F482737
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 832 | 712 | 261 | 833 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2551306092|2551735605 |
| Length | 893 |
| Sequence | RWAVLAYVAIIIFGCLAALPSVLTPAMREQVASVLPFEPVTLGLDLRGGSHLVLEVDGAGLQKARLNSLLDDTRRVLRGERVSASSARISGNSVTVSIPDAQDRDKVLPKLQELATPVSTVGFAAPAPEVEVTTAGDVITLAMTEAGLADRMTKAVEQSLEIIRNRVDQVGVAEPLIQRIGSNRILVQLPGLQDPTRLRELLGSTAQMSFHMLDQSVDVTQPAPRGVDILPGANDGNRYPVESRVAISGERLDDAKVGFDQRTNQPVVDFSFDSLGARQFADITRENVGRPFAIVLDGKVLTAPVINEPILGGRGQISGSFTVEEATVLSALLRSGALPAPLTIIEERSVGPNLGSDSIRMGLFTGLAGFGLVVVLMVVLYGAWGMIANVGLVLHTIMTIGVLGLIGSTLTLPGIAGIILGIGMAVDANILINARIREETEAGAGAMKALDIGFNKAYATIIDSNVTTLAGTVLLFWFGSGPVKGFAVTMMLGIGISMFTSVTVVRLLMREVVVRRKMKKLEIPSLFGKVPQLPTFSFMKGRFLAIGFSAFLSISSVILFFTPGLNYGIDFIGGIQVEAVSKEKINLPTLRQSLEELNLGEVALQDFGGGQSVLIRVQRQPGGEQAQTVALNKVKDAVTTAIPGASMERTEVVGPTVSGELARSGFLAVALAMLAILLYIWFRFEWHFAVGAIAVLLLDITKTVGFFALTGIDFNLTAIAALLTMIGYSVNDKVVVYDRMRENLRKYKSMPFSDLIDMSINQVIARCIFTSAATALSLVPMAIWGGEAVQSFAWPMIFGVIVATTSSIYIGGXXXXGGRSGKPLVPPGSRRKRRQPDGLVPSTDAGGKPSAPFLIPPCRSRQRGSLYEGCPFFVGNSCLYSTRPLHGDSALPR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2503198000 | Mesorhizobium opportunistum WSM2075 | Isolate | Nodule |
| 2 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 3 | 2508501123 | Mesorhizobium sp. WSM3626 | Isolate | Nodule |
| 4 | 2508501127 | Mesorhizobium sp. WSM2561 | Isolate | Nodule |
| 5 | 2509276018 | Mesorhizobium ciceri CMG6 | Isolate | Nodule |
| 6 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 7 | 2509276022 | Mesorhizobium australicum WSM2073 | Isolate | Nodule |
| 8 | 2510065057 | Sinorhizobium meliloti WSM1022 | Isolate | Nodule |
| 9 | 2510065059 | Mesorhizobium ciceri WSM4083 | Isolate | Nodule |
| 10 | 2511231027 | Phyllobacterium sp. YR531 | Isolate | Rhizosphere |
| 11 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 12 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 13 | 2512875016 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 14 | 2512875024 | Mesorhizobium loti R88b | Isolate | Nodule |
| 15 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 16 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 17 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 18 | 2513237090 | Mesorhizobium sp. WSM3224 | Isolate | Nodule |
| 19 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 20 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 21 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 22 | 2513237144 | Rhizobium sullae WSM1592 | Isolate | Nodule |
| 23 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 24 | 2513237156 | Sinorhizobium medicae WSM1369 | Isolate | Nodule |
| 25 | 2513237159 | Rhizobium giardinii bv. giardinii H152 | Isolate | Nodule |
| 26 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 27 | 2513237164 | Mesorhizobium loti CJ3sym | Isolate | Nodule |
| 28 | 2513237305 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 29 | 2513237351 | Mesorhizobium alhagi CCNWXJ12-2 | Isolate | Nodule |
| 30 | 2515154107 | Sinorhizobium meliloti 4H41 | Isolate | Nodule |
| 31 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 32 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 33 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 34 | 2522572158 | Azospirillum halopraeferens DSM 3675 | Isolate | Unclassified |
| 35 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 36 | 2524023250 | Niveispirillum irakense DSM 11586 | Isolate | Unclassified |
| 37 | 2534681786 | Brucella suis 92/29 | Isolate | Unclassified |
| 38 | 2551306084 | Sinorhizobium meliloti 5A14 | Isolate | Nodule |
| 39 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 40 | 2551306086 | Sinorhizobium meliloti AK11 | Isolate | Nodule |
| 41 | 2551306087 | Sinorhizobium meliloti A0643DD | Isolate | Nodule |
| 42 | 2551306089 | Sinorhizobium meliloti 1A42 | Isolate | Nodule |
| 43 | 2551306090 | Sinorhizobium meliloti A0641M | Isolate | Nodule |
| 44 | 2551306091 | Sinorhizobium meliloti C0431A | Isolate | Nodule |
| 45 | 2551306092 | Sinorhizobium meliloti AK75 | Isolate | Nodule |
| 46 | 2551306093 | Sinorhizobium meliloti C0438LL | Isolate | Nodule |
| 47 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 48 | 2582581283 | Rhizobium sp. OK665 | Isolate | Rhizosphere |
| 49 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 50 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 51 | 2582581304 | Rhizobium sp. YR519 | Isolate | Rhizosphere |
| 52 | 2582581306 | Rhizobium sp. YR295 | Isolate | Rhizosphere |
| 53 | 2582581865 | Rhizobium sp. CF258 | Isolate | Rhizosphere |
| 54 | 2582581866 | Rhizobium sp. CF097 | Isolate | Rhizosphere |
| 55 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 56 | 2585427594 | Rhizobium sp. YR528 | Isolate | Rhizosphere |
| 57 | 2588253730 | Mesorhizobium huakuii 7653R | Isolate | Rhizosphere |
| 58 | 2597489875 | Mesorhizobium ciceri ca181 | Isolate | Unclassified |
| 59 | 2599185156 | Rhizobium sp. NFR03 | Isolate | Rhizoplane |
| 60 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 61 | 2599185236 | Rhizobium sp. NFR07 | Isolate | Rhizoplane |
| 62 | 2599185301 | Mesorhizobium sp. NFR06 | Isolate | Rhizoplane |
| 63 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 64 | 2643221550 | Mesorhizobium sp. Root552 | Isolate | Unclassified |
| 65 | 2643221551 | Mesorhizobium sp. Root1471 | Isolate | Unclassified |
| 66 | 2643221555 | Mesorhizobium sp. Root554 | Isolate | Unclassified |
| 67 | 2643221557 | Ensifer sp. Root558 | Isolate | Unclassified |
| 68 | 2643221564 | Mesorhizobium sp. Root157 | Isolate | Unclassified |
| 69 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 70 | 2643221607 | Rhizobium sp. Root73 | Isolate | Unclassified |
| 71 | 2643221610 | Ensifer sp. Root74 | Isolate | Unclassified |
| 72 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 73 | 2643221623 | Aminobacter sp. DSM 101952 Root100 | Isolate | Unclassified |
| 74 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 75 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 76 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 77 | 2643221636 | Rhizobium sp. Root1204 | Isolate | Unclassified |
| 78 | 2643221637 | Rhizobium sp. Root1212 | Isolate | Unclassified |
| 79 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 80 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 81 | 2643221668 | Ensifer sp. Root423 | Isolate | Unclassified |
| 82 | 2643221675 | Ensifer sp. Root1298 | Isolate | Unclassified |
| 83 | 2643221680 | Ensifer sp. Root1312 | Isolate | Unclassified |
| 84 | 2643221686 | Rhizobium sp. Root1334 | Isolate | Unclassified |
| 85 | 2643221688 | Rhizobium sp. Root482 | Isolate | Unclassified |
| 86 | 2643221689 | Rhizobium sp. Root483D2 | Isolate | Unclassified |
| 87 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 88 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 89 | 2643221718 | Rhizobium sp. Root268 | Isolate | Unclassified |
| 90 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 91 | 2643221726 | Ensifer sp. Root954 | Isolate | Unclassified |
| 92 | 2657244999 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 93 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 94 | 2690316117 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 95 | 2693429783 | Mesorhizobium sp. LCM 4577 | Isolate | Rhizosphere |
| 96 | 2693429784 | Mesorhizobium sp. LCM 4576 | Isolate | Rhizosphere |
| 97 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 98 | 2738541293 | Rhizobium sp. GV031 | Isolate | Unclassified |
| 99 | 2738543024 | Aminobacter sp. AP02 | Isolate | Unclassified |
| 100 | 2751185800 | Brucella pituitosa AA2 | Isolate | Unclassified |
| 101 | 2751185821 | Ensifer shofinae CCBAU 251167 | Isolate | Unclassified |
| 102 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 103 | 2757320392 | Phyllobacterium leguminum ORS 1419 | Isolate | Nodule |
| 104 | 2758568016 | [Ochrobactrum] quorumnocens A44 | Isolate | Rhizosphere |
| 105 | 2765235802 | Phyllobacterium bourgognense 31-25a | Isolate | Rhizoplane |
| 106 | 2767802442 | Phyllobacterium brassicacearum 29-15 | Isolate | Rhizoplane |
| 107 | 2775506902 | Phyllobacterium zundukense Tri-48 | Isolate | Unclassified |
| 108 | 2775506904 | Phyllobacterium zundukense Tri-38 | Isolate | Unclassified |
| 109 | 2791355082 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 110 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 111 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 112 | 2791355094 | Sinorhizobium sp. BJ1 | Isolate | Nodule |
