4924 |
| 798 | nmdc:mga0n895_414195_c1 | 3300050512 | Bacteria | 1362 |
| 799 | nmdc:mga0n895_45639_c2 | 3300050512 | Unclassified | 2631 |
| 800 | nmdc:mga0n895_62016_c1 | 3300050512 | Bacteria | 3693 |
| 801 | nmdc:mga0rr50_211525_c1 | 3300050513 | Bacteria | 1598 |
| 802 | nmdc:mga0rr50_214993_c1 | 3300050513 | Bacteria | 1585 |
| 803 | nmdc:mga0rr50_223194_c1 | 3300050513 | Bacteria | 1557 |
| 804 | nmdc:mga0rr50_250903_c1 | 3300050513 | Bacteria | 1470 |
| 805 | nmdc:mga0rr50_321089_c1 | 3300050513 | Unclassified | 1298 |
| 806 | nmdc:mga08x19_20101_c1 | 3300050514 | Bacteria | 4110 |
| 807 | nmdc:mga08x19_38349_c1 | 3300050514 | Bacteria | 3044 |
| 808 | nmdc:mga0a205_178237_c1 | 3300050515 | Bacteria | 2020 |
| 809 | nmdc:mga0a205_189372_c1 | 3300050515 | Bacteria | 1950 |
| 810 | nmdc:mga0a205_293360_c1 | 3300050515 | Unclassified | 1500 |
| 811 | nmdc:mga0a205_649978_c1 | 3300050515 | Bacteria | 906 |
| 812 | Ga0495655_0082696 | 3300053083 | Bacteria | 921 |
| 813 | Ga0495619_0016537 | 3300053085 | Bacteria | 4670 |
| 814 | Ga0495619_0251256 | 3300053085 | Bacteria | 1225 |
| 815 | Ga0495619_0357840 | 3300053085 | Bacteria | 1009 |
| 816 | Ga0501084_0053093 | 3300054114 | Bacteria | 3390 |
| 817 | Ga0501084_0065694 | 3300054114 | Bacteria | 3036 |
| 818 | Ga0501084_0072431 | 3300054114 | Bacteria | 2886 |
| 819 | Ga0501084_0111464 | 3300054114 | Bacteria | 2299 |
| 820 | Ga0501084_0134960 | 3300054114 | Bacteria | 2078 |
| 821 | Ga0501084_0544832 | 3300054114 | Bacteria | 980 |
| 822 | Ga0501084_0618861 | 3300054114 | Bacteria | 915 |
| 823 | Ga0590074_002113 | 3300059423 | Bacteria | 3254 |
| 824 | Ga0590075_033943 | 3300059424 | Unclassified | 1297 |
| 825 | Ga0590077_062931 | 3300059426 | Unclassified | 842 |
| 826 | Ga0501082_0006325 | 3300060353 | Bacteria | 10272 |
| 827 | Ga0501082_0048383 | 3300060353 | Bacteria | 3665 |
| 828 | Ga0501082_0128487 | 3300060353 | Bacteria | 2198 |
| 829 | Ga0501082_0225639 | 3300060353 | Bacteria | 1630 |
| 830 | Ga0501082_0358988 | 3300060353 | Bacteria | 1271 |
| 831 | Ga0466962_0027603 | 3300061719 | Bacteria | 2724 |
| 832 | Ga0530510_0006274 | 3300061734 | Bacteria | 8272 |
| 833 | Ga0530510_0056942 | 3300061734 | Bacteria | 2825 |
| 834 | Ga0530510_0096219 | 3300061734 | Bacteria | 2164 |
| 835 | Ga0530510_0329386 | 3300061734 | Bacteria | 1145 |
| 836 | Ga0530510_0350031 | 3300061734 | Unclassified | 1110 |
| 837 | Ga0105239_10044659 | |||
| 838 | JGI24751J29686_10014635 | |||
| 839 | JGI25406J46586_10053215 | |||
| 840 | JGI25407J50210_10000770 | |||
| 841 | Ga0070658_10350605 | |||
| 842 | Ga0070658_10674471 | |||
| 843 | Ga0070676_10441138 | |||
| 844 | Ga0070683_100013511 | |||
| 845 | Ga0070683_100026943 | |||
| 846 | Ga0070683_100047293 | |||
| 847 | Ga0070683_100090017 | |||
| 848 | Ga0070683_100093890 | |||
| 849 | Ga0070683_100107591 | |||
| 850 | Ga0070683_100126091 | |||
| 851 | Ga0070683_100188032 | |||
| 852 | Ga0070683_100212043 | |||
| 853 | Ga0070690_100019595 | |||
| 854 | Ga0070690_100034526 | |||
| 855 | Ga0070670_100007727 | |||
| 856 | Ga0070670_100191050 | |||
| 857 | Ga0070670_100518669 | |||
| 858 | Ga0070677_10058660 | |||
| 859 | Ga0070677_10186806 | |||
| 860 | Ga0068869_100029542 | |||
| 861 | Ga0068869_100755134 | |||
| 862 | Ga0070680_100039196 | |||
| 863 | Ga0070680_100062948 | |||
| 864 | Ga0070680_100071052 | |||
| 865 | Ga0070680_100084186 | |||
| 866 | Ga0070680_100110932 | |||
| 867 | Ga0070682_100045949 | |||
| 868 | Ga0068868_100029440 | |||
| 869 | Ga0068868_100040408 | |||
| 870 | Ga0068868_100059846 | |||
| 871 | Ga0068868_100086877 | |||
| 872 | Ga0070660_100122232 | |||
| 873 | Ga0070660_100186203 | |||
| 874 | Ga0070660_100389158 | |||
| 875 | Ga0070660_100664619 | |||
| 876 | Ga0070689_100014951 | |||
| 877 | Ga0070689_100020156 | |||
| 878 | Ga0070691_10078402 | |||
| 879 | Ga0070687_100077154 | |||
| 880 | Ga0070661_100027680 | |||
| 881 | Ga0070668_100291126 | |||
| 882 | Ga0070668_100585297 | |||
| 883 | Ga0070669_100241960 | |||
| 884 | Ga0070671_100074414 | |||
| 885 | Ga0070671_100085697 | |||
| 886 | Ga0070671_100242059 | |||
