F482737

General Info

Members Datasets Scaffolds Average Seq Length
832 712 261 833

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2551306092|2551735605
Length 893
Sequence RWAVLAYVAIIIFGCLAALPSVLTPAMREQVASVLPFEPVTLGLDLRGGSHLVLEVDGAGLQKARLNSLLDDTRRVLRGERVSASSARISGNSVTVSIPDAQDRDKVLPKLQELATPVSTVGFAAPAPEVEVTTAGDVITLAMTEAGLADRMTKAVEQSLEIIRNRVDQVGVAEPLIQRIGSNRILVQLPGLQDPTRLRELLGSTAQMSFHMLDQSVDVTQPAPRGVDILPGANDGNRYPVESRVAISGERLDDAKVGFDQRTNQPVVDFSFDSLGARQFADITRENVGRPFAIVLDGKVLTAPVINEPILGGRGQISGSFTVEEATVLSALLRSGALPAPLTIIEERSVGPNLGSDSIRMGLFTGLAGFGLVVVLMVVLYGAWGMIANVGLVLHTIMTIGVLGLIGSTLTLPGIAGIILGIGMAVDANILINARIREETEAGAGAMKALDIGFNKAYATIIDSNVTTLAGTVLLFWFGSGPVKGFAVTMMLGIGISMFTSVTVVRLLMREVVVRRKMKKLEIPSLFGKVPQLPTFSFMKGRFLAIGFSAFLSISSVILFFTPGLNYGIDFIGGIQVEAVSKEKINLPTLRQSLEELNLGEVALQDFGGGQSVLIRVQRQPGGEQAQTVALNKVKDAVTTAIPGASMERTEVVGPTVSGELARSGFLAVALAMLAILLYIWFRFEWHFAVGAIAVLLLDITKTVGFFALTGIDFNLTAIAALLTMIGYSVNDKVVVYDRMRENLRKYKSMPFSDLIDMSINQVIARCIFTSAATALSLVPMAIWGGEAVQSFAWPMIFGVIVATTSSIYIGGXXXXGGRSGKPLVPPGSRRKRRQPDGLVPSTDAGGKPSAPFLIPPCRSRQRGSLYEGCPFFVGNSCLYSTRPLHGDSALPR

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
3 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
4 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
5 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
6 2509276019 Ensifer aridi TW10 Isolate Nodule
7 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
8 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
9 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
10 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
11 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
12 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
13 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
14 2512875024 Mesorhizobium loti R88b Isolate Nodule
15 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
16 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
17 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
18 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
19 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
20 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
21 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
22 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
23 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
24 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
25 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
26 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
27 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
28 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
29 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
30 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
31 2516143018 Ensifer sp. BR816 Isolate Nodule
32 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
33 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
34 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
35 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
36 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
37 2534681786 Brucella suis 92/29 Isolate Unclassified
38 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
39 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
40 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
41 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
42 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
43 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
44 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
45 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
46 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
47 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
48 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
49 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
50 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
51 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
52 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
53 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
54 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
55 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
56 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
57 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
58 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
59 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
60 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
61 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
62 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
63 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
64 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
65 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
66 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
67 2643221557 Ensifer sp. Root558 Isolate Unclassified
68 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
69 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
70 2643221607 Rhizobium sp. Root73 Isolate Unclassified
71 2643221610 Ensifer sp. Root74 Isolate Unclassified
72 2643221618 Ensifer sp. Root231 Isolate Unclassified
73 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
74 2643221626 Ensifer sp. Root31 Isolate Unclassified
75 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
76 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
77 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
78 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
79 2643221655 Ensifer sp. Root1252 Isolate Unclassified
80 2643221659 Ensifer sp. Root127 Isolate Unclassified
81 2643221668 Ensifer sp. Root423 Isolate Unclassified
82 2643221675 Ensifer sp. Root1298 Isolate Unclassified
83 2643221680 Ensifer sp. Root1312 Isolate Unclassified
84 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
85 2643221688 Rhizobium sp. Root482 Isolate Unclassified
86 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
87 2643221698 Ensifer sp. Root142 Isolate Unclassified
88 2643221712 Ensifer sp. Root258 Isolate Unclassified
89 2643221718 Rhizobium sp. Root268 Isolate Unclassified
90 2643221723 Ensifer sp. Root278 Isolate Unclassified
91 2643221726 Ensifer sp. Root954 Isolate Unclassified
92 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
93 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
94 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
95 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
96 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
97 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
98 2738541293 Rhizobium sp. GV031 Isolate Unclassified
99 2738543024 Aminobacter sp. AP02 Isolate Unclassified
100 2751185800 Brucella pituitosa AA2 Isolate Unclassified
101 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
102 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
103 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
104 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
105 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
106 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
107 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
108 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
109 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
110 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
111 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
112 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
113 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
114 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
115 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
116 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
117 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
118 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
119 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
120 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
121 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
122 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
123 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
124 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
125 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
126 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
127 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
128 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
129 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
130 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
131 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
132 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
133 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
134 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
135 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
136 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
137 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
138 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
139 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
140 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
141 2844163670 Ensifer sp. 1H6 Isolate Unclassified
142 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
143 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
144 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
145 2854911287 Brucella lupini LUP21 Isolate Unclassified
146 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
147 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
148 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
149 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
150 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
151 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
152 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
153 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
154 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
155 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
156 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
157 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
158 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
159 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
160 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
161 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
162 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
163 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
164 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
165 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
166 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
167 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
168 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
169 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
170 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
171 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
172 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
173 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
174 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
175 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
176 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
177 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
178 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
179 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
180 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
181 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
182 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
183 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
184 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
185 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
186 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
187 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
188 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
189 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
190 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
191 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
192 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
193 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
194 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
195 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
196 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
197 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
198 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
199 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
200 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
201 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
202 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
203 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
204 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
205 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
206 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
207 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
208 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
209 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
210 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
211 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
212 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
213 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
214 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
215 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
216 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
217 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
218 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
219 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
220 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
221 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
222 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
223 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
224 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
225 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
226 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
227 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
228 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
229 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
230 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
231 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
232 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
233 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
234 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
235 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
236 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
237 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
238 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
239 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
240 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
241 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
242 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
243 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
244 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
245 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
246 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
247 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
248 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
249 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
250 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
251 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
252 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
253 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
254 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
255 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
256 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
257 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
258 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
259 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
260 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
261 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
262 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
263 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
264 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
265 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
266 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
267 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
268 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
269 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
270 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
271 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
272 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
273 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
274 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
275 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
276 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
277 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
278 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
279 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
280 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
281 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
282 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
283 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
284 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
285 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
286 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
287 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
288 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
289 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
290 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
291 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
292 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
293 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
294 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
295 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
296 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
297 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
298 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
299 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
300 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
301 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
302 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
303 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
304 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
305 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
306 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
307 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
308 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
309 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
310 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
311 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
312 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
313 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
314 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
315 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
316 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
317 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
318 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
319 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
320 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
321 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
322 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
323 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
324 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
325 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
326 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
327 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
328 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
329 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
330 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
331 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
332 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
333 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
334 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
335 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
336 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
337 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
338 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
339 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
340 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
341 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
342 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
343 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
344 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
345 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
346 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
347 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
348 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
349 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
350 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
351 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
352 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
353 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
354 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
355 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
356 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
357 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
358 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
359 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
360 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
361 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
362 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
363 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
364 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
365 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
366 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
367 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
368 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
369 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
370 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
371 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
372 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
373 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
374 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
375 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
376 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
377 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
378 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
379 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
380 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
381 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
382 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
383 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
384 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
385 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
386 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
387 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
388 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
389 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
390 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
391 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
392 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
393 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
394 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
395 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
396 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
397 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
398 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
399 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
400 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
401 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
402 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
403 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
404 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
405 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
406 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
407 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
408 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
409 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
410 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
411 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
412 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
413 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
414 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
415 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
416 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
417 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
418 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
419 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
420 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
421 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
422 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
423 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
424 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
425 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
426 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
427 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
428 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
429 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
430 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
431 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
432 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
433 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
434 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
435 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
436 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
437 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
438 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
439 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
440 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
441 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
442 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
443 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
444 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
445 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
446 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
447 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
448 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
449 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
450 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
451 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
452 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
453 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
454 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
455 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
456 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
457 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
458 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
459 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
460 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
461 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
462 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
463 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
464 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
465 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
466 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
467 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
468 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
469 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
470 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
471 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
472 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
473 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
474 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
475 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
476 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
477 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
478 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
479 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
480 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
481 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
482 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
483 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
484 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
485 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
486 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
487 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
488 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
489 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
490 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
491 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
492 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
493 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
494 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
495 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
496 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
497 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
498 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
499 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
500 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
501 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
502 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
503 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
504 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
505 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
506 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
507 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
508 3004167301 Mesorhizobium loti 582 Isolate Unclassified
509 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
510 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
511 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
512 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
513 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
514 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
515 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
516 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
517 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
518 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
519 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
520 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
521 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
522 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
523 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
524 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
525 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
526 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
527 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
528 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
529 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
530 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
531 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
532 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
533 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
534 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
535 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
536 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
537 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
538 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
539 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
540 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
541 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
542 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
543 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
544 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
545 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
546 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
547 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
548 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
549 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
550 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
551 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
552 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
553 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
554 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
555 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
556 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
557 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
558 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
559 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
560 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
561 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
562 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
563 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
564 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
565 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
566 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
567 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
568 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
569 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
570 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
571 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
572 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
573 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
574 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
575 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
576 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
577 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
578 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
579 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
580 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
581 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
582 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
583 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
584 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
585 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
586 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
587 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
588 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
589 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
590 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
591 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
592 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
593 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
594 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
595 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
596 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
597 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
598 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
599 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
600 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
601 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
602 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
603 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
604 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
605 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
606 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
607 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
608 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
609 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
610 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
611 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
612 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
613 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
614 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
615 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
616 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
617 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
618 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
619 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
620 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
621 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
622 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
623 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
624 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
625 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
626 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
627 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
628 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
629 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
630 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
631 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
632 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
633 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
634 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
635 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
636 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
637 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
638 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
639 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
640 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
641 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
642 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
643 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
644 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
645 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
646 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
647 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
648 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
649 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
650 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
651 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
652 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
653 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
654 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
655 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
656 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
657 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
658 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
659 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
660 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
661 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
662 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
663 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
664 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
665 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
666 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
667 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
668 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
669 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
670 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
671 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
672 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
673 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
674 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
675 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
676 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
677 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
678 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
679 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
680 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
681 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
682 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
683 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
684 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
685 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
686 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
687 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
688 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
689 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
690 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
691 641228493 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
692 643348555 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
693 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
694 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
695 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
696 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
697 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
698 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
699 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
700 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
701 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
702 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
703 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
704 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
705 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
706 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
707 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
708 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
709 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
710 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
711 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
712 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 31.37
Metatranscriptomes 0
Isolates 68.63