| 113 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 114 | 2791355253 | Rhizobium rhizosphaerae RD15 | Isolate | Rhizosphere |
| 115 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 116 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 117 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 118 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 119 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 120 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 121 | 2802429268 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 122 | 2818991461 | Neorhizobium alkalisoli 1225 | Isolate | Unclassified |
| 123 | 2821123053 | Rhizobium cellulosilyticum 1193 | Isolate | Unclassified |
| 124 | 2837651117 | Pseudohoeflea suaedae YC6898 | Isolate | Unclassified |
| 125 | 2837678835 | Jiella endophytica CBS5Q-3 | Isolate | Unclassified |
| 126 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 127 | 2838074704 | Sinorhizobium terangae SEMIA 6460 | Isolate | Unclassified |
| 128 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 129 | 2838736955 | Rhizobium cellulosilyticum SEMIA 448 | Isolate | Nodule |
| 130 | 2839993093 | Phyllobacterium endophyticum PEPV15 | Isolate | Unclassified |
| 131 | 2840764183 | Phyllobacterium sophorae CCBAU 03422 | Isolate | Unclassified |
| 132 | 2841734538 | Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 | Isolate | Nodule |
| 133 | 2841840854 | Rhizobium cellulosilyticum SEMIA 444 | Isolate | Nodule |
| 134 | 2842140634 | Rhizobium cellulosilyticum SEMIA 452 | Isolate | Nodule |
| 135 | 2842333319 | Skermanella aerolata SEMIA 4010 | Isolate | Nodule |
| 136 | 2842521101 | Rhizobium giardinii SEMIA 4084 | Isolate | Nodule |
| 137 | 2842871566 | Phyllobacterium sp. R-73111 | Isolate | Unclassified |
| 138 | 2842922631 | Pararhizobium sp. R-72066 | Isolate | Unclassified |
| 139 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 140 | 2844009547 | Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 | Isolate | Nodule |
| 141 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 142 | 2847417321 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 143 | 2848992105 | Sinorhizobium fredii CCBAU 25509 | Isolate | Unclassified |
| 144 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 145 | 2854911287 | Brucella lupini LUP21 | Isolate | Unclassified |
| 146 | 2855825444 | Sinorhizobium meliloti CXM1-105 | Isolate | Nodule |
| 147 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 148 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 149 | 2856320880 | Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 | Isolate | Nodule |
| 150 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 151 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 152 | 2856342000 | Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 | Isolate | Nodule |
| 153 | 2856364286 | Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 | Isolate | Nodule |
| 154 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 155 | 2857531043 | Neorhizobium sp. R-72160 | Isolate | Unclassified |
| 156 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 157 | 2869234852 | Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 | Isolate | Nodule |
| 158 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 159 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 160 | 2869271264 | Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | Isolate | Nodule |
| 161 | 2869278585 | Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 | Isolate | Nodule |
| 162 | 2869285874 | Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 | Isolate | Nodule |
| 163 | 2871429161 | Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 | Isolate | Nodule |
| 164 | 2871444079 | Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 | Isolate | Nodule |
| 165 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 166 | 2871466892 | Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 | Isolate | Nodule |
| 167 | 2871474448 | Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 | Isolate | Nodule |
| 168 | 2871481445 | Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 | Isolate | Nodule |
| 169 | 2871488783 | Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 | Isolate | Nodule |
| 170 | 2871495908 | Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 | Isolate | Nodule |
| 171 | 2874102143 | Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 | Isolate | Nodule |
| 172 | 2874109183 | Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 | Isolate | Nodule |
| 173 | 2874116593 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 | Isolate | Nodule |
| 174 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 175 | 2874131515 | Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 | Isolate | Nodule |
| 176 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 177 | 2874146452 | Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 | Isolate | Nodule |
| 178 | 2874155637 | Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 | Isolate | Nodule |
| 179 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 180 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 181 | 2876363079 | Mesorhizobium loti R7ANS::ICEMlSym2042 | Isolate | Nodule |
| 182 | 2876369609 | Mesorhizobium sp. USDA-HM6 | Isolate | Unclassified |
| 183 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 184 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 185 | 2876406927 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 | Isolate | Nodule |
| 186 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 187 | 2878730984 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 | Isolate | Nodule |
| 188 | 2878738818 | Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 | Isolate | Nodule |
| 189 | 2878745973 | Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 | Isolate | Nodule |
| 190 | 2878753008 | Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 | Isolate | Nodule |
| 191 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 192 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 193 | 2878781027 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 | Isolate | Nodule |
| 194 | 2881155292 | Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 | Isolate | Nodule |
| 195 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 196 | 2881845957 | Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 | Isolate | Nodule |
| 197 | 2881861095 | Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 | Isolate | Nodule |
| 198 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 199 | 2882912400 | Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 | Isolate | Nodule |
| 200 | 2885312484 | Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 | Isolate | Nodule |
| 201 | 2885318864 | Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 | Isolate | Nodule |
| 202 | 2885342637 | Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 | Isolate | Nodule |
| 203 | 2885350715 | Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 | Isolate | Nodule |
| 204 | 2888337043 | Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 | Isolate | Nodule |
| 205 | 2888343758 | Mesorhizobium sp. AA22 | Isolate | Unclassified |
| 206 | 2888350351 | Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 | Isolate | Nodule |
| 207 | 2889010040 | Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 | Isolate | Nodule |
| 208 | 2889016732 | Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 | Isolate | Nodule |
| 209 | 2889790730 | Chelativorans xinjiangense lm93 | Isolate | Rhizosphere |
| 210 | 2889914905 | Chelativorans alearense UJN715 | Isolate | Rhizosphere |
| 211 | 2891373044 | Shinella sp. AETb1-6 | Isolate | Rhizosphere |
| 212 | 2894652903 | Phyllobacterium sp. SYP-B3895 | Isolate | Rhizosphere |
| 213 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 214 | 2903448605 | Mesorhizobium japonicum Opo-235 | Isolate | Nodule |
| 215 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 216 | 2903521522 | Mesorhizobium loti R7ANS::ICEMlSym2014 | Isolate | Nodule |
| 217 | 2903528002 | Mesorhizobium loti R7ANS::ICEMlSym2037 | Isolate | Nodule |
| 218 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 219 | 2904578770 | Phyllobacterium sp. 586 | Isolate | Unclassified |
| 220 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 221 | 2906308376 | Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 | Isolate | Nodule |