| 887 | Ga0070674_100004980 | |||
| 888 | Ga0070674_100005962 | |||
| 889 | Ga0070674_100059685 | |||
| 890 | Ga0070673_100210876 | |||
| 891 | Ga0070673_100589466 | |||
| 892 | Ga0070688_100024520 | |||
| 893 | Ga0070659_100051870 | |||
| 894 | Ga0070709_10127352 | |||
| 895 | Ga0070714_100184212 | |||
| 896 | Ga0070714_100287713 | |||
| 897 | Ga0070713_100301499 | |||
| 898 | Ga0070710_10013945 | |||
| 899 | Ga0070710_10405742 | |||
| 900 | Ga0070701_10005292 | |||
| 901 | Ga0070701_10038856 | |||
| 902 | Ga0070711_100007272 | |||
| 903 | Ga0070705_100117116 | |||
| 904 | Ga0070705_100201468 | |||
| 905 | Ga0070700_100003305 | |||
| 906 | Ga0070700_100026488 | |||
| 907 | Ga0070700_100048276 | |||
| 908 | Ga0070694_100111249 | |||
| 909 | Ga0070708_100039060 | |||
| 910 | Ga0070663_100024955 | |||
| 911 | Ga0070663_100171550 | |||
| 912 | Ga0070663_100371220 | |||
| 913 | Ga0070678_100023954 | |||
| 914 | Ga0070678_100027885 | |||
| 915 | Ga0070662_100199148 | |||
| 916 | Ga0070662_100268052 | |||
| 917 | Ga0070662_100503178 | |||
| 918 | Ga0070681_10007560 | |||
| 919 | Ga0070681_10174916 | |||
| 920 | Ga0068867_100101821 | |||
| 921 | Ga0068867_100125999 | |||
| 922 | Ga0068867_100292808 | |||
| 923 | Ga0070685_10005360 | |||
| 924 | Ga0070707_100026060 | |||
| 925 | Ga0070698_100031331 | |||
| 926 | Ga0070699_100106492 | |||
| 927 | Ga0070699_100167127 | |||
| 928 | Ga0070679_100009976 | |||
| 929 | Ga0070679_100147751 | |||
| 930 | Ga0070679_100176844 | |||
| 931 | Ga0070684_100002263 | |||
| 932 | Ga0070684_100007411 | |||
| 933 | Ga0070684_100022623 | |||
| 934 | Ga0070684_100045412 | |||
| 935 | Ga0070684_100049522 | |||
| 936 | Ga0070684_100149299 | |||
| 937 | Ga0070684_100176819 | |||
| 938 | Ga0070684_100351701 | |||
| 939 | Ga0070697_100170300 | |||
| 940 | Ga0068853_100082054 | |||
| 941 | Ga0070672_100082022 | |||
| 942 | Ga0070672_100226380 | |||
| 943 | Ga0070686_100014705 | |||
| 944 | Ga0070686_100028968 | |||
| 945 | Ga0070686_100047377 | |||
| 946 | Ga0070686_100113152 | |||
| 947 | Ga0070686_100446279 | |||
| 948 | Ga0070695_100172524 | |||
| 949 | Ga0070695_100176033 | |||
| 950 | Ga0070696_100061405 | |||
| 951 | Ga0070696_100260016 | |||
| 952 | Ga0070693_100015854 | |||
| 953 | Ga0070693_100027344 | |||
| 954 | Ga0070693_100047295 | |||
| 955 | Ga0070693_100165864 | |||
| 956 | Ga0070665_100048803 | |||
| 957 | Ga0070665_100089131 | |||
| 958 | Ga0070704_100204659 | |||
| 959 | Ga0070704_100279763 | |||
| 960 | Ga0068855_100065227 | |||
| 961 | Ga0068855_100169056 | |||
| 962 | Ga0068855_100269473 | |||
| 963 | Ga0068855_100420102 | |||
| 964 | Ga0070664_100216694 | |||
| 965 | Ga0068857_100086654 | |||
| 966 | Ga0068857_100414155 | |||
| 967 | Ga0068854_100031564 | |||
| 968 | Ga0068854_100104565 | |||
| 969 | Ga0068854_100139840 | |||
| 970 | Ga0068856_100016763 | |||
| 971 | Ga0068856_100019584 | |||
| 972 | Ga0068856_100056424 | |||
| 973 | Ga0068856_100060833 | |||
| 974 | Ga0068856_100074879 | |||
| 975 | Ga0068856_100383067 | |||
| 976 | Ga0068852_100010955 | |||
| 977 | Ga0068852_100074113 | |||
| 978 | Ga0068852_100122054 | |||
| 979 | Ga0068852_100349586 | |||
| 980 | Ga0068859_100258369 | |||
| 981 | Ga0068864_100064733 | |||
| 982 | Ga0068864_100064875 | |||
| 983 | Ga0068866_10003296 | |||
| 984 | Ga0068870_10067468 | |||
| 985 | Ga0068863_100150822 | |||
| 986 | Ga0068863_100366295 | |||
| 987 | Ga0068860_100085016 | |||
| 988 | Ga0068860_100154709 | |||
| 989 | Ga0068860_100366644 | |||
| 990 | Ga0081455_10022186 | |||
| 991 | Ga0081455_10078046 | |||
| 992 | Ga0081455_10128328 | |||
| 993 | Ga0081455_10192377 | |||
| 994 | Ga0081455_10241138 | |||
| 995 | Ga0081538_10000093 | |||
| 996 | Ga0081538_10000917 | |||
| 997 | Ga0081538_10009114 | |||
| 998 | Ga0081539_10000363 | |||
| 999 | Ga0075365_10059341 | |||
| 1000 | Ga0075363_100180801 | |||
| 1001 | Ga0075364_10023031 | |||
| 1002 | Ga0070716_100011235 | |||
| 1003 | Ga0070716_100098021 | |||
| 1004 | Ga0070712_100075562 | |||
| 1005 | Ga0070712_100089854 | |||
| 1006 | Ga0097621_100017526 | |||
| 1007 | Ga0097621_100236415 | |||
| 1008 | Ga0097621_100263428 | |||