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.65
Nodule 55.65
Rhizoplane 1.56
Rhizosphere 20.07
Stem 0
Stem Tuber 0
Unclassified 17.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25157J39369_1001953 3300002741 Bacteria 6139
2 JGI25150J39212_1000225 3300002774 Bacteria 30907
3 JGI25159J45721_1000003 3300002987 Bacteria 274069
4 JGI25151J46595_10000025 3300003187 Bacteria 213302
5 JGI25151J46595_10006775 3300003187 Bacteria 5704
6 JGI25151J46595_10014745 3300003187 Bacteria 3470
7 JGI25165J46597_1000024 3300003214 Bacteria 335150
8 JGI25165J46597_1000062 3300003214 Bacteria 206459
9 JGI25160J50197_1000003 3300003354 Bacteria 482719
10 Ga0055524_1001620 3300003775 Bacteria 12561
11 Ga0055531_10000750 3300003794 Bacteria 27296
12 Ga0058692_1000760 3300003856 Bacteria 12967
13 Ga0058692_1001496 3300003856 Bacteria 8556
14 Ga0055543_1001796 3300004625 Bacteria 7927
15 Ga0065165_1000084 3300005262 Bacteria 154822
16 Ga0065165_1002726 3300005262 Bacteria 14126
17 Ga0070658_10002112 3300005327 Bacteria 16680
18 Ga0070658_10026403 3300005327 Bacteria 4658
19 Ga0070666_10010803 3300005335 Bacteria 5716
20 Ga0070689_100001628 3300005340 Bacteria 14349
21 Ga0070687_100006273 3300005343 Bacteria 4867
22 Ga0070675_100002511 3300005354 Bacteria 13733
23 Ga0070688_100012857 3300005365 Bacteria 4703
24 Ga0070667_100007368 3300005367 Bacteria 9137
25 Ga0068853_100048465 3300005539 Bacteria 3649
26 Ga0070686_100005252 3300005544 Bacteria 7154
27 Ga0070665_100065107 3300005548 Bacteria 3656
28 Ga0070664_100015904 3300005564 Bacteria 6160
29 Ga0068856_100056117 3300005614 Bacteria 3886
30 Ga0068864_100001849 3300005618 Bacteria 17415
31 Ga0068861_100029782 3300005719 Bacteria 3995
32 Ga0068863_100002703 3300005841 Bacteria 17511
33 Ga0068858_100018190 3300005842 Bacteria 6580
34 Ga0068862_100000218 3300005844 Bacteria 63913
35 Ga0068862_100030879 3300005844 Bacteria 4517
36 Ga0075364_10000233 3300006051 Bacteria 26416
37 Ga0075428_100010266 3300006844 Bacteria 10397
38 Ga0075428_100071853 3300006844 Bacteria 3781
39 Ga0075430_100021269 3300006846 Bacteria 5516
40 Ga0075431_100026987 3300006847 Bacteria 5891
41 Ga0075431_100029257 3300006847 Bacteria 5669
42 Ga0075429_100009409 3300006880 Bacteria 8484
43 Ga0079104_1000022 3300006946 Bacteria 223522
44 Ga0079104_1002716 3300006946 Bacteria 9054
45 Ga0099826_10000272 3300006948 Bacteria 22976
46 Ga0099826_10002759 3300006948 Bacteria 11519
47 Ga0111539_10001318 3300009094 Bacteria 33146
48 Ga0111539_10006051 3300009094 Bacteria 15620
49 Ga0105245_10000484 3300009098 Bacteria 36479
50 Ga0114129_10010549 3300009147 Bacteria 13173
51 Ga0105243_10017621 3300009148 Bacteria 5402
52 Ga0105243_10024430 3300009148 Bacteria 4609
53 Ga0105248_10006194 3300009177 Bacteria 13113
54 Ga0105238_10004699 3300009551 Bacteria 13508
55 Ga0105249_10009169 3300009553 Bacteria 8651
56 Ga0105239_10051661 3300010375 Bacteria 4506
57 Ga0105239_10080643 3300010375 Bacteria 3581
58 Ga0157371_10000015 3300013102 Bacteria 339838
59 Ga0157370_10049459 3300013104 Bacteria 4023
60 Ga0157369_10052574 3300013105 Bacteria 4407
61 Ga0171463_1001 3300013249 Bacteria 1406070
62 Ga0157375_10044851 3300013308 Bacteria 4300
63 Ga0163163_10020638 3300014325 Bacteria 6208
64 Ga0183363_1021 3300015690 Bacteria 59303
65 Ga0163161_10010106 3300017792 Bacteria 6532
66 Ga0214544_1000012 3300021320 Bacteria 229808
67 Ga0214544_1000024 3300021320 Bacteria 163562
68 Ga0214542_1000011 3300021321 Bacteria 238260
69 Ga0214542_1000015 3300021321 Bacteria 227912
70 Ga0214543_1000004 3300021327 Bacteria 527190
71 Ga0214543_1000011 3300021327 Bacteria 344093
72 Ga0214543_1000027 3300021327 Bacteria 215065
73 Ga0214543_1000064 3300021327 Bacteria 126778
74 Ga0228711_1000041 3300022739 Bacteria 86591
75 Ga0228711_1000528 3300022739 Bacteria 47804
76 Ga0228710_1000006 3300022740 Bacteria 209134
77 Ga0228710_1000024 3300022740 Bacteria 106694
78 Ga0209436_100423 3300025208 Bacteria 18928
79 Ga0207425_1000012 3300025245 Bacteria 528324
80 Ga0207425_1001797 3300025245 Bacteria 8309
81 Ga0209026_1000024 3300025250 Bacteria 355839
82 Ga0209759_1000389 3300025256 Bacteria 54772
83 Ga0209129_1000081 3300025258 Bacteria 183694
84 Ga0209129_1002837 3300025258 Bacteria 8017
85 Ga0209233_1000084 3300025261 Bacteria 335222
86 Ga0209233_1000129 3300025261 Bacteria 206511
87 Ga0209130_1000005 3300025284 Bacteria 599620
88 Ga0209025_1000024 3300025294 Bacteria 528324
89 Ga0209025_1000094 3300025294 Bacteria 241080
90 Ga0209025_1000188 3300025294 Bacteria 154209
91 Ga0209025_1000295 3300025294 Bacteria 111489
92 Ga0209564_1000093 3300025295 Bacteria 245793
93 Ga0209758_1000046 3300025297 Bacteria 364931
94 Ga0209758_1003983 3300025297 Bacteria 12786
95 Ga0209758_1003989 3300025297 Bacteria 12772
96 Ga0209256_1000027 3300025299 Bacteria 423283
97 Ga0209256_1001266 3300025299 Bacteria 27596
98 Ga0207426_1000015 3300025302 Bacteria 599316
99 Ga0209257_1001158 3300025304 Bacteria 33507
100 Ga0207647_10002906 3300025904 Bacteria 12901
101 Ga0207662_10010396 3300025918 Bacteria 5138
102 Ga0207657_10003799 3300025919 Bacteria 16058
103 Ga0207694_10016895 3300025924 Bacteria 5512
104 Ga0207659_10014359 3300025926 Bacteria 5105
105 Ga0207687_10001011 3300025927 Bacteria 19090
106 Ga0207670_10006436 3300025936 Bacteria 6510
107 Ga0207689_10045741 3300025942 Bacteria 3618
108 Ga0207674_10009454 3300026116 Bacteria 11138
109 Ga0207675_100018195 3300026118 Bacteria 6551
110 Ga0207683_10041425 3300026121 Bacteria 4021
111 Ga0209281_1000036 3300027111 Bacteria 369415
112 Ga0209281_1000047 3300027111 Bacteria 326514
113 Ga0209281_1000200 3300027111 Bacteria 135685
114 Ga0209281_1000268 3300027111 Bacteria 100508
115 Ga0209281_1000409 3300027111 Bacteria 65132
116 Ga0209281_1000578 3300027111 Bacteria 43096
117 Ga0209371_1000021 3300027312 Bacteria 555864
118 Ga0209371_1000698 3300027312 Bacteria 28446
119 Ga0209282_1000026 3300027666 Bacteria 166272
120 Ga0209282_1000090 3300027666 Bacteria 65132
121 Ga0209282_1000300 3300027666 Bacteria 24486
122 Ga0209282_1032110 3300027666 Bacteria 3215
123 Ga0207428_10002517 3300027907 Bacteria 18293
124 Ga0207428_10021721 3300027907 Bacteria 5429
125 Ga0268265_10005830 3300028380 Bacteria 8403
126 Ga0307515_10000674 3300028794 Bacteria 78735
127 Ga0268256_1000020 3300030500 Bacteria 557873
128 Ga0265320_10000928 3300031240 Bacteria 21873
129 Ga0265320_10004959 3300031240 Bacteria 8633
130 Ga0265327_10000428 3300031251 Bacteria 76098
131 Ga0307513_10000180 3300031456 Bacteria 91340
132 Ga0265313_10001410 3300031595 Bacteria 22500
133 Ga0265314_10007331 3300031711 Bacteria 9575
134 Ga0307405_10010850 3300031731 Bacteria 4744
135 Ga0315914_1000008 3300031967 Bacteria 209133
136 Ga0315914_1000167 3300031967 Bacteria 65125
137 Ga0315913_1000038 3300033430 Bacteria 64995
138 Ga0315913_1000137 3300033430 Bacteria 47802
139 Ga0315915_1000014 3300033464 Bacteria 171068
140 Ga0315915_1000019 3300033464 Bacteria 129295
141 Ga0373935_0039226 3300035692 Bacteria 2969
142 Ga0373927_0000347 3300035695 Bacteria 36341
143 Ga0395899_0000440 3300037312 Bacteria 47632
144 Ga0395900_0000509 3300037418 Bacteria 54852
145 Ga0395898_0000908 3300037466 Bacteria 47632
146 Ga0395905_0000623 3300037471 Bacteria 47316
147 Ga0395905_0000700 3300037471 Bacteria 44432
148 Ga0395905_0011190 3300037471 Bacteria 8675
149 Ga0395905_0019540 3300037471 Bacteria 6421
150 Ga0395901_0000142 3300038443 Bacteria 92246
151 Ga0436365_0137793 3300039437 Bacteria 11084
152 Ga0439436_0002688 3300041404 Bacteria 5365
153 Ga0439465_0005556 3300041413 Bacteria 4019
154 Ga0439449_0012907 3300042007 Bacteria 3141
155 Ga0439458_0001040 3300042157 Bacteria 7085
156 Ga0466972_0002327 3300044658 Bacteria 9355
157 Ga0466972_0026360 3300044658 Bacteria 2881
158 Ga0466960_0002841 3300044901 Bacteria 6569
159 Ga0451576_0029340 3300045051 Bacteria 5887
160 Ga0451576_0075068 3300045051 Bacteria 3518
161 Ga0495583_0003339 3300046506 Bacteria 12408
162 Ga0495583_0012156 3300046506 Bacteria 4895
163 Ga0495606_0002572 3300046507 Bacteria 20783
164 Ga0495606_0021775 3300046507 Bacteria 4689
165 Ga0495643_0000582 3300046522 Bacteria 44578
166 Ga0495643_0014326 3300046522 Bacteria 4720
167 Ga0495648_0035494 3300046524 Bacteria 3232
168 Ga0495663_0001308 3300046525 Bacteria 7893
169 Ga0495654_0000486 3300046530 Bacteria 32788
170 Ga0495668_0000401 3300046616 Bacteria 56860
171 Ga0495625_0006085 3300046660 Bacteria 10823
172 Ga0495588_0003135 3300046674 Bacteria 7155
173 Ga0495683_0001945 3300047323 Bacteria 12903
174 Ga0495687_000512 3300047443 Bacteria 46683
175 Ga0495681_0001903 3300047470 Bacteria 15323
176 Ga0495686_0000989 3300047472 Bacteria 34642
177 Ga0495686_0005059 3300047472 Bacteria 10566
178 Ga0496102_0001268 3300048905 Bacteria 22808
179 Ga0496103_0000307 3300048906 Bacteria 45142
180 Ga0496105_0000190 3300048908 Bacteria 41092
181 Ga0496111_0004566 3300048914 Bacteria 8767
182 Ga0496113_0076245 3300048916 Bacteria 2561
183 Ga0496114_0003105 3300048917 Bacteria 12733
184 Ga0496115_0000251 3300048918 Bacteria 47811
185 Ga0496116_0002014 3300048919 Bacteria 21842
186 Ga0496116_0039285 3300048919 Bacteria 3273
187 Ga0496117_0000002 3300048920 Bacteria 2483758
188 Ga0496117_0000182 3300048920 Bacteria 128076
189 Ga0496117_0003603 3300048920 Bacteria 17850
190 Ga0496117_0029463 3300048920 Bacteria 4231
191 Ga0496118_0000125 3300048921 Bacteria 136422
192 Ga0496118_0000355 3300048921 Bacteria 77500
193 Ga0496118_0021287 3300048921 Bacteria 5714
194 Ga0496119_0003199 3300048922 Bacteria 17159
195 Ga0496119_0005531 3300048922 Bacteria 12047
196 Ga0496120_0001026 3300048923 Bacteria 37324
197 Ga0496120_0016215 3300048923 Bacteria 4876
198 Ga0496121_0000001 3300048924 Bacteria 1830318
199 Ga0496121_0000906 3300048924 Bacteria 53394
200 Ga0496121_0018124 3300048924 Bacteria 7123
201 Ga0496121_0022318 3300048924 Bacteria 6150
202 Ga0496121_0025039 3300048924 Bacteria 5681
203 Ga0496122_0000001 3300048925 Bacteria 1827766
204 Ga0496122_0004380 3300048925 Bacteria 17589
205 Ga0496123_0000001 3300048926 Bacteria 1831497
206 Ga0496123_0000544 3300048926 Bacteria 64764
207 Ga0496124_0000082 3300048927 Bacteria 208248
208 Ga0496124_0000112 3300048927 Bacteria 166282
209 Ga0496124_0001589 3300048927 Bacteria 32712
210 Ga0496124_0011598 3300048927 Bacteria 8795
211 Ga0496125_0000001 3300048928 Bacteria 1766138
212 Ga0496125_0000372 3300048928 Bacteria 84272
213 Ga0496125_0000730 3300048928 Bacteria 54485
214 Ga0496126_0000221 3300048929 Bacteria 124193
215 Ga0496126_0004329 3300048929 Bacteria 17037
216 Ga0501031_0021492 3300049568 Bacteria 4206
217 Ga0501031_0021556 3300049568 Bacteria 4200
218 Ga0501032_0007647 3300049569 Bacteria 7880
219 Ga0501033_0000779 3300049570 Bacteria 29299
220 Ga0501033_0032197 3300049570 Bacteria 3937
221 Ga0501037_0000077 3300049573 Bacteria 91081
222 Ga0501037_0024801 3300049573 Bacteria 4434
223 Ga0501043_0000114 3300049579 Bacteria 75782
224 Ga0501046_0018297 3300049580 Bacteria 5833
225 Ga0501047_0016074 3300049581 Bacteria 7137
226 Ga0501047_0021070 3300049581 Bacteria 6259
227 Ga0501069_0000016 3300049585 Bacteria 142565
228 Ga0501069_0037130 3300049585 Bacteria 2688
229 Ga0501070_0000048 3300049586 Bacteria 105951
230 Ga0501070_0010043 3300049586 Bacteria 8010
231 Ga0501073_0005974 3300049589 Bacteria 9083
232 Ga0501074_0001298 3300049590 Bacteria 16571
233 Ga0501080_0001324 3300049742 Bacteria 20643
234 Ga0501081_0040385 3300049743 Bacteria 3195
235 Ga0501083_0002018 3300049744 Bacteria 13963
236 Ga0501083_0015039 3300049744 Bacteria 5416
237 Ga0501035_0000048 3300049822 Bacteria 146466
238 Ga0501035_0005812 3300049822 Bacteria 11629
239 Ga0501035_0008447 3300049822 Bacteria 9591
240 Ga0501044_0000003 3300049823 Bacteria 345647
241 Ga0501044_0008569 3300049823 Bacteria 11203
242 Ga0501044_0012802 3300049823 Bacteria 9085
243 Ga0501044_0019650 3300049823 Bacteria 7221
244 nmdc:mga00v17_188_c1 3300050491 Bacteria 37077
245 nmdc:mga00v17_6_c1 3300050491 Bacteria 179509
246 nmdc:mga0yw44_10639_c1 3300050492 Bacteria 4710
247 nmdc:mga07m45_30643_c1 3300050496 Bacteria 2980
248 nmdc:mga09592_20378_c1 3300050508 Bacteria 5451
249 nmdc:mga09592_3554_c1 3300050508 Bacteria 12587
250 nmdc:mga08y16_571_c2 3300050511 Bacteria 30328
251 Ga0500643_000021 3300053087 Bacteria 284326
252 Ga0500559_0004224 3300053136 Bacteria 6872
253 Ga0500561_0000363 3300053137 Bacteria 7515
254 Ga0500568_0000144 3300053139 Bacteria 62519
255 Ga0500568_0002628 3300053139 Bacteria 10439
256 Ga0500624_000396 3300053157 Bacteria 13695
257 Ga0500636_0000013 3300053177 Bacteria 130122
258 Ga0500636_0018664 3300053177 Bacteria 4101
259 Ga0500596_001274 3300053735 Bacteria 5090
260 Ga0501082_0008571 3300060353 Bacteria 8820
261 Ga0501082_0075746 3300060353 Bacteria 2899