| 222 | 2906321335 | Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 | Isolate | Nodule |
| 223 | 2906328253 | Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 | Isolate | Nodule |
| 224 | 2906354277 | Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 | Isolate | Nodule |
| 225 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 226 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 227 | 2906393657 | Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 | Isolate | Nodule |
| 228 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 229 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 230 | 2913295892 | Sinorhizobium kostiensis DSM 13372 | Isolate | Nodule |
| 231 | 2915650412 | Ochrobactrum sp. CM-21-5 | Isolate | Rhizosphere |
| 232 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 233 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 234 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 235 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 236 | 2916007675 | Sinorhizobium meliloti USDA1289 | Isolate | Nodule |
| 237 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 238 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 239 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 240 | 2916035215 | Sinorhizobium meliloti 3011 | Isolate | Nodule |
| 241 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 242 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 243 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 244 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 245 | 2916068649 | Sinorhizobium meliloti USDA1220 | Isolate | Nodule |
| 246 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 247 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 248 | 2919119836 | Phyllobacterium sp. 1468 | Isolate | Rhizosphere |
| 249 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 250 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 251 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 252 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 253 | 2921237296 | Sinorhizobium meliloti USDA1508 | Isolate | Nodule |
| 254 | 2921244191 | Sinorhizobium meliloti 2119 | Isolate | Nodule |
| 255 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 256 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 257 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 258 | 2921282425 | Sinorhizobium meliloti USDA1203 | Isolate | Nodule |
| 259 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 260 | 2921296804 | Sinorhizobium meliloti USDA1200 | Isolate | Nodule |
| 261 | 2922158528 | Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 | Isolate | Nodule |
| 262 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 263 | 2922178524 | Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 | Isolate | Nodule |
| 264 | 2922185730 | Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 | Isolate | Nodule |
| 265 | 2924144063 | Sinorhizobium meliloti USDA1022 | Isolate | Nodule |
| 266 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 267 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 268 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 269 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 270 | 2924179722 | Sinorhizobium meliloti USDA1280 | Isolate | Nodule |
| 271 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 272 | 2924193448 | Sinorhizobium meliloti USDA1158 | Isolate | Nodule |
| 273 | 2924200457 | Sinorhizobium meliloti USDA1007 | Isolate | Nodule |
| 274 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 275 | 2924214083 | Sinorhizobium meliloti USDA1702 | Isolate | Nodule |
| 276 | 2924221636 | Sinorhizobium meliloti USDA1416 | Isolate | Nodule |
| 277 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 278 | 2924710171 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 | Isolate | Nodule |
| 279 | 2924726620 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 | Isolate | Nodule |
| 280 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 281 | 2924741084 | Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 | Isolate | Nodule |
| 282 | 2924754689 | Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 | Isolate | Nodule |
| 283 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 284 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 285 | 2924784321 | Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | Isolate | Nodule |
| 286 | 2928521798 | Phyllobacterium ifriqiyense 1451 | Isolate | Rhizosphere |
| 287 | 2936996657 | Sinorhizobium meliloti USDA1025 | Isolate | Nodule |
| 288 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 289 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 290 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 291 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 292 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 293 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 294 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 295 | 2937049772 | Sinorhizobium meliloti USDA1691 | Isolate | Nodule |
| 296 | 2937056579 | Sinorhizobium meliloti USDA1357 | Isolate | Nodule |
| 297 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 298 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 299 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 300 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 301 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 302 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 303 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 304 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 305 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 306 | 2937126314 | Sinorhizobium meliloti USDA1612 | Isolate | Nodule |
| 307 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 308 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 309 | 2937836603 | Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 | Isolate | Nodule |
| 310 | 2937843397 | Mesorhizobium xinjiangense lm94 | Isolate | Rhizosphere |
| 311 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 312 | 2937861824 | Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 | Isolate | Nodule |
| 313 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 314 | 2937891427 | Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 | Isolate | Nodule |
| 315 | 2937972304 | Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 | Isolate | Nodule |
| 316 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 317 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 318 | 2957375807 | Sinorhizobium medicae USDA1632 | Isolate | Nodule |
| 319 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 320 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 321 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 322 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 323 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 324 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 325 | 2957430029 | Sinorhizobium meliloti USDA1590 | Isolate | Nodule |
| 326 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 327 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 328 | 2957450854 | Sinorhizobium meliloti USDA1655 | Isolate | Nodule |
| 329 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 330 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 331 | 2957471148 | Sinorhizobium meliloti USDA1204 | Isolate | Nodule |
| 332 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 333 | 2957484790 | Sinorhizobium meliloti USDA1464 | Isolate | Nodule |
| 334 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 335 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 336 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 337 | 2958034702 | Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 | Isolate | Nodule |
| 338 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 339 | 2958064165 | Mesorhizobium sp. SARCC-RB16n | Isolate | Unclassified |
| 340 | 2958071322 | Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 | Isolate | Nodule |
| 341 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 342 | 2958092219 | Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 | Isolate | Nodule |
| 343 | 2958100919 | Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 | Isolate | Nodule |
| 344 | 2958108152 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 | Isolate | Nodule |