| 1009 | Ga0068871_100024455 | |||
| 1010 | Ga0068871_100053110 | |||
| 1011 | Ga0068871_100135211 | |||
| 1012 | Ga0068871_100217609 | |||
| 1013 | Ga0075428_100055596 | |||
| 1014 | Ga0075428_100218272 | |||
| 1015 | Ga0075428_100313518 | |||
| 1016 | Ga0075430_100061646 | |||
| 1017 | Ga0075430_100086585 | |||
| 1018 | Ga0075430_100157756 | |||
| 1019 | Ga0075431_100052231 | |||
| 1020 | Ga0075431_100074243 | |||
| 1021 | Ga0075433_10182918 | |||
| 1022 | Ga0075434_100001851 | |||
| 1023 | Ga0075434_100008655 | |||
| 1024 | Ga0075434_100042760 | |||
| 1025 | Ga0075434_100310345 | |||
| 1026 | Ga0075434_100611575 | |||
| 1027 | Ga0075429_100034302 | |||
| 1028 | Ga0075429_100183319 | |||
| 1029 | Ga0068865_100009060 | |||
| 1030 | Ga0068865_100030396 | |||
| 1031 | Ga0068865_100179268 | |||
| 1032 | Ga0068865_100184091 | |||
| 1033 | Ga0075436_100009503 | |||
| 1034 | Ga0075436_100024409 | |||
| 1035 | Ga0097620_100258337 | |||
| 1036 | Ga0075435_100033567 | |||
| 1037 | Ga0075435_100088796 | |||
| 1038 | Ga0075435_100189719 | |||
| 1039 | Ga0105240_10320960 | |||
| 1040 | Ga0105240_10347429 | |||
| 1041 | Ga0111539_10010806 | |||
| 1042 | Ga0111539_10016408 | |||
| 1043 | Ga0111539_10375452 | |||
| 1044 | Ga0111539_10420010 | |||
| 1045 | Ga0111539_10935127 | |||
| 1046 | Ga0111539_11170066 | |||
| 1047 | Ga0105245_10023127 | |||
| 1048 | Ga0105245_10024081 | |||
| 1049 | Ga0105245_10026917 | |||
| 1050 | Ga0105245_10075223 | |||
| 1051 | Ga0105245_10082758 | |||
| 1052 | Ga0105245_10090493 | |||
| 1053 | Ga0105245_10121076 | |||
| 1054 | Ga0105245_10146812 | |||
| 1055 | Ga0105245_10154705 | |||
| 1056 | Ga0105245_10353198 | |||
| 1057 | Ga0105245_10527894 | |||
| 1058 | Ga0105245_10867518 | |||
| 1059 | Ga0105245_11154827 | |||
| 1060 | Ga0114129_10063811 | |||
| 1061 | Ga0114129_10141717 | |||
| 1062 | Ga0114129_10245538 | |||
| 1063 | Ga0114129_10603390 | |||
| 1064 | Ga0105243_10041511 | |||
| 1065 | Ga0105243_10068542 | |||
| 1066 | Ga0105243_10070713 | |||
| 1067 | Ga0105243_10168419 | |||
| 1068 | Ga0105243_10911210 | |||
| 1069 | Ga0105241_10033872 | |||
| 1070 | Ga0105242_10156276 | |||
| 1071 | Ga0105242_10374476 | |||
| 1072 | Ga0105242_10677604 | |||
| 1073 | Ga0105248_10829601 | |||
| 1074 | Ga0105248_11169934 | |||
| 1075 | Ga0105238_10053698 | |||
| 1076 | Ga0105238_10080991 | |||
| 1077 | Ga0105238_10154092 | |||
| 1078 | Ga0105249_10020480 | |||
| 1079 | Ga0105249_10727637 | |||
| 1080 | Ga0105239_10033267 | |||
| 1081 | Ga0105239_10065163 | |||
| 1082 | Ga0105239_10778058 | |||
| 1083 | Ga0105246_10025404 | |||
| 1084 | Ga0105246_10093388 | |||
| 1085 | Ga0105246_10368011 | |||
| 1086 | Ga0157371_10180653 | |||
| 1087 | Ga0157370_10595452 | |||
| 1088 | Ga0157369_10001698 | |||
| 1089 | Ga0157369_10106646 | |||
| 1090 | Ga0157369_10382484 | |||
| 1091 | Ga0157374_10020244 | |||
| 1092 | Ga0157374_10409028 | |||
| 1093 | Ga0157374_10600161 | |||
| 1094 | Ga0157378_10638218 | |||
| 1095 | Ga0157378_10978548 | |||
| 1096 | Ga0163162_10255507 | |||
| 1097 | Ga0157372_10054897 | |||
| 1098 | Ga0157372_10068217 | |||
| 1099 | Ga0157372_10109005 | |||
| 1100 | Ga0157372_10827883 | |||
| 1101 | Ga0157375_10032725 | |||
| 1102 | Ga0157375_10545270 | |||
| 1103 | Ga0157375_10564957 | |||
| 1104 | Ga0157375_10656884 | |||
| 1105 | Ga0157375_10765692 | |||
| 1106 | Ga0157375_11256566 | |||
| 1107 | Ga0163163_10009258 | |||
| 1108 | Ga0163163_10196739 | |||
| 1109 | Ga0157380_10116230 | |||
| 1110 | Ga0157380_10825902 | |||
| 1111 | Ga0157380_10892964 | |||
| 1112 | Ga0157377_10007410 | |||
| 1113 | Ga0157377_10042506 | |||
| 1114 | Ga0157377_10067162 | |||
| 1115 | Ga0157379_10090083 | |||
| 1116 | Ga0157376_10271269 | |||
| 1117 | Ga0157376_10687097 | |||
| 1118 | Ga0163161_10069647 | |||
| 1119 | Ga0163161_10154831 | |||
| 1120 | Ga0197907_10787494 | |||
| 1121 | Ga0206356_10690906 | |||
| 1122 | Ga0206354_10493040 | |||
| 1123 | Ga0206354_11181411 | |||
| 1124 | Ga0206353_10682305 | |||
| 1125 | Ga0206353_11563311 | |||
| 1126 | Ga0213876_10173606 | |||
| 1127 | Ga0207653_10045403 | |||
| 1128 | Ga0207682_10131711 | |||
