F482656

General Info

Members Datasets Scaffolds Average Seq Length
830 277 1660 102

Family's Representative Sequence

Representative Sequence 3300031911|Ga0307412_11144775|Ga0307412_111447752
Length 115
Sequence VSTVVEQLIPSSKVVTVEIAGQRYPIRSGLDERYVAELAAYVESRMRVASDSAPASDLLGLAILVALNITDELFRLRAQHSEANGELNERALRLERIVDEVLADLDAPAENVRPQ

Samples

Sample ID Description Type Environment
1 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
5 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
6 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
7 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
8 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
9 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
10 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
11 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
12 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
14 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
15 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
28 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
41 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
42 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
43 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
44 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
45 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
46 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
47 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
48 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
49 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
50 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
51 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
52 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
53 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
54 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
55 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
56 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
57 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
58 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
59 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
60 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
61 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
62 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
63 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
64 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
65 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
66 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
67 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
68 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
69 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
70 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
71 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
72 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
73 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
74 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
75 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
76 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
77 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
78 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
79 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
80 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
81 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
82 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
83 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
84 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
85 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
87 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
88 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
89 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
90 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
91 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
92 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
93 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
94 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
96 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
98 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
100 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
101 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
102 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
103 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
104 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
105 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
106 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
107 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
108 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
109 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
110 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
111 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
112 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
113 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
114 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
115 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
116 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
117 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
118 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
119 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
120 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
121 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
122 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
178 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
182 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
183 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
184 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
185 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
186 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
187 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
188 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
189 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
190 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
191 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
192 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
193 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
194 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
195 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
196 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
197 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
198 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
199 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
200 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
201 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
202 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
203 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
204 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
205 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
206 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
207 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
208 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
209 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
210 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
211 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
212 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
213 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
214 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
215 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
216 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
217 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
218 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
219 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
220 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
221 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
222 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
223 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
224 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
225 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
226 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
227 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
228 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
229 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
230 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
231 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
232 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
233 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
234 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
235 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
236 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
237 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
238 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
239 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
240 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
241 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
242 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
243 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
253 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
254 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