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053177 Ga0500636_0018664 Ga0500636_0018664_1928_4081 639
2 iso_pu_bacteria 2876369609 2876374815 676
3 iso_pu_bacteria 2958158011 2958163989 685
4 iso_pu_bacteria 2906393657 2906399605 689
5 iso_pu_bacteria 2968138860 2968146914 698
6 iso_pu_bacteria 2906354277 2906361279 706
7 3300041413 Ga0439465_0005556 Ga0439465_0005556_1683_3857 707
8 iso_pu_bacteria 2970532167 2970538122 708
9 iso_pu_bacteria 2874109183 2874112222 713
10 3300046525 Ga0495663_0001308 Ga0495663_0001308_2046_4385 715
11 3300046660 Ga0495625_0006085 Ga0495625_0006085_6181_8520 715
12 3300047323 Ga0495683_0001945 Ga0495683_0001945_7816_10155 715
13 3300048916 Ga0496113_0076245 Ga0496113_0076245_16_2355 715
14 3300048928 Ga0496125_0000730 Ga0496125_0000730_14259_16598 715
15 3300048905 Ga0496102_0001268 Ga0496102_0001268_7018_9357 719
16 3300048906 Ga0496103_0000307 Ga0496103_0000307_27389_29728 719
17 3300048908 Ga0496105_0000190 Ga0496105_0000190_37410_39749 719
18 3300048914 Ga0496111_0004566 Ga0496111_0004566_4776_7115 719
19 3300048917 Ga0496114_0003105 Ga0496114_0003105_4683_7022 719
20 3300048918 Ga0496115_0000251 Ga0496115_0000251_8846_11185 719
21 3300048919 Ga0496116_0002014 Ga0496116_0002014_7199_9538 719
22 3300048920 Ga0496117_0000182 Ga0496117_0000182_12533_14872 719
23 3300048921 Ga0496118_0000125 Ga0496118_0000125_113165_115504 719
24 3300048922 Ga0496119_0005531 Ga0496119_0005531_2603_4942 719
25 3300048923 Ga0496120_0016215 Ga0496120_0016215_278_2617 719
26 3300048924 Ga0496121_0000906 Ga0496121_0000906_36780_39119 719
27 3300048927 Ga0496124_0000082 Ga0496124_0000082_20904_23243 719
28 3300048929 Ga0496126_0000221 Ga0496126_0000221_8694_11033 719
29 3300031595 Ga0265313_10001410 Ga0265313_100014106 726
30 3300005548 Ga0070665_100065107 Ga0070665_1000651073 728
31 3300005842 Ga0068858_100018190 Ga0068858_1000181907 729
32 3300053087 Ga0500643_000021 Ga0500643_000021_188522_191026 731
33 3300021320 Ga0214544_1000024 Ga0214544_1000024100 733
34 3300021321 Ga0214542_1000015 Ga0214542_100001585 733
35 3300021327 Ga0214543_1000064 Ga0214543_1000064125 733
36 iso_pu_bacteria 3002141150 3002144651 734
37 3300047443 Ga0495687_000512 Ga0495687_000512_35518_37893 737
38 3300047470 Ga0495681_0001903 Ga0495681_0001903_11608_13983 737
39 3300005327 Ga0070658_10026403 Ga0070658_100264035 739
40 3300005335 Ga0070666_10010803 Ga0070666_100108035 739
41 3300025919 Ga0207657_10003799 Ga0207657_100037996 739
42 3300046507 Ga0495606_0021775 Ga0495606_0021775_660_3041 739
43 3300042007 Ga0439449_0012907 Ga0439449_0012907_700_3066 749
44 3300049744 Ga0501083_0015039 Ga0501083_0015039_1019_3523 755
45 3300006844 Ga0075428_100010266 Ga0075428_10001026610 760
46 3300006847 Ga0075431_100026987 Ga0075431_1000269874 760
47 3300006880 Ga0075429_100009409 Ga0075429_1000094097 760
48 3300009094 Ga0111539_10001318 Ga0111539_1000131832 760
49 3300027907 Ga0207428_10002517 Ga0207428_100025175 760
50 3300050508 nmdc:mga09592_3554_c1 nmdc:mga09592_3554_c1_6024_8555 760
51 3300050511 nmdc:mga08y16_571_c2 nmdc:mga08y16_571_c2_15487_18018 760
52 iso_pu_bacteria 2961127735 2961135832 761
53 iso_pu_bacteria 8004300914 8004303454 762
54 3300031251 Ga0265327_10000428 Ga0265327_1000042843 765
55 3300042157 Ga0439458_0001040 Ga0439458_0001040_3945_6446 765
56 3300046522 Ga0495643_0014326 Ga0495643_0014326_898_3402 765
57 3300053735 Ga0500596_001274 Ga0500596_001274_982_3486 766
58 iso_pu_bacteria 2987673487 2987675137 767
59 3300005327 Ga0070658_10002112 Ga0070658_100021128 768
60 3300005539 Ga0068853_100048465 Ga0068853_1000484651 768
61 3300017792 Ga0163161_10010106 Ga0163161_100101063 768
62 3300025904 Ga0207647_10002906 Ga0207647_100029063 768
63 3300046506 Ga0495583_0012156 Ga0495583_0012156_1065_3563 768
64 3300046524 Ga0495648_0035494 Ga0495648_0035494_555_3053 768
65 3300003214 JGI25165J46597_1000024 JGI25165J46597_1000024176 769
66 3300025261 Ga0209233_1000084 Ga0209233_1000084135 769
67 3300005367 Ga0070667_100007368 Ga0070667_1000073688 770
68 3300005614 Ga0068856_100056117 Ga0068856_1000561172 770
69 3300010375 Ga0105239_10051661 Ga0105239_100516612 770
70 3300013104 Ga0157370_10049459 Ga0157370_100494592 770
71 3300048924 Ga0496121_0000001 Ga0496121_0000001_1251577_1254129 771
72 3300048928 Ga0496125_0000001 Ga0496125_0000001_1410657_1413209 771
73 3300009147 Ga0114129_10010549 Ga0114129_100105497 773
74 3300050508 nmdc:mga09592_20378_c1 nmdc:mga09592_20378_c1_1973_4513 773
75 3300044658 Ga0466972_0002327 Ga0466972_0002327_3098_5572 774
76 3300044901 Ga0466960_0002841 Ga0466960_0002841_2623_5097 774
77 3300053139 Ga0500568_0002628 Ga0500568_0002628_4635_7151 774
78 3300031240 Ga0265320_10004959 Ga0265320_100049595 775
79 3300049573 Ga0501037_0024801 Ga0501037_0024801_1643_4147 775
80 3300049580 Ga0501046_0018297 Ga0501046_0018297_2799_5303 775
81 3300049581 Ga0501047_0016074 Ga0501047_0016074_1595_4099 775
82 3300049823 Ga0501044_0008569 Ga0501044_0008569_7246_9750 775
83 3300048921 Ga0496118_0021287 Ga0496118_0021287_854_3406 778
84 3300046522 Ga0495643_0000582 Ga0495643_0000582_3385_5889 779
85 3300048920 Ga0496117_0029463 Ga0496117_0029463_1382_3934 779
86 3300049743 Ga0501081_0040385 Ga0501081_0040385_26_2590 779
87 3300060353 Ga0501082_0075746 Ga0501082_0075746_86_2650 779
88 3300013105 Ga0157369_10052574 Ga0157369_100525742 780
89 3300026121 Ga0207683_10041425 Ga0207683_100414252 780
90 3300046616 Ga0495668_0000401 Ga0495668_0000401_2272_4776 780
91 3300046506 Ga0495583_0003339 Ga0495583_0003339_17_2563 781
92 3300046507 Ga0495606_0002572 Ga0495606_0002572_10923_13484 781
93 3300047472 Ga0495686_0000989 Ga0495686_0000989_7468_10029 781
94 3300009098 Ga0105245_10000484 Ga0105245_1000048419 782
95 3300025927 Ga0207687_10001011 Ga0207687_1000101116 782
96 3300021327 Ga0214543_1000011 Ga0214543_1000011321 786
97 3300037471 Ga0395905_0011190 Ga0395905_0011190_1344_3902 786
98 3300005343 Ga0070687_100006273 Ga0070687_1000062733 787
99 3300005354 Ga0070675_100002511 Ga0070675_10000251110 787
100 3300005365 Ga0070688_100012857 Ga0070688_1000128574 787
101 3300005544 Ga0070686_100005252 Ga0070686_1000052522 787
102 3300005564 Ga0070664_100015904 Ga0070664_1000159045 787
103 3300005618 Ga0068864_100001849 Ga0068864_10000184916 787
104 3300005719 Ga0068861_100029782 Ga0068861_1000297822 787
105 3300005841 Ga0068863_100002703 Ga0068863_10000270313 787
106 3300005844 Ga0068862_100030879 Ga0068862_1000308795 787
107 3300009148 Ga0105243_10024430 Ga0105243_100244302 787
108 3300013308 Ga0157375_10044851 Ga0157375_100448512 787
109 3300014325 Ga0163163_10020638 Ga0163163_100206384 787
110 3300025918 Ga0207662_10010396 Ga0207662_100103963 787
111 3300025926 Ga0207659_10014359 Ga0207659_100143596 787
112 3300025942 Ga0207689_10045741 Ga0207689_100457412 787
113 3300026116 Ga0207674_10009454 Ga0207674_100094543 787
114 3300026118 Ga0207675_100018195 Ga0207675_1000181953 787
115 iso_pu_bacteria 2871474448 2871475204 787
116 3300053136 Ga0500559_0004224 Ga0500559_0004224_2637_5195 788
117 3300003856 Ga0058692_1001496 Ga0058692_10014963 789
118 3300027312 Ga0209371_1000698 Ga0209371_100069816 789
119 3300046674 Ga0495588_0003135 Ga0495588_0003135_3257_5818 789
120 3300003187 JGI25151J46595_10006775 JGI25151J46595_100067753 790
121 3300006948 Ga0099826_10000272 Ga0099826_100002728 790
122 3300006948 Ga0099826_10002759 Ga0099826_100027596 790
123 3300009148 Ga0105243_10017621 Ga0105243_100176212 790
124 3300013102 Ga0157371_10000015 Ga0157371_1000001583 790
125 3300022739 Ga0228711_1000528 Ga0228711_100052822 790
126 3300022740 Ga0228710_1000006 Ga0228710_1000006157 790
127 3300025294 Ga0209025_1000094 Ga0209025_100009488 790
128 3300027111 Ga0209281_1000268 Ga0209281_100026870 790
129 3300027111 Ga0209281_1000578 Ga0209281_100057816 790
130 3300027312 Ga0209371_1000021 Ga0209371_100002168 790
131 3300027666 Ga0209282_1000026 Ga0209282_1000026117 790
132 3300027666 Ga0209282_1000300 Ga0209282_100030018 790
133 3300027666 Ga0209282_1032110 Ga0209282_10321102 790
134 3300030500 Ga0268256_1000020 Ga0268256_100002074 790
135 3300031967 Ga0315914_1000008 Ga0315914_1000008156 790
136 3300033430 Ga0315913_1000137 Ga0315913_100013722 790
137 3300033464 Ga0315915_1000014 Ga0315915_100001420 790
138 3300048920 Ga0496117_0000002 Ga0496117_0000002_1040142_1042706 790
139 3300048921 Ga0496118_0000355 Ga0496118_0000355_39535_42099 790
140 3300048923 Ga0496120_0001026 Ga0496120_0001026_4854_7418 790
141 3300048925 Ga0496122_0000001 Ga0496122_0000001_346596_349160 790