| 1129 | Ga0207692_10006352 | |||
| 1130 | Ga0207692_10074306 | |||
| 1131 | Ga0207642_10006027 | |||
| 1132 | Ga0207642_10006211 | |||
| 1133 | Ga0207642_10079263 | |||
| 1134 | Ga0207642_10114279 | |||
| 1135 | Ga0207688_10013509 | |||
| 1136 | Ga0207688_10040384 | |||
| 1137 | Ga0207688_10330089 | |||
| 1138 | Ga0207685_10183672 | |||
| 1139 | Ga0207645_10129437 | |||
| 1140 | Ga0207643_10006336 | |||
| 1141 | Ga0207705_10187184 | |||
| 1142 | Ga0207684_10081383 | |||
| 1143 | Ga0207654_10034181 | |||
| 1144 | Ga0207654_10340525 | |||
| 1145 | Ga0207654_10389089 | |||
| 1146 | Ga0207707_10015519 | |||
| 1147 | Ga0207707_10020859 | |||
| 1148 | Ga0207693_10002227 | |||
| 1149 | Ga0207693_10107738 | |||
| 1150 | Ga0207693_10134809 | |||
| 1151 | Ga0207693_10185444 | |||
| 1152 | Ga0207663_10102392 | |||
| 1153 | Ga0207660_10014082 | |||
| 1154 | Ga0207660_10174227 | |||
| 1155 | Ga0207660_10533787 | |||
| 1156 | Ga0207662_10030533 | |||
| 1157 | Ga0207662_10103164 | |||
| 1158 | Ga0207657_10039192 | |||
| 1159 | Ga0207657_10579652 | |||
| 1160 | Ga0207657_10650851 | |||
| 1161 | Ga0207649_10041202 | |||
| 1162 | Ga0207652_10012862 | |||
| 1163 | Ga0207652_10078373 | |||
| 1164 | Ga0207652_10202229 | |||
| 1165 | Ga0207652_10300395 | |||
| 1166 | Ga0207652_10409002 | |||
| 1167 | Ga0207681_10386858 | |||
| 1168 | Ga0207694_10237139 | |||
| 1169 | Ga0207694_10341585 | |||
| 1170 | Ga0207694_10345114 | |||
| 1171 | Ga0207650_10016944 | |||
| 1172 | Ga0207659_10104562 | |||
| 1173 | Ga0207659_10405487 | |||
| 1174 | Ga0207687_10022683 | |||
| 1175 | Ga0207687_10027614 | |||
| 1176 | Ga0207687_10029173 | |||
| 1177 | Ga0207687_10070197 | |||
| 1178 | Ga0207687_10109983 | |||
| 1179 | Ga0207687_10363695 | |||
| 1180 | Ga0207700_10000028 | |||
| 1181 | Ga0207700_10221860 | |||
| 1182 | Ga0207664_10176568 | |||
| 1183 | Ga0207664_10396316 | |||
| 1184 | Ga0207664_10784449 | |||
| 1185 | Ga0207644_10056530 | |||
| 1186 | Ga0207644_10064384 | |||
| 1187 | Ga0207690_10086333 | |||
| 1188 | Ga0207706_10051097 | |||
| 1189 | Ga0207706_10074971 | |||
| 1190 | Ga0207706_10239430 | |||
| 1191 | Ga0207706_10407067 | |||
| 1192 | Ga0207706_10711986 | |||
| 1193 | Ga0207686_10180867 | |||
| 1194 | Ga0207709_10037539 | |||
| 1195 | Ga0207709_10109083 | |||
| 1196 | Ga0207709_10156559 | |||
| 1197 | Ga0207670_10059903 | |||
| 1198 | Ga0207669_10014396 | |||
| 1199 | Ga0207704_10032807 | |||
| 1200 | Ga0207665_10016464 | |||
| 1201 | Ga0207665_10070940 | |||
| 1202 | Ga0207691_10008423 | |||
| 1203 | Ga0207711_10236339 | |||
| 1204 | Ga0207689_10026029 | |||
| 1205 | Ga0207689_10377512 | |||
| 1206 | Ga0207689_10529991 | |||
| 1207 | Ga0207689_10611576 | |||
| 1208 | Ga0207661_10006079 | |||
| 1209 | Ga0207661_10036005 | |||
| 1210 | Ga0207661_10063063 | |||
| 1211 | Ga0207661_10139743 | |||
| 1212 | Ga0207661_10151254 | |||
| 1213 | Ga0207661_10273858 | |||
| 1214 | Ga0207661_10807737 | |||
| 1215 | Ga0207679_10034083 | |||
| 1216 | Ga0207679_10221029 | |||
| 1217 | Ga0207679_10364172 | |||
| 1218 | Ga0207667_10165119 | |||
| 1219 | Ga0207667_10251091 | |||
| 1220 | Ga0207667_10394999 | |||
| 1221 | Ga0207667_10519289 | |||
| 1222 | Ga0207667_10880642 | |||
| 1223 | Ga0207651_10688704 | |||
| 1224 | Ga0207712_10104656 | |||
| 1225 | Ga0207712_10616945 | |||
| 1226 | Ga0207668_10323397 | |||
| 1227 | Ga0207668_10344644 | |||
| 1228 | Ga0207640_10011193 | |||
| 1229 | Ga0207640_10100021 | |||
| 1230 | Ga0207677_10029329 | |||
| 1231 | Ga0207677_10104612 | |||
| 1232 | Ga0207677_10122539 | |||
| 1233 | Ga0207677_10195183 | |||
| 1234 | Ga0207677_10616520 | |||
| 1235 | Ga0207678_10075875 | |||
| 1236 | Ga0207678_10079945 | |||
| 1237 | Ga0207678_10084591 | |||
| 1238 | Ga0207678_10147832 | |||
| 1239 | Ga0207678_10360243 | |||
| 1240 | Ga0207708_10016076 | |||
| 1241 | Ga0207708_10022412 | |||
| 1242 | Ga0207708_10033742 | |||
| 1243 | Ga0207708_10084149 | |||
| 1244 | Ga0207708_10188994 | |||
| 1245 | Ga0207702_10080039 | |||
| 1246 | Ga0207702_10119051 | |||
| 1247 | Ga0207702_10201809 | |||
| 1248 | Ga0207702_10238868 | |||
| 1249 | Ga0207641_10304650 | |||