255 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
256 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
257 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
258 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
259 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
260 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
261 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
262 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
263 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
264 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
265 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
266 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
267 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
268 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
269 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
270 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
271 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
272 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
273 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
274 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
275 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
276 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
277 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.52
Metatranscriptomes 0.48
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.72
Rhizosphere 98.67
Stem 0
Stem Tuber 0
Unclassified 36.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307412_11144775 3300031911 Bacteria 694
2 SwRhRL2b_contig_1987167 2162886007 Bacteria 1530
3 MRS1b_contig_5900326 2162886011 Unclassified 1023
4 MRS1b_contig_7203457 2162886011 Unclassified 1857
5 MBSR1b_contig_7265978 2162886012 Bacteria 1187
6 ARCol0yngRDRAFT_1003926 3300000652 Bacteria 1080
7 JGI24746J21847_1002532 3300001977 Bacteria 2908
8 JGI24034J26672_10075648 3300002239 Unclassified 609
9 JGI24742J22300_10026837 3300002244 Unclassified 997
10 JGI25406J46586_10010020 3300003203 Bacteria 4224
11 JGI25406J46586_10040444 3300003203 Unclassified 1653
12 JGI25406J46586_10062171 3300003203 Unclassified 1200
13 Ga0058859_11627370 3300004798 Unclassified 833
14 Ga0058859_11742140 3300004798 Unclassified 716
15 Ga0058859_11760998 3300004798 Bacteria 903
16 Ga0058860_10022288 3300004801 Bacteria 878
17 Ga0065714_10112506 3300005288 Unclassified 1455
18 Ga0065714_10496070 3300005288 Unclassified 508
19 Ga0065704_10001460 3300005289 Bacteria 9189
20 Ga0065704_10201218 3300005289 Bacteria 1145
21 Ga0065704_10559376 3300005289 Unclassified 611
22 Ga0065712_10125890 3300005290 Unclassified 1608
23 Ga0065712_10141591 3300005290 Unclassified 1445
24 Ga0065712_10148291 3300005290 Unclassified 1387
25 Ga0065712_10173504 3300005290 Bacteria 1230
26 Ga0065712_10241480 3300005290 Unclassified 983
27 Ga0065712_10566540 3300005290 Bacteria 608
28 Ga0065715_10003843 3300005293 Bacteria 5658
29 Ga0065715_10009499 3300005293 Bacteria 2323
30 Ga0065715_10099087 3300005293 Bacteria 3460
31 Ga0065715_10310408 3300005293 Unclassified 1014
32 Ga0065715_10488068 3300005293 Bacteria 788
33 Ga0065715_10677353 3300005293 Bacteria 645
34 Ga0065707_10005888 3300005295 Bacteria 4515
35 Ga0065707_10092932 3300005295 Bacteria 3696
36 Ga0065707_10124504 3300005295 Bacteria 2041
37 Ga0065707_10163380 3300005295 Bacteria 1543
38 Ga0065707_10244679 3300005295 Bacteria 1144
39 Ga0065707_10406119 3300005295 Unclassified 832
40 Ga0070676_10024469 3300005328 Bacteria 3402
41 Ga0070676_10072064 3300005328 Unclassified 2076
42 Ga0070676_10216645 3300005328 Unclassified 1262
43 Ga0070676_10918854 3300005328 Bacteria 653
44 Ga0070690_100044149 3300005330 Bacteria 2828
45 Ga0070690_100182696 3300005330 Bacteria 1450
46 Ga0070690_100398996 3300005330 Unclassified 1010
47 Ga0070690_101469315 3300005330 Bacteria 550
48 Ga0070670_100129571 3300005331 Bacteria 2178
49 Ga0070670_100241478 3300005331 Bacteria 1573
50 Ga0070670_100269112 3300005331 Bacteria 1486
51 Ga0070670_100286192 3300005331 Bacteria 1440
52 Ga0070670_100388357 3300005331 Unclassified 1230
53 Ga0070670_100762046 3300005331 Unclassified 873
54 Ga0070670_101509095 3300005331 Unclassified 617
55 Ga0070670_102179705 3300005331 Unclassified 511
56 Ga0070677_10001862 3300005333 Bacteria 6666
57 Ga0070677_10038368 3300005333 Bacteria 1874
58 Ga0070677_10047696 3300005333 Bacteria 1718
59 Ga0070677_10554025 3300005333 Bacteria 631
60 Ga0068869_100037759 3300005334 Bacteria 3436
61 Ga0068869_100045881 3300005334 Bacteria 3148
62 Ga0068869_100277144 3300005334 Bacteria 1348
63 Ga0068869_100902924 3300005334 Unclassified 765
64 Ga0070666_10066247 3300005335 Bacteria 2450
65 Ga0070666_10383139 3300005335 Bacteria 1009
66 Ga0070680_100159574 3300005336 Bacteria 1894
67 Ga0070680_100525079 3300005336 Unclassified 1014
68 Ga0068868_100042564 3300005338 Bacteria 3545
69 Ga0068868_100175727 3300005338 Bacteria 1775
70 Ga0068868_100704322 3300005338 Bacteria 904
71 Ga0070660_100665273 3300005339 Bacteria 872
72 Ga0070689_100023774 3300005340 Bacteria 4592
73 Ga0070689_100063437 3300005340 Bacteria 2875
74 Ga0070689_100696938 3300005340 Unclassified 886
75 Ga0070691_10102868 3300005341 Bacteria 1421
76 Ga0070691_10397709 3300005341 Bacteria 776
77 Ga0070687_100012979 3300005343 Bacteria 3697
78 Ga0070687_100031776 3300005343 Bacteria 2592
79 Ga0070687_100318351 3300005343 Unclassified 993
80 Ga0070661_100003093 3300005344 Bacteria 11453
81 Ga0070661_100109675 3300005344 Bacteria 2060
82 Ga0070661_100433384 3300005344 Bacteria 1044
83 Ga0070692_10474993 3300005345 Bacteria 805
84 Ga0070692_10965095 3300005345 Bacteria 594
85 Ga0070668_100040753 3300005347 Bacteria 3555
86 Ga0070668_100523991 3300005347 Unclassified 1028
87 Ga0070668_101393140 3300005347 Bacteria 639
88 Ga0070669_100014718 3300005353 Bacteria 5569
89 Ga0070669_100016387 3300005353 Bacteria 5287
90 Ga0070669_100039550 3300005353 Bacteria 3427
91 Ga0070669_100059664 3300005353 Bacteria 2801
92 Ga0070669_100340927 3300005353 Unclassified 1214
93 Ga0070675_100042973 3300005354 Bacteria 3692
94 Ga0070675_100054935 3300005354 Bacteria 3277
95 Ga0070675_100067198 3300005354 Bacteria 2966
96 Ga0070675_100298272 3300005354 Unclassified 1419
97 Ga0070675_100373534 3300005354 Unclassified 1268
98 Ga0070675_100892409 3300005354 Unclassified 815
99 Ga0070675_101364454 3300005354 Unclassified 653
100 Ga0070675_101742042 3300005354 Unclassified 575
101 Ga0070671_100063501 3300005355 Bacteria 3075
102 Ga0070671_100109689 3300005355 Bacteria 2318
103 Ga0070671_100352295 3300005355 Bacteria 1256
104 Ga0070671_100545329 3300005355 Bacteria 1000
105 Ga0070671_100722974 3300005355 Bacteria 864
106 Ga0070674_100007028 3300005356 Bacteria 6615
107 Ga0070674_100062257 3300005356 Unclassified 2607
108 Ga0070674_100181768 3300005356 Unclassified 1611
109 Ga0070674_100867855 3300005356 Bacteria 784
110 Ga0070674_101046988 3300005356 Bacteria 718
111 Ga0070674_101262431 3300005356 Unclassified 657
112 Ga0070673_100008649 3300005364 Bacteria 6782
113 Ga0070673_100061684 3300005364 Unclassified 2975
114 Ga0070673_100276071 3300005364 Unclassified 1472
115 Ga0070673_100571249 3300005364 Unclassified 1029
116 Ga0070673_101225257 3300005364 Unclassified 703
117 Ga0070673_102263922 3300005364 Unclassified 516
118 Ga0070688_100002841 3300005365 Bacteria 8825
119 Ga0070688_100047588 3300005365 Bacteria 2661
120 Ga0070688_100057626 3300005365 Bacteria 2443
121 Ga0070688_100092327 3300005365 Bacteria 1980
122 Ga0070688_100732020 3300005365 Bacteria 768
123 Ga0070659_100014099 3300005366 Bacteria 5965
124 Ga0070659_100785780 3300005366 Bacteria 827
125 Ga0070659_101062098 3300005366 Unclassified 713
126 Ga0070667_100116500 3300005367 Bacteria 2321
127 Ga0070667_100181819 3300005367 Bacteria 1860
128 Ga0070667_100551294 3300005367 Bacteria 1060
129 Ga0070667_100937711 3300005367 Bacteria 806
130 Ga0070667_101998326 3300005367 Unclassified 546
131 Ga0070703_10129715 3300005406 Unclassified 925
132 Ga0070703_10524038 3300005406 Bacteria 537
133 Ga0070703_10618596 3300005406 Bacteria 502
134 Ga0070701_10070405 3300005438 Bacteria 1869
135 Ga0070701_10174534 3300005438 Bacteria 1254
136 Ga0070705_100078770 3300005440 Bacteria 2016
137 Ga0070705_100188226 3300005440 Bacteria 1404
138 Ga0070705_100193834 3300005440 Bacteria 1387
139 Ga0070705_100916158 3300005440 Bacteria 706
140 Ga0070705_101611046 3300005440 Unclassified 546
141 Ga0070700_100067852 3300005441 Unclassified 2266
142 Ga0070700_100248748 3300005441 Bacteria 1274
143 Ga0070700_100273592 3300005441 Bacteria 1221
144 Ga0070700_100586713 3300005441 Unclassified 871
145 Ga0070694_100063096 3300005444 Bacteria 2533
146 Ga0070694_100322244 3300005444 Bacteria 1190
147 Ga0070694_100591613 3300005444 Unclassified 892
148 Ga0070708_100012556 3300005445 Bacteria 6915
149 Ga0070663_100405969 3300005455 Unclassified 1115
150 Ga0070678_100027052 3300005456 Bacteria 3888
151 Ga0070678_100029501 3300005456 Unclassified 3757
152 Ga0070678_100106719 3300005456 Bacteria 2183
153 Ga0070678_100123091 3300005456 Bacteria 2048
154 Ga0070678_100231933 3300005456 Bacteria 1539
155 Ga0070678_100311827 3300005456 Unclassified 1341
156 Ga0070678_101005103 3300005456 Bacteria 767
157 Ga0070678_101604056 3300005456 Bacteria 611