142 3300048926 Ga0496123_0000001 Ga0496123_0000001_350327_352891 790
143 3300048927 Ga0496124_0011598 Ga0496124_0011598_3221_5785 790
144 3300050491 nmdc:mga00v17_6_c1 nmdc:mga00v17_6_c1_106543_109107 790
145 3300050492 nmdc:mga0yw44_10639_c1 nmdc:mga0yw44_10639_c1_1443_4007 790
146 3300053137 Ga0500561_0000363 Ga0500561_0000363_3763_6327 790
147 3300053157 Ga0500624_000396 Ga0500624_000396_6278_8839 790
148 3300025258 Ga0209129_1002837 Ga0209129_10028371 791
149 3300049568 Ga0501031_0021492 Ga0501031_0021492_1331_3895 791
150 3300049569 Ga0501032_0007647 Ga0501032_0007647_3113_5677 791
151 3300049570 Ga0501033_0000779 Ga0501033_0000779_5299_7863 791
152 3300049573 Ga0501037_0000077 Ga0501037_0000077_43726_46290 791
153 3300049579 Ga0501043_0000114 Ga0501043_0000114_2078_4642 791
154 3300049585 Ga0501069_0000016 Ga0501069_0000016_71580_74144 791
155 3300049586 Ga0501070_0000048 Ga0501070_0000048_93475_96039 791
156 3300049589 Ga0501073_0005974 Ga0501073_0005974_715_3279 791
157 3300049590 Ga0501074_0001298 Ga0501074_0001298_6569_9133 791
158 3300049742 Ga0501080_0001324 Ga0501080_0001324_4697_7261 791
159 3300049744 Ga0501083_0002018 Ga0501083_0002018_4821_7385 791
160 3300049822 Ga0501035_0000048 Ga0501035_0000048_105232_107796 791
161 3300049823 Ga0501044_0000003 Ga0501044_0000003_146182_148746 791
162 3300060353 Ga0501082_0008571 Ga0501082_0008571_5818_8382 791
163 3300006844 Ga0075428_100071853 Ga0075428_1000718533 792
164 3300006846 Ga0075430_100021269 Ga0075430_1000212696 792
165 3300006847 Ga0075431_100029257 Ga0075431_1000292573 792
166 3300031240 Ga0265320_10000928 Ga0265320_1000092816 792
167 3300031711 Ga0265314_10007331 Ga0265314_100073313 792
168 3300049570 Ga0501033_0032197 Ga0501033_0032197_1422_3926 792
169 3300049823 Ga0501044_0019650 Ga0501044_0019650_167_2731 792
170 iso_pu_bacteria 641228493 641335679 792
171 iso_pu_bacteria 643348555 643664219 792
172 3300047472 Ga0495686_0005059 Ga0495686_0005059_5265_7826 793
173 3300006946 Ga0079104_1002716 Ga0079104_10027166 794
174 3300022739 Ga0228711_1000041 Ga0228711_100004126 794
175 3300022740 Ga0228710_1000024 Ga0228710_100002453 794
176 3300027111 Ga0209281_1000409 Ga0209281_100040952 794
177 3300027666 Ga0209282_1000090 Ga0209282_100009052 794
178 3300031967 Ga0315914_1000167 Ga0315914_100016712 794
179 3300033430 Ga0315913_1000038 Ga0315913_100003812 794
180 3300033464 Ga0315915_1000019 Ga0315915_100001952 794
181 3300048922 Ga0496119_0003199 Ga0496119_0003199_12760_15294 794
182 3300053139 Ga0500568_0000144 Ga0500568_0000144_1645_4206 794
183 3300003856 Ga0058692_1000760 Ga0058692_10007608 795
184 3300037471 Ga0395905_0000700 Ga0395905_0000700_35931_38495 795
185 3300021327 Ga0214543_1000027 Ga0214543_1000027195 796
186 3300037312 Ga0395899_0000440 Ga0395899_0000440_31640_34204 796
187 3300037418 Ga0395900_0000509 Ga0395900_0000509_13429_15993 796
188 3300037466 Ga0395898_0000908 Ga0395898_0000908_13429_15993 796
189 3300037471 Ga0395905_0000623 Ga0395905_0000623_13429_15993 796
190 3300038443 Ga0395901_0000142 Ga0395901_0000142_13429_15993 796
191 3300048924 Ga0496121_0018124 Ga0496121_0018124_4554_7082 796
192 3300048927 Ga0496124_0000112 Ga0496124_0000112_7047_9611 796
193 3300035692 Ga0373935_0039226 Ga0373935_0039226_31_2580 798
194 3300035695 Ga0373927_0000347 Ga0373927_0000347_14876_17425 798
195 3300039437 Ga0436365_0137793 Ga0436365_0137793_2558_5104 798
196 iso_pu_bacteria 2522572158 2523104386 798
197 iso_pu_bacteria 2924710171 2924714298 798
198 3300005340 Ga0070689_100001628 Ga0070689_1000016283 799
199 3300005844 Ga0068862_100000218 Ga0068862_10000021821 799
200 3300009094 Ga0111539_10006051 Ga0111539_100060516 799
201 3300009177 Ga0105248_10006194 Ga0105248_1000619414 799
202 3300009553 Ga0105249_10009169 Ga0105249_100091692 799
203 3300010375 Ga0105239_10080643 Ga0105239_100806433 799
204 3300025936 Ga0207670_10006436 Ga0207670_100064363 799
205 3300027907 Ga0207428_10021721 Ga0207428_100217214 799
206 3300028380 Ga0268265_10005830 Ga0268265_100058306 799
207 3300045051 Ga0451576_0075068 Ga0451576_0075068_275_2806 799
208 3300048920 Ga0496117_0003603 Ga0496117_0003603_4939_7467 799
209 3300048926 Ga0496123_0000544 Ga0496123_0000544_38750_41278 799
210 3300049568 Ga0501031_0021556 Ga0501031_0021556_421_2949 800
211 iso_pu_bacteria 2818991461 2819684796 800
212 3300046530 Ga0495654_0000486 Ga0495654_0000486_1275_3785 801
213 3300048927 Ga0496124_0001589 Ga0496124_0001589_9781_12309 801
214 iso_pu_bacteria 2979793036 2979798731 801
215 3300003187 JGI25151J46595_10014745 JGI25151J46595_100147452 802
216 3300025294 Ga0209025_1000188 Ga0209025_100018819 802
217 3300048928 Ga0496125_0000372 Ga0496125_0000372_57880_60417 802
218 iso_pu_bacteria 2996336353 2996340798 802
219 3300027111 Ga0209281_1000200 Ga0209281_1000200119 803
220 3300041404 Ga0439436_0002688 Ga0439436_0002688_416_2947 803
221 iso_pu_bacteria 2582581304 2585256001 803
222 iso_pu_bacteria 2821123053 2821127966 803
223 iso_pu_bacteria 2838736955 2838738378 803
224 iso_pu_bacteria 2841840854 2841841253 803
225 iso_pu_bacteria 2842140634 2842141031 803
226 iso_pu_bacteria 2857531043 2857535008 803
227 3300048929 Ga0496126_0004329 Ga0496126_0004329_9510_12047 804
228 iso_pu_bacteria 2524023250 2524612706 804
229 iso_pu_bacteria 2585427594 2585844118 804
230 iso_pu_bacteria 2599185236 2599721448 804
231 iso_pu_bacteria 2738541293 2738801329 804
232 iso_pu_bacteria 2775506902 2776270719 804
233 iso_pu_bacteria 2775506904 2776280458 804
234 iso_pu_bacteria 2894652903 2894656093 804
235 3300053177 Ga0500636_0000013 Ga0500636_0000013_16435_18999 805
236 iso_pu_bacteria 2582581299 2585229731 805
237 iso_pu_bacteria 2599185156 2599332887 805
238 iso_pu_bacteria 2643221634 2644190486 805
239 iso_pu_bacteria 2643221637 2644206894 805
240 iso_pu_bacteria 2643221718 2644650542 805
241 iso_pu_bacteria 2751185800 2753359672 805
242 iso_pu_bacteria 2758568016 2758641931 805
243 iso_pu_bacteria 2842922631 2842923178 805
244 iso_pu_bacteria 2854911287 2854912294 805
245 iso_pu_bacteria 2913295892 2913298114 805
246 iso_pu_bacteria 2915650412 2915653061 805
247 iso_pu_bacteria 3003930520 3003932829 805
248 iso_pu_bacteria 2511231027 2511389745 806
249 iso_pu_bacteria 2513237159 2513996632 806
250 iso_pu_bacteria 2534681786 2535485034 806
251 iso_pu_bacteria 2582581283 2585164797 806
252 iso_pu_bacteria 2582581866 2585392046 806
253 iso_pu_bacteria 2643221607 2644047337 806
254 iso_pu_bacteria 2643221636 2644199755 806
255 iso_pu_bacteria 2643221686 2644480126 806
256 iso_pu_bacteria 2643221688 2644492649 806
257 iso_pu_bacteria 2643221689 2644496925 806
258 iso_pu_bacteria 2738543024 2739305736 806
259 iso_pu_bacteria 2757320392 2757569645 806
260 iso_pu_bacteria 2765235802 2765464745 806
261 iso_pu_bacteria 2839993093 2839996905 806
262 iso_pu_bacteria 2840764183 2840767518 806
263 iso_pu_bacteria 2842521101 2842521561 806
264 iso_pu_bacteria 2842871566 2842871841 806
265 iso_pu_bacteria 2904578770 2904580732 806
266 iso_pu_bacteria 2919119836 2919121553 806
267 iso_pu_bacteria 2928521798 2928523776 806
268 iso_pu_bacteria 8002285264 8002289816 806
269 3300006946 Ga0079104_1000022 Ga0079104_100002293 807
270 3300027111 Ga0209281_1000036 Ga0209281_1000036371 807
271 3300027111 Ga0209281_1000047 Ga0209281_1000047313 807
272 iso_pu_bacteria 2508501122 2509111739 807
273 iso_pu_bacteria 2509276019 2509375127 807
274 iso_pu_bacteria 2510065057 2510303520 807
275 iso_pu_bacteria 2511231052 2511500318 807
276 iso_pu_bacteria 2512047086 2512531852 807
277 iso_pu_bacteria 2512875026 2512972889 807
278 iso_pu_bacteria 2513237086 2513582269 807
279 iso_pu_bacteria 2513237089 2513602775 807
280 iso_pu_bacteria 2513237091 2513616615 807
281 iso_pu_bacteria 2513237140 2513885764 807
282 iso_pu_bacteria 2513237143 2513903953 807
283 iso_pu_bacteria 2513237156 2513985793 807
284 iso_pu_bacteria 2513237160 2514005039 807
285 iso_pu_bacteria 2515154107 2515607593 807
286 iso_pu_bacteria 2516143018 2516204464 807
287 iso_pu_bacteria 2516653046 2516891720 807
288 iso_pu_bacteria 2517487022 2517568496 807
289 iso_pu_bacteria 2524023207 2524450675 807
290 iso_pu_bacteria 2551306084 2551677012 807
291 iso_pu_bacteria 2551306085 2551686609 807
292 iso_pu_bacteria 2551306086 2551696107 807
293 iso_pu_bacteria 2551306087 2551699714 807
294 iso_pu_bacteria 2551306093 2551746183 807
295 iso_pu_bacteria 2558860100 2558866230 807
296 iso_pu_bacteria 2582581306 2585265175 807