| 1250 | Ga0207641_10660975 | |||
| 1251 | Ga0207648_10001618 | |||
| 1252 | Ga0207648_10027846 | |||
| 1253 | Ga0207648_10184700 | |||
| 1254 | Ga0207648_10328856 | |||
| 1255 | Ga0207648_10437068 | |||
| 1256 | Ga0207648_10671302 | |||
| 1257 | Ga0207674_10011223 | |||
| 1258 | Ga0207674_10256794 | |||
| 1259 | Ga0207675_100019600 | |||
| 1260 | Ga0207675_100020260 | |||
| 1261 | Ga0207675_100088815 | |||
| 1262 | Ga0207675_100291051 | |||
| 1263 | Ga0207675_100562717 | |||
| 1264 | Ga0207683_10005786 | |||
| 1265 | Ga0207683_10023914 | |||
| 1266 | Ga0207683_10024330 | |||
| 1267 | Ga0207683_10028840 | |||
| 1268 | Ga0207683_10028930 | |||
| 1269 | Ga0207683_10036902 | |||
| 1270 | Ga0207428_10002578 | |||
| 1271 | Ga0207428_10133040 | |||
| 1272 | Ga0207428_10298528 | |||
| 1273 | Ga0268266_10212816 | |||
| 1274 | Ga0268266_11114546 | |||
| 1275 | Ga0268265_10242349 | |||
| 1276 | Ga0265318_10037183 | |||
| 1277 | Ga0265338_10129398 | |||
| 1278 | Ga0307408_100476957 | |||
| 1279 | Ga0307408_100513371 | |||
| 1280 | Ga0307405_10000763 | |||
| 1281 | Ga0307405_10359396 | |||
| 1282 | Ga0307413_10726688 | |||
| 1283 | Ga0307410_10030123 | |||
| 1284 | Ga0307406_10002380 | |||
| 1285 | Ga0307406_10084650 | |||
| 1286 | Ga0307406_10240866 | |||
| 1287 | Ga0307407_10002086 | |||
| 1288 | Ga0307412_10176038 | |||
| 1289 | Ga0307409_100452512 | |||
| 1290 | Ga0307409_100901063 | |||
| 1291 | Ga0307416_100061199 | |||
| 1292 | Ga0307416_100234962 | |||
| 1293 | Ga0307416_100522864 | |||
| 1294 | Ga0307414_10011153 | |||
| 1295 | Ga0307415_100011986 | |||
| 1296 | Ga0373928_0040147 | |||
| 1297 | Ga0373944_0011271 | |||
| 1298 | Ga0373951_0045506 | |||
| 1299 | Ga0373943_0008346 | |||
| 1300 | Ga0373943_0155318 | |||
| 1301 | Ga0373946_0097326 | |||
| 1302 | Ga0373931_0075531 | |||
| 1303 | Ga0373927_0063413 | |||
| 1304 | Ga0373947_0001800 | |||
| 1305 | Ga0373925_0235356 | |||
| 1306 | Ga0395899_0010469 | |||
| 1307 | Ga0395899_0056130 | |||
| 1308 | Ga0395899_0089903 | |||
| 1309 | Ga0395899_0183006 | |||
| 1310 | Ga0395900_0005641 | |||
| 1311 | Ga0395900_0034902 | |||
| 1312 | Ga0395900_0103933 | |||
| 1313 | Ga0395900_0109143 | |||
| 1314 | Ga0395900_0116757 | |||
| 1315 | Ga0395900_0321796 | |||
| 1316 | Ga0395900_0583692 | |||
| 1317 | Ga0395898_0012333 | |||
| 1318 | Ga0395898_0018348 | |||
| 1319 | Ga0395898_0042686 | |||
| 1320 | Ga0395898_0185978 | |||
| 1321 | Ga0395898_0196252 | |||
| 1322 | Ga0395898_0325954 | |||
| 1323 | Ga0395898_0784231 | |||
| 1324 | Ga0395905_0002820 | |||
| 1325 | Ga0395905_0018242 | |||
| 1326 | Ga0395905_0065878 | |||
| 1327 | Ga0395905_0440253 | |||
| 1328 | Ga0395901_0021008 | |||
| 1329 | Ga0395901_0083306 | |||
| 1330 | Ga0395901_0136099 | |||
| 1331 | Ga0395901_0165855 | |||
| 1332 | Ga0395901_0341237 | |||
| 1333 | Ga0395901_0360676 | |||
| 1334 | Ga0436365_1717107 | |||
| 1335 | Ga0436363_1306718 | |||
| 1336 | Ga0439451_049687 | |||
| 1337 | Ga0466966_0147010 | |||
| 1338 | Ga0466963_0011804 | |||
| 1339 | Ga0466963_0064000 | |||
| 1340 | Ga0466964_0038383 | |||
| 1341 | Ga0466971_0012859 | |||
| 1342 | Ga0466968_0132144 | |||
| 1343 | Ga0466957_0209412 | |||
| 1344 | Ga0466960_0027536 | |||
| 1345 | Ga0466960_0051920 | |||
| 1346 | Ga0466960_0413369 | |||
| 1347 | Ga0451576_0039365 | |||
| 1348 | Ga0451576_0070400 | |||
| 1349 | Ga0451576_0288864 | |||
| 1350 | Ga0466958_0047901 | |||
| 1351 | Ga0466958_0051946 | |||
| 1352 | Ga0466967_0015805 | |||
| 1353 | Ga0466967_0026415 | |||
| 1354 | Ga0466967_0074387 | |||
| 1355 | Ga0495603_0040882 | |||
| 1356 | Ga0495603_0262672 | |||
| 1357 | Ga0495629_0004153 | |||
| 1358 | Ga0495629_0611126 | |||
| 1359 | Ga0495641_0000850 | |||
| 1360 | Ga0495651_0021532 | |||
| 1361 | Ga0495651_0233273 | |||
| 1362 | Ga0495651_0283601 | |||
| 1363 | Ga0495653_0096292 | |||
| 1364 | Ga0495580_0179818 | |||
| 1365 | Ga0495582_0000054 | |||
| 1366 | Ga0495605_0229636 | |||
| 1367 | Ga0495639_0000608 | |||
| 1368 | Ga0495639_0026258 | |||
| 1369 | Ga0495662_0007155 | |||
| 1370 | Ga0495584_0078101 | |||
| 1371 | Ga0495594_0060192 | |||
| 1372 | Ga0495607_0046643 | |||