158 Ga0070662_100013173 3300005457 Bacteria 5497
159 Ga0070662_100465790 3300005457 Bacteria 1051
160 Ga0070662_100599234 3300005457 Unclassified 927
161 Ga0070662_101598834 3300005457 Bacteria 562
162 Ga0070681_10899454 3300005458 Unclassified 804
163 Ga0068867_100000147 3300005459 Bacteria 45184
164 Ga0068867_100109708 3300005459 Unclassified 2119
165 Ga0068867_100316514 3300005459 Unclassified 1291
166 Ga0068867_100879300 3300005459 Unclassified 805
167 Ga0068867_101277897 3300005459 Bacteria 677
168 Ga0070685_10010874 3300005466 Bacteria 4743
169 Ga0070685_10033576 3300005466 Bacteria 2884
170 Ga0070685_10435148 3300005466 Unclassified 916
171 Ga0070706_100173631 3300005467 Bacteria 2012
172 Ga0070707_100124655 3300005468 Bacteria 2502
173 Ga0070707_101885814 3300005468 Bacteria 565
174 Ga0070698_100069046 3300005471 Bacteria 3549
175 Ga0070699_100014984 3300005518 Bacteria 6663
176 Ga0070699_100031153 3300005518 Bacteria 4605
177 Ga0070699_100077488 3300005518 Bacteria 2894
178 Ga0070699_100571773 3300005518 Unclassified 1029
179 Ga0070699_100998151 3300005518 Bacteria 767
180 Ga0070699_101218797 3300005518 Bacteria 690
181 Ga0070679_100749106 3300005530 Bacteria 920
182 Ga0070679_101393473 3300005530 Unclassified 647
183 Ga0070684_100316272 3300005535 Unclassified 1434
184 Ga0070684_101497035 3300005535 Bacteria 636
185 Ga0070684_101777726 3300005535 Unclassified 582
186 Ga0070697_100993668 3300005536 Unclassified 746
187 Ga0070672_100041272 3300005543 Unclassified 3546
188 Ga0070672_100084820 3300005543 Bacteria 2544
189 Ga0070672_100225620 3300005543 Bacteria 1572
190 Ga0070672_100256679 3300005543 Bacteria 1473
191 Ga0070672_100260138 3300005543 Unclassified 1463
192 Ga0070672_100370474 3300005543 Bacteria 1224
193 Ga0070672_101073911 3300005543 Bacteria 715
194 Ga0070672_101407019 3300005543 Unclassified 624
195 Ga0070686_100036659 3300005544 Unclassified 3038
196 Ga0070686_100115327 3300005544 Unclassified 1837
197 Ga0070686_100240604 3300005544 Bacteria 1318
198 Ga0070686_100486140 3300005544 Bacteria 955
199 Ga0070686_101926914 3300005544 Unclassified 505
200 Ga0070695_100558011 3300005545 Bacteria 894
201 Ga0070695_100622532 3300005545 Unclassified 849
202 Ga0070695_101381550 3300005545 Unclassified 584
203 Ga0070696_100033868 3300005546 Bacteria 3512
204 Ga0070696_100604380 3300005546 Bacteria 885
205 Ga0070696_101040986 3300005546 Unclassified 685
206 Ga0070696_101720486 3300005546 Unclassified 541
207 Ga0070693_100335233 3300005547 Bacteria 1031
208 Ga0070693_100890664 3300005547 Bacteria 666
209 Ga0070693_100978838 3300005547 Unclassified 639
210 Ga0070665_100042221 3300005548 Bacteria 4584
211 Ga0070665_100907376 3300005548 Unclassified 894
212 Ga0070704_100009821 3300005549 Bacteria 5804
213 Ga0070704_100583850 3300005549 Unclassified 980
214 Ga0070704_100859645 3300005549 Unclassified 814
215 Ga0070704_101449772 3300005549 Unclassified 630
216 Ga0068855_101141074 3300005563 Bacteria 813
217 Ga0070664_100006202 3300005564 Bacteria 9659
218 Ga0070664_100020437 3300005564 Bacteria 5451
219 Ga0070664_100153258 3300005564 Bacteria 2035
220 Ga0070664_100479572 3300005564 Bacteria 1144
221 Ga0070664_100887941 3300005564 Bacteria 835
222 Ga0070664_101013772 3300005564 Unclassified 780
223 Ga0068857_100104201 3300005577 Unclassified 2547
224 Ga0068857_100144314 3300005577 Unclassified 2153
225 Ga0068857_100916955 3300005577 Unclassified 841
226 Ga0068854_100460737 3300005578 Archaea 1064
227 Ga0068854_100785694 3300005578 Bacteria 829
228 Ga0068856_100166847 3300005614 Bacteria 2213
229 Ga0070702_100569448 3300005615 Unclassified 844
230 Ga0070702_101733200 3300005615 Unclassified 520
231 Ga0068852_100030148 3300005616 Bacteria 4462
232 Ga0068852_102437728 3300005616 Unclassified 544
233 Ga0068859_100036834 3300005617 Bacteria 4912
234 Ga0068859_100068816 3300005617 Bacteria 3575
235 Ga0068859_100107003 3300005617 Bacteria 2856
236 Ga0068859_100108108 3300005617 Bacteria 2842
237 Ga0068859_100214077 3300005617 Bacteria 2014
238 Ga0068859_100653371 3300005617 Bacteria 1143
239 Ga0068864_100013579 3300005618 Bacteria 6752
240 Ga0068864_100021793 3300005618 Bacteria 5368
241 Ga0068864_100199436 3300005618 Bacteria 1837
242 Ga0068864_100206293 3300005618 Bacteria 1808
243 Ga0068864_100226346 3300005618 Bacteria 1728
244 Ga0068864_100271495 3300005618 Bacteria 1580
245 Ga0068864_100478669 3300005618 Bacteria 1195
246 Ga0068864_101604570 3300005618 Unclassified 655
247 Ga0068864_101619627 3300005618 Bacteria 651
248 Ga0068861_100004416 3300005719 Bacteria 9428
249 Ga0068861_100125708 3300005719 Bacteria 2074
250 Ga0068861_100438546 3300005719 Unclassified 1167
251 Ga0068870_10007223 3300005840 Bacteria 4947
252 Ga0068870_10043392 3300005840 Bacteria 2345
253 Ga0068870_10063734 3300005840 Bacteria 1989
254 Ga0068870_10154233 3300005840 Bacteria 1356
255 Ga0068870_10552485 3300005840 Bacteria 775
256 Ga0068863_100003088 3300005841 Bacteria 16457
257 Ga0068863_100346548 3300005841 Bacteria 1446
258 Ga0068863_100877830 3300005841 Unclassified 896
259 Ga0068858_100009208 3300005842 Bacteria 9433
260 Ga0068858_100114282 3300005842 Bacteria 2522
261 Ga0068858_101708487 3300005842 Unclassified 622
262 Ga0068858_102503470 3300005842 Unclassified 510
263 Ga0068860_100014554 3300005843 Bacteria 7698
264 Ga0068860_100057619 3300005843 Bacteria 3693
265 Ga0068860_100688526 3300005843 Unclassified 1031
266 Ga0068860_100902856 3300005843 Unclassified 899
267 Ga0068862_100001293 3300005844 Bacteria 23404
268 Ga0068862_100009919 3300005844 Bacteria 7865
269 Ga0068862_100175950 3300005844 Bacteria 1918
270 Ga0068862_100312285 3300005844 Bacteria 1449
271 Ga0068862_100677788 3300005844 Bacteria 997
272 Ga0068862_101706668 3300005844 Bacteria 638
273 Ga0068862_101818192 3300005844 Bacteria 618
274 Ga0068862_101923585 3300005844 Unclassified 602
275 Ga0081455_10099678 3300005937 Unclassified 2336
276 Ga0081539_10000164 3300005985 Bacteria 154639
277 Ga0081539_10000334 3300005985 Bacteria 104401
278 Ga0081539_10002616 3300005985 Bacteria 24630
279 Ga0075432_10042337 3300006058 Archaea 1593
280 Ga0075427_10100732 3300006194 Unclassified 537
281 Ga0097621_100367117 3300006237 Bacteria 1283
282 Ga0097621_100381638 3300006237 Bacteria 1259
283 Ga0097621_101244577 3300006237 Bacteria 702
284 Ga0097621_101559104 3300006237 Unclassified 627
285 Ga0068871_100063036 3300006358 Unclassified 3031
286 Ga0068871_100146119 3300006358 Unclassified 2013
287 Ga0068871_100654268 3300006358 Bacteria 959
288 Ga0068871_100727361 3300006358 Unclassified 911
289 Ga0068871_101164041 3300006358 Unclassified 722
290 Ga0068871_101246310 3300006358 Unclassified 698
291 Ga0068871_102167681 3300006358 Unclassified 529
292 Ga0075428_100007951 3300006844 Bacteria 11763
293 Ga0075428_100009580 3300006844 Bacteria 10757
294 Ga0075428_100035912 3300006844 Bacteria 5462
295 Ga0075428_100039280 3300006844 Bacteria 5208
296 Ga0075428_100115920 3300006844 Bacteria 2918
297 Ga0075428_100143908 3300006844 Unclassified 2591
298 Ga0075428_100628906 3300006844 Bacteria 1145
299 Ga0075428_100810002 3300006844 Bacteria 995
300 Ga0075428_101307522 3300006844 Unclassified 762
301 Ga0075428_101943844 3300006844 Unclassified 610
302 Ga0075430_100005300 3300006846 Bacteria 10881
303 Ga0075430_100023497 3300006846 Bacteria 5248
304 Ga0075430_100088638 3300006846 Bacteria 2589
305 Ga0075430_100225377 3300006846 Bacteria 1555
306 Ga0075430_100445659 3300006846 Unclassified 1068
307 Ga0075430_100736325 3300006846 Bacteria 813
308 Ga0075431_100009162 3300006847 Bacteria 9926
309 Ga0075431_100093234 3300006847 Bacteria 3108
310 Ga0075431_100115152 3300006847 Bacteria 2775
311 Ga0075431_101099899 3300006847 Unclassified 759
312 Ga0075431_101758174 3300006847 Unclassified 576
313 Ga0075433_10012016 3300006852 Bacteria 6984
314 Ga0075433_10046641 3300006852 Bacteria 3769
315 Ga0075433_10057894 3300006852 Bacteria 3389
316 Ga0075433_10125823 3300006852 Unclassified 2276
317 Ga0075433_10129241 3300006852 Unclassified 2244
318 Ga0075433_10162408 3300006852 Bacteria 1988
319 Ga0075433_10189379 3300006852 Unclassified 1830
320 Ga0075433_10228226 3300006852 Bacteria 1654
321 Ga0075434_100012823 3300006871 Bacteria 7957
322 Ga0075434_100040917 3300006871 Bacteria 4589
323 Ga0075434_100045718 3300006871 Bacteria 4344
324 Ga0075434_100047736 3300006871 Bacteria 4248
325 Ga0075434_100060460 3300006871 Bacteria 3768
326 Ga0075434_100307090 3300006871 Bacteria 1606
327 Ga0075434_100393621 3300006871 Unclassified 1406
328 Ga0075434_102042029 3300006871 Bacteria 578
329 Ga0075434_102155576 3300006871 Unclassified 561
330 Ga0075429_100022968 3300006880 Bacteria 5407
331 Ga0075429_100054872 3300006880 Bacteria 3466
332 Ga0075429_100189231 3300006880 Bacteria 1803
333 Ga0075429_100526886 3300006880 Bacteria 1035
334 Ga0075429_100720855 3300006880 Bacteria 873
335 Ga0075429_101619593 3300006880 Unclassified 563
336 Ga0068865_100255336 3300006881 Unclassified 1385
337 Ga0068865_100367559 3300006881 Unclassified 1170
338 Ga0068865_100546018 3300006881 Unclassified 972
339 Ga0097620_100036834 3300006931 Bacteria 4912
340 Ga0097620_100068815 3300006931 Bacteria 3575
341 Ga0097620_100107009 3300006931 Bacteria 2856
342 Ga0097620_100108112 3300006931 Bacteria 2842
343 Ga0097620_100214089 3300006931 Bacteria 2014