297 iso_pu_bacteria 2582581865 2585385692 807
298 iso_pu_bacteria 2599185352 2600191263 807
299 iso_pu_bacteria 2643221723 2644671838 807
300 iso_pu_bacteria 2657244999 2657686347 807
301 iso_pu_bacteria 2690316117 2692317421 807
302 iso_pu_bacteria 2751185821 2753462574 807
303 iso_pu_bacteria 2767802442 2770195333 807
304 iso_pu_bacteria 2791355082 2792583044 807
305 iso_pu_bacteria 2791355091 2792621283 807
306 iso_pu_bacteria 2791355092 2792625498 807
307 iso_pu_bacteria 2791355094 2792637932 807
308 iso_pu_bacteria 2791355253 2793282133 807
309 iso_pu_bacteria 2802428858 2802718458 807
310 iso_pu_bacteria 2802428859 2802726281 807
311 iso_pu_bacteria 2802428860 2802731565 807
312 iso_pu_bacteria 2802428861 2802740805 807
313 iso_pu_bacteria 2802428862 2802742459 807
314 iso_pu_bacteria 2802428863 2802749165 807
315 iso_pu_bacteria 2802429268 2804750797 807
316 iso_pu_bacteria 2838074704 2838075219 807
317 iso_pu_bacteria 2842333319 2842333452 807
318 iso_pu_bacteria 2847417321 2847417512 807
319 iso_pu_bacteria 2848992105 2848992346 807
320 iso_pu_bacteria 2850079185 2850079851 807
321 iso_pu_bacteria 2855825444 2855828089 807
322 iso_pu_bacteria 2855839649 2855839860 807
323 iso_pu_bacteria 2855872281 2855873515 807
324 iso_pu_bacteria 2858800743 2858803834 807
325 iso_pu_bacteria 2896384573 2896389078 807
326 iso_pu_bacteria 2915980308 2915983986 807
327 iso_pu_bacteria 2915986958 2915990718 807
328 iso_pu_bacteria 2915993759 2915997134 807
329 iso_pu_bacteria 2916000859 2916000960 807
330 iso_pu_bacteria 2916007675 2916011145 807
331 iso_pu_bacteria 2916014648 2916021321 807
332 iso_pu_bacteria 2916021584 2916022016 807
333 iso_pu_bacteria 2916028427 2916034049 807
334 iso_pu_bacteria 2916035215 2916036377 807
335 iso_pu_bacteria 2916041962 2916048440 807
336 iso_pu_bacteria 2916048683 2916053692 807
337 iso_pu_bacteria 2916055098 2916056908 807
338 iso_pu_bacteria 2916061851 2916064754 807
339 iso_pu_bacteria 2916068649 2916075145 807
340 iso_pu_bacteria 2916076590 2916083305 807
341 iso_pu_bacteria 2920760137 2920763525 807
342 iso_pu_bacteria 2921201388 2921206784 807
343 iso_pu_bacteria 2921208531 2921214551 807
344 iso_pu_bacteria 2921237296 2921241553 807
345 iso_pu_bacteria 2921244191 2921247132 807
346 iso_pu_bacteria 2921250672 2921254426 807
347 iso_pu_bacteria 2921257292 2921262865 807
348 iso_pu_bacteria 2921263974 2921268654 807
349 iso_pu_bacteria 2921282425 2921282872 807
350 iso_pu_bacteria 2921289301 2921291726 807
351 iso_pu_bacteria 2921296804 2921298689 807
352 iso_pu_bacteria 2924144063 2924150796 807
353 iso_pu_bacteria 2924150972 2924156639 807
354 iso_pu_bacteria 2924158325 2924160349 807
355 iso_pu_bacteria 2924165586 2924170699 807
356 iso_pu_bacteria 2924172951 2924176816 807
357 iso_pu_bacteria 2924179722 2924183613 807
358 iso_pu_bacteria 2924186466 2924190841 807
359 iso_pu_bacteria 2924193448 2924199023 807
360 iso_pu_bacteria 2924200457 2924200891 807
361 iso_pu_bacteria 2924207177 2924209185 807
362 iso_pu_bacteria 2924214083 2924218524 807
363 iso_pu_bacteria 2924221636 2924228008 807
364 iso_pu_bacteria 2924228884 2924232783 807
365 iso_pu_bacteria 2936996657 2936997798 807
366 iso_pu_bacteria 2937002841 2937007672 807
367 iso_pu_bacteria 2937009748 2937014921 807
368 iso_pu_bacteria 2937016420 2937022335 807
369 iso_pu_bacteria 2937023124 2937023341 807
370 iso_pu_bacteria 2937029754 2937034664 807
371 iso_pu_bacteria 2937036028 2937039758 807
372 iso_pu_bacteria 2937042894 2937044891 807
373 iso_pu_bacteria 2937049772 2937051771 807
374 iso_pu_bacteria 2937056579 2937062699 807
375 iso_pu_bacteria 2937063883 2937064205 807
376 iso_pu_bacteria 2937071275 2937072842 807
377 iso_pu_bacteria 2937078374 2937078876 807
378 iso_pu_bacteria 2937084907 2937087611 807
379 iso_pu_bacteria 2937091812 2937094942 807
380 iso_pu_bacteria 2937098957 2937099850 807
381 iso_pu_bacteria 2937106411 2937112466 807
382 iso_pu_bacteria 2937113482 2937119507 807
383 iso_pu_bacteria 2937119839 2937126155 807
384 iso_pu_bacteria 2937126314 2937131578 807
385 iso_pu_bacteria 2957375807 2957379830 807
386 iso_pu_bacteria 2957382221 2957388641 807
387 iso_pu_bacteria 2957388812 2957393415 807
388 iso_pu_bacteria 2957395598 2957400244 807
389 iso_pu_bacteria 2957402308 2957403856 807
390 iso_pu_bacteria 2957408893 2957413734 807
391 iso_pu_bacteria 2957415311 2957418081 807
392 iso_pu_bacteria 2957430029 2957436923 807
393 iso_pu_bacteria 2957437181 2957443638 807
394 iso_pu_bacteria 2957443900 2957447261 807
395 iso_pu_bacteria 2957450854 2957451184 807
396 iso_pu_bacteria 2957457609 2957460216 807
397 iso_pu_bacteria 2957464669 2957469611 807
398 iso_pu_bacteria 2957471148 2957473559 807
399 iso_pu_bacteria 2957478035 2957482041 807
400 iso_pu_bacteria 2957484790 2957484866 807
401 iso_pu_bacteria 2957491536 2957492141 807
402 iso_pu_bacteria 2957498199 2957500632 807
403 iso_pu_bacteria 2957505466 2957508160 807
404 iso_pu_bacteria 2960584000 2960586123 807
405 iso_pu_bacteria 2960591022 2960594631 807
406 iso_pu_bacteria 2960597568 2960603419 807
407 iso_pu_bacteria 2960603979 2960607773 807
408 iso_pu_bacteria 2960610863 2960611760 807
409 iso_pu_bacteria 2960617483 2960621563 807
410 iso_pu_bacteria 2960624210 2960626807 807
411 iso_pu_bacteria 2960631154 2960635012 807
412 iso_pu_bacteria 2960637947 2960643446 807
413 iso_pu_bacteria 2960645483 2960648050 807
414 iso_pu_bacteria 2960652885 2960660077 807
415 iso_pu_bacteria 2960660292 2960660545 807
416 iso_pu_bacteria 2960667422 2960672219 807
417 iso_pu_bacteria 2960674078 2960679569 807
418 iso_pu_bacteria 2960680706 2960684681 807
419 iso_pu_bacteria 2960687367 2960687540 807
420 iso_pu_bacteria 2960693952 2960694546 807
421 iso_pu_bacteria 2964607997 2964610223 807
422 iso_pu_bacteria 2964615318 2964618461 807
423 iso_pu_bacteria 2964621998 2964625404 807
424 iso_pu_bacteria 2964628898 2964633820 807
425 iso_pu_bacteria 2964636051 2964639080 807
426 iso_pu_bacteria 2964643177 2964649348 807
427 iso_pu_bacteria 2964649959 2964650198 807
428 iso_pu_bacteria 2964656573 2964663046 807
429 iso_pu_bacteria 2964663802 2964668128 807
430 iso_pu_bacteria 2964678106 2964683426 807
431 iso_pu_bacteria 2964685014 2964689624 807
432 iso_pu_bacteria 2964691889 2964694744 807
433 iso_pu_bacteria 2964698721 2964700526 807
434 iso_pu_bacteria 2964705432 2964710170 807
435 iso_pu_bacteria 2964712639 2964717254 807
436 iso_pu_bacteria 2964719344 2964722066 807
437 iso_pu_bacteria 2967664464 2967670558 807
438 iso_pu_bacteria 2967678726 2967680899 807
439 iso_pu_bacteria 2967686174 2967689634 807
440 iso_pu_bacteria 2967693043 2967694936 807
441 iso_pu_bacteria 2967706974 2967712266 807
442 iso_pu_bacteria 2967714385 2967714530 807
443 iso_pu_bacteria 2967721400 2967723478 807
444 iso_pu_bacteria 2967728569 2967730423 807
445 iso_pu_bacteria 2967735183 2967739280 807
446 iso_pu_bacteria 2967748971 2967754918 807
447 iso_pu_bacteria 2967755722 2967762025 807
448 iso_pu_bacteria 2967762386 2967766523 807
449 iso_pu_bacteria 2967769361 2967769972 807
450 iso_pu_bacteria 2967775926 2967778005 807
451 iso_pu_bacteria 2970019648 2970025160 807
452 iso_pu_bacteria 2970026789 2970030924 807
453 iso_pu_bacteria 2970033650 2970037079 807
454 iso_pu_bacteria 2970040964 2970041147 807
455 iso_pu_bacteria 2970047711 2970050726 807
456 iso_pu_bacteria 2970054988 2970056817 807
457 iso_pu_bacteria 2970061556 2970062707 807
458 iso_pu_bacteria 2970068827 2970075362 807
459 iso_pu_bacteria 2970076120 2970081751 807
460 iso_pu_bacteria 2970082768 2970088416 807
461 iso_pu_bacteria 2970088815 2970089533 807
462 iso_pu_bacteria 2970095765 2970101942 807
463 iso_pu_bacteria 2970102677 2970105952 807
464 iso_pu_bacteria 2970109326 2970115725 807
465 iso_pu_bacteria 2970116247 2970117590 807
466 iso_pu_bacteria 2970122695 2970124255 807
467 iso_pu_bacteria 2970129317 2970131434 807
468 iso_pu_bacteria 2970136068 2970141008 807
469 iso_pu_bacteria 2970143518 2970144313 807
470 iso_pu_bacteria 2970149975 2970154440 807
471 iso_pu_bacteria 2970156795 2970161284 807
472 iso_pu_bacteria 2970164137 2970170085 807
473 iso_pu_bacteria 2970170962 2970175793 807
474 iso_pu_bacteria 2970177841 2970184223 807
475 iso_pu_bacteria 2970184632 2970190861 807
476 iso_pu_bacteria 2970191845 2970197421 807
477 iso_pu_bacteria 2977516862 2977519060 807
478 iso_pu_bacteria 2977523885 2977528578 807
479 iso_pu_bacteria 2977530762 2977532582 807
480 iso_pu_bacteria 2977537788 2977543832 807
481 iso_pu_bacteria 2977544691 2977551627 807