| 345 | 2958115193 | Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 | Isolate | Nodule |
| 346 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 347 | 2958130278 | Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 | Isolate | Nodule |
| 348 | 2958158011 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 | Isolate | Nodule |
| 349 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 350 | 2958172287 | Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 | Isolate | Nodule |
| 351 | 2958179912 | Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 | Isolate | Nodule |
| 352 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 353 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 354 | 2960597568 | Sinorhizobium meliloti 3085 | Isolate | Nodule |
| 355 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 356 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 357 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 358 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 359 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 360 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 361 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 362 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 363 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 364 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 365 | 2960674078 | Sinorhizobium meliloti USDA1666 | Isolate | Nodule |
| 366 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 367 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 368 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 369 | 2961077736 | Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 | Isolate | Nodule |
| 370 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 371 | 2961127735 | Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 | Isolate | Nodule |
| 372 | 2961136820 | Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 | Isolate | Nodule |
| 373 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 374 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 375 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 376 | 2963644680 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 377 | 2964607997 | Sinorhizobium meliloti USDA1212 | Isolate | Nodule |
| 378 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 379 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 380 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 381 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 382 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 383 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 384 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 385 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 386 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 387 | 2964685014 | Sinorhizobium meliloti USDA1232 | Isolate | Nodule |
| 388 | 2964691889 | Sinorhizobium meliloti USDA1379 | Isolate | Nodule |
| 389 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 390 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 391 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 392 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 393 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 394 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 395 | 2965047637 | Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 | Isolate | Nodule |
| 396 | 2965062239 | Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 | Isolate | Nodule |
| 397 | 2965119406 | Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 | Isolate | Nodule |
| 398 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 399 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 400 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 401 | 2967686174 | Sinorhizobium medicae USDA1641 | Isolate | Nodule |
| 402 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 403 | 2967706974 | Sinorhizobium meliloti USDA1206 | Isolate | Nodule |
| 404 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 405 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 406 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 407 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 408 | 2967748971 | Sinorhizobium meliloti USDA1024A | Isolate | Nodule |
| 409 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 410 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 411 | 2967769361 | Sinorhizobium meliloti USDA1005 | Isolate | Nodule |
| 412 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 413 | 2967996073 | Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 | Isolate | Nodule |
| 414 | 2968003550 | Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 | Isolate | Nodule |
| 415 | 2968016561 | Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 | Isolate | Nodule |
| 416 | 2968083720 | Mesorhizobium erdmanii Opo-242 | Isolate | Unclassified |
| 417 | 2968091066 | Mesorhizobium sp. AA23 | Isolate | Unclassified |
| 418 | 2968097103 | Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 | Isolate | Nodule |
| 419 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 420 | 2968117919 | Mesorhizobium atlanticum CNPSo 3140 | Isolate | Unclassified |
| 421 | 2968128360 | Mesorhizobium sp. WSM3873 | Isolate | Unclassified |
| 422 | 2968138860 | Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 | Isolate | Nodule |
| 423 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 424 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 425 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 426 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 427 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 428 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 429 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 430 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 431 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 432 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 433 | 2970082768 | Sinorhizobium meliloti USDA1803 | Isolate | Nodule |
| 434 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 435 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 436 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 437 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 438 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 439 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 440 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 441 | 2970136068 | Sinorhizobium meliloti USDA1699 | Isolate | Nodule |
| 442 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 443 | 2970149975 | Sinorhizobium meliloti USDA1215 | Isolate | Nodule |
| 444 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 445 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 446 | 2970170962 | Sinorhizobium meliloti USDA1571 | Isolate | Nodule |
| 447 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 448 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 449 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 450 | 2970469710 | Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 | Isolate | Nodule |
| 451 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 452 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 453 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 454 | 2970524798 | Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 | Isolate | Nodule |
| 455 | 2970532167 | Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 | Isolate | Nodule |
| 456 | 2970540015 | Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 | Isolate | Nodule |
| 457 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 458 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 459 | 2970593180 | Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 | Isolate | Nodule |
| 460 | 2970619444 | Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 | Isolate | Nodule |
| 461 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 462 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 463 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 464 | 2977537788 | Sinorhizobium meliloti USDA1184 | Isolate | Nodule |
| 465 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 466 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 467 | 2977558990 | Sinorhizobium meliloti USDA1222 | Isolate | Nodule |
| 468 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 469 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 470 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 471 | 2977821940 | Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 | Isolate | Nodule |