344 Ga0097620_100653379 3300006931 Bacteria 1143
345 Ga0075435_100009397 3300007076 Bacteria 7075
346 Ga0075435_100032516 3300007076 Bacteria 4120
347 Ga0075435_100139554 3300007076 Bacteria 2033
348 Ga0075435_100167929 3300007076 Bacteria 1851
349 Ga0075435_100793172 3300007076 Unclassified 824
350 Ga0111539_10000044 3300009094 Bacteria 125347
351 Ga0111539_10000769 3300009094 Bacteria 41797
352 Ga0111539_10001774 3300009094 Bacteria 28680
353 Ga0111539_10005848 3300009094 Bacteria 15900
354 Ga0111539_10022822 3300009094 Bacteria 7686
355 Ga0111539_10050548 3300009094 Bacteria 4952
356 Ga0111539_10090992 3300009094 Unclassified 3585
357 Ga0111539_10118633 3300009094 Bacteria 3101
358 Ga0111539_10486591 3300009094 Bacteria 1437
359 Ga0111539_10641728 3300009094 Unclassified 1236
360 Ga0111539_11105866 3300009094 Unclassified 921
361 Ga0105245_10370780 3300009098 Bacteria 1423
362 Ga0105245_12476946 3300009098 Unclassified 572
363 Ga0114129_10003198 3300009147 Bacteria 22984
364 Ga0114129_10032110 3300009147 Bacteria 7422
365 Ga0114129_10071328 3300009147 Bacteria 4844
366 Ga0114129_10165027 3300009147 Bacteria 3023
367 Ga0114129_10325685 3300009147 Unclassified 2042
368 Ga0114129_11042853 3300009147 Bacteria 1027
369 Ga0114129_11066281 3300009147 Bacteria 1014
370 Ga0105243_10079752 3300009148 Bacteria 2668
371 Ga0105243_10163428 3300009148 Bacteria 1922
372 Ga0105243_10756840 3300009148 Unclassified 953
373 Ga0105243_11136624 3300009148 Bacteria 791
374 Ga0105242_10297662 3300009176 Unclassified 1471
375 Ga0105242_12410938 3300009176 Unclassified 574
376 Ga0105248_10072878 3300009177 Bacteria 3860
377 Ga0105248_10780624 3300009177 Unclassified 1078
378 Ga0105248_11128982 3300009177 Bacteria 886
379 Ga0105249_10003236 3300009553 Bacteria 14108
380 Ga0105249_10024420 3300009553 Bacteria 5432
381 Ga0105249_10202342 3300009553 Unclassified 1944
382 Ga0105249_11032878 3300009553 Bacteria 891
383 Ga0105030_105764 3300009987 Unclassified 1050
384 Ga0105239_10942428 3300010375 Unclassified 991
385 Ga0105239_11663171 3300010375 Bacteria 739
386 Ga0105239_13284757 3300010375 Unclassified 526
387 Ga0105246_10328733 3300011119 Unclassified 1245
388 Ga0105246_11807928 3300011119 Unclassified 584
389 Ga0157319_1004086 3300012497 Unclassified 939
390 Ga0157327_1001305 3300012512 Bacteria 1536
391 Ga0157371_10699038 3300013102 Unclassified 759
392 Ga0157370_12031710 3300013104 Unclassified 515
393 Ga0157374_10195969 3300013296 Bacteria 1977
394 Ga0157374_10259156 3300013296 Unclassified 1712
395 Ga0157378_10313896 3300013297 Bacteria 1521
396 Ga0157378_10742572 3300013297 Bacteria 1004
397 Ga0157378_12728066 3300013297 Unclassified 547
398 Ga0163162_10013453 3300013306 Bacteria 7987
399 Ga0163162_10419402 3300013306 Bacteria 1471
400 Ga0163162_10696172 3300013306 Bacteria 1138
401 Ga0163162_12359981 3300013306 Bacteria 611
402 Ga0157372_11518237 3300013307 Unclassified 772
403 Ga0157375_10066628 3300013308 Bacteria 3596
404 Ga0157375_10070625 3300013308 Bacteria 3502
405 Ga0157375_10121794 3300013308 Bacteria 2719
406 Ga0157375_10467797 3300013308 Bacteria 1426
407 Ga0157375_10560598 3300013308 Unclassified 1303
408 Ga0157375_10775196 3300013308 Bacteria 1109
409 Ga0157375_11040228 3300013308 Bacteria 957
410 Ga0157375_11572109 3300013308 Bacteria 777
411 Ga0157375_11924202 3300013308 Bacteria 702
412 Ga0163163_10012939 3300014325 Bacteria 7620
413 Ga0163163_10172758 3300014325 Unclassified 2208
414 Ga0163163_12569032 3300014325 Unclassified 567
415 Ga0157380_10019591 3300014326 Bacteria 5043
416 Ga0157380_10118775 3300014326 Unclassified 2236
417 Ga0157380_10209466 3300014326 Bacteria 1736
418 Ga0157380_10372011 3300014326 Bacteria 1345
419 Ga0157380_10378106 3300014326 Bacteria 1336
420 Ga0157380_10424324 3300014326 Unclassified 1269
421 Ga0157380_12190463 3300014326 Bacteria 616
422 Ga0157380_12762685 3300014326 Unclassified 557
423 Ga0157377_10003735 3300014745 Bacteria 6905
424 Ga0157377_10181478 3300014745 Bacteria 1324
425 Ga0157377_10209593 3300014745 Unclassified 1242
426 Ga0157377_10328140 3300014745 Unclassified 1019
427 Ga0157377_10371953 3300014745 Bacteria 965
428 Ga0157377_10437303 3300014745 Bacteria 900
429 Ga0157379_10012177 3300014968 Bacteria 7513
430 Ga0157379_10347219 3300014968 Bacteria 1358
431 Ga0157376_10184905 3300014969 Unclassified 1907
432 Ga0157376_10629607 3300014969 Bacteria 1071
433 Ga0157376_11929865 3300014969 Bacteria 628
434 Ga0182005_1117603 3300015265 Unclassified 755
435 Ga0163161_10053525 3300017792 Bacteria 2927
436 Ga0163161_10143950 3300017792 Bacteria 1807
437 Ga0207666_1059591 3300025271 Unclassified 610
438 Ga0207697_10009232 3300025315 Bacteria 4268
439 Ga0207697_10084073 3300025315 Bacteria 1343
440 Ga0207697_10099355 3300025315 Unclassified 1239
441 Ga0207653_10086651 3300025885 Unclassified 1092
442 Ga0207682_10003228 3300025893 Bacteria 7131
443 Ga0207682_10007325 3300025893 Bacteria 4402
444 Ga0207682_10027343 3300025893 Bacteria 2271
445 Ga0207682_10058423 3300025893 Bacteria 1610
446 Ga0207682_10097793 3300025893 Unclassified 1280
447 Ga0207642_10558066 3300025899 Unclassified 708
448 Ga0207688_10000708 3300025901 Bacteria 16482
449 Ga0207688_10083498 3300025901 Bacteria 1827
450 Ga0207688_10318225 3300025901 Unclassified 954
451 Ga0207680_10583266 3300025903 Bacteria 799
452 Ga0207680_11331793 3300025903 Unclassified 510
453 Ga0207647_10156717 3300025904 Bacteria 1329
454 Ga0207645_10000988 3300025907 Bacteria 23486
455 Ga0207645_10012760 3300025907 Bacteria 5696
456 Ga0207645_10027640 3300025907 Bacteria 3662
457 Ga0207645_10532575 3300025907 Bacteria 796
458 Ga0207643_10004675 3300025908 Bacteria 7347
459 Ga0207643_10005747 3300025908 Bacteria 6632
460 Ga0207643_10006252 3300025908 Bacteria 6371
461 Ga0207643_10088723 3300025908 Bacteria 1800
462 Ga0207643_10106665 3300025908 Bacteria 1647
463 Ga0207643_10133861 3300025908 Bacteria 1476
464 Ga0207643_10260790 3300025908 Bacteria 1070
465 Ga0207643_10770448 3300025908 Bacteria 623
466 Ga0207684_10613546 3300025910 Unclassified 928
467 Ga0207660_11173116 3300025917 Unclassified 625
468 Ga0207662_10011416 3300025918 Bacteria 4927
469 Ga0207662_10023479 3300025918 Bacteria 3543
470 Ga0207662_10301039 3300025918 Unclassified 1066
471 Ga0207657_10517801 3300025919 Bacteria 934
472 Ga0207649_10013082 3300025920 Bacteria 4627
473 Ga0207649_10035330 3300025920 Bacteria 3003
474 Ga0207649_10141168 3300025920 Bacteria 1648
475 Ga0207649_10629755 3300025920 Unclassified 827
476 Ga0207652_11878690 3300025921 Bacteria 504
477 Ga0207646_10567945 3300025922 Bacteria 1019
478 Ga0207681_10008644 3300025923 Bacteria 6219
479 Ga0207681_10010350 3300025923 Bacteria 5708
480 Ga0207681_10042624 3300025923 Bacteria 3032
481 Ga0207681_10222085 3300025923 Unclassified 1462
482 Ga0207681_10365614 3300025923 Bacteria 1158
483 Ga0207650_10104397 3300025925 Bacteria 2186
484 Ga0207650_10122641 3300025925 Bacteria 2025
485 Ga0207650_10127061 3300025925 Unclassified 1991
486 Ga0207650_10425225 3300025925 Unclassified 1103
487 Ga0207650_10439305 3300025925 Unclassified 1085
488 Ga0207650_10558420 3300025925 Bacteria 960
489 Ga0207659_10000651 3300025926 Bacteria 20674
490 Ga0207659_10001472 3300025926 Bacteria 14038
491 Ga0207659_10034509 3300025926 Bacteria 3489
492 Ga0207659_10099492 3300025926 Bacteria 2189
493 Ga0207659_10212498 3300025926 Bacteria 1551
494 Ga0207659_10325509 3300025926 Bacteria 1269
495 Ga0207659_10597322 3300025926 Bacteria 941
496 Ga0207659_10858905 3300025926 Unclassified 780
497 Ga0207659_11515225 3300025926 Bacteria 573
498 Ga0207644_10020921 3300025931 Unclassified 4453
499 Ga0207644_10092011 3300025931 Bacteria 2262
500 Ga0207644_10363430 3300025931 Unclassified 1178
501 Ga0207644_11230204 3300025931 Unclassified 629
502 Ga0207644_11705052 3300025931 Unclassified 528
503 Ga0207690_10219748 3300025932 Bacteria 1453
504 Ga0207690_10317243 3300025932 Unclassified 1224
505 Ga0207690_10738863 3300025932 Unclassified 811
506 Ga0207690_11025023 3300025932 Unclassified 687
507 Ga0207706_10003313 3300025933 Bacteria 15419
508 Ga0207706_10064669 3300025933 Bacteria 3221
509 Ga0207706_10211866 3300025933 Bacteria 1698
510 Ga0207706_10236453 3300025933 Bacteria 1597
511 Ga0207706_11715201 3300025933 Unclassified 505
512 Ga0207686_10992242 3300025934 Unclassified 681
513 Ga0207686_11395464 3300025934 Unclassified 576
514 Ga0207709_10225526 3300025935 Unclassified 1354
515 Ga0207709_10289183 3300025935 Bacteria 1214
516 Ga0207709_10439836 3300025935 Bacteria 1005
517 Ga0207709_11243740 3300025935 Bacteria 614
518 Ga0207670_10010928 3300025936 Bacteria 5245
519 Ga0207670_10024885 3300025936 Bacteria 3748
520 Ga0207670_10046927 3300025936 Bacteria 2873
521 Ga0207670_10094207 3300025936 Unclassified 2124
522 Ga0207669_10009606 3300025937 Bacteria 4620
523 Ga0207669_10106040 3300025937 Unclassified 1871
524 Ga0207669_10852675 3300025937 Unclassified 758
525 Ga0207669_11141103 3300025937 Bacteria 659
526 Ga0207669_11279044 3300025937 Unclassified 623
527 Ga0207704_10198936 3300025938 Unclassified 1465
528 Ga0207704_10449829 3300025938 Bacteria 1028
529 Ga0207704_10922311 3300025938 Unclassified 735
530 Ga0207704_11506819 3300025938 Unclassified 577
531 Ga0207691_10000604 3300025940 Bacteria 35804
532 Ga0207691_10001395 3300025940 Bacteria 24180