482 iso_pu_bacteria 2977551784 2977553429 807
483 iso_pu_bacteria 2977558990 2977563694 807
484 iso_pu_bacteria 2977565890 2977571768 807
485 iso_pu_bacteria 2977572785 2977574651 807
486 iso_pu_bacteria 2977579622 2977584471 807
487 iso_pu_bacteria 2989349275 2989354018 807
488 iso_pu_bacteria 643692032 643824409 807
489 iso_pu_bacteria 648276728 648738483 807
490 iso_pu_bacteria 8003992118 8003992314 807
491 iso_pu_bacteria 8003999396 8003999578 807
492 iso_pu_bacteria 8049293176 8049293350 807
493 3300002774 JGI25150J39212_1000225 JGI25150J39212_10002253 808
494 3300003187 JGI25151J46595_10000025 JGI25151J46595_1000002539 808
495 3300025245 Ga0207425_1000012 Ga0207425_1000012202 808
496 3300025258 Ga0209129_1000081 Ga0209129_1000081159 808
497 3300025294 Ga0209025_1000024 Ga0209025_1000024202 808
498 3300025297 Ga0209758_1000046 Ga0209758_1000046340 808
499 3300031731 Ga0307405_10010850 Ga0307405_100108502 808
500 3300048919 Ga0496116_0039285 Ga0496116_0039285_197_2737 808
501 3300048924 Ga0496121_0025039 Ga0496121_0025039_133_2673 808
502 3300048925 Ga0496122_0004380 Ga0496122_0004380_10317_12857 808
503 iso_pu_bacteria 2513237144 2513910264 808
504 iso_pu_bacteria 2582581298 2585223673 808
505 iso_pu_bacteria 2585427529 2585545731 808
506 iso_pu_bacteria 2643221557 2643806154 808
507 iso_pu_bacteria 2643221610 2644070293 808
508 iso_pu_bacteria 2643221618 2644103426 808
509 iso_pu_bacteria 2643221626 2644144306 808
510 iso_pu_bacteria 2643221655 2644306356 808
511 iso_pu_bacteria 2643221659 2644330546 808
512 iso_pu_bacteria 2643221668 2644377416 808
513 iso_pu_bacteria 2643221675 2644421055 808
514 iso_pu_bacteria 2643221680 2644454578 808
515 iso_pu_bacteria 2643221698 2644542651 808
516 iso_pu_bacteria 2643221712 2644611967 808
517 iso_pu_bacteria 2643221726 2644692517 808
518 iso_pu_bacteria 2844163670 2844165124 808
519 iso_pu_bacteria 2891373044 2891377171 808
520 iso_pu_bacteria 2919100787 2919101442 808
521 iso_pu_bacteria 2920822456 2920823245 808
522 iso_pu_bacteria 2941499720 2941500851 808
523 iso_pu_bacteria 2989771324 2989772270 808
524 iso_pu_bacteria 2996310559 2996314142 808
525 3300005262 Ga0065165_1002726 Ga0065165_100272611 809
526 3300006051 Ga0075364_10000233 Ga0075364_1000023323 809
527 3300021320 Ga0214544_1000012 Ga0214544_10000127 809
528 3300021321 Ga0214542_1000011 Ga0214542_100001119 809
529 3300021327 Ga0214543_1000004 Ga0214543_1000004481 809
530 3300028794 Ga0307515_10000674 Ga0307515_1000067459 809
531 3300031456 Ga0307513_10000180 Ga0307513_1000018050 809
532 3300045051 Ga0451576_0029340 Ga0451576_0029340_712_3276 809
533 3300050491 nmdc:mga00v17_188_c1 nmdc:mga00v17_188_c1_21152_23689 809
534 iso_pu_bacteria 2551306090 2551718787 809
535 iso_pu_bacteria 2878730984 2878738351 809
536 iso_pu_bacteria 8054558443 8054559039 809
537 3300048924 Ga0496121_0022318 Ga0496121_0022318_2089_4632 810
538 iso_pu_bacteria 2513237146 2513929774 810
539 iso_pu_bacteria 2551306091 2551730030 810
540 iso_pu_bacteria 2599185170 2599419277 810
541 iso_pu_bacteria 2838035591 2838037038 810
542 iso_pu_bacteria 2838661181 2838663785 810
543 3300002987 JGI25159J45721_1000003 JGI25159J45721_1000003220 811
544 3300003354 JGI25160J50197_1000003 JGI25160J50197_1000003401 811
545 3300003794 Ga0055531_10000750 Ga0055531_1000075016 811
546 3300004625 Ga0055543_1001796 Ga0055543_10017963 811
547 3300005262 Ga0065165_1000084 Ga0065165_100008477 811
548 3300025208 Ga0209436_100423 Ga0209436_10042312 811
549 3300025284 Ga0209130_1000005 Ga0209130_100000576 811
550 3300025294 Ga0209025_1000295 Ga0209025_100029532 811
551 3300025295 Ga0209564_1000093 Ga0209564_100009379 811
552 3300025299 Ga0209256_1001266 Ga0209256_100126625 811
553 3300025302 Ga0207426_1000015 Ga0207426_1000015523 811
554 3300025304 Ga0209257_1001158 Ga0209257_100115810 811
555 iso_pu_bacteria 2551306089 2551710367 811
556 iso_pu_bacteria 2551306092 2551735605 811
557 3300003775 Ga0055524_1001620 Ga0055524_10016205 812
558 3300013249 Ga0171463_1001 Ga0171463_1001886 812
559 3300015690 Ga0183363_1021 Ga0183363_102169 812
560 3300025245 Ga0207425_1001797 Ga0207425_10017977 812
561 3300025297 Ga0209758_1003983 Ga0209758_100398310 812
562 3300025297 Ga0209758_1003989 Ga0209758_100398911 812
563 3300025299 Ga0209256_1000027 Ga0209256_1000027335 812
564 iso_pu_bacteria 2967671571 2967676673 812
565 3300049581 Ga0501047_0021070 Ga0501047_0021070_642_3206 818
566 3300049585 Ga0501069_0037130 Ga0501069_0037130_73_2637 818
567 3300049586 Ga0501070_0010043 Ga0501070_0010043_4953_7517 818
568 3300049822 Ga0501035_0008447 Ga0501035_0008447_5536_8100 818
569 3300049823 Ga0501044_0012802 Ga0501044_0012802_941_3505 818
570 3300050496 nmdc:mga07m45_30643_c1 nmdc:mga07m45_30643_c1_14_2521 820
571 iso_pu_bacteria 2937861824 2937864988 820
572 iso_pu_bacteria 2977828996 2977832119 824
573 iso_pu_bacteria 2838074704 2838079401 825
574 iso_pu_bacteria 2791355094 2792642677 826
575 iso_pu_bacteria 2941499720 2941499747 826
576 iso_pu_bacteria 643692032 643825585 826
577 3300049822 Ga0501035_0005812 Ga0501035_0005812_3888_6455 827
578 iso_pu_bacteria 2881861095 2881867992 827
579 iso_pu_bacteria 2896384573 2896387067 827
580 iso_pu_bacteria 2643221618 2644109448 828
581 iso_pu_bacteria 2643221626 2644145133 828
582 iso_pu_bacteria 2643221655 2644307713 828
583 iso_pu_bacteria 2643221659 2644332489 828
584 iso_pu_bacteria 2643221698 2644544236 828
585 iso_pu_bacteria 2643221712 2644613802 828
586 iso_pu_bacteria 2844163670 2844170323 828
587 iso_pu_bacteria 2920760137 2920765655 828
588 iso_pu_bacteria 2837651117 2837652956 829
589 iso_pu_bacteria 2996336353 2996341130 829
590 iso_pu_bacteria 3000135777 3000140156 829
591 iso_pu_bacteria 8018150411 8018155715 829
592 iso_pu_bacteria 2503198000 2503202035 830
593 iso_pu_bacteria 2508501123 2509115588 830
594 iso_pu_bacteria 2509276018 2509371206 830
595 iso_pu_bacteria 2509276022 2509396697 830
596 iso_pu_bacteria 2510065059 2510313863 830
597 iso_pu_bacteria 2512875016 2512931077 830
598 iso_pu_bacteria 2512875024 2512958795 830
599 iso_pu_bacteria 2513237164 2514037648 830
600 iso_pu_bacteria 2513237351 2514590313 830
601 iso_pu_bacteria 2588253730 2588516835 830
602 iso_pu_bacteria 2643221551 2643775786 830
603 iso_pu_bacteria 2643221555 2643794233 830
604 iso_pu_bacteria 2643221595 2643989219 830
605 iso_pu_bacteria 2643221623 2644129882 830
606 iso_pu_bacteria 2643221627 2644152791 830
607 iso_pu_bacteria 2687453392 2688598849 830
608 iso_pu_bacteria 2756170246 2756675734 830
609 iso_pu_bacteria 2844002411 2844006242 830
610 iso_pu_bacteria 2844009547 2844014190 830
611 iso_pu_bacteria 2856320880 2856325663 830
612 iso_pu_bacteria 2856328259 2856331540 830
613 iso_pu_bacteria 2856334872 2856336840 830
614 iso_pu_bacteria 2869234852 2869239306 830
615 iso_pu_bacteria 2869249662 2869254379 830
616 iso_pu_bacteria 2869256925 2869263550 830
617 iso_pu_bacteria 2869271264 2869276870 830
618 iso_pu_bacteria 2869278585 2869279285 830
619 iso_pu_bacteria 2871451962 2871454016 830
620 iso_pu_bacteria 2871466892 2871467905 830
621 iso_pu_bacteria 2871481445 2871484081 830
622 iso_pu_bacteria 2874116593 2874117306 830
623 iso_pu_bacteria 2874131515 2874134848 830
624 iso_pu_bacteria 2874139085 2874145032 830
625 iso_pu_bacteria 2874162495 2874166291 830
626 iso_pu_bacteria 2876363079 2876365667 830
627 iso_pu_bacteria 2876386047 2876390602 830
628 iso_pu_bacteria 2876399893 2876400011 830
629 iso_pu_bacteria 2876406927 2876409003 830
630 iso_pu_bacteria 2878738818 2878745669 830
631 iso_pu_bacteria 2878781027 2878788560 830
632 iso_pu_bacteria 2888337043 2888339851 830
633 iso_pu_bacteria 2889790730 2889792225 830
634 iso_pu_bacteria 2889914905 2889917042 830
635 iso_pu_bacteria 2903448605 2903455454 830
636 iso_pu_bacteria 2903521522 2903523596 830
637 iso_pu_bacteria 2903528002 2903534230 830
638 iso_pu_bacteria 2906363423 2906364245 830
639 iso_pu_bacteria 2906370794 2906375234 830
640 iso_pu_bacteria 2906401398 2906406590 830
641 iso_pu_bacteria 2906408224 2906408266 830
642 iso_pu_bacteria 2922172374 2922176015 830
643 iso_pu_bacteria 2922178524 2922184577 830
644 iso_pu_bacteria 2924733363 2924739305 830
645 iso_pu_bacteria 2924741084 2924744663 830
646 iso_pu_bacteria 2924762789 2924766835 830
647 iso_pu_bacteria 2924776078 2924783914 830
648 iso_pu_bacteria 2937822353 2937824911 830
649 iso_pu_bacteria 2937848649 2937855061 830
650 iso_pu_bacteria 2937877337 2937877444 830
651 iso_pu_bacteria 2937972304 2937975450 830