| 1373 | Ga0495608_0058926 | |||
| 1374 | Ga0495608_0223848 | |||
| 1375 | Ga0495618_0257340 | |||
| 1376 | Ga0495630_0006532 | |||
| 1377 | Ga0495630_0099611 | |||
| 1378 | Ga0495630_0901591 | |||
| 1379 | Ga0495631_0045678 | |||
| 1380 | Ga0495663_0081187 | |||
| 1381 | Ga0495666_0083864 | |||
| 1382 | Ga0495642_0035217 | |||
| 1383 | Ga0495652_0516051 | |||
| 1384 | Ga0495640_0151385 | |||
| 1385 | Ga0495586_0077937 | |||
| 1386 | Ga0495587_0084487 | |||
| 1387 | Ga0495587_0186313 | |||
| 1388 | Ga0495609_0184828 | |||
| 1389 | Ga0495667_0037023 | |||
| 1390 | Ga0495667_0063607 | |||
| 1391 | Ga0495656_0355838 | |||
| 1392 | Ga0495668_0355221 | |||
| 1393 | Ga0495635_0015770 | |||
| 1394 | Ga0495635_0358885 | |||
| 1395 | Ga0495659_0057466 | |||
| 1396 | Ga0495659_0077257 | |||
| 1397 | Ga0495657_0070907 | |||
| 1398 | Ga0495646_0089793 | |||
| 1399 | Ga0495647_0012862 | |||
| 1400 | Ga0495658_0001151 | |||
| 1401 | Ga0495658_0519893 | |||
| 1402 | Ga0495613_0015631 | |||
| 1403 | Ga0495613_0139580 | |||
| 1404 | Ga0495624_0019148 | |||
| 1405 | Ga0495600_0017106 | |||
| 1406 | Ga0495600_0197960 | |||
| 1407 | Ga0495581_0001507 | |||
| 1408 | Ga0495604_0277326 | |||
| 1409 | Ga0495674_0066250 | |||
| 1410 | Ga0495674_0122635 | |||
| 1411 | Ga0495676_0001978 | |||
| 1412 | Ga0495676_0012780 | |||
| 1413 | Ga0495680_0007171 | |||
| 1414 | Ga0495675_0219417 | |||
| 1415 | Ga0495677_0031065 | |||
| 1416 | Ga0495677_0209213 | |||
| 1417 | Ga0495684_0355666 | |||
| 1418 | Ga0495593_0010033 | |||
| 1419 | Ga0495614_0005102 | |||
| 1420 | Ga0496100_0006635 | |||
| 1421 | Ga0496100_0052242 | |||
| 1422 | Ga0496100_0079903 | |||
| 1423 | Ga0496100_0143567 | |||
| 1424 | Ga0496100_0181469 | |||
| 1425 | Ga0496100_0848239 | |||
| 1426 | Ga0496100_1264702 | |||
| 1427 | Ga0496101_0002853 | |||
| 1428 | Ga0496101_0007728 | |||
| 1429 | Ga0496101_0014724 | |||
| 1430 | Ga0496101_0023646 | |||
| 1431 | Ga0496101_0038763 | |||
| 1432 | Ga0496101_0068102 | |||
| 1433 | Ga0496101_0161190 | |||
| 1434 | Ga0496101_0209372 | |||
| 1435 | Ga0496102_0090721 | |||
| 1436 | Ga0496102_0206556 | |||
| 1437 | Ga0496102_0509105 | |||
| 1438 | Ga0496102_0581264 | |||
| 1439 | Ga0496103_0002848 | |||
| 1440 | Ga0496103_0192402 | |||
| 1441 | Ga0496104_0000261 | |||
| 1442 | Ga0496104_0005537 | |||
| 1443 | Ga0496104_0019952 | |||
| 1444 | Ga0496104_0021669 | |||
| 1445 | Ga0496104_0062208 | |||
| 1446 | Ga0496104_0112553 | |||
| 1447 | Ga0496104_0149135 | |||
| 1448 | Ga0496104_0631403 | |||
| 1449 | Ga0496105_0000341 | |||
| 1450 | Ga0496105_0000489 | |||
| 1451 | Ga0496105_0106462 | |||
| 1452 | Ga0496105_0229308 | |||
| 1453 | Ga0496105_0432799 | |||
| 1454 | Ga0496106_0009087 | |||
| 1455 | Ga0496106_0056290 | |||
| 1456 | Ga0496106_0099407 | |||
| 1457 | Ga0496106_0113899 | |||
| 1458 | Ga0496106_0297114 | |||
| 1459 | Ga0496106_0778695 | |||
| 1460 | Ga0496107_0002143 | |||
| 1461 | Ga0496107_0003268 | |||
| 1462 | Ga0496107_0029143 | |||
| 1463 | Ga0496107_0032884 | |||
| 1464 | Ga0496107_0052381 | |||
| 1465 | Ga0496107_0091743 | |||
| 1466 | Ga0496107_0128782 | |||
| 1467 | Ga0496107_0147328 | |||
| 1468 | Ga0496107_0227916 | |||
| 1469 | Ga0496108_0007200 | |||
| 1470 | Ga0496108_0023336 | |||
| 1471 | Ga0496108_0070061 | |||
| 1472 | Ga0496108_0084511 | |||
| 1473 | Ga0496108_0115761 | |||
| 1474 | Ga0496108_0115931 | |||
| 1475 | Ga0496108_0152234 | |||
| 1476 | Ga0496108_0218221 | |||
| 1477 | Ga0496109_0000301 | |||
| 1478 | Ga0496109_0007517 | |||
| 1479 | Ga0496109_0015256 | |||
| 1480 | Ga0496109_0018133 | |||
| 1481 | Ga0496109_0028696 | |||
| 1482 | Ga0496109_0058691 | |||
| 1483 | Ga0496109_0077625 | |||
| 1484 | Ga0496109_0111816 | |||
| 1485 | Ga0496109_0188717 | |||
| 1486 | Ga0496109_0564728 | |||
| 1487 | Ga0496109_0643051 | |||
| 1488 | Ga0496109_0643562 | |||
| 1489 | Ga0496110_0000221 | |||
| 1490 | Ga0496110_0008818 | |||
| 1491 | Ga0496110_0011717 | |||
| 1492 | Ga0496110_0011876 | |||
| 1493 | Ga0496110_0028246 | |||
| 1494 | Ga0496110_0046383 | |||
| 1495 | Ga0496110_0059256 | |||
| 1496 | Ga0496110_0080714 | |||
| 1497 | Ga0496110_0139428 | |||