533 Ga0207691_10010694 3300025940 Bacteria 8809
534 Ga0207691_10014539 3300025940 Bacteria 7507
535 Ga0207691_10047189 3300025940 Bacteria 3954
536 Ga0207691_10049629 3300025940 Bacteria 3845
537 Ga0207691_10063058 3300025940 Bacteria 3362
538 Ga0207691_11287383 3300025940 Bacteria 604
539 Ga0207711_10388674 3300025941 Bacteria 1295
540 Ga0207711_11330386 3300025941 Bacteria 661
541 Ga0207689_10002988 3300025942 Bacteria 15600
542 Ga0207689_10226167 3300025942 Unclassified 1546
543 Ga0207689_10256987 3300025942 Bacteria 1445
544 Ga0207689_10296132 3300025942 Bacteria 1341
545 Ga0207689_10325819 3300025942 Bacteria 1275
546 Ga0207689_10391843 3300025942 Unclassified 1157
547 Ga0207661_10031457 3300025944 Bacteria 4100
548 Ga0207679_10037309 3300025945 Bacteria 3453
549 Ga0207679_10092930 3300025945 Bacteria 2338
550 Ga0207679_10123435 3300025945 Bacteria 2065
551 Ga0207679_10366368 3300025945 Unclassified 1260
552 Ga0207679_10777349 3300025945 Unclassified 872
553 Ga0207679_11007576 3300025945 Unclassified 763
554 Ga0207679_11015312 3300025945 Bacteria 760
555 Ga0207651_10010107 3300025960 Bacteria 5209
556 Ga0207651_10112591 3300025960 Bacteria 2046
557 Ga0207651_10131070 3300025960 Bacteria 1919
558 Ga0207651_10301083 3300025960 Unclassified 1333
559 Ga0207651_10335248 3300025960 Bacteria 1269
560 Ga0207651_10341745 3300025960 Bacteria 1257
561 Ga0207651_11967282 3300025960 Unclassified 525
562 Ga0207712_10006735 3300025961 Bacteria 7247
563 Ga0207668_10155335 3300025972 Unclassified 1777
564 Ga0207668_10241737 3300025972 Bacteria 1461
565 Ga0207668_10292983 3300025972 Bacteria 1340
566 Ga0207668_11687479 3300025972 Bacteria 572
567 Ga0207640_11288248 3300025981 Bacteria 652
568 Ga0207658_10188164 3300025986 Bacteria 1714
569 Ga0207677_10626138 3300026023 Unclassified 947
570 Ga0207677_11478006 3300026023 Unclassified 627
571 Ga0207703_10006821 3300026035 Bacteria 9096
572 Ga0207703_10035266 3300026035 Bacteria 3975
573 Ga0207703_11148244 3300026035 Unclassified 746
574 Ga0207639_12171145 3300026041 Unclassified 516
575 Ga0207678_10441366 3300026067 Unclassified 1130
576 Ga0207678_11862945 3300026067 Bacteria 525
577 Ga0207708_10243628 3300026075 Bacteria 1447
578 Ga0207708_10290812 3300026075 Bacteria 1326
579 Ga0207708_10377665 3300026075 Bacteria 1168
580 Ga0207708_10414018 3300026075 Unclassified 1117
581 Ga0207708_11865444 3300026075 Unclassified 527
582 Ga0207702_10337774 3300026078 Bacteria 1438
583 Ga0207641_10008163 3300026088 Bacteria 8664
584 Ga0207641_10152487 3300026088 Unclassified 2094
585 Ga0207641_10520951 3300026088 Unclassified 1156
586 Ga0207648_10000446 3300026089 Bacteria 45706
587 Ga0207648_10027152 3300026089 Bacteria 5084
588 Ga0207648_11115143 3300026089 Unclassified 740
589 Ga0207648_11124169 3300026089 Unclassified 737
590 Ga0207648_11534465 3300026089 Unclassified 626
591 Ga0207676_10043539 3300026095 Bacteria 3458
592 Ga0207676_10049398 3300026095 Bacteria 3272
593 Ga0207676_10065262 3300026095 Bacteria 2898
594 Ga0207676_10145529 3300026095 Bacteria 2035
595 Ga0207676_10207064 3300026095 Bacteria 1737
596 Ga0207676_10444179 3300026095 Bacteria 1221
597 Ga0207676_10594099 3300026095 Unclassified 1062
598 Ga0207676_11438710 3300026095 Bacteria 686
599 Ga0207674_10051002 3300026116 Bacteria 4224
600 Ga0207674_10199612 3300026116 Bacteria 1950
601 Ga0207674_10767845 3300026116 Bacteria 930
602 Ga0207674_11213473 3300026116 Unclassified 724
603 Ga0207674_12239435 3300026116 Bacteria 509
604 Ga0207675_100017763 3300026118 Bacteria 6635
605 Ga0207675_100073164 3300026118 Bacteria 3206
606 Ga0207675_100283183 3300026118 Unclassified 1611
607 Ga0207675_100783322 3300026118 Unclassified 966
608 Ga0207675_101148082 3300026118 Unclassified 797
609 Ga0207683_10004069 3300026121 Bacteria 12639
610 Ga0207683_10013401 3300026121 Bacteria 6992
611 Ga0207683_10052963 3300026121 Bacteria 3557
612 Ga0207683_10260561 3300026121 Unclassified 1583
613 Ga0207683_10372068 3300026121 Bacteria 1313
614 Ga0207683_10616749 3300026121 Bacteria 1004
615 Ga0207683_11614602 3300026121 Bacteria 598
616 Ga0207683_11867653 3300026121 Bacteria 550
617 Ga0207698_11635759 3300026142 Unclassified 659
618 Ga0210000_1030081 3300027462 Bacteria 847
619 Ga0209970_1066851 3300027614 Bacteria 665
620 Ga0209971_1021410 3300027682 Bacteria 1538
621 Ga0209971_1136354 3300027682 Bacteria 605
622 Ga0209974_10071297 3300027876 Bacteria 1186
623 Ga0207428_10000224 3300027907 Bacteria 78533
624 Ga0207428_10000353 3300027907 Bacteria 59325
625 Ga0207428_10001721 3300027907 Bacteria 22410
626 Ga0207428_10001835 3300027907 Bacteria 21713
627 Ga0207428_10042270 3300027907 Unclassified 3685
628 Ga0207428_10161343 3300027907 Unclassified 1702
629 Ga0207428_10324091 3300027907 Bacteria 1137
630 Ga0207428_10336729 3300027907 Unclassified 1112
631 Ga0207428_10559733 3300027907 Bacteria 826
632 Ga0268266_10914510 3300028379 Unclassified 848
633 Ga0268265_10000574 3300028380 Bacteria 37262
634 Ga0268265_10055472 3300028380 Bacteria 3011
635 Ga0268265_10072770 3300028380 Bacteria 2682
636 Ga0268265_10809185 3300028380 Bacteria 914
637 Ga0268265_11499297 3300028380 Unclassified 678
638 Ga0268265_12068474 3300028380 Bacteria 576
639 Ga0268264_10074079 3300028381 Bacteria 2891
640 Ga0268264_10436826 3300028381 Bacteria 1265
641 Ga0268264_10748508 3300028381 Unclassified 973
642 Ga0268264_11517621 3300028381 Unclassified 681
643 Ga0307408_100504994 3300031548 Bacteria 1059
644 Ga0307408_100862119 3300031548 Unclassified 826
645 Ga0307405_10255490 3300031731 Unclassified 1306
646 Ga0307405_10448854 3300031731 Bacteria 1022
647 Ga0307405_11281080 3300031731 Unclassified 637
648 Ga0307413_10452136 3300031824 Unclassified 1020
649 Ga0307406_11727491 3300031901 Unclassified 555
650 Ga0307407_10846653 3300031903 Unclassified 698
651 Ga0307407_10916817 3300031903 Unclassified 673
652 Ga0307407_11509323 3300031903 Bacteria 532
653 Ga0307412_10321680 3300031911 Unclassified 1231
654 Ga0307412_10355461 3300031911 Unclassified 1178
655 Ga0307412_10360231 3300031911 Unclassified 1171
656 Ga0307409_100183466 3300031995 Bacteria 1855
657 Ga0307409_101277272 3300031995 Bacteria 759
658 Ga0307409_101735076 3300031995 Unclassified 653
659 Ga0307409_102934309 3300031995 Unclassified 504
660 Ga0307416_100056568 3300032002 Bacteria 3167
661 Ga0307416_100625573 3300032002 Unclassified 1159
662 Ga0307416_100844472 3300032002 Unclassified 1014
663 Ga0307416_100901311 3300032002 Unclassified 984
664 Ga0307416_102139994 3300032002 Bacteria 661
665 Ga0307414_11167757 3300032004 Unclassified 712
666 Ga0307414_11329098 3300032004 Unclassified 667
667 Ga0307411_10158856 3300032005 Bacteria 1690
668 Ga0307411_10820222 3300032005 Bacteria 821
669 Ga0307411_10824001 3300032005 Bacteria 819
670 Ga0307415_100418395 3300032126 Bacteria 1149
671 Ga0373930_0014064 3300034816 Bacteria 1485
672 Ga0373958_0039073 3300034819 Unclassified 963
673 Ga0373938_0015964 3300034957 Bacteria 1462
674 Ga0373928_0025889 3300035084 Bacteria 1268
675 Ga0373940_0036939 3300035088 Bacteria 1328
676 Ga0373940_0103953 3300035088 Unclassified 865
677 Ga0373951_0101559 3300035091 Unclassified 765
678 Ga0373932_0055328 3300035112 Bacteria 1190
679 Ga0373941_0061985 3300035115 Bacteria 1219
680 Ga0373946_0147015 3300035171 Unclassified 1097
681 Ga0373942_0258658 3300035207 Unclassified 594
682 Ga0373961_0031574 3300035241 Bacteria 1480
683 Ga0373962_0103045 3300035242 Unclassified 892
684 Ga0373962_0265307 3300035242 Bacteria 600
685 Ga0373931_0093161 3300035691 Bacteria 1682
686 Ga0373931_0754424 3300035691 Bacteria 646
687 Ga0373947_0152407 3300035725 Bacteria 1490
688 Ga0373925_0946217 3300037068 Bacteria 710
689 Ga0439439_0189637 3300041406 Bacteria 595
690 Ga0439453_0000960 3300041408 Bacteria 3489
691 Ga0439453_0015183 3300041408 Bacteria 1329
692 Ga0451807_2707401 3300041486 Unclassified 558
693 Ga0451847_0504052 3300041503 Bacteria 525
694 Ga0439450_006029 3300042008 Unclassified 2163
695 Ga0450896_058820 3300042133 Unclassified 623
696 Ga0439446_0270984 3300042156 Bacteria 590
697 Ga0450908_013125 3300042184 Bacteria 1496
698 Ga0439435_0107378 3300042436 Bacteria 863
699 Ga0439435_0113817 3300042436 Bacteria 842
700 Ga0439464_0146053 3300042439 Unclassified 738
701 Ga0439464_0242229 3300042439 Unclassified 581
702 Ga0439460_0011474 3300042461 Bacteria 2285
703 Ga0439460_0064014 3300042461 Bacteria 1128
704 Ga0450916_004974 3300042530 Bacteria 1520
705 Ga0439440_0016405 3300042993 Bacteria 1621
706 Ga0453683_1048754 3300044673 Unclassified 542
707 Ga0451576_0012736 3300045051 Bacteria 9442
708 Ga0451576_0091131 3300045051 Bacteria 3171
709 Ga0451576_0271053 3300045051 Unclassified 1774
710 Ga0451576_0615874 3300045051 Unclassified 1141
711 Ga0451576_2240114 3300045051 Unclassified 560
712 Ga0495591_061082 3300046458 Unclassified 1001
713 Ga0495591_154529 3300046458 Archaea 550
714 Ga0495580_0297553 3300046472 Bacteria 1099
715 Ga0495594_0112008 3300046499 Unclassified 1539
716 Ga0495643_0013200 3300046522 Bacteria 4955
717 Ga0495642_0043907 3300046528 Bacteria 1824
718 Ga0495665_0181814 3300046531 Unclassified 1093
719 Ga0495598_0016268 3300046537 Unclassified 1895
720 Ga0495598_0268257 3300046537 Unclassified 637
721 Ga0495621_0003656 3300046539 Bacteria 4249
722 Ga0495621_0006701 3300046539 Bacteria 3375