| 472 | 2977828996 | Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 | Isolate | Nodule |
| 473 | 2977843712 | Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 | Isolate | Nodule |
| 474 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 475 | 2977858184 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 | Isolate | Nodule |
| 476 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 477 | 2977898635 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 | Isolate | Nodule |
| 478 | 2977907340 | Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 | Isolate | Nodule |
| 479 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 480 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 481 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 482 | 2977942078 | Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 | Isolate | Nodule |
| 483 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 484 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 485 | 2977986579 | Mesorhizobium intechi BD68 | Isolate | Unclassified |
| 486 | 2979710463 | Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 | Isolate | Nodule |
| 487 | 2979742915 | Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 | Isolate | Nodule |
| 488 | 2979764755 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 | Isolate | Nodule |
| 489 | 2979772303 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 | Isolate | Nodule |
| 490 | 2979793036 | Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 | Isolate | Nodule |
| 491 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 492 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 493 | 2987645492 | Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 | Isolate | Nodule |
| 494 | 2987652177 | Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 | Isolate | Nodule |
| 495 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 496 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 497 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 498 | 2989349275 | Shinella kummerowiae CCBAU 25048 | Isolate | Unclassified |
| 499 | 2989771324 | Rhizobium rhizolycopersici DBTS2 | Isolate | Rhizosphere |
| 500 | 2996310559 | Mesorhizobium zhangyense CGMCC 1.15528 | Isolate | Unclassified |
| 501 | 2996336353 | Mesorhizobium sp. YM1C-6-2 | Isolate | Unclassified |
| 502 | 2996341866 | Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 | Isolate | Nodule |
| 503 | 2996348954 | Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 | Isolate | Nodule |
| 504 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 505 | 3000135777 | Unclassified bacterium M00.F.Ca.ET.205.01.1.1 | Isolate | Unclassified |
| 506 | 3002141150 | Phyllobacterium sp. 628 | Isolate | Unclassified |
| 507 | 3003930520 | Sinorhizobium sp. BG8 | Isolate | Unclassified |
| 508 | 3004167301 | Mesorhizobium loti 582 | Isolate | Unclassified |
| 509 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 510 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 511 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 512 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 513 | 3004232784 | Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 | Isolate | Nodule |
| 514 | 3004239961 | Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 | Isolate | Nodule |
| 515 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 516 | 3004275668 | Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 | Isolate | Nodule |
| 517 | 3004289098 | Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 | Isolate | Nodule |
| 518 | 3004334049 | Mesorhizobium huakuii 583 | Isolate | Unclassified |
| 519 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 520 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 521 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 522 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 523 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 524 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 525 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 526 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 527 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 528 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 529 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 530 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 531 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 532 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 533 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 534 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 535 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 536 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 537 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 538 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 539 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 540 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 541 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 542 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 543 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 544 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 545 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 546 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 547 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 548 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 549 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 550 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 551 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 552 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 553 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 554 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 555 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 556 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 557 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 558 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 559 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 560 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 561 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 562 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 563 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 564 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 565 | 3300013249 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 | Metagenome | Rhizosphere |
| 566 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 567 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 568 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 569 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 570 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 571 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 572 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 573 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 574 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 575 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 576 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 577 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 578 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 579 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 580 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 581 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 582 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 583 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 584 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 585 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 586 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 587 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 588 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 589 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 590 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 591 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 592 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 593 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 594 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 595 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 596 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 597 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 598 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 599 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 600 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 