| 1498 | Ga0496110_0467391 | |||
| 1499 | Ga0496111_0000132 | |||
| 1500 | Ga0496111_0001079 | |||
| 1501 | Ga0496111_0001218 | |||
| 1502 | Ga0496111_0029353 | |||
| 1503 | Ga0496111_0042088 | |||
| 1504 | Ga0496111_0178400 | |||
| 1505 | Ga0496112_0003185 | |||
| 1506 | Ga0496112_0055832 | |||
| 1507 | Ga0496112_0865720 | |||
| 1508 | Ga0496112_1273153 | |||
| 1509 | Ga0496113_0013269 | |||
| 1510 | Ga0496113_0031188 | |||
| 1511 | Ga0496113_0052525 | |||
| 1512 | Ga0496113_0119987 | |||
| 1513 | Ga0496113_0364064 | |||
| 1514 | Ga0496113_0686111 | |||
| 1515 | Ga0496114_0000801 | |||
| 1516 | Ga0496114_0001557 | |||
| 1517 | Ga0496114_0004524 | |||
| 1518 | Ga0496114_0019844 | |||
| 1519 | Ga0496114_0220629 | |||
| 1520 | Ga0496114_0435352 | |||
| 1521 | Ga0496114_1078594 | |||
| 1522 | Ga0496115_0016111 | |||
| 1523 | Ga0496115_0048676 | |||
| 1524 | Ga0496115_0135703 | |||
| 1525 | Ga0496115_0144913 | |||
| 1526 | Ga0496115_0161679 | |||
| 1527 | Ga0496115_0355954 | |||
| 1528 | Ga0501291_003751 | |||
| 1529 | Ga0501032_0086882 | |||
| 1530 | Ga0501032_0537053 | |||
| 1531 | Ga0501036_0012707 | |||
| 1532 | Ga0501036_0159180 | |||
| 1533 | Ga0501036_0475263 | |||
| 1534 | Ga0501036_0769762 | |||
| 1535 | Ga0501037_0014381 | |||
| 1536 | Ga0501038_0015192 | |||
| 1537 | Ga0501038_0721431 | |||
| 1538 | Ga0501039_0049672 | |||
| 1539 | Ga0501039_0102879 | |||
| 1540 | Ga0501040_0004638 | |||
| 1541 | Ga0501040_0009087 | |||
| 1542 | Ga0501040_0111173 | |||
| 1543 | Ga0501040_0118586 | |||
| 1544 | Ga0501040_0163336 | |||
| 1545 | Ga0501040_0880088 | |||
| 1546 | Ga0501041_0072069 | |||
| 1547 | Ga0501042_0067921 | |||
| 1548 | Ga0501042_0117208 | |||
| 1549 | Ga0501042_0133421 | |||
| 1550 | Ga0501042_0177617 | |||
| 1551 | Ga0501043_0010486 | |||
| 1552 | Ga0501046_0000122 | |||
| 1553 | Ga0501046_0483453 | |||
| 1554 | Ga0501047_0191857 | |||
| 1555 | Ga0501048_0047065 | |||
| 1556 | Ga0501048_0075289 | |||
| 1557 | Ga0501067_0007826 | |||
| 1558 | Ga0501067_0053221 | |||
| 1559 | Ga0501067_0147343 | |||
| 1560 | Ga0501068_0000426 | |||
| 1561 | Ga0501068_0006032 | |||
| 1562 | Ga0501069_0000061 | |||
| 1563 | Ga0501069_0002211 | |||
| 1564 | Ga0501069_0004456 | |||
| 1565 | Ga0501069_0026501 | |||
| 1566 | Ga0501069_0070306 | |||
| 1567 | Ga0501069_0088767 | |||
| 1568 | Ga0501069_0169956 | |||
| 1569 | Ga0501070_0005391 | |||
| 1570 | Ga0501070_0666336 | |||
| 1571 | Ga0501071_0054999 | |||
| 1572 | Ga0501071_0067747 | |||
| 1573 | Ga0501071_0127145 | |||
| 1574 | Ga0501071_0134567 | |||
| 1575 | Ga0501071_0146708 | |||
| 1576 | Ga0501072_0132704 | |||
| 1577 | Ga0501072_0409306 | |||
| 1578 | Ga0501072_0809853 | |||
| 1579 | Ga0501073_0008113 | |||
| 1580 | Ga0501074_0052612 | |||
| 1581 | Ga0501074_0132415 | |||
| 1582 | Ga0501074_0174795 | |||
| 1583 | Ga0501074_0434795 | |||
| 1584 | Ga0501075_0031794 | |||
| 1585 | Ga0501075_0037435 | |||
| 1586 | Ga0501075_0295884 | |||
| 1587 | Ga0501075_0562232 | |||
| 1588 | Ga0501076_0031889 | |||
| 1589 | Ga0501076_0060351 | |||
| 1590 | Ga0501076_0095054 | |||
| 1591 | Ga0501076_0177160 | |||
| 1592 | Ga0501077_0018438 | |||
| 1593 | Ga0501077_0040409 | |||
| 1594 | Ga0501079_0024424 | |||
| 1595 | Ga0501079_0043908 | |||
| 1596 | Ga0501079_0359240 | |||
| 1597 | Ga0501079_0403011 | |||
| 1598 | Ga0501079_0830379 | |||
| 1599 | Ga0501080_0033905 | |||
| 1600 | Ga0501080_0047211 | |||
| 1601 | Ga0501080_0208580 | |||
| 1602 | Ga0501080_0383847 | |||
| 1603 | Ga0501081_0016426 | |||
| 1604 | Ga0501081_0037706 | |||
| 1605 | Ga0501081_0162934 | |||
| 1606 | Ga0501081_0733245 | |||
| 1607 | Ga0501083_0001412 | |||
| 1608 | Ga0501083_0170660 | |||
| 1609 | Ga0501035_0015492 | |||
| 1610 | Ga0501035_0211555 | |||
| 1611 | Ga0501044_0008263 | |||
| 1612 | Ga0501045_0045496 | |||
| 1613 | Ga0501045_0071314 | |||
| 1614 | Ga0501045_0193709 | |||
| 1615 | Ga0501045_0353619 | |||
| 1616 | nmdc:mga0yw44_109382_c1 | |||
| 1617 | nmdc:mga05p37_174992_c1 | |||
| 1618 | nmdc:mga05p37_202575_c1 | |||
| 1619 | nmdc:mga05p37_28507_c1 | |||
| 1620 | nmdc:mga05p37_77421_c1 | |||
| 1621 | nmdc:mga09592_150544_c1 | |||