723 Ga0495621_0015251 3300046539 Unclassified 2448
724 Ga0495633_0227033 3300046558 Unclassified 854
725 Ga0495633_0238406 3300046558 Bacteria 831
726 Ga0495656_0047025 3300046615 Unclassified 1828
727 Ga0495656_0073589 3300046615 Unclassified 1524
728 Ga0495668_0285900 3300046616 Bacteria 904
729 Ga0495659_0007114 3300046664 Bacteria 3541
730 Ga0495659_0119962 3300046664 Unclassified 1034
731 Ga0495659_0205215 3300046664 Bacteria 809
732 Ga0495659_0219682 3300046664 Unclassified 784
733 Ga0495658_0359861 3300046683 Bacteria 925
734 Ga0495613_0632015 3300046689 Archaea 710
735 Ga0495670_0043108 3300046691 Bacteria 2252
736 Ga0495636_0164293 3300047318 Bacteria 1001
737 Ga0495677_0180306 3300047445 Unclassified 818
738 Ga0496104_0448944 3300048907 Bacteria 1201
739 Ga0496106_0200604 3300048909 Bacteria 1587
740 Ga0496106_0298467 3300048909 Bacteria 1292
741 Ga0496108_1484191 3300048911 Bacteria 565
742 Ga0496109_0122060 3300048912 Unclassified 2428
743 Ga0501298_165440 3300049521 Unclassified 548
744 Ga0501031_0077781 3300049568 Unclassified 2161
745 Ga0501033_0286980 3300049570 Bacteria 1161
746 Ga0501036_0021560 3300049572 Bacteria 5417
747 Ga0501038_0446452 3300049574 Bacteria 995
748 Ga0501039_0343996 3300049575 Bacteria 1172
749 Ga0501041_0161603 3300049577 Unclassified 1400
750 Ga0501041_0230095 3300049577 Unclassified 1164
751 Ga0501042_0397896 3300049578 Unclassified 998
752 Ga0501046_0042164 3300049580 Unclassified 3639
753 Ga0501048_0660691 3300049582 Bacteria 750
754 Ga0501067_0463695 3300049583 Unclassified 708
755 Ga0501069_0180170 3300049585 Archaea 1221
756 Ga0501071_0106454 3300049587 Unclassified 2071
757 Ga0501071_0463403 3300049587 Bacteria 970
758 Ga0501071_0710202 3300049587 Bacteria 774
759 Ga0501072_0125630 3300049588 Unclassified 2044
760 Ga0501072_0310911 3300049588 Unclassified 1253
761 Ga0501072_0337523 3300049588 Bacteria 1197
762 Ga0501074_0072396 3300049590 Unclassified 2476
763 Ga0501075_0779878 3300049591 Bacteria 727
764 Ga0501076_0122069 3300049592 Unclassified 2110
765 Ga0501202_129897 3300049652 Bacteria 641
766 Ga0501249_037719 3300049679 Unclassified 1091
767 Ga0501079_0154400 3300049741 Unclassified 1789
768 Ga0501080_0263478 3300049742 Unclassified 1570
769 Ga0501081_0092255 3300049743 Unclassified 2131
770 Ga0501263_055593 3300049760 Unclassified 611
771 Ga0501270_024286 3300049767 Unclassified 951
772 Ga0501283_073605 3300049779 Unclassified 633
773 nmdc:mga05p37_11033_c1 3300050507 Bacteria 10735
774 nmdc:mga05p37_11783_c1 3300050507 Bacteria 10423
775 nmdc:mga05p37_119081_c1 3300050507 Bacteria 3244
776 nmdc:mga05p37_193469_c1 3300050507 Bacteria 2468
777 nmdc:mga05p37_266482_c1 3300050507 Unclassified 2048
778 nmdc:mga05p37_787206_c1 3300050507 Unclassified 1043
779 nmdc:mga05p37_891973_c1 3300050507 Bacteria 960
780 nmdc:mga09592_1261485_c1 3300050508 Unclassified 609
781 nmdc:mga09592_129792_c1 3300050508 Unclassified 2168
782 nmdc:mga09592_172196_c1 3300050508 Bacteria 1872
783 nmdc:mga09592_21264_c1 3300050508 Bacteria 5347
784 nmdc:mga09592_52799_c1 3300050508 Bacteria 3431
785 nmdc:mga09592_666231_c1 3300050508 Bacteria 888
786 nmdc:mga0qj67_1183_c1 3300050509 Bacteria 18079
787 nmdc:mga0qj67_163363_c1 3300050509 Unclassified 1808
788 nmdc:mga0qj67_254185_c1 3300050509 Unclassified 1426
789 nmdc:mga0qj67_458730_c1 3300050509 Bacteria 1026
790 nmdc:mga0qj67_832446_c1 3300050509 Bacteria 729
791 nmdc:mga0qj67_912202_c1 3300050509 Unclassified 692
792 nmdc:mga0qj67_96052_c1 3300050509 Bacteria 2386
793 nmdc:mga06r32_10017_c1 3300050510 Bacteria 8552
794 nmdc:mga06r32_185719_c1 3300050510 Unclassified 2066
795 nmdc:mga06r32_452303_c1 3300050510 Unclassified 1264
796 nmdc:mga08y16_1376503_c1 3300050511 Unclassified 670
797 nmdc:mga08y16_145_c1 3300050511 Bacteria 61822
798 nmdc:mga08y16_171783_c1 3300050511 Bacteria 2251
799 nmdc:mga08y16_17393_c1 3300050511 Bacteria 7570
800 nmdc:mga08y16_266097_c1 3300050511 Bacteria 1770
801 nmdc:mga08y16_3589_c1 3300050511 Bacteria 16115
802 nmdc:mga08y16_7446_c1 3300050511 Bacteria 11466
803 nmdc:mga08y16_9502_c1 3300050511 Bacteria 10208
804 nmdc:mga08y16_966259_c1 3300050511 Unclassified 834
805 nmdc:mga08y16_9784_c1 3300050511 Bacteria 10064
806 nmdc:mga0n895_1015798_c1 3300050512 Unclassified 810
807 nmdc:mga0n895_10349_c1 3300050512 Bacteria 8231
808 nmdc:mga0n895_109758_c1 3300050512 Bacteria 2774
809 nmdc:mga0n895_14522_c1 3300050512 Bacteria 7156
810 nmdc:mga0n895_1591735_c1 3300050512 Bacteria 618
811 nmdc:mga0n895_1953890_c1 3300050512 Unclassified 545
812 nmdc:mga0n895_237348_c1 3300050512 Unclassified 1850
813 nmdc:mga0n895_29336_c1 3300050512 Bacteria 5246
814 nmdc:mga0n895_510218_c1 3300050512 Bacteria 1211
815 nmdc:mga0n895_77498_c1 3300050512 Bacteria 3307
816 nmdc:mga0rr50_100756_c1 3300050513 Bacteria 2269
817 nmdc:mga0rr50_14631_c1 3300050513 Bacteria 5152
818 nmdc:mga0rr50_148676_c1 3300050513 Bacteria 1891
819 nmdc:mga0rr50_33565_c1 3300050513 Bacteria 3667
820 nmdc:mga0a205_152564_c1 3300050515 Unclassified 2209
821 nmdc:mga0a205_22910_c1 3300050515 Bacteria 5922
822 nmdc:mga0a205_56680_c1 3300050515 Bacteria 3783
823 nmdc:mga0a205_58252_c1 3300050515 Bacteria 3731
824 nmdc:mga0a205_744_c1 3300050515 Bacteria 26285
825 nmdc:mga0a205_8052_c1 3300050515 Bacteria 9580
826 nmdc:mga0a205_916782_c1 3300050515 Unclassified 723
827 Ga0501084_0002042 3300054114 Bacteria 16121
828 Ga0501082_0024994 3300060353 Bacteria 5146
829 Ga0501082_0553953 3300060353 Unclassified 1006
830 Ga0530510_0291948 3300061734 Bacteria 1219
831 Ga0307412_11144775
832 SwRhRL2b_contig_1987167
833 MRS1b_contig_5900326
834 MRS1b_contig_7203457
835 MBSR1b_contig_7265978
836 ARCol0yngRDRAFT_1003926
837 JGI24746J21847_1002532
838 JGI24034J26672_10075648
839 JGI24742J22300_10026837
840 JGI25406J46586_10010020
841 JGI25406J46586_10040444
842 JGI25406J46586_10062171
843 Ga0058859_11627370
844 Ga0058859_11742140
845 Ga0058859_11760998
846 Ga0058860_10022288
847 Ga0065714_10112506
848 Ga0065714_10496070
849 Ga0065704_10001460
850 Ga0065704_10201218
851 Ga0065704_10559376
852 Ga0065712_10125890
853 Ga0065712_10141591
854 Ga0065712_10148291
855 Ga0065712_10173504
856 Ga0065712_10241480
857 Ga0065712_10566540
858 Ga0065715_10003843
859 Ga0065715_10009499
860 Ga0065715_10099087
861 Ga0065715_10310408
862 Ga0065715_10488068
863 Ga0065715_10677353
864 Ga0065707_10005888
865 Ga0065707_10092932
866 Ga0065707_10124504
867 Ga0065707_10163380
868 Ga0065707_10244679
869 Ga0065707_10406119
870 Ga0070676_10024469
871 Ga0070676_10072064
872 Ga0070676_10216645
873 Ga0070676_10918854
874 Ga0070690_100044149
875 Ga0070690_100182696
876 Ga0070690_100398996
877 Ga0070690_101469315
878 Ga0070670_100129571
879 Ga0070670_100241478
880 Ga0070670_100269112
881 Ga0070670_100286192
882 Ga0070670_100388357
883 Ga0070670_100762046
884 Ga0070670_101509095
885 Ga0070670_102179705
886 Ga0070677_10001862
887 Ga0070677_10038368
888 Ga0070677_10047696
889 Ga0070677_10554025
890 Ga0068869_100037759
891 Ga0068869_100045881
892 Ga0068869_100277144
893 Ga0068869_100902924
894 Ga0070666_10066247
895 Ga0070666_10383139
896 Ga0070680_100159574
897 Ga0070680_100525079
898 Ga0068868_100042564
899 Ga0068868_100175727
900 Ga0068868_100704322
901 Ga0070660_100665273
902 Ga0070689_100023774
903 Ga0070689_100063437
904 Ga0070689_100696938
905 Ga0070691_10102868
906 Ga0070691_10397709
907 Ga0070687_100012979
908 Ga0070687_100031776
909 Ga0070687_100318351
910 Ga0070661_100003093
911 Ga0070661_100109675
912 Ga0070661_100433384
913 Ga0070692_10474993
914 Ga0070692_10965095
915 Ga0070668_100040753
916 Ga0070668_100523991
917 Ga0070668_101393140
918 Ga0070669_100014718
919 Ga0070669_100016387
920 Ga0070669_100039550
921 Ga0070669_100059664
922 Ga0070669_100340927
923 Ga0070675_100042973
924 Ga0070675_100054935
925 Ga0070675_100067198
926 Ga0070675_100298272
927 Ga0070675_100373534
928 Ga0070675_100892409
929 Ga0070675_101364454
930 Ga0070675_101742042
931 Ga0070671_100063501
932 Ga0070671_100109689
933 Ga0070671_100352295
934 Ga0070671_100545329
935 Ga0070671_100722974
936 Ga0070674_100007028
937 Ga0070674_100062257
938 Ga0070674_100181768
939 Ga0070674_100867855
940 Ga0070674_101046988
941 Ga0070674_101262431
942 Ga0070673_100008649
943 Ga0070673_100061684
944 Ga0070673_100276071
945 Ga0070673_100571249
946 Ga0070673_101225257
947 Ga0070673_102263922
948 Ga0070688_100002841
949 Ga0070688_100047588
950 Ga0070688_100057626
951 Ga0070688_100092327
952 Ga0070688_100732020
953 Ga0070659_100014099
954 Ga0070659_100785780
955 Ga0070659_101062098
956 Ga0070667_100116500
957 Ga0070667_100181819
958 Ga0070667_100551294
959 Ga0070667_100937711
960 Ga0070667_101998326
961 Ga0070703_10129715
962 Ga0070703_10524038
963 Ga0070703_10618596
964 Ga0070701_10070405
965 Ga0070701_10174534
966 Ga0070705_100078770
967 Ga0070705_100188226
968 Ga0070705_100193834
969 Ga0070705_100916158
970 Ga0070705_101611046
971 Ga0070700_100067852
972 Ga0070700_100248748
973 Ga0070700_100273592
974 Ga0070700_100586713
975 Ga0070694_100063096
976 Ga0070694_100322244
977 Ga0070694_100591613
978 Ga0070708_100012556
979 Ga0070663_100405969
980 Ga0070678_100027052
981 Ga0070678_100029501
982 Ga0070678_100106719
983 Ga0070678_100123091
984 Ga0070678_100231933
985 Ga0070678_100311827
986 Ga0070678_101005103
987 Ga0070678_101604056