601 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 602 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 603 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 604 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 605 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 606 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 607 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 608 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 609 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 610 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 611 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 612 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 613 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 614 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 615 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 616 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 617 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 618 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 619 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 620 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 621 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 622 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 623 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 624 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 625 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 626 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 627 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 628 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 629 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 630 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 631 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 632 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 633 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 634 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 635 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 636 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 637 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 638 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 639 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 640 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 641 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 642 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 643 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 644 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 645 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 646 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 647 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 648 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 649 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 650 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 651 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 652 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 653 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 654 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 655 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 656 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 657 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 658 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 659 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 660 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 661 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 662 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 663 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 664 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 665 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 666 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 667 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 668 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 669 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 670 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 671 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 672 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 673 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 674 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 675 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 676 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 677 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 678 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 679 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 680 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 681 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 682 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 683 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 684 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 685 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 686 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 687 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 688 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 689 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 690 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
| 691 | 641228493 | Gluconacetobacter diazotrophicus PA1 5 | Isolate | Unclassified |
| 692 | 643348555 | Gluconacetobacter diazotrophicus PA1 5 | Isolate | Unclassified |
| 693 | 643692032 | Sinorhizobium fredii NGR234 | Isolate | Nodule |
| 694 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 695 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 696 | 8002285264 | Aminobacter anthyllidis LMG 26462 | Isolate | Nodule |
| 697 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 698 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 699 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 700 | 8004312739 | Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 | Isolate | Nodule |
| 701 | 8004374579 | Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 | Isolate | Nodule |
| 702 | 8004387939 | Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 | Isolate | Nodule |
| 703 | 8004445564 | Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 | Isolate | Nodule |
| 704 | 8004633249 | Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 | Isolate | Nodule |
| 705 | 8004640170 | Mesorhizobium sp. GbtcB19 | Isolate | Unclassified |
| 706 | 8004703790 | Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 | Isolate | Nodule |
| 707 | 8004714634 | Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 | Isolate | Nodule |
| 708 | 8004727605 | Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 | Isolate | Nodule |
| 709 | 8018150411 | Rhizobium straminoryzae SM12 | Isolate | Rhizosphere |
| 710 | 8049293176 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 711 | 8054558443 | Rhizobium alarense TRM95111 | Isolate | Nodule |
| 712 | 8055617313 | Mesorhizobium onobrychidis OM4 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 31.37 |
| Metatranscriptomes | 0 |
| Isolates | 68.63 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.65 |
| Nodule | 55.65 |
| Rhizoplane | 1.56 |
| Rhizosphere | 20.07 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 17.07 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25157J39369_1001953 | 3300002741 | Bacteria | 6139 |
| 2 | JGI25150J39212_1000225 | 3300002774 | Bacteria | 30907 |
| 3 | JGI25159J45721_1000003 | 3300002987 | Bacteria | 274069 |
| 4 | JGI25151J46595_10000025 | 3300003187 | Bacteria | 213302 |
| 5 | JGI25151J46595_10006775 | 3300003187 | Bacteria | 5704 |
| 6 | JGI25151J46595_10014745 | 3300003187 | Bacteria | 3470 |
| 7 | JGI25165J46597_1000024 | 3300003214 | Bacteria | 335150 |
| 8 | JGI25165J46597_1000062 | 3300003214 | Bacteria | 206459 |
| 9 | JGI25160J50197_1000003 | 3300003354 | Bacteria | 482719 |
| 10 | Ga0055524_1001620 | 3300003775 | Bacteria | 12561 |
| 11 | Ga0055531_10000750 | 3300003794 | Bacteria | 27296 |
| 12 | Ga0058692_1000760 | 3300003856 | Bacteria | 12967 |
| 13 | Ga0058692_1001496 | 3300003856 | Bacteria | 8556 |
| 14 | Ga0055543_1001796 | 3300004625 | Bacteria | 7927 |
| 15 | Ga0065165_1000084 | 3300005262 | Bacteria | 154822 |
| 16 | Ga0065165_1002726 | 3300005262 | Bacteria | 14126 |
| 17 | Ga0070658_10002112 | 3300005327 | Bacteria | 16680 |
| 18 | Ga0070658_10026403 | 3300005327 | Bacteria | 4658 |
| 19 | Ga0070666_10010803 | 3300005335 | Bacteria | 5716 |
| 20 | Ga0070689_100001628 | 3300005340 | Bacteria | 14349 |