| 1622 | nmdc:mga09592_337950_c1 | |||
| 1623 | nmdc:mga09592_760081_c1 | |||
| 1624 | nmdc:mga0qj67_379788_c1 | |||
| 1625 | nmdc:mga0qj67_52311_c1 | |||
| 1626 | nmdc:mga0qj67_61560_c1 | |||
| 1627 | nmdc:mga06r32_29294_c1 | |||
| 1628 | nmdc:mga08y16_29379_c1 | |||
| 1629 | nmdc:mga08y16_54582_c2 | |||
| 1630 | nmdc:mga08y16_689951_c1 | |||
| 1631 | nmdc:mga08y16_81094_c1 | |||
| 1632 | nmdc:mga0n895_1117356_c1 | |||
| 1633 | nmdc:mga0n895_33689_c1 | |||
| 1634 | nmdc:mga0n895_414195_c1 | |||
| 1635 | nmdc:mga0n895_45639_c2 | |||
| 1636 | nmdc:mga0n895_62016_c1 | |||
| 1637 | nmdc:mga0rr50_211525_c1 | |||
| 1638 | nmdc:mga0rr50_214993_c1 | |||
| 1639 | nmdc:mga0rr50_223194_c1 | |||
| 1640 | nmdc:mga0rr50_250903_c1 | |||
| 1641 | nmdc:mga0rr50_321089_c1 | |||
| 1642 | nmdc:mga08x19_20101_c1 | |||
| 1643 | nmdc:mga08x19_38349_c1 | |||
| 1644 | nmdc:mga0a205_178237_c1 | |||
| 1645 | nmdc:mga0a205_189372_c1 | |||
| 1646 | nmdc:mga0a205_293360_c1 | |||
| 1647 | nmdc:mga0a205_649978_c1 | |||
| 1648 | Ga0495655_0082696 | |||
| 1649 | Ga0495619_0016537 | |||
| 1650 | Ga0495619_0251256 | |||
| 1651 | Ga0495619_0357840 | |||
| 1652 | Ga0501084_0053093 | |||
| 1653 | Ga0501084_0065694 | |||
| 1654 | Ga0501084_0072431 | |||
| 1655 | Ga0501084_0111464 | |||
| 1656 | Ga0501084_0134960 | |||
| 1657 | Ga0501084_0544832 | |||
| 1658 | Ga0501084_0618861 | |||
| 1659 | Ga0590074_002113 | |||
| 1660 | Ga0590075_033943 | |||
| 1661 | Ga0590077_062931 | |||
| 1662 | Ga0501082_0006325 | |||
| 1663 | Ga0501082_0048383 | |||
| 1664 | Ga0501082_0128487 | |||
| 1665 | Ga0501082_0225639 | |||
| 1666 | Ga0501082_0358988 | |||
| 1667 | Ga0466962_0027603 | |||
| 1668 | Ga0530510_0006274 | |||
| 1669 | Ga0530510_0056942 | |||
| 1670 | Ga0530510_0096219 | |||
| 1671 | Ga0530510_0329386 | |||
| 1672 | Ga0530510_0350031 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2q5w-assembly1.cif.gz_E | the x-ray crystal structure of molybdopterin synthase from staphylococcus aureus | 0.9435 | 74 | 206 |
| 4ap8-assembly1.cif.gz_A | crystal structure of human molybdopterin synthase catalytic subunit (mocs2b) | 0.9406 | 76 | 198 |
| 2wp4-assembly1.cif.gz_A | crystal structure of rv3119 from mycobacterium tuberculosis | 0.9334 | 77 | 196 |
| 1nvj-assembly1.cif.gz_B | deletion mutant (delta 141) of molybdopterin synthase | 0.9247 | 75 | 194 |
| 6jc0-assembly1.cif.gz_B | structural analysis of molybdopterin synthases from two mycobacteria pathogens | 0.9182 | 76 | 205 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P91500_195_340_3.90.1170.40 | Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit | 0.9689 | 76 | 207 | 3.90.1170.40 |
| af_Q86HF4_1_145_3.90.1170.40 | Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit | 0.9481 | 76 | 208 | 3.90.1170.40 |
| 5mpoC00 | Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit | 0.9357 | 75 | 198 | 3.90.1170.40 |
| 2qieK00 | Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit | 0.9309 | 74 | 207 | 3.90.1170.40 |
| 2qieK00 | Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit | 0.9113 | 74 | 207 | 3.90.1170.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A151GLE3-F1-model_v4 | Molybdenum cofactor synthesis protein 2b | 0.9758 | 90 | 207 |
GO:0006777
|
| AF-A0A3N5F992-F1-model_v4 | Molybdenum cofactor biosynthesis protein MoaE | 0.9749 | 76 | 206 |
GO:0006777
|
| AF-R1EYC6-F1-model_v4 | Molybdopterin synthase catalytic subunit (EC 2.8.1.12) (Common component for nitrate reductase and xanthine dehydrogenase protein H) (Molybdenum cofactor synthesis protein 2 large subunit) (Molybdenum cofactor synthesis protein 2B) (MOCS2B) | 0.9746 | 76 | 207 |
GO:0006777
GO:0030366 GO:1990140 |
| AF-A0A495ZJE1-F1-model_v4 | Molybdenum cofactor biosynthesis protein MoaE | 0.9742 | 78 | 207 |
GO:0006777
|
| AF-A0A5N5D4U3-F1-model_v4 | Molybdopterin synthase catalytic subunit (EC 2.8.1.12) (Common component for nitrate reductase and xanthine dehydrogenase protein H) (Molybdenum cofactor synthesis protein 2 large subunit) (Molybdenum cofactor synthesis protein 2B) (MOCS2B) | 0.9739 | 76 | 207 |
GO:0006777
GO:0030366 GO:1990140 |