988 Ga0070662_100013173
989 Ga0070662_100465790
990 Ga0070662_100599234
991 Ga0070662_101598834
992 Ga0070681_10899454
993 Ga0068867_100000147
994 Ga0068867_100109708
995 Ga0068867_100316514
996 Ga0068867_100879300
997 Ga0068867_101277897
998 Ga0070685_10010874
999 Ga0070685_10033576
1000 Ga0070685_10435148
1001 Ga0070706_100173631
1002 Ga0070707_100124655
1003 Ga0070707_101885814
1004 Ga0070698_100069046
1005 Ga0070699_100014984
1006 Ga0070699_100031153
1007 Ga0070699_100077488
1008 Ga0070699_100571773
1009 Ga0070699_100998151
1010 Ga0070699_101218797
1011 Ga0070679_100749106
1012 Ga0070679_101393473
1013 Ga0070684_100316272
1014 Ga0070684_101497035
1015 Ga0070684_101777726
1016 Ga0070697_100993668
1017 Ga0070672_100041272
1018 Ga0070672_100084820
1019 Ga0070672_100225620
1020 Ga0070672_100256679
1021 Ga0070672_100260138
1022 Ga0070672_100370474
1023 Ga0070672_101073911
1024 Ga0070672_101407019
1025 Ga0070686_100036659
1026 Ga0070686_100115327
1027 Ga0070686_100240604
1028 Ga0070686_100486140
1029 Ga0070686_101926914
1030 Ga0070695_100558011
1031 Ga0070695_100622532
1032 Ga0070695_101381550
1033 Ga0070696_100033868
1034 Ga0070696_100604380
1035 Ga0070696_101040986
1036 Ga0070696_101720486
1037 Ga0070693_100335233
1038 Ga0070693_100890664
1039 Ga0070693_100978838
1040 Ga0070665_100042221
1041 Ga0070665_100907376
1042 Ga0070704_100009821
1043 Ga0070704_100583850
1044 Ga0070704_100859645
1045 Ga0070704_101449772
1046 Ga0068855_101141074
1047 Ga0070664_100006202
1048 Ga0070664_100020437
1049 Ga0070664_100153258
1050 Ga0070664_100479572
1051 Ga0070664_100887941
1052 Ga0070664_101013772
1053 Ga0068857_100104201
1054 Ga0068857_100144314
1055 Ga0068857_100916955
1056 Ga0068854_100460737
1057 Ga0068854_100785694
1058 Ga0068856_100166847
1059 Ga0070702_100569448
1060 Ga0070702_101733200
1061 Ga0068852_100030148
1062 Ga0068852_102437728
1063 Ga0068859_100036834
1064 Ga0068859_100068816
1065 Ga0068859_100107003
1066 Ga0068859_100108108
1067 Ga0068859_100214077
1068 Ga0068859_100653371
1069 Ga0068864_100013579
1070 Ga0068864_100021793
1071 Ga0068864_100199436
1072 Ga0068864_100206293
1073 Ga0068864_100226346
1074 Ga0068864_100271495
1075 Ga0068864_100478669
1076 Ga0068864_101604570
1077 Ga0068864_101619627
1078 Ga0068861_100004416
1079 Ga0068861_100125708
1080 Ga0068861_100438546
1081 Ga0068870_10007223
1082 Ga0068870_10043392
1083 Ga0068870_10063734
1084 Ga0068870_10154233
1085 Ga0068870_10552485
1086 Ga0068863_100003088
1087 Ga0068863_100346548
1088 Ga0068863_100877830
1089 Ga0068858_100009208
1090 Ga0068858_100114282
1091 Ga0068858_101708487
1092 Ga0068858_102503470
1093 Ga0068860_100014554
1094 Ga0068860_100057619
1095 Ga0068860_100688526
1096 Ga0068860_100902856
1097 Ga0068862_100001293
1098 Ga0068862_100009919
1099 Ga0068862_100175950
1100 Ga0068862_100312285
1101 Ga0068862_100677788
1102 Ga0068862_101706668
1103 Ga0068862_101818192
1104 Ga0068862_101923585
1105 Ga0081455_10099678
1106 Ga0081539_10000164
1107 Ga0081539_10000334
1108 Ga0081539_10002616
1109 Ga0075432_10042337
1110 Ga0075427_10100732
1111 Ga0097621_100367117
1112 Ga0097621_100381638
1113 Ga0097621_101244577
1114 Ga0097621_101559104
1115 Ga0068871_100063036
1116 Ga0068871_100146119
1117 Ga0068871_100654268
1118 Ga0068871_100727361
1119 Ga0068871_101164041
1120 Ga0068871_101246310
1121 Ga0068871_102167681
1122 Ga0075428_100007951
1123 Ga0075428_100009580
1124 Ga0075428_100035912
1125 Ga0075428_100039280
1126 Ga0075428_100115920
1127 Ga0075428_100143908
1128 Ga0075428_100628906
1129 Ga0075428_100810002
1130 Ga0075428_101307522
1131 Ga0075428_101943844
1132 Ga0075430_100005300
1133 Ga0075430_100023497
1134 Ga0075430_100088638
1135 Ga0075430_100225377
1136 Ga0075430_100445659
1137 Ga0075430_100736325
1138 Ga0075431_100009162
1139 Ga0075431_100093234
1140 Ga0075431_100115152
1141 Ga0075431_101099899
1142 Ga0075431_101758174
1143 Ga0075433_10012016
1144 Ga0075433_10046641
1145 Ga0075433_10057894
1146 Ga0075433_10125823
1147 Ga0075433_10129241
1148 Ga0075433_10162408
1149 Ga0075433_10189379
1150 Ga0075433_10228226
1151 Ga0075434_100012823
1152 Ga0075434_100040917
1153 Ga0075434_100045718
1154 Ga0075434_100047736
1155 Ga0075434_100060460
1156 Ga0075434_100307090
1157 Ga0075434_100393621
1158 Ga0075434_102042029
1159 Ga0075434_102155576
1160 Ga0075429_100022968
1161 Ga0075429_100054872
1162 Ga0075429_100189231
1163 Ga0075429_100526886
1164 Ga0075429_100720855
1165 Ga0075429_101619593
1166 Ga0068865_100255336
1167 Ga0068865_100367559
1168 Ga0068865_100546018
1169 Ga0097620_100036834
1170 Ga0097620_100068815
1171 Ga0097620_100107009
1172 Ga0097620_100108112
1173 Ga0097620_100214089
1174 Ga0097620_100653379
1175 Ga0075435_100009397
1176 Ga0075435_100032516
1177 Ga0075435_100139554
1178 Ga0075435_100167929
1179 Ga0075435_100793172
1180 Ga0111539_10000044
1181 Ga0111539_10000769
1182 Ga0111539_10001774
1183 Ga0111539_10005848
1184 Ga0111539_10022822
1185 Ga0111539_10050548
1186 Ga0111539_10090992
1187 Ga0111539_10118633
1188 Ga0111539_10486591
1189 Ga0111539_10641728
1190 Ga0111539_11105866
1191 Ga0105245_10370780
1192 Ga0105245_12476946
1193 Ga0114129_10003198
1194 Ga0114129_10032110
1195 Ga0114129_10071328
1196 Ga0114129_10165027
1197 Ga0114129_10325685
1198 Ga0114129_11042853
1199 Ga0114129_11066281
1200 Ga0105243_10079752
1201 Ga0105243_10163428
1202 Ga0105243_10756840
1203 Ga0105243_11136624
1204 Ga0105242_10297662
1205 Ga0105242_12410938
1206 Ga0105248_10072878
1207 Ga0105248_10780624
1208 Ga0105248_11128982
1209 Ga0105249_10003236
1210 Ga0105249_10024420
1211 Ga0105249_10202342
1212 Ga0105249_11032878
1213 Ga0105030_105764
1214 Ga0105239_10942428
1215 Ga0105239_11663171
1216 Ga0105239_13284757
1217 Ga0105246_10328733
1218 Ga0105246_11807928
1219 Ga0157319_1004086
1220 Ga0157327_1001305
1221 Ga0157371_10699038
1222 Ga0157370_12031710
1223 Ga0157374_10195969
1224 Ga0157374_10259156
1225 Ga0157378_10313896
1226 Ga0157378_10742572
1227 Ga0157378_12728066
1228 Ga0163162_10013453
1229 Ga0163162_10419402
1230 Ga0163162_10696172
1231 Ga0163162_12359981
1232 Ga0157372_11518237
1233 Ga0157375_10066628
1234 Ga0157375_10070625
1235 Ga0157375_10121794
1236 Ga0157375_10467797
1237 Ga0157375_10560598
1238 Ga0157375_10775196
1239 Ga0157375_11040228
1240 Ga0157375_11572109
1241 Ga0157375_11924202
1242 Ga0163163_10012939
1243 Ga0163163_10172758
1244 Ga0163163_12569032
1245 Ga0157380_10019591
1246 Ga0157380_10118775
1247 Ga0157380_10209466
1248 Ga0157380_10372011
1249 Ga0157380_10378106
1250 Ga0157380_10424324
1251 Ga0157380_12190463
1252 Ga0157380_12762685
1253 Ga0157377_10003735
1254 Ga0157377_10181478
1255 Ga0157377_10209593
1256 Ga0157377_10328140
1257 Ga0157377_10371953
1258 Ga0157377_10437303
1259 Ga0157379_10012177
1260 Ga0157379_10347219
1261 Ga0157376_10184905
1262 Ga0157376_10629607
1263 Ga0157376_11929865
1264 Ga0182005_1117603
1265 Ga0163161_10053525
1266 Ga0163161_10143950
1267 Ga0207666_1059591
1268 Ga0207697_10009232
1269 Ga0207697_10084073
1270 Ga0207697_10099355
1271 Ga0207653_10086651
1272 Ga0207682_10003228
1273 Ga0207682_10007325
1274 Ga0207682_10027343
1275 Ga0207682_10058423
1276 Ga0207682_10097793
1277 Ga0207642_10558066
1278 Ga0207688_10000708
1279 Ga0207688_10083498
1280 Ga0207688_10318225
1281 Ga0207680_10583266
1282 Ga0207680_11331793
1283 Ga0207647_10156717
1284 Ga0207645_10000988
1285 Ga0207645_10012760
1286 Ga0207645_10027640
1287 Ga0207645_10532575
1288 Ga0207643_10004675
1289 Ga0207643_10005747
1290 Ga0207643_10006252
1291 Ga0207643_10088723
1292 Ga0207643_10106665
1293 Ga0207643_10133861
1294 Ga0207643_10260790
1295 Ga0207643_10770448
1296 Ga0207684_10613546
1297 Ga0207660_11173116
1298 Ga0207662_10011416
1299 Ga0207662_10023479
1300 Ga0207662_10301039
1301 Ga0207657_10517801
1302 Ga0207649_10013082
1303 Ga0207649_10035330
1304 Ga0207649_10141168
1305 Ga0207649_10629755
1306 Ga0207652_11878690
1307 Ga0207646_10567945
1308 Ga0207681_10008644
1309 Ga0207681_10010350
1310 Ga0207681_10042624
1311 Ga0207681_10222085
1312 Ga0207681_10365614
1313 Ga0207650_10104397
1314 Ga0207650_10122641
1315 Ga0207650_10127061
1316 Ga0207650_10425225
1317 Ga0207650_10439305
1318 Ga0207650_10558420
1319 Ga0207659_10000651
1320 Ga0207659_10001472
1321 Ga0207659_10034509
1322 Ga0207659_10099492
1323 Ga0207659_10212498
1324 Ga0207659_10325509
1325 Ga0207659_10597322
1326 Ga0207659_10858905
1327 Ga0207659_11515225
1328 Ga0207644_10020921
1329 Ga0207644_10092011
1330 Ga0207644_10363430
1331 Ga0207644_11230204
1332 Ga0207644_11705052
1333 Ga0207690_10219748
1334 Ga0207690_10317243
1335 Ga0207690_10738863
1336 Ga0207690_11025023
1337 Ga0207706_10003313
1338 Ga0207706_10064669
1339 Ga0207706_10211866
1340 Ga0207706_10236453
1341 Ga0207706_11715201
1342 Ga0207686_10992242
1343 Ga0207686_11395464
1344 Ga0207709_10225526
1345 Ga0207709_10289183
1346 Ga0207709_10439836
1347 Ga0207709_11243740
1348 Ga0207670_10010928
1349 Ga0207670_10024885
1350 Ga0207670_10046927
1351 Ga0207670_10094207
1352 Ga0207669_10009606
1353 Ga0207669_10106040
1354 Ga0207669_10852675
1355 Ga0207669_11141103
1356 Ga0207669_11279044
1357 Ga0207704_10198936
1358 Ga0207704_10449829
1359 Ga0207704_10922311
1360 Ga0207704_11506819
1361 Ga0207691_10000604
1362 Ga0207691_10001395
1363 Ga0207691_10010694
1364 Ga0207691_10014539
1365 Ga0207691_10047189
1366 Ga0207691_10049629
1367 Ga0207691_10063058
1368 Ga0207691_11287383