| 21 | Ga0070687_100006273 | 3300005343 | Bacteria | 4867 |
| 22 | Ga0070675_100002511 | 3300005354 | Bacteria | 13733 |
| 23 | Ga0070688_100012857 | 3300005365 | Bacteria | 4703 |
| 24 | Ga0070667_100007368 | 3300005367 | Bacteria | 9137 |
| 25 | Ga0068853_100048465 | 3300005539 | Bacteria | 3649 |
| 26 | Ga0070686_100005252 | 3300005544 | Bacteria | 7154 |
| 27 | Ga0070665_100065107 | 3300005548 | Bacteria | 3656 |
| 28 | Ga0070664_100015904 | 3300005564 | Bacteria | 6160 |
| 29 | Ga0068856_100056117 | 3300005614 | Bacteria | 3886 |
| 30 | Ga0068864_100001849 | 3300005618 | Bacteria | 17415 |
| 31 | Ga0068861_100029782 | 3300005719 | Bacteria | 3995 |
| 32 | Ga0068863_100002703 | 3300005841 | Bacteria | 17511 |
| 33 | Ga0068858_100018190 | 3300005842 | Bacteria | 6580 |
| 34 | Ga0068862_100000218 | 3300005844 | Bacteria | 63913 |
| 35 | Ga0068862_100030879 | 3300005844 | Bacteria | 4517 |
| 36 | Ga0075364_10000233 | 3300006051 | Bacteria | 26416 |
| 37 | Ga0075428_100010266 | 3300006844 | Bacteria | 10397 |
| 38 | Ga0075428_100071853 | 3300006844 | Bacteria | 3781 |
| 39 | Ga0075430_100021269 | 3300006846 | Bacteria | 5516 |
| 40 | Ga0075431_100026987 | 3300006847 | Bacteria | 5891 |
| 41 | Ga0075431_100029257 | 3300006847 | Bacteria | 5669 |
| 42 | Ga0075429_100009409 | 3300006880 | Bacteria | 8484 |
| 43 | Ga0079104_1000022 | 3300006946 | Bacteria | 223522 |
| 44 | Ga0079104_1002716 | 3300006946 | Bacteria | 9054 |
| 45 | Ga0099826_10000272 | 3300006948 | Bacteria | 22976 |
| 46 | Ga0099826_10002759 | 3300006948 | Bacteria | 11519 |
| 47 | Ga0111539_10001318 | 3300009094 | Bacteria | 33146 |
| 48 | Ga0111539_10006051 | 3300009094 | Bacteria | 15620 |
| 49 | Ga0105245_10000484 | 3300009098 | Bacteria | 36479 |
| 50 | Ga0114129_10010549 | 3300009147 | Bacteria | 13173 |
| 51 | Ga0105243_10017621 | 3300009148 | Bacteria | 5402 |
| 52 | Ga0105243_10024430 | 3300009148 | Bacteria | 4609 |
| 53 | Ga0105248_10006194 | 3300009177 | Bacteria | 13113 |
| 54 | Ga0105238_10004699 | 3300009551 | Bacteria | 13508 |
| 55 | Ga0105249_10009169 | 3300009553 | Bacteria | 8651 |
| 56 | Ga0105239_10051661 | 3300010375 | Bacteria | 4506 |
| 57 | Ga0105239_10080643 | 3300010375 | Bacteria | 3581 |
| 58 | Ga0157371_10000015 | 3300013102 | Bacteria | 339838 |
| 59 | Ga0157370_10049459 | 3300013104 | Bacteria | 4023 |
| 60 | Ga0157369_10052574 | 3300013105 | Bacteria | 4407 |
| 61 | Ga0171463_1001 | 3300013249 | Bacteria | 1406070 |
| 62 | Ga0157375_10044851 | 3300013308 | Bacteria | 4300 |
| 63 | Ga0163163_10020638 | 3300014325 | Bacteria | 6208 |
| 64 | Ga0183363_1021 | 3300015690 | Bacteria | 59303 |
| 65 | Ga0163161_10010106 | 3300017792 | Bacteria | 6532 |
| 66 | Ga0214544_1000012 | 3300021320 | Bacteria | 229808 |
| 67 | Ga0214544_1000024 | 3300021320 | Bacteria | 163562 |
| 68 | Ga0214542_1000011 | 3300021321 | Bacteria | 238260 |
| 69 | Ga0214542_1000015 | 3300021321 | Bacteria | 227912 |
| 70 | Ga0214543_1000004 | 3300021327 | Bacteria | 527190 |
| 71 | Ga0214543_1000011 | 3300021327 | Bacteria | 344093 |
| 72 | Ga0214543_1000027 | 3300021327 | Bacteria | 215065 |
| 73 | Ga0214543_1000064 | 3300021327 | Bacteria | 126778 |
| 74 | Ga0228711_1000041 | 3300022739 | Bacteria | 86591 |
| 75 | Ga0228711_1000528 | 3300022739 | Bacteria | 47804 |
| 76 | Ga0228710_1000006 | 3300022740 | Bacteria | 209134 |
| 77 | Ga0228710_1000024 | 3300022740 | Bacteria | 106694 |
| 78 | Ga0209436_100423 | 3300025208 | Bacteria | 18928 |
| 79 | Ga0207425_1000012 | 3300025245 | Bacteria | 528324 |
| 80 | Ga0207425_1001797 | 3300025245 | Bacteria | 8309 |
| 81 | Ga0209026_1000024 | 3300025250 | Bacteria | 355839 |
| 82 | Ga0209759_1000389 | 3300025256 | Bacteria | 54772 |
| 83 | Ga0209129_1000081 | 3300025258 | Bacteria | 183694 |
| 84 | Ga0209129_1002837 | 3300025258 | Bacteria | 8017 |
| 85 | Ga0209233_1000084 | 3300025261 | Bacteria | 335222 |
| 86 | Ga0209233_1000129 | 3300025261 | Bacteria | 206511 |
| 87 | Ga0209130_1000005 | 3300025284 | Bacteria | 599620 |
| 88 | Ga0209025_1000024 | 3300025294 | Bacteria | 528324 |
| 89 | Ga0209025_1000094 | 3300025294 | Bacteria | 241080 |
| 90 | Ga0209025_1000188 | 3300025294 | Bacteria | 154209 |
| 91 | Ga0209025_1000295 | 3300025294 | Bacteria | 111489 |
| 92 | Ga0209564_1000093 | 3300025295 | Bacteria | 245793 |
| 93 | Ga0209758_1000046 | 3300025297 | Bacteria | 364931 |
| 94 | Ga0209758_1003983 | 3300025297 | Bacteria | 12786 |
| 95 | Ga0209758_1003989 | 3300025297 | Bacteria | 12772 |
| 96 | Ga0209256_1000027 | 3300025299 | Bacteria | 423283 |
| 97 | Ga0209256_1001266 | 3300025299 | Bacteria | 27596 |
| 98 | Ga0207426_1000015 | 3300025302 | Bacteria | 599316 |
| 99 | Ga0209257_1001158 | 3300025304 | Bacteria | 33507 |
| 100 | Ga0207647_10002906 | 3300025904 | Bacteria | 12901 |
| 101 | Ga0207662_10010396 | 3300025918 | Bacteria | 5138 |
| 102 | Ga0207657_10003799 | 3300025919 | Bacteria | 16058 |
| 103 | Ga0207694_10016895 | 3300025924 | Bacteria | 5512 |
| 104 | Ga0207659_10014359 | 3300025926 | Bacteria | 5105 |
| 105 | Ga0207687_10001011 | 3300025927 | Bacteria | 19090 |
| 106 | Ga0207670_10006436 | 3300025936 | Bacteria | 6510 |
| 107 | Ga0207689_10045741 | 3300025942 | Bacteria | 3618 |
| 108 | Ga0207674_10009454 | 3300026116 | Bacteria | 11138 |
| 109 | Ga0207675_100018195 | 3300026118 | Bacteria | 6551 |
| 110 | Ga0207683_10041425 | 3300026121 | Bacteria | 4021 |
| 111 | Ga0209281_1000036 | 3300027111 | Bacteria | 369415 |
| 112 | Ga0209281_1000047 | 3300027111 | Bacteria | 326514 |
| 113 | Ga0209281_1000200 | 3300027111 | Bacteria | 135685 |
| 114 | Ga0209281_1000268 | 3300027111 | Bacteria | 100508 |
| 115 | Ga0209281_1000409 | 3300027111 | Bacteria | 65132 |
| 116 | Ga0209281_1000578 | 3300027111 | Bacteria | 43096 |
| 117 | Ga0209371_1000021 | 3300027312 | Bacteria | 555864 |
| 118 | Ga0209371_1000698 | 3300027312 | Bacteria | 28446 |
| 119 | Ga0209282_1000026 | 3300027666 | Bacteria | 166272 |
| 120 | Ga0209282_1000090 | 3300027666 | Bacteria | 65132 |
| 121 | Ga0209282_1000300 | 3300027666 | Bacteria | 24486 |
| 122 | Ga0209282_1032110 | 3300027666 | Bacteria | 3215 |
| 123 | Ga0207428_10002517 | 3300027907 | Bacteria | 18293 |
| 124 | Ga0207428_10021721 | 3300027907 | Bacteria | 5429 |
| 125 | Ga0268265_10005830 | 3300028380 | Bacteria | 8403 |
| 126 | Ga0307515_10000674 | 3300028794 | Bacteria | 78735 |
| 127 | Ga0268256_1000020 | 3300030500 | Bacteria | 557873 |
| 128 | Ga0265320_10000928 | 3300031240 | Bacteria | 21873 |
| 129 | Ga0265320_10004959 | 3300031240 | Bacteria | 8633 |
| 130 | Ga0265327_10000428 | 3300031251 | Bacteria | 76098 |
| 131 | Ga0307513_10000180 | 3300031456 | Bacteria | 91340 |
| 132 | Ga0265313_10001410 | 3300031595 | Bacteria | 22500 |
| 133 | Ga0265314_10007331 | 3300031711 | Bacteria | 9575 |
| 134 | Ga0307405_10010850 | 3300031731 | Bacteria | 4744 |
| 135 | Ga0315914_1000008 | 3300031967 | Bacteria | 209133 |
| 136 | Ga0315914_1000167 | 3300031967 | Bacteria | 65125 |
| 137 | Ga0315913_1000038 | 3300033430 | Bacteria | 64995 |
| 138 | Ga0315913_1000137 | 3300033430 | Bacteria | 47802 |
| 139 | Ga0315915_1000014 | 3300033464 | Bacteria | 171068 |
| 140 | Ga0315915_1000019 | 3300033464 | Bacteria | 129295 |
| 141 | Ga0373935_0039226 | 3300035692 | Bacteria | 2969 |
| 142 | Ga0373927_0000347 | 3300035695 | Bacteria | 36341 |
| 143 | Ga0395899_0000440 | 3300037312 | Bacteria | 47632 |
| 144 | Ga0395900_0000509 | 3300037418 | Bacteria | 54852 |
| 145 | Ga0395898_0000908 | 3300037466 | Bacteria | 47632 |
| 146 | Ga0395905_0000623 | 3300037471 | Bacteria | 47316 |
| 147 | Ga0395905_0000700 | 3300037471 | Bacteria | 44432 |
| 148 | Ga0395905_0011190 | 3300037471 | Bacteria | 8675 |
| 149 | Ga0395905_0019540 | 3300037471 | Bacteria | 6421 |
| 150 | Ga0395901_0000142 | 3300038443 | Bacteria | 92246 |
| 151 | Ga0436365_0137793 | 3300039437 | Bacteria | 11084 |
| 152 | Ga0439436_0002688 | 3300041404 | Bacteria | 5365 |
| 153 | Ga0439465_0005556 | 3300041413 | Bacteria | 4019 |
| 154 | Ga0439449_0012907 | 3300042007 | Bacteria | 3141 |
| 155 | Ga0439458_0001040 | 3300042157 | Bacteria | 7085 |
| 156 | Ga0466972_0002327 | 3300044658 | Bacteria | 9355 |
| 157 | Ga0466972_0026360 | 3300044658 | Bacteria | 2881 |
| 158 | Ga0466960_0002841 | 3300044901 | Bacteria | 6569 |
| 159 | Ga0451576_0029340 | 3300045051 | Bacteria | 5887 |
| 160 | Ga0451576_0075068 | 3300045051 | Bacteria | 3518 |
| 161 | Ga0495583_0003339 | 3300046506 | Bacteria | 12408 |