652 iso_pu_bacteria 2958034702 2958035426 830
653 iso_pu_bacteria 2958041894 2958043613 830
654 iso_pu_bacteria 2958064165 2958067832 830
655 iso_pu_bacteria 2958084443 2958084550 830
656 iso_pu_bacteria 2958092219 2958097281 830
657 iso_pu_bacteria 2958108152 2958110653 830
658 iso_pu_bacteria 2958122699 2958124911 830
659 iso_pu_bacteria 2961136820 2961139937 830
660 iso_pu_bacteria 2961183825 2961190190 830
661 iso_pu_bacteria 2963644680 2963648142 830
662 iso_pu_bacteria 2965025482 2965026600 830
663 iso_pu_bacteria 2965047637 2965053008 830
664 iso_pu_bacteria 2968016561 2968018027 830
665 iso_pu_bacteria 2968083720 2968090964 830
666 iso_pu_bacteria 2970469710 2970471798 830
667 iso_pu_bacteria 2970489779 2970495751 830
668 iso_pu_bacteria 2970510686 2970512877 830
669 iso_pu_bacteria 2970547951 2970548234 830
670 iso_pu_bacteria 2970593180 2970593881 830
671 iso_pu_bacteria 2970619444 2970627063 830
672 iso_pu_bacteria 2977851361 2977856923 830
673 iso_pu_bacteria 2977872689 2977874818 830
674 iso_pu_bacteria 2977898635 2977904160 830
675 iso_pu_bacteria 2977907340 2977913552 830
676 iso_pu_bacteria 2977915119 2977916385 830
677 iso_pu_bacteria 2977922695 2977929270 830
678 iso_pu_bacteria 2977935797 2977940743 830
679 iso_pu_bacteria 2977950692 2977952333 830
680 iso_pu_bacteria 2977957713 2977963048 830
681 iso_pu_bacteria 2977986579 2977992349 830
682 iso_pu_bacteria 2979764755 2979771777 830
683 iso_pu_bacteria 2979772303 2979779329 830
684 iso_pu_bacteria 2987645492 2987646266 830
685 iso_pu_bacteria 2987666974 2987668823 830
686 iso_pu_bacteria 2996348954 2996350582 830
687 iso_pu_bacteria 2996386984 2996389279 830
688 iso_pu_bacteria 3004167301 3004169345 830
689 iso_pu_bacteria 3004211236 3004211874 830
690 iso_pu_bacteria 3004218560 3004219121 830
691 iso_pu_bacteria 3004232784 3004235005 830
692 iso_pu_bacteria 3004239961 3004247927 830
693 iso_pu_bacteria 3004268573 3004268949 830
694 iso_pu_bacteria 3004275668 3004277280 830
695 iso_pu_bacteria 3004289098 3004296220 830
696 iso_pu_bacteria 3004334049 3004341261 830
697 iso_pu_bacteria 637000159 637074180 830
698 iso_pu_bacteria 649633066 649873365 830
699 iso_pu_bacteria 8004312739 8004315399 830
700 iso_pu_bacteria 8004727605 8004731265 830
701 iso_pu_bacteria 2508501127 2509140770 831
702 iso_pu_bacteria 2513237090 2513610964 831
703 iso_pu_bacteria 2513237305 2514420279 831
704 iso_pu_bacteria 2513237351 2514592207 831
705 iso_pu_bacteria 2597489875 2597814253 831
706 iso_pu_bacteria 2599185301 2599938320 831
707 iso_pu_bacteria 2643221550 2643772791 831
708 iso_pu_bacteria 2643221564 2643837851 831
709 iso_pu_bacteria 2693429783 2694629811 831
710 iso_pu_bacteria 2693429784 2694636316 831
711 iso_pu_bacteria 2721755686 2723575794 831
712 iso_pu_bacteria 2738543024 2739309399 831
713 iso_pu_bacteria 2791355123 2792749741 831
714 iso_pu_bacteria 2837678835 2837683603 831
715 iso_pu_bacteria 2841734538 2841736249 831
716 iso_pu_bacteria 2841734538 2841739706 831
717 iso_pu_bacteria 2856342000 2856348707 831
718 iso_pu_bacteria 2857349434 2857350633 831
719 iso_pu_bacteria 2871474448 2871481253 831
720 iso_pu_bacteria 2874123672 2874130813 831
721 iso_pu_bacteria 2874168670 2874174369 831
722 iso_pu_bacteria 2881161766 2881167925 831
723 iso_pu_bacteria 2882632389 2882635297 831
724 iso_pu_bacteria 2882632389 2882637029 831
725 iso_pu_bacteria 2885312484 2885314284 831
726 iso_pu_bacteria 2885312484 2885316926 831
727 iso_pu_bacteria 2888343758 2888344205 831
728 iso_pu_bacteria 2888343758 2888347276 831
729 iso_pu_bacteria 2888350351 2888356194 831
730 iso_pu_bacteria 2889010040 2889011123 831
731 iso_pu_bacteria 2889016732 2889017152 831
732 iso_pu_bacteria 2889914905 2889919938 831
733 iso_pu_bacteria 2904659560 2904661265 831
734 iso_pu_bacteria 2922185730 2922190206 831
735 iso_pu_bacteria 2937836603 2937837978 831
736 iso_pu_bacteria 2937836603 2937843177 831
737 iso_pu_bacteria 2937843397 2937846110 831
738 iso_pu_bacteria 2958071322 2958072652 831
739 iso_pu_bacteria 2958071322 2958077209 831
740 iso_pu_bacteria 2958100919 2958101842 831
741 iso_pu_bacteria 2958172287 2958178985 831
742 iso_pu_bacteria 2961114664 2961116417 831
743 iso_pu_bacteria 2965119406 2965123145 831
744 iso_pu_bacteria 2968110612 2968112323 831
745 iso_pu_bacteria 2970524798 2970525917 831
746 iso_pu_bacteria 2970524798 2970530762 831
747 iso_pu_bacteria 2970540015 2970541942 831
748 iso_pu_bacteria 2970540015 2970545635 831
749 iso_pu_bacteria 2977942078 2977947662 831
750 iso_pu_bacteria 2979710463 2979713702 831
751 iso_pu_bacteria 2979742915 2979748537 831
752 iso_pu_bacteria 2987636660 2987637817 831
753 iso_pu_bacteria 2987652177 2987657442 831
754 iso_pu_bacteria 3004203850 3004205861 831
755 iso_pu_bacteria 8002285264 8002285603 831
756 iso_pu_bacteria 8004633249 8004635086 831
757 iso_pu_bacteria 8004633249 8004638428 831
758 iso_pu_bacteria 8055617313 8055617735 831
759 iso_pu_bacteria 8055617313 8055621330 831
760 iso_pu_bacteria 2856364286 2856370544 833
761 iso_pu_bacteria 2869285874 2869291729 833
762 iso_pu_bacteria 2871429161 2871434939 833
763 iso_pu_bacteria 2871444079 2871451106 833
764 iso_pu_bacteria 2871488783 2871495583 833
765 iso_pu_bacteria 2871495908 2871502839 833
766 iso_pu_bacteria 2874102143 2874103313 833
767 iso_pu_bacteria 2874146452 2874149329 833
768 iso_pu_bacteria 2874155637 2874157592 833
769 iso_pu_bacteria 2876413966 2876415795 833
770 iso_pu_bacteria 2878745973 2878752073 833
771 iso_pu_bacteria 2878753008 2878757822 833
772 iso_pu_bacteria 2878760144 2878766731 833
773 iso_pu_bacteria 2878767105 2878773928 833
774 iso_pu_bacteria 2881155292 2881155706 833
775 iso_pu_bacteria 2881845957 2881848156 833
776 iso_pu_bacteria 2882912400 2882913962 833
777 iso_pu_bacteria 2885318864 2885320378 833
778 iso_pu_bacteria 2885342637 2885346871 833
779 iso_pu_bacteria 2885350715 2885351921 833
780 iso_pu_bacteria 2903492973 2903493369 833
781 iso_pu_bacteria 2903492973 2903506539 833
782 iso_pu_bacteria 2903540706 2903547978 833
783 iso_pu_bacteria 2906308376 2906314467 833
784 iso_pu_bacteria 2906321335 2906327635 833
785 iso_pu_bacteria 2906328253 2906329623 833
786 iso_pu_bacteria 2922158528 2922160205 833
787 iso_pu_bacteria 2924726620 2924731736 833
788 iso_pu_bacteria 2924784321 2924785683 833
789 iso_pu_bacteria 2937813078 2937816230 833
790 iso_pu_bacteria 2937891427 2937894775 833
791 iso_pu_bacteria 2937994558 2938001855 833
792 iso_pu_bacteria 2958115193 2958118820 833
793 iso_pu_bacteria 2958130278 2958136127 833
794 iso_pu_bacteria 2958165035 2958171910 833
795 iso_pu_bacteria 2958179912 2958185595 833
796 iso_pu_bacteria 2961077736 2961083972 833
797 iso_pu_bacteria 2961163497 2961170356 833
798 iso_pu_bacteria 2961170736 2961174365 833
799 iso_pu_bacteria 2965018300 2965025102 833
800 iso_pu_bacteria 2965062239 2965063334 833
801 iso_pu_bacteria 2967996073 2968000355 833
802 iso_pu_bacteria 2968003550 2968003760 833
803 iso_pu_bacteria 2968091066 2968096636 833
804 iso_pu_bacteria 2968097103 2968099998 833
805 iso_pu_bacteria 2968117919 2968121123 833
806 iso_pu_bacteria 2968128360 2968132688 833
807 iso_pu_bacteria 2968171901 2968178743 833
808 iso_pu_bacteria 2970503327 2970506952 833
809 iso_pu_bacteria 2970554993 2970561588 833
810 iso_pu_bacteria 2977821940 2977822354 833
811 iso_pu_bacteria 2977843712 2977846466 833
812 iso_pu_bacteria 2977858184 2977860549 833
813 iso_pu_bacteria 2979808191 2979812147 833
814 iso_pu_bacteria 2987659509 2987666597 833
815 iso_pu_bacteria 2996341866 2996347204 833
816 iso_pu_bacteria 3004188549 3004195599 833
817 iso_pu_bacteria 8004374579 8004379333 833
818 iso_pu_bacteria 8004387939 8004394545 833
819 iso_pu_bacteria 8004445564 8004452018 833
820 iso_pu_bacteria 8004640170 8004640325 833
821 iso_pu_bacteria 8004703790 8004709722 833
822 iso_pu_bacteria 8004714634 8004720729 833
823 3300037471 Ga0395905_0019540 Ga0395905_0019540_45_2594 835
824 3300044658 Ga0466972_0026360 Ga0466972_0026360_154_2703 835
825 iso_pu_bacteria 2924754689 2924761403 835
826 3300003214 JGI25165J46597_1000062 JGI25165J46597_100006239 836
827 3300009551 Ga0105238_10004699 Ga0105238_1000469910 836
828 3300025261 Ga0209233_1000129 Ga0209233_1000129154 836
829 3300025924 Ga0207694_10016895 Ga0207694_100168952 836
830 3300002741 JGI25157J39369_1001953 JGI25157J39369_10019533 837
831 3300025250 Ga0209026_1000024 Ga0209026_1000024219 837
832 3300025256 Ga0209759_1000389 Ga0209759_100038940 837

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02355

SecD_SecF

Protein export membrane protein

633

815

0.97

PF21760

SecD_1st

Protein translocase subunit SecDF, P1 domain, N-terminal

156

215

0.97

PF22599

SecDF_P1_head

SecDF, P1 head subdomain

227

340

0.96

PF07549

Sec_GG

SecD/SecF GG Motif

558

582

0.94

PF02355

SecD_SecF

Protein export membrane protein

336

515

0.88

PF07549

Sec_GG

SecD/SecF GG Motif

34

59

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3aqo-assembly2.cif.gz_B structure and function of a membrane component secdf that enhances protein export 0.8049 162 364
3aqo-assembly2.cif.gz_B structure and function of a membrane component secdf that enhances protein export 0.7424 162 364
7bfe-assembly1.cif.gz_E circular permutant of ribosomal protein s6, p54-55 truncated, l21a mutant. 0.695 587 665
7b90-assembly1.cif.gz_E circular permutant of ribosomal protein s6, p54-55 truncated, i8a mutant 0.6938 586 665
6m49-assembly1.cif.gz_B cryo-em structure of scap/insig complex in the present of 25-hydroxyl cholesterol. 0.6892 370 537
ID Description Score Start End Superfamily
af_P0AG90_434_612_1.20.1640.10 Mainly Alpha;Up-down Bundle;Multidrug efflux transporter AcrB transmembrane fold;Multidrug efflux transporter AcrB transmembrane domain 0.9324 357 534 1.20.1640.10
af_P0AG90_434_612_1.20.1640.10 Mainly Alpha;Up-down Bundle;Multidrug efflux transporter AcrB transmembrane fold;Multidrug efflux transporter AcrB transmembrane domain 0.9224 357 534 1.20.1640.10
af_P9WGP1_361_542_1.20.1640.10 Mainly Alpha;Up-down Bundle;Multidrug efflux transporter AcrB transmembrane fold;Multidrug efflux transporter AcrB transmembrane domain 0.9155 351 526 1.20.1640.10
af_P9WGP1_237_360_3.30.1360.200 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2; 0.889 242 350 3.30.1360.200
af_D3ZRK8_252_456_1.20.1640.10 Mainly Alpha;Up-down Bundle;Multidrug efflux transporter AcrB transmembrane fold;Multidrug efflux transporter AcrB transmembrane domain 0.8865 371 525 1.20.1640.10
ID Description Score Start End GO Terms
AF-A0A0G1WJV2-F1-model_v4 Protein translocase subunit SecD 0.9571 387 529 GO:0005886
GO:0015031
AF-X1M6Y0-F1-model_v4 Protein export membrane protein SecD/SecF C-terminal domain-containing protein 0.9409 383 534 GO:0005886
GO:0015031
GO:0022857
AF-A0A529LEU2-F1-model_v4 Protein translocase subunit SecDF 0.9292 241 344 GO:0005886
GO:0015031
AF-A0A2D3VUD0-F1-model_v4 Protein translocase subunit SecD 0.9148 354 531 GO:0005886
GO:0006886
GO:0015450
AF-A0A1G5P8V2-F1-model_v4 Protein translocase subunit SecD 0.913 1 537 GO:0005886
GO:0006605
GO:0015450
GO:0043952
GO:0065002

Feature Viewer

pLDDT pTM Quality
76.55 0.6 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map