1369 Ga0207711_10388674
1370 Ga0207711_11330386
1371 Ga0207689_10002988
1372 Ga0207689_10226167
1373 Ga0207689_10256987
1374 Ga0207689_10296132
1375 Ga0207689_10325819
1376 Ga0207689_10391843
1377 Ga0207661_10031457
1378 Ga0207679_10037309
1379 Ga0207679_10092930
1380 Ga0207679_10123435
1381 Ga0207679_10366368
1382 Ga0207679_10777349
1383 Ga0207679_11007576
1384 Ga0207679_11015312
1385 Ga0207651_10010107
1386 Ga0207651_10112591
1387 Ga0207651_10131070
1388 Ga0207651_10301083
1389 Ga0207651_10335248
1390 Ga0207651_10341745
1391 Ga0207651_11967282
1392 Ga0207712_10006735
1393 Ga0207668_10155335
1394 Ga0207668_10241737
1395 Ga0207668_10292983
1396 Ga0207668_11687479
1397 Ga0207640_11288248
1398 Ga0207658_10188164
1399 Ga0207677_10626138
1400 Ga0207677_11478006
1401 Ga0207703_10006821
1402 Ga0207703_10035266
1403 Ga0207703_11148244
1404 Ga0207639_12171145
1405 Ga0207678_10441366
1406 Ga0207678_11862945
1407 Ga0207708_10243628
1408 Ga0207708_10290812
1409 Ga0207708_10377665
1410 Ga0207708_10414018
1411 Ga0207708_11865444
1412 Ga0207702_10337774
1413 Ga0207641_10008163
1414 Ga0207641_10152487
1415 Ga0207641_10520951
1416 Ga0207648_10000446
1417 Ga0207648_10027152
1418 Ga0207648_11115143
1419 Ga0207648_11124169
1420 Ga0207648_11534465
1421 Ga0207676_10043539
1422 Ga0207676_10049398
1423 Ga0207676_10065262
1424 Ga0207676_10145529
1425 Ga0207676_10207064
1426 Ga0207676_10444179
1427 Ga0207676_10594099
1428 Ga0207676_11438710
1429 Ga0207674_10051002
1430 Ga0207674_10199612
1431 Ga0207674_10767845
1432 Ga0207674_11213473
1433 Ga0207674_12239435
1434 Ga0207675_100017763
1435 Ga0207675_100073164
1436 Ga0207675_100283183
1437 Ga0207675_100783322
1438 Ga0207675_101148082
1439 Ga0207683_10004069
1440 Ga0207683_10013401
1441 Ga0207683_10052963
1442 Ga0207683_10260561
1443 Ga0207683_10372068
1444 Ga0207683_10616749
1445 Ga0207683_11614602
1446 Ga0207683_11867653
1447 Ga0207698_11635759
1448 Ga0210000_1030081
1449 Ga0209970_1066851
1450 Ga0209971_1021410
1451 Ga0209971_1136354
1452 Ga0209974_10071297
1453 Ga0207428_10000224
1454 Ga0207428_10000353
1455 Ga0207428_10001721
1456 Ga0207428_10001835
1457 Ga0207428_10042270
1458 Ga0207428_10161343
1459 Ga0207428_10324091
1460 Ga0207428_10336729
1461 Ga0207428_10559733
1462 Ga0268266_10914510
1463 Ga0268265_10000574
1464 Ga0268265_10055472
1465 Ga0268265_10072770
1466 Ga0268265_10809185
1467 Ga0268265_11499297
1468 Ga0268265_12068474
1469 Ga0268264_10074079
1470 Ga0268264_10436826
1471 Ga0268264_10748508
1472 Ga0268264_11517621
1473 Ga0307408_100504994
1474 Ga0307408_100862119
1475 Ga0307405_10255490
1476 Ga0307405_10448854
1477 Ga0307405_11281080
1478 Ga0307413_10452136
1479 Ga0307406_11727491
1480 Ga0307407_10846653
1481 Ga0307407_10916817
1482 Ga0307407_11509323
1483 Ga0307412_10321680
1484 Ga0307412_10355461
1485 Ga0307412_10360231
1486 Ga0307409_100183466
1487 Ga0307409_101277272
1488 Ga0307409_101735076
1489 Ga0307409_102934309
1490 Ga0307416_100056568
1491 Ga0307416_100625573
1492 Ga0307416_100844472
1493 Ga0307416_100901311
1494 Ga0307416_102139994
1495 Ga0307414_11167757
1496 Ga0307414_11329098
1497 Ga0307411_10158856
1498 Ga0307411_10820222
1499 Ga0307411_10824001
1500 Ga0307415_100418395
1501 Ga0373930_0014064
1502 Ga0373958_0039073
1503 Ga0373938_0015964
1504 Ga0373928_0025889
1505 Ga0373940_0036939
1506 Ga0373940_0103953
1507 Ga0373951_0101559
1508 Ga0373932_0055328
1509 Ga0373941_0061985
1510 Ga0373946_0147015
1511 Ga0373942_0258658
1512 Ga0373961_0031574
1513 Ga0373962_0103045
1514 Ga0373962_0265307
1515 Ga0373931_0093161
1516 Ga0373931_0754424
1517 Ga0373947_0152407
1518 Ga0373925_0946217
1519 Ga0439439_0189637
1520 Ga0439453_0000960
1521 Ga0439453_0015183
1522 Ga0451807_2707401
1523 Ga0451847_0504052
1524 Ga0439450_006029
1525 Ga0450896_058820
1526 Ga0439446_0270984
1527 Ga0450908_013125
1528 Ga0439435_0107378
1529 Ga0439435_0113817
1530 Ga0439464_0146053
1531 Ga0439464_0242229
1532 Ga0439460_0011474
1533 Ga0439460_0064014
1534 Ga0450916_004974
1535 Ga0439440_0016405
1536 Ga0453683_1048754
1537 Ga0451576_0012736
1538 Ga0451576_0091131
1539 Ga0451576_0271053
1540 Ga0451576_0615874
1541 Ga0451576_2240114
1542 Ga0495591_061082
1543 Ga0495591_154529
1544 Ga0495580_0297553
1545 Ga0495594_0112008
1546 Ga0495643_0013200
1547 Ga0495642_0043907
1548 Ga0495665_0181814
1549 Ga0495598_0016268
1550 Ga0495598_0268257
1551 Ga0495621_0003656
1552 Ga0495621_0006701
1553 Ga0495621_0015251
1554 Ga0495633_0227033
1555 Ga0495633_0238406
1556 Ga0495656_0047025
1557 Ga0495656_0073589
1558 Ga0495668_0285900
1559 Ga0495659_0007114
1560 Ga0495659_0119962
1561 Ga0495659_0205215
1562 Ga0495659_0219682
1563 Ga0495658_0359861
1564 Ga0495613_0632015
1565 Ga0495670_0043108
1566 Ga0495636_0164293
1567 Ga0495677_0180306
1568 Ga0496104_0448944
1569 Ga0496106_0200604
1570 Ga0496106_0298467
1571 Ga0496108_1484191
1572 Ga0496109_0122060
1573 Ga0501298_165440
1574 Ga0501031_0077781
1575 Ga0501033_0286980
1576 Ga0501036_0021560
1577 Ga0501038_0446452
1578 Ga0501039_0343996
1579 Ga0501041_0161603
1580 Ga0501041_0230095
1581 Ga0501042_0397896
1582 Ga0501046_0042164
1583 Ga0501048_0660691
1584 Ga0501067_0463695
1585 Ga0501069_0180170
1586 Ga0501071_0106454
1587 Ga0501071_0463403
1588 Ga0501071_0710202
1589 Ga0501072_0125630
1590 Ga0501072_0310911
1591 Ga0501072_0337523
1592 Ga0501074_0072396
1593 Ga0501075_0779878
1594 Ga0501076_0122069
1595 Ga0501202_129897
1596 Ga0501249_037719
1597 Ga0501079_0154400
1598 Ga0501080_0263478
1599 Ga0501081_0092255
1600 Ga0501263_055593
1601 Ga0501270_024286
1602 Ga0501283_073605
1603 nmdc:mga05p37_11033_c1
1604 nmdc:mga05p37_11783_c1
1605 nmdc:mga05p37_119081_c1
1606 nmdc:mga05p37_193469_c1
1607 nmdc:mga05p37_266482_c1
1608 nmdc:mga05p37_787206_c1
1609 nmdc:mga05p37_891973_c1
1610 nmdc:mga09592_1261485_c1
1611 nmdc:mga09592_129792_c1
1612 nmdc:mga09592_172196_c1
1613 nmdc:mga09592_21264_c1
1614 nmdc:mga09592_52799_c1
1615 nmdc:mga09592_666231_c1
1616 nmdc:mga0qj67_1183_c1
1617 nmdc:mga0qj67_163363_c1
1618 nmdc:mga0qj67_254185_c1
1619 nmdc:mga0qj67_458730_c1
1620 nmdc:mga0qj67_832446_c1
1621 nmdc:mga0qj67_912202_c1
1622 nmdc:mga0qj67_96052_c1
1623 nmdc:mga06r32_10017_c1
1624 nmdc:mga06r32_185719_c1
1625 nmdc:mga06r32_452303_c1
1626 nmdc:mga08y16_1376503_c1
1627 nmdc:mga08y16_145_c1
1628 nmdc:mga08y16_171783_c1
1629 nmdc:mga08y16_17393_c1
1630 nmdc:mga08y16_266097_c1
1631 nmdc:mga08y16_3589_c1
1632 nmdc:mga08y16_7446_c1
1633 nmdc:mga08y16_9502_c1
1634 nmdc:mga08y16_966259_c1
1635 nmdc:mga08y16_9784_c1
1636 nmdc:mga0n895_1015798_c1
1637 nmdc:mga0n895_10349_c1
1638 nmdc:mga0n895_109758_c1
1639 nmdc:mga0n895_14522_c1
1640 nmdc:mga0n895_1591735_c1
1641 nmdc:mga0n895_1953890_c1
1642 nmdc:mga0n895_237348_c1
1643 nmdc:mga0n895_29336_c1
1644 nmdc:mga0n895_510218_c1
1645 nmdc:mga0n895_77498_c1
1646 nmdc:mga0rr50_100756_c1
1647 nmdc:mga0rr50_14631_c1
1648 nmdc:mga0rr50_148676_c1
1649 nmdc:mga0rr50_33565_c1
1650 nmdc:mga0a205_152564_c1
1651 nmdc:mga0a205_22910_c1
1652 nmdc:mga0a205_56680_c1
1653 nmdc:mga0a205_58252_c1
1654 nmdc:mga0a205_744_c1
1655 nmdc:mga0a205_8052_c1
1656 nmdc:mga0a205_916782_c1
1657 Ga0501084_0002042
1658 Ga0501082_0024994
1659 Ga0501082_0553953
1660 Ga0530510_0291948

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05164

ZapA

Cell division protein ZapA

15

101

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
4p1m-assembly1.cif.gz_B-2 the structure of escherichia coli zapa 0.9171 2 95
4p1m-assembly1.cif.gz_A-2 the structure of escherichia coli zapa 0.8845 2 94
4p1m-assembly1.cif.gz_B-2 the structure of escherichia coli zapa 0.8333 2 95
4p1m-assembly1.cif.gz_A-2 the structure of escherichia coli zapa 0.7991 2 94
1t3u-assembly1.cif.gz_D unknown conserved bacterial protein from pseudomonas aeruginosa pao1 0.7888 1 88
ID Description Score Start End Superfamily
1j78A05 Mainly Alpha;Orthogonal Bundle;Serum Albumin; Chain A, Domain 1; 0.8962 29 57 1.10.246.10
af_Q9SUP7_123_206_1.10.30.10 Mainly Alpha;Orthogonal Bundle;DNA Binding (I), subunit A;High mobility group box domain 0.8882 28 59 1.10.30.10
4p1mB01 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Cell division protein ZapA protomer, N-terminal domain 0.8133 2 41 3.30.160.880
1t3uD01 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Cell division protein ZapA protomer, N-terminal domain 0.789 1 37 3.30.160.880
4p1mB01 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Cell division protein ZapA protomer, N-terminal domain 0.7255 2 41 3.30.160.880
ID Description Score Start End GO Terms
AF-A0A2V8FA65-F1-model_v4 Cell division protein ZapA (Z ring-associated protein ZapA) 0.9901 2 91 GO:0000917
GO:0000921
GO:0005829
GO:0030428
GO:0032153
GO:0043093
AF-A0A521SXP9-F1-model_v4 Cell division protein ZapA (Z ring-associated protein ZapA) 0.9832 2 92 GO:0000917
GO:0000921
GO:0005829
GO:0030428
GO:0032153
GO:0043093
AF-A0A2G4JHG6-F1-model_v4 Cell division protein ZapA (Z ring-associated protein ZapA) 0.9818 2 92 GO:0000917
GO:0000921
GO:0005829
GO:0030428
GO:0032153
GO:0043093
AF-A0A7X7Z316-F1-model_v4 Cell division protein ZapA (Z ring-associated protein ZapA) 0.9808 2 91 GO:0000917
GO:0000921
GO:0005829
GO:0030428
GO:0032153
GO:0043093
AF-A0A532DLL5-F1-model_v4 Cell division protein ZapA (Z ring-associated protein ZapA) 0.9802 2 96 GO:0000917
GO:0000921
GO:0005829
GO:0030428
GO:0032153
GO:0043093

Map