| 162 | Ga0495583_0012156 | 3300046506 | Bacteria | 4895 |
| 163 | Ga0495606_0002572 | 3300046507 | Bacteria | 20783 |
| 164 | Ga0495606_0021775 | 3300046507 | Bacteria | 4689 |
| 165 | Ga0495643_0000582 | 3300046522 | Bacteria | 44578 |
| 166 | Ga0495643_0014326 | 3300046522 | Bacteria | 4720 |
| 167 | Ga0495648_0035494 | 3300046524 | Bacteria | 3232 |
| 168 | Ga0495663_0001308 | 3300046525 | Bacteria | 7893 |
| 169 | Ga0495654_0000486 | 3300046530 | Bacteria | 32788 |
| 170 | Ga0495668_0000401 | 3300046616 | Bacteria | 56860 |
| 171 | Ga0495625_0006085 | 3300046660 | Bacteria | 10823 |
| 172 | Ga0495588_0003135 | 3300046674 | Bacteria | 7155 |
| 173 | Ga0495683_0001945 | 3300047323 | Bacteria | 12903 |
| 174 | Ga0495687_000512 | 3300047443 | Bacteria | 46683 |
| 175 | Ga0495681_0001903 | 3300047470 | Bacteria | 15323 |
| 176 | Ga0495686_0000989 | 3300047472 | Bacteria | 34642 |
| 177 | Ga0495686_0005059 | 3300047472 | Bacteria | 10566 |
| 178 | Ga0496102_0001268 | 3300048905 | Bacteria | 22808 |
| 179 | Ga0496103_0000307 | 3300048906 | Bacteria | 45142 |
| 180 | Ga0496105_0000190 | 3300048908 | Bacteria | 41092 |
| 181 | Ga0496111_0004566 | 3300048914 | Bacteria | 8767 |
| 182 | Ga0496113_0076245 | 3300048916 | Bacteria | 2561 |
| 183 | Ga0496114_0003105 | 3300048917 | Bacteria | 12733 |
| 184 | Ga0496115_0000251 | 3300048918 | Bacteria | 47811 |
| 185 | Ga0496116_0002014 | 3300048919 | Bacteria | 21842 |
| 186 | Ga0496116_0039285 | 3300048919 | Bacteria | 3273 |
| 187 | Ga0496117_0000002 | 3300048920 | Bacteria | 2483758 |
| 188 | Ga0496117_0000182 | 3300048920 | Bacteria | 128076 |
| 189 | Ga0496117_0003603 | 3300048920 | Bacteria | 17850 |
| 190 | Ga0496117_0029463 | 3300048920 | Bacteria | 4231 |
| 191 | Ga0496118_0000125 | 3300048921 | Bacteria | 136422 |
| 192 | Ga0496118_0000355 | 3300048921 | Bacteria | 77500 |
| 193 | Ga0496118_0021287 | 3300048921 | Bacteria | 5714 |
| 194 | Ga0496119_0003199 | 3300048922 | Bacteria | 17159 |
| 195 | Ga0496119_0005531 | 3300048922 | Bacteria | 12047 |
| 196 | Ga0496120_0001026 | 3300048923 | Bacteria | 37324 |
| 197 | Ga0496120_0016215 | 3300048923 | Bacteria | 4876 |
| 198 | Ga0496121_0000001 | 3300048924 | Bacteria | 1830318 |
| 199 | Ga0496121_0000906 | 3300048924 | Bacteria | 53394 |
| 200 | Ga0496121_0018124 | 3300048924 | Bacteria | 7123 |
| 201 | Ga0496121_0022318 | 3300048924 | Bacteria | 6150 |
| 202 | Ga0496121_0025039 | 3300048924 | Bacteria | 5681 |
| 203 | Ga0496122_0000001 | 3300048925 | Bacteria | 1827766 |
| 204 | Ga0496122_0004380 | 3300048925 | Bacteria | 17589 |
| 205 | Ga0496123_0000001 | 3300048926 | Bacteria | 1831497 |
| 206 | Ga0496123_0000544 | 3300048926 | Bacteria | 64764 |
| 207 | Ga0496124_0000082 | 3300048927 | Bacteria | 208248 |
| 208 | Ga0496124_0000112 | 3300048927 | Bacteria | 166282 |
| 209 | Ga0496124_0001589 | 3300048927 | Bacteria | 32712 |
| 210 | Ga0496124_0011598 | 3300048927 | Bacteria | 8795 |
| 211 | Ga0496125_0000001 | 3300048928 | Bacteria | 1766138 |
| 212 | Ga0496125_0000372 | 3300048928 | Bacteria | 84272 |
| 213 | Ga0496125_0000730 | 3300048928 | Bacteria | 54485 |
| 214 | Ga0496126_0000221 | 3300048929 | Bacteria | 124193 |
| 215 | Ga0496126_0004329 | 3300048929 | Bacteria | 17037 |
| 216 | Ga0501031_0021492 | 3300049568 | Bacteria | 4206 |
| 217 | Ga0501031_0021556 | 3300049568 | Bacteria | 4200 |
| 218 | Ga0501032_0007647 | 3300049569 | Bacteria | 7880 |
| 219 | Ga0501033_0000779 | 3300049570 | Bacteria | 29299 |
| 220 | Ga0501033_0032197 | 3300049570 | Bacteria | 3937 |
| 221 | Ga0501037_0000077 | 3300049573 | Bacteria | 91081 |
| 222 | Ga0501037_0024801 | 3300049573 | Bacteria | 4434 |
| 223 | Ga0501043_0000114 | 3300049579 | Bacteria | 75782 |
| 224 | Ga0501046_0018297 | 3300049580 | Bacteria | 5833 |
| 225 | Ga0501047_0016074 | 3300049581 | Bacteria | 7137 |
| 226 | Ga0501047_0021070 | 3300049581 | Bacteria | 6259 |
| 227 | Ga0501069_0000016 | 3300049585 | Bacteria | 142565 |
| 228 | Ga0501069_0037130 | 3300049585 | Bacteria | 2688 |
| 229 | Ga0501070_0000048 | 3300049586 | Bacteria | 105951 |
| 230 | Ga0501070_0010043 | 3300049586 | Bacteria | 8010 |
| 231 | Ga0501073_0005974 | 3300049589 | Bacteria | 9083 |
| 232 | Ga0501074_0001298 | 3300049590 | Bacteria | 16571 |
| 233 | Ga0501080_0001324 | 3300049742 | Bacteria | 20643 |
| 234 | Ga0501081_0040385 | 3300049743 | Bacteria | 3195 |
| 235 | Ga0501083_0002018 | 3300049744 | Bacteria | 13963 |
| 236 | Ga0501083_0015039 | 3300049744 | Bacteria | 5416 |
| 237 | Ga0501035_0000048 | 3300049822 | Bacteria | 146466 |
| 238 | Ga0501035_0005812 | 3300049822 | Bacteria | 11629 |
| 239 | Ga0501035_0008447 | 3300049822 | Bacteria | 9591 |
| 240 | Ga0501044_0000003 | 3300049823 | Bacteria | 345647 |
| 241 | Ga0501044_0008569 | 3300049823 | Bacteria | 11203 |
| 242 | Ga0501044_0012802 | 3300049823 | Bacteria | 9085 |
| 243 | Ga0501044_0019650 | 3300049823 | Bacteria | 7221 |
| 244 | nmdc:mga00v17_188_c1 | 3300050491 | Bacteria | 37077 |
| 245 | nmdc:mga00v17_6_c1 | 3300050491 | Bacteria | 179509 |
| 246 | nmdc:mga0yw44_10639_c1 | 3300050492 | Bacteria | 4710 |
| 247 | nmdc:mga07m45_30643_c1 | 3300050496 | Bacteria | 2980 |
| 248 | nmdc:mga09592_20378_c1 | 3300050508 | Bacteria | 5451 |
| 249 | nmdc:mga09592_3554_c1 | 3300050508 | Bacteria | 12587 |
| 250 | nmdc:mga08y16_571_c2 | 3300050511 | Bacteria | 30328 |
| 251 | Ga0500643_000021 | 3300053087 | Bacteria | 284326 |
| 252 | Ga0500559_0004224 | 3300053136 | Bacteria | 6872 |
| 253 | Ga0500561_0000363 | 3300053137 | Bacteria | 7515 |
| 254 | Ga0500568_0000144 | 3300053139 | Bacteria | 62519 |
| 255 | Ga0500568_0002628 | 3300053139 | Bacteria | 10439 |
| 256 | Ga0500624_000396 | 3300053157 | Bacteria | 13695 |
| 257 | Ga0500636_0000013 | 3300053177 | Bacteria | 130122 |
| 258 | Ga0500636_0018664 | 3300053177 | Bacteria | 4101 |
| 259 | Ga0500596_001274 | 3300053735 | Bacteria | 5090 |
| 260 | Ga0501082_0008571 | 3300060353 | Bacteria | 8820 |
| 261 | Ga0501082_0075746 | 3300060353 | Bacteria | 2899 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3aqo-assembly2.cif.gz_B | structure and function of a membrane component secdf that enhances protein export | 0.8049 | 162 | 364 |
| 3aqo-assembly2.cif.gz_B | structure and function of a membrane component secdf that enhances protein export | 0.7424 | 162 | 364 |
| 7bfe-assembly1.cif.gz_E | circular permutant of ribosomal protein s6, p54-55 truncated, l21a mutant. | 0.695 | 587 | 665 |
| 7b90-assembly1.cif.gz_E | circular permutant of ribosomal protein s6, p54-55 truncated, i8a mutant | 0.6938 | 586 | 665 |
| 6m49-assembly1.cif.gz_B | cryo-em structure of scap/insig complex in the present of 25-hydroxyl cholesterol. | 0.6892 | 370 | 537 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0AG90_434_612_1.20.1640.10 | Mainly Alpha;Up-down Bundle;Multidrug efflux transporter AcrB transmembrane fold;Multidrug efflux transporter AcrB transmembrane domain | 0.9324 | 357 | 534 | 1.20.1640.10 |
| af_P0AG90_434_612_1.20.1640.10 | Mainly Alpha;Up-down Bundle;Multidrug efflux transporter AcrB transmembrane fold;Multidrug efflux transporter AcrB transmembrane domain | 0.9224 | 357 | 534 | 1.20.1640.10 |
| af_P9WGP1_361_542_1.20.1640.10 | Mainly Alpha;Up-down Bundle;Multidrug efflux transporter AcrB transmembrane fold;Multidrug efflux transporter AcrB transmembrane domain | 0.9155 | 351 | 526 | 1.20.1640.10 |
| af_P9WGP1_237_360_3.30.1360.200 | Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2; | 0.889 | 242 | 350 | 3.30.1360.200 |
| af_D3ZRK8_252_456_1.20.1640.10 | Mainly Alpha;Up-down Bundle;Multidrug efflux transporter AcrB transmembrane fold;Multidrug efflux transporter AcrB transmembrane domain | 0.8865 | 371 | 525 | 1.20.1640.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0G1WJV2-F1-model_v4 | Protein translocase subunit SecD | 0.9571 | 387 | 529 |
GO:0005886
GO:0015031 |
| AF-X1M6Y0-F1-model_v4 | Protein export membrane protein SecD/SecF C-terminal domain-containing protein | 0.9409 | 383 | 534 |
GO:0005886
GO:0015031 GO:0022857 |
| AF-A0A529LEU2-F1-model_v4 | Protein translocase subunit SecDF | 0.9292 | 241 | 344 |
GO:0005886
GO:0015031 |
| AF-A0A2D3VUD0-F1-model_v4 | Protein translocase subunit SecD | 0.9148 | 354 | 531 |
GO:0005886
GO:0006886 GO:0015450 |
| AF-A0A1G5P8V2-F1-model_v4 | Protein translocase subunit SecD | 0.913 | 1 | 537 |
GO:0005886
GO:0006605 GO:0015450 GO:0043952 GO:0065002 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar