F482648

General Info

Members Datasets Scaffolds Average Seq Length
830 307 826 333

Family's Representative Sequence

Representative Sequence 3300009176|Ga0105242_10066025|Ga0105242_100660254
Length 368
Sequence MARNSFRLDSRLRTKIHPATQAIALTGRMSTLETSMIDAVVSRSRPHMARACLAAILALTGATPVLAWEPTKPVEFVVPAGTGGGADQMARLIQGIIVKHKLMKESMIVSNKSGGAGAEGFLDVKSKKGEAHTIVITLSNLFTTPLHTGIPFSWRDLTPVARLALDEFILWVNADTSYKTAKEYLAAVKEQTGKPGQMKMGGTGSAQEDQILTIQLEQAMPGTKFTYVPFKGGGEVCVNLVGKHVDSTVNNPIECVSHWKAARVRPLAVFDTARISVGEWKDIPTIKEALGVDVSYLMLRGMPGAPKEAVDWYVAFFKKVTETPEWKKYMEDGALKPAFASGPEYVKWVEENEQLHRELMTKGGLLKK

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
3 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
4 2643221672 Variovorax sp. Root434 Isolate Unclassified
5 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
6 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
7 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
8 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
66 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
67 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
68 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
69 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
70 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
71 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
72 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
86 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
87 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
102 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
103 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
115 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
116 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
178 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
179 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
183 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
184 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
185 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
186 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
187 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
188 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
189 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
190 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
191 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
192 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
193 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
194 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
195 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
196 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
197 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
198 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
199 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
200 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
201 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
202 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
203 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
204 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
205 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
206 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
207 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
208 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
209 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
210 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
211 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
212 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
213 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
214 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
215 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
216 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
217 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
218 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
219 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
220 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
221 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
222 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
223 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
224 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
225 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
226 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
227 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
228 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
229 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
230 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
231 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
232 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
233 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
234 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
235 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
236 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
237 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
238 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
239 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
240 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
241 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
242 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
243 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
244 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
245 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
246 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
247 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
248 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
249 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
250 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
251 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
252 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
253 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
254 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
255 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
256 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
257 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
258 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
270 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
271 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
272 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
273 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
274 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
275 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
276 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
277 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
278 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
279 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
280 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
282 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
283 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
284 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
285 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
286 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
287 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
288 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
289 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
290 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
291 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
292 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
293 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
294 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
295 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
296 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
297 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
298 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
299 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
300 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
301 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
302 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
303 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
304 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
305 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
306 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
307 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.52
Metatranscriptomes 0
Isolates 0.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.34
Nodule 0
Rhizoplane 2.53
Rhizosphere 90.72
Stem 0
Stem Tuber 0
Unclassified 2.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214922984 2209111006 Bacteria 1359
2 Ga0055536_1001542 3300003781 Bacteria 13829
3 Ga0055531_10001303 3300003794 Bacteria 18799
4 Ga0065716_1003999 3300005277 Bacteria 1086
5 Ga0065712_10067794 3300005290 Bacteria 34092
6 Ga0065712_10073744 3300005290 Bacteria 4287
7 Ga0065715_10000302 3300005293 Bacteria 23656
8 Ga0065715_10282678 3300005293 Bacteria 1082
9 Ga0070658_10022218 3300005327 Bacteria 5090
10 Ga0070658_10100259 3300005327 Bacteria 2394
11 Ga0070658_10193013 3300005327 Bacteria 1717
12 Ga0070676_10004177 3300005328 Bacteria 7579
13 Ga0070676_10062625 3300005328 Bacteria 2214
14 Ga0070690_100005700 3300005330 Bacteria 7015
15 Ga0070670_100005591 3300005331 Bacteria 10604
16 Ga0070677_10011261 3300005333 Bacteria 3080
17 Ga0070677_10030192 3300005333 Bacteria 2062
18 Ga0068869_100000966 3300005334 Bacteria 16712
19 Ga0068869_100032393 3300005334 Bacteria 3683
20 Ga0068869_100049933 3300005334 Bacteria 3031
21 Ga0070666_10010460 3300005335 Bacteria 5806
22 Ga0070680_100011700 3300005336 Bacteria 6799
23 Ga0070680_100017652 3300005336 Bacteria 5629
24 Ga0070680_100312692 3300005336 Bacteria 1333
25 Ga0068868_100022037 3300005338 Bacteria 4803
26 Ga0068868_100050777 3300005338 Bacteria 3259
27 Ga0068868_100202895 3300005338 Bacteria 1654
28 Ga0070691_10009588 3300005341 Bacteria 4419
29 Ga0070691_10011961 3300005341 Bacteria 3973
30 Ga0070691_10051994 3300005341 Unclassified 1959
31 Ga0070661_100051437 3300005344 Bacteria 3015
32 Ga0070692_10113560 3300005345 Bacteria 1501
33 Ga0070668_100022166 3300005347 Bacteria 4802
34 Ga0070668_100029091 3300005347 Bacteria 4195
35 Ga0070668_100095077 3300005347 Bacteria 2353
36 Ga0070669_100030851 3300005353 Bacteria 3869
37 Ga0070669_100064942 3300005353 Bacteria 2688
38 Ga0070669_100111225 3300005353 Bacteria 2079
39 Ga0070669_100130053 3300005353 Bacteria 1930
40 Ga0070675_100008041 3300005354 Bacteria 8176
41 Ga0070675_100012318 3300005354 Bacteria 6702
42 Ga0070675_100143812 3300005354 Bacteria 2040
43 Ga0070675_100431519 3300005354 Bacteria 1180
44 Ga0070671_100003747 3300005355 Bacteria 11941
45 Ga0070671_100011289 3300005355 Bacteria 7176
46 Ga0070671_100150517 3300005355 Bacteria 1965
47 Ga0070671_100178458 3300005355 Bacteria 1797
48 Ga0070671_100222130 3300005355 Bacteria 1602
49 Ga0070673_100007204 3300005364 Bacteria 7313
50 Ga0070673_100009277 3300005364 Bacteria 6600
51 Ga0070673_100029379 3300005364 Bacteria 4098
52 Ga0070673_100081600 3300005364 Bacteria 2623
53 Ga0070659_100173101 3300005366 Bacteria 1769
54 Ga0070667_100012330 3300005367 Bacteria 7072
55 Ga0070667_100088213 3300005367 Bacteria 2663
56 Ga0070711_100044173 3300005439 Bacteria 3023
57 Ga0070700_100030979 3300005441 Bacteria 3201
58 Ga0070700_100093999 3300005441 Bacteria 1962
59 Ga0070694_100087502 3300005444 Bacteria 2179
60 Ga0070708_100007577 3300005445 Bacteria 8689
61 Ga0070708_100009904 3300005445 Bacteria 7703
62 Ga0070708_100010509 3300005445 Bacteria 7504
63 Ga0070708_100032557 3300005445 Bacteria 4524
64 Ga0070708_100062810 3300005445 Bacteria 3323
65 Ga0070708_100251746 3300005445 Bacteria 1659
66 Ga0070708_100357543 3300005445 Bacteria 1376
67 Ga0070663_100037907 3300005455 Bacteria 3358
68 Ga0070663_100227957 3300005455 Bacteria 1466
69 Ga0070678_100011332 3300005456 Bacteria 5494
70 Ga0070678_100040192 3300005456 Bacteria 3307
71 Ga0070678_100155199 3300005456 Bacteria 1848
72 Ga0070678_100184015 3300005456 Bacteria 1713
73 Ga0070678_100286465 3300005456 Bacteria 1395
74 Ga0070662_100014260 3300005457 Bacteria 5305
75 Ga0070662_100019928 3300005457 Bacteria 4564
76 Ga0070662_100021528 3300005457 Bacteria 4403
77 Ga0070662_100026417 3300005457 Bacteria 4021
78 Ga0070662_100036296 3300005457 Bacteria 3486
79 Ga0070662_100045273 3300005457 Bacteria 3156
80 Ga0070662_100112798 3300005457 Bacteria 2073
81 Ga0070681_10002879 3300005458 Bacteria 15900
82 Ga0070681_10012674 3300005458 Bacteria 8364
83 Ga0070681_10060167 3300005458 Bacteria 3776
84 Ga0070681_10324921 3300005458 Bacteria 1448
85 Ga0068867_100031859 3300005459 Bacteria 3809
86 Ga0068867_100088054 3300005459 Bacteria 2352
87 Ga0068867_100236285 3300005459 Bacteria 1480
88 Ga0070706_100001589 3300005467 Bacteria 23687
89 Ga0070706_100005491 3300005467 Bacteria 12070
90 Ga0070706_100010557 3300005467 Bacteria 8572
91 Ga0070706_100032033 3300005467 Bacteria 4848
92 Ga0070706_100070565 3300005467 Bacteria 3230
93 Ga0070706_100077488 3300005467 Bacteria 3076
94 Ga0070707_100001162 3300005468 Bacteria 25888
95 Ga0070707_100001404 3300005468 Bacteria 23652
96 Ga0070707_100100816 3300005468 Bacteria 2798
97 Ga0070707_100332738 3300005468 Bacteria 1475
98 Ga0070707_100458707 3300005468 Bacteria 1235
99 Ga0070707_100550856 3300005468 Bacteria 1115
100 Ga0070698_100009924 3300005471 Bacteria 10179
101 Ga0070698_100039844 3300005471 Bacteria 4832
102 Ga0070698_100040892 3300005471 Bacteria 4762
103 Ga0070698_100344923 3300005471 Bacteria 1420
104 Ga0070699_100018229 3300005518 Bacteria 6032
105 Ga0070699_100225138 3300005518 Bacteria 1672
106 Ga0070699_100280401 3300005518 Bacteria 1493
107 Ga0070679_100047324 3300005530 Bacteria 4287
108 Ga0070679_100067827 3300005530 Bacteria 3558
109 Ga0070684_100052918 3300005535 Bacteria 3532
110 Ga0070697_100021883 3300005536 Bacteria 5070
111 Ga0070697_100035132 3300005536 Bacteria 4042
112 Ga0070697_100079233 3300005536 Bacteria 2704
113 Ga0070672_100007704 3300005543 Bacteria 7334
114 Ga0070672_100029468 3300005543 Bacteria 4116
115 Ga0070672_100067175 3300005543 Bacteria 2840
116 Ga0070672_100073109 3300005543 Bacteria 2732
117 Ga0070686_100168705 3300005544 Bacteria 1546
118 Ga0070696_100120426 3300005546 Bacteria 1899
119 Ga0070665_100157616 3300005548 Bacteria 2272
120 Ga0068855_100010300 3300005563 Bacteria 11276
121 Ga0068855_100019538 3300005563 Bacteria 8139
122 Ga0068855_100031423 3300005563 Bacteria 6340
123 Ga0070664_100002604 3300005564 Bacteria 14550
124 Ga0070664_100010652 3300005564 Bacteria 7451
125 Ga0068857_100033034 3300005577 Bacteria 4575
126 Ga0068854_100017084 3300005578 Bacteria 4851
127 Ga0068854_100092671 3300005578 Bacteria 2251
128 Ga0068854_100113215 3300005578 Bacteria 2049
129 Ga0068854_100316254 3300005578 Bacteria 1267
130 Ga0068856_100085833 3300005614 Bacteria 3127
131 Ga0070702_100030150 3300005615 Bacteria 2955
132 Ga0070702_100114693 3300005615 Bacteria 1677
133 Ga0068852_100084133 3300005616 Bacteria 2830
134 Ga0068852_100182214 3300005616 Bacteria 1976
135 Ga0068859_100005136 3300005617 Bacteria 13293
136 Ga0068859_100102845 3300005617 Bacteria 2914
137 Ga0068859_100715878 3300005617 Bacteria 1091
138 Ga0068864_100009415 3300005618 Bacteria 8059
139 Ga0068864_100053353 3300005618 Bacteria 3487
140 Ga0068861_100000575 3300005719 Bacteria 21693
141 Ga0068861_100137979 3300005719 Bacteria 1987
142 Ga0068870_10005096 3300005840 Bacteria 5713
143 Ga0068870_10016783 3300005840 Bacteria 3507
144 Ga0068863_100029312 3300005841 Bacteria 5253
145 Ga0068863_100076781 3300005841 Bacteria 3160
146 Ga0068863_100109776 3300005841 Bacteria 2626
147 Ga0068858_100008304 3300005842 Bacteria 9984
148 Ga0068858_100035532 3300005842 Bacteria 4622
149 Ga0068858_100108403 3300005842 Bacteria 2592
150 Ga0068858_100200318 3300005842 Bacteria 1888
151 Ga0068860_100030814 3300005843 Bacteria 5157
152 Ga0068860_100058908 3300005843 Bacteria 3652
153 Ga0068860_100117085 3300005843 Bacteria 2549
154 Ga0068860_100525064 3300005843 Bacteria 1184
155 Ga0068862_100197452 3300005844 Bacteria 1813
156 Ga0068862_100367943 3300005844 Bacteria 1337
157 Ga0081538_10002834 3300005981 Bacteria 16585
158 Ga0081540_1081992 3300005983 Bacteria 1448
159 Ga0081539_10000092 3300005985 Bacteria 208968
160 Ga0081539_10017494 3300005985 Bacteria 5028
161 Ga0075365_10040606 3300006038 Bacteria 3034
162 Ga0070712_100062413 3300006175 Bacteria 2635
163 Ga0070712_100093727 3300006175 Bacteria 2205
164 Ga0075362_10010992 3300006177 Bacteria 3554
165 Ga0075367_10020965 3300006178 Bacteria 3647
166 Ga0075366_10009924 3300006195 Bacteria 5329
167 Ga0075366_10013053 3300006195 Bacteria 4724
168 Ga0075366_10046644 3300006195 Bacteria 2568
169 Ga0075366_10113838 3300006195 Bacteria 1628
170 Ga0097621_100034178 3300006237 Bacteria 4054
171 Ga0097621_100034948 3300006237 Bacteria 4012
172 Ga0097621_100065873 3300006237 Bacteria 2983
173 Ga0097621_100095756 3300006237 Bacteria 2490
174 Ga0075370_10035473 3300006353 Bacteria 2799
175 Ga0068871_100017804 3300006358 Bacteria 5386
176 Ga0068871_100024771 3300006358 Bacteria 4657
177 Ga0068871_100150122 3300006358 Bacteria 1987
178 Ga0075428_100000436 3300006844 Bacteria 41529
179 Ga0075428_100012043 3300006844 Bacteria 9623
180 Ga0075428_100012245 3300006844 Bacteria 9538
181 Ga0075428_100013199 3300006844 Bacteria 9190
182 Ga0075428_100029862 3300006844 Bacteria 6030
183 Ga0075428_100034150 3300006844 Bacteria 5612
184 Ga0075428_100091471 3300006844 Bacteria 3318
185 Ga0075428_100137898 3300006844 Bacteria 2652
186 Ga0075428_100234543 3300006844 Bacteria 1980
187 Ga0075430_100000002 3300006846 Bacteria 150510
188 Ga0075430_100000678 3300006846 Bacteria 26055
189 Ga0075430_100004567 3300006846 Bacteria 11652
190 Ga0075430_100021586 3300006846 Bacteria 5471
191 Ga0075430_100052664 3300006846 Bacteria 3429
192 Ga0075430_100053397 3300006846 Bacteria 3402
193 Ga0075430_100064840 3300006846 Bacteria 3069
194 Ga0075431_100000452 3300006847 Bacteria 33772
195 Ga0075431_100001143 3300006847 Bacteria 23854
196 Ga0075431_100004273 3300006847 Bacteria 13990
197 Ga0075431_100006431 3300006847 Bacteria 11663
198 Ga0075431_100006738 3300006847 Bacteria 11408
199 Ga0075431_100091558 3300006847 Bacteria 3138
200 Ga0075431_100108770 3300006847 Bacteria 2861
201 Ga0075431_100127404 3300006847 Bacteria 2627
202 Ga0075431_100182374 3300006847 Bacteria 2154
203 Ga0075433_10003800 3300006852 Bacteria 11696
204 Ga0075433_10006010 3300006852 Bacteria 9564
205 Ga0075433_10008009 3300006852 Bacteria 8414
206 Ga0075433_10019115 3300006852 Bacteria 5700
207 Ga0075433_10049089 3300006852 Bacteria 3671
208 Ga0075433_10059887 3300006852 Bacteria 3332
209 Ga0075433_10110084 3300006852 Bacteria 2444
210 Ga0075433_10123164 3300006852 Bacteria 2303
211 Ga0075433_10138804 3300006852 Bacteria 2161
212 Ga0075433_10141093 3300006852 Bacteria 2142
213 Ga0075433_10170332 3300006852 Bacteria 1938
214 Ga0075433_10245953 3300006852 Bacteria 1588
215 Ga0075433_10397558 3300006852 Bacteria 1216
216 Ga0075434_100002356 3300006871 Bacteria 16547
217 Ga0075434_100005140 3300006871 Bacteria 11880
218 Ga0075434_100009161 3300006871 Bacteria 9221
219 Ga0075434_100026125 3300006871 Bacteria 5719
220 Ga0075434_100029969 3300006871 Bacteria 5356
221 Ga0075434_100032201 3300006871 Bacteria 5169
222 Ga0075434_100049867 3300006871 Bacteria 4157
223 Ga0075434_100069050 3300006871 Bacteria 3522
224 Ga0075434_100078710 3300006871 Bacteria 3293
225 Ga0075434_100083481 3300006871 Bacteria 3192
226 Ga0075434_100113841 3300006871 Bacteria 2718
227 Ga0075434_100124067 3300006871 Bacteria 2599
228 Ga0075434_100177262 3300006871 Bacteria 2151
229 Ga0075434_100214923 3300006871 Bacteria 1943
230 Ga0075434_100523460 3300006871 Bacteria 1206
231 Ga0075434_100549203 3300006871 Bacteria 1175
232 Ga0075434_100582910 3300006871 Bacteria 1138
233 Ga0075429_100000460 3300006880 Bacteria 30370
234 Ga0075429_100001854 3300006880 Bacteria 17514
235 Ga0075429_100010953 3300006880 Bacteria 7844
236 Ga0075429_100041711 3300006880 Bacteria 3996
237 Ga0075429_100046370 3300006880 Bacteria 3781
238 Ga0075429_100093929 3300006880 Bacteria 2616
239 Ga0075429_100270905 3300006880 Bacteria 1487
240 Ga0068865_100026816 3300006881 Bacteria 3801
241 Ga0075436_100001438 3300006914 Bacteria 16202
242 Ga0075436_100015795 3300006914 Bacteria 5170
243 Ga0097620_100005136 3300006931 Bacteria 13293
244 Ga0097620_100102842 3300006931 Bacteria 2914
245 Ga0097620_100715770 3300006931 Bacteria 1091
246 Ga0075435_100003478 3300007076 Bacteria 10682
247 Ga0075435_100013001 3300007076 Bacteria 6178
248 Ga0075435_100016217 3300007076 Bacteria 5615
249 Ga0075435_100040318 3300007076 Unclassified 3729
250 Ga0075435_100040978 3300007076 Bacteria 3700
251 Ga0075435_100055170 3300007076 Bacteria 3208
252 Ga0075435_100056645 3300007076 Bacteria 3169
253 Ga0075435_100095060 3300007076 Bacteria 2464
254 Ga0075435_100128226 3300007076 Bacteria 2121
255 Ga0075435_100203807 3300007076 Bacteria 1676
256 Ga0075435_100212135 3300007076 Bacteria 1643
257 Ga0075435_100240129 3300007076 Bacteria 1541
258 Ga0075435_100284504 3300007076 Bacteria 1412
259 Ga0099794_10012766 3300007265 Bacteria 3638
260 Ga0099794_10024348 3300007265 Bacteria 2778
261 Ga0099794_10049142 3300007265 Bacteria 2026
262 Ga0105244_10025409 3300009036 Bacteria 3219
263 Ga0111539_10000557 3300009094 Bacteria 47767
264 Ga0111539_10007349 3300009094 Bacteria 14109
265 Ga0111539_10163932 3300009094 Bacteria 2600
266 Ga0111539_10226547 3300009094 Bacteria 2177
267 Ga0111539_10248176 3300009094 Bacteria 2073
268 Ga0111539_10327515 3300009094 Bacteria 1783
269 Ga0111539_10367544 3300009094 Bacteria 1674
270 Ga0111539_10407084 3300009094 Bacteria 1584
271 Ga0105245_10101720 3300009098 Bacteria 2661
272 Ga0105245_10399728 3300009098 Bacteria 1373
273 Ga0105247_10100466 3300009101 Bacteria 1849
274 Ga0114129_10013913 3300009147 Bacteria 11464
275 Ga0114129_10015808 3300009147 Bacteria 10730
276 Ga0114129_10018918 3300009147 Bacteria 9814
277 Ga0114129_10022405 3300009147 Bacteria 8969
278 Ga0114129_10023727 3300009147 Bacteria 8695
279 Ga0114129_10027955 3300009147 Bacteria 7986
280 Ga0114129_10028080 3300009147 Bacteria 7972
281 Ga0114129_10031378 3300009147 Bacteria 7512
282 Ga0114129_10061558 3300009147 Bacteria 5245
283 Ga0114129_10083235 3300009147 Bacteria 4446
284 Ga0114129_10099597 3300009147 Bacteria 4023
285 Ga0114129_10149663 3300009147 Bacteria 3195
286 Ga0114129_10215283 3300009147 Bacteria 2594
287 Ga0114129_10259863 3300009147 Bacteria 2328
288 Ga0114129_10272460 3300009147 Bacteria 2264
289 Ga0114129_10309773 3300009147 Bacteria 2102
290 Ga0114129_10342592 3300009147 Bacteria 1982
291 Ga0114129_10379746 3300009147 Bacteria 1866
292 Ga0114129_10411631 3300009147 Bacteria 1780
293 Ga0114129_10431285 3300009147 Bacteria 1732
294 Ga0114129_10457427 3300009147 Bacteria 1673
295 Ga0114129_10461567 3300009147 Bacteria 1664
296 Ga0114129_10462710 3300009147 Bacteria 1662
297 Ga0114129_10479024 3300009147 Bacteria 1629
298 Ga0105243_10009794 3300009148 Bacteria 7293
299 Ga0105243_10117532 3300009148 Bacteria 2236
300 Ga0105243_10175226 3300009148 Bacteria 1861
301 Ga0105241_10040435 3300009174 Bacteria 3520
302 Ga0105241_10068787 3300009174 Bacteria 2744
303 Ga0105241_10403397 3300009174 Bacteria 1199
304 Ga0105242_10003647 3300009176 Bacteria 11985
305 Ga0105242_10066025 3300009176 Bacteria 2987
306 Ga0105242_10198533 3300009176 Unclassified 1780
307 Ga0105242_10228060 3300009176 Bacteria 1668
308 Ga0105242_10272672 3300009176 Unclassified 1533
309 Ga0105242_10298573 3300009176 Bacteria 1469
310 Ga0105248_10040261 3300009177 Bacteria 5238
311 Ga0105248_10132458 3300009177 Bacteria 2813
312 Ga0105248_10150680 3300009177 Bacteria 2624
313 Ga0105237_10203201 3300009545 Bacteria 1982
314 Ga0105238_10263627 3300009551 Bacteria 1703
315 Ga0105249_10004175 3300009553 Bacteria 12475
316 Ga0105249_10239632 3300009553 Bacteria 1793
317 Ga0105249_10430811 3300009553 Bacteria 1354
318 Ga0105239_10183357 3300010375 Bacteria 2342
319 Ga0105239_10357149 3300010375 Bacteria 1650
320 Ga0105246_10054413 3300011119 Bacteria 2758
321 Ga0157325_1001329 3300012485 Bacteria 1117
322 Ga0157373_10112894 3300013100 Bacteria 1910
323 Ga0157371_10066298 3300013102 Bacteria 2556
324 Ga0157374_10034097 3300013296 Bacteria 4648
325 Ga0157374_10056675 3300013296 Bacteria 3659
326 Ga0157374_10069604 3300013296 Bacteria 3313
327 Ga0157378_10020644 3300013297 Bacteria 5794
328 Ga0157378_10039990 3300013297 Bacteria 4159
329 Ga0157378_10118200 3300013297 Bacteria 2440
330 Ga0163162_10056936 3300013306 Bacteria 3937
331 Ga0163162_10060920 3300013306 Bacteria 3811
332 Ga0163162_10070558 3300013306 Bacteria 3545
333 Ga0163162_10156757 3300013306 Bacteria 2397
334 Ga0163162_10221658 3300013306 Bacteria 2021
335 Ga0163162_10245008 3300013306 Unclassified 1924
336 Ga0157372_10021948 3300013307 Bacteria 6901
337 Ga0157372_10334191 3300013307 Bacteria 1765
338 Ga0157375_10037314 3300013308 Bacteria 4655
339 Ga0157375_10163231 3300013308 Bacteria 2371
340 Ga0157375_10208326 3300013308 Bacteria 2112
341 Ga0163163_10007322 3300014325 Bacteria 9733
342 Ga0157380_10012144 3300014326 Bacteria 6237
343 Ga0157380_10071391 3300014326 Bacteria 2809
344 Ga0157380_10275232 3300014326 Bacteria 1537
345 Ga0157377_10053709 3300014745 Bacteria 2279
346 Ga0157379_10048037 3300014968 Bacteria 3809
347 Ga0157379_10050042 3300014968 Bacteria 3729
348 Ga0157379_10072723 3300014968 Bacteria 3077
349 Ga0157376_10004342 3300014969 Bacteria 9856
350 Ga0157376_10004443 3300014969 Bacteria 9770
351 Ga0157376_10062886 3300014969 Bacteria 3125
352 Ga0157376_10282256 3300014969 Bacteria 1564
353 Ga0182007_10001904 3300015262 Bacteria 10866
354 Ga0163161_10000201 3300017792 Bacteria 54704
355 Ga0163161_10037878 3300017792 Bacteria 3457
356 Ga0163161_10049693 3300017792 Bacteria 3032
357 Ga0207666_1002179 3300025271 Bacteria 2348
358 Ga0209676_1001621 3300025292 Bacteria 19914
359 Ga0209050_1000511 3300025298 Bacteria 65746
360 Ga0209051_1000326 3300025303 Bacteria 71572
361 Ga0209257_1000249 3300025304 Bacteria 124522
362 Ga0207697_10013998 3300025315 Bacteria 3339
363 Ga0207655_1003575 3300025728 Bacteria 11504
364 Ga0207682_10010199 3300025893 Bacteria 3686
365 Ga0207682_10010960 3300025893 Bacteria 3549
366 Ga0207642_10031608 3300025899 Bacteria 2219
367 Ga0207688_10015621 3300025901 Bacteria 4117
368 Ga0207680_10013062 3300025903 Bacteria 4252
369 Ga0207680_10263563 3300025903 Bacteria 1193
370 Ga0207685_10029541 3300025905 Bacteria 1941
371 Ga0207645_10003317 3300025907 Bacteria 12283
372 Ga0207645_10105918 3300025907 Bacteria 1817
373 Ga0207643_10011086 3300025908 Bacteria 4865
374 Ga0207643_10011571 3300025908 Bacteria 4764
375 Ga0207643_10104622 3300025908 Bacteria 1662
376 Ga0207705_10170128 3300025909 Bacteria 1640
377 Ga0207684_10000242 3300025910 Bacteria 81735
378 Ga0207684_10002560 3300025910 Bacteria 18242
379 Ga0207684_10006317 3300025910 Bacteria 10809
380 Ga0207684_10017290 3300025910 Bacteria 6185
381 Ga0207684_10096540 3300025910 Bacteria 2523
382 Ga0207684_10331392 3300025910 Bacteria 1311
383 Ga0207654_10100827 3300025911 Bacteria 1779
384 Ga0207707_10006041 3300025912 Bacteria 10592
385 Ga0207707_10014037 3300025912 Bacteria 6983
386 Ga0207707_10061944 3300025912 Bacteria 3255
387 Ga0207695_10017451 3300025913 Bacteria 8354
388 Ga0207693_10010103 3300025915 Bacteria 7668
389 Ga0207693_10126656 3300025915 Bacteria 2007
390 Ga0207657_10053475 3300025919 Bacteria 3498
391 Ga0207649_10021044 3300025920 Bacteria 3748
392 Ga0207649_10170219 3300025920 Bacteria 1517
393 Ga0207652_10008523 3300025921 Bacteria 8251
394 Ga0207652_10008998 3300025921 Bacteria 8047
395 Ga0207646_10000574 3300025922 Bacteria 48122
396 Ga0207646_10001059 3300025922 Bacteria 35029
397 Ga0207646_10014377 3300025922 Bacteria 7521
398 Ga0207646_10019416 3300025922 Bacteria 6318
399 Ga0207646_10021809 3300025922 Bacteria 5910
400 Ga0207646_10032739 3300025922 Bacteria 4703
401 Ga0207646_10045699 3300025922 Bacteria 3930
402 Ga0207646_10162679 3300025922 Bacteria 2014
403 Ga0207681_10043058 3300025923 Bacteria 3020
404 Ga0207681_10061243 3300025923 Bacteria 2586
405 Ga0207681_10102521 3300025923 Bacteria 2066
406 Ga0207681_10186358 3300025923 Bacteria 1584
407 Ga0207650_10007400 3300025925 Bacteria 7477
408 Ga0207650_10056804 3300025925 Bacteria 2909
409 Ga0207659_10001714 3300025926 Bacteria 13016
410 Ga0207659_10003908 3300025926 Bacteria 8987
411 Ga0207659_10126306 3300025926 Bacteria 1967
412 Ga0207687_10133153 3300025927 Bacteria 1877
413 Ga0207644_10009027 3300025931 Bacteria 6534
414 Ga0207644_10062435 3300025931 Bacteria 2702
415 Ga0207644_10180387 3300025931 Bacteria 1654
416 Ga0207644_10210719 3300025931 Bacteria 1536
417 Ga0207690_10038315 3300025932 Bacteria 3119
418 Ga0207706_10005505 3300025933 Bacteria 11807
419 Ga0207706_10010676 3300025933 Bacteria 8389
420 Ga0207706_10010908 3300025933 Bacteria 8292
421 Ga0207706_10058823 3300025933 Bacteria 3385
422 Ga0207706_10071674 3300025933 Bacteria 3048
423 Ga0207686_10047398 3300025934 Bacteria 2656
424 Ga0207709_10009580 3300025935 Bacteria 5332
425 Ga0207709_10081359 3300025935 Bacteria 2088
426 Ga0207709_10118291 3300025935 Bacteria 1785
427 Ga0207669_10267070 3300025937 Bacteria 1283
428 Ga0207704_10053082 3300025938 Bacteria 2461
429 Ga0207691_10016579 3300025940 Bacteria 6993
430 Ga0207691_10029124 3300025940 Bacteria 5166
431 Ga0207691_10040836 3300025940 Bacteria 4286
432 Ga0207711_10025878 3300025941 Bacteria 4921
433 Ga0207711_10029877 3300025941 Bacteria 4597
434 Ga0207711_10054531 3300025941 Bacteria 3431
435 Ga0207689_10000578 3300025942 Bacteria 34981
436 Ga0207689_10008649 3300025942 Bacteria 8864
437 Ga0207689_10037686 3300025942 Bacteria 4009
438 Ga0207689_10058161 3300025942 Bacteria 3180
439 Ga0207679_10180775 3300025945 Bacteria 1745
440 Ga0207667_10039202 3300025949 Bacteria 5051
441 Ga0207667_10058694 3300025949 Bacteria 4034
442 Ga0207651_10001572 3300025960 Bacteria 10454
443 Ga0207651_10093360 3300025960 Bacteria 2209
444 Ga0207651_10225090 3300025960 Bacteria 1519
445 Ga0207712_10008657 3300025961 Bacteria 6436
446 Ga0207712_10085590 3300025961 Bacteria 2308
447 Ga0207668_10140461 3300025972 Bacteria 1856
448 Ga0207668_10245038 3300025972 Bacteria 1452
449 Ga0207668_10383227 3300025972 Bacteria 1184
450 Ga0207640_10038096 3300025981 Bacteria 3031
451 Ga0207640_10073024 3300025981 Bacteria 2317
452 Ga0207658_10002890 3300025986 Bacteria 12312
453 Ga0207658_10008700 3300025986 Bacteria 6897
454 Ga0207658_10105321 3300025986 Bacteria 2218
455 Ga0207658_10247393 3300025986 Bacteria 1514
456 Ga0207677_10001764 3300026023 Bacteria 11437
457 Ga0207677_10008037 3300026023 Bacteria 5872
458 Ga0207703_10076591 3300026035 Bacteria 2775
459 Ga0207703_10122412 3300026035 Bacteria 2235
460 Ga0207639_10057989 3300026041 Bacteria 2976
461 Ga0207678_10064226 3300026067 Bacteria 3154
462 Ga0207678_10124647 3300026067 Bacteria 2198
463 Ga0207678_10203816 3300026067 Bacteria 1692
464 Ga0207708_10038044 3300026075 Bacteria 3664
465 Ga0207708_10078665 3300026075 Bacteria 2532
466 Ga0207708_10111402 3300026075 Bacteria 2125
467 Ga0207702_10114699 3300026078 Bacteria 2401
468 Ga0207641_10000594 3300026088 Bacteria 39811
469 Ga0207641_10034332 3300026088 Bacteria 4218
470 Ga0207641_10098334 3300026088 Bacteria 2573
471 Ga0207641_10272256 3300026088 Bacteria 1589
472 Ga0207641_10344860 3300026088 Unclassified 1418
473 Ga0207648_10041353 3300026089 Bacteria 4047
474 Ga0207648_10077095 3300026089 Bacteria 2905
475 Ga0207648_10170905 3300026089 Bacteria 1921
476 Ga0207648_10223741 3300026089 Bacteria 1673
477 Ga0207676_10000860 3300026095 Bacteria 23595
478 Ga0207676_10017649 3300026095 Bacteria 5174
479 Ga0207676_10095071 3300026095 Bacteria 2457
480 Ga0207674_10024823 3300026116 Bacteria 6398
481 Ga0207674_10027649 3300026116 Bacteria 5996
482 Ga0207675_100027354 3300026118 Bacteria 5312
483 Ga0207675_100034386 3300026118 Bacteria 4725
484 Ga0207675_100050157 3300026118 Bacteria 3894
485 Ga0207675_100168002 3300026118 Bacteria 2095
486 Ga0207683_10000890 3300026121 Bacteria 27458
487 Ga0207683_10002475 3300026121 Bacteria 16113
488 Ga0207683_10129945 3300026121 Bacteria 2265
489 Ga0207698_10046728 3300026142 Bacteria 3272
490 Ga0207698_10178288 3300026142 Bacteria 1879
491 Ga0209996_1006774 3300027395 Bacteria 1486
492 Ga0209999_1021436 3300027543 Bacteria 1186
493 Ga0209588_1010717 3300027671 Bacteria 2760
494 Ga0209588_1016016 3300027671 Bacteria 2310
495 Ga0209588_1020355 3300027671 Bacteria 2078
496 Ga0209588_1035179 3300027671 Bacteria 1610
497 Ga0209813_10033417 3300027866 Bacteria 1529
498 Ga0207428_10000033 3300027907 Bacteria 232081
499 Ga0207428_10000054 3300027907 Bacteria 175237
500 Ga0207428_10030997 3300027907 Bacteria 4418
501 Ga0207428_10087894 3300027907 Bacteria 2417
502 Ga0207428_10163063 3300027907 Bacteria 1692
503 Ga0268266_10139377 3300028379 Bacteria 2176
504 Ga0268265_10387699 3300028380 Bacteria 1287
505 Ga0268264_10003635 3300028381 Bacteria 13261
506 Ga0268264_10009846 3300028381 Bacteria 7912
507 Ga0268264_10047987 3300028381 Bacteria 3551
508 Ga0268264_10557296 3300028381 Bacteria 1125
509 Ga0307515_10000179 3300028794 Bacteria 156716
510 Ga0307515_10000586 3300028794 Bacteria 85517
511 Ga0307515_10006221 3300028794 Bacteria 23979
512 Ga0307515_10069999 3300028794 Bacteria 4783
513 Ga0307512_10142109 3300030522 Bacteria 1465
514 Ga0307513_10047767 3300031456 Bacteria 4653
515 Ga0307509_10008236 3300031507 Bacteria 13333
516 Ga0307509_10128577 3300031507 Bacteria 2494
517 Ga0307408_100007871 3300031548 Bacteria 7046
518 Ga0307408_100055346 3300031548 Bacteria 2872
519 Ga0307408_100148525 3300031548 Bacteria 1848
520 Ga0307508_10000649 3300031616 Bacteria 41802
521 Ga0307514_10031436 3300031649 Bacteria 4258
522 Ga0307516_10166651 3300031730 Bacteria 1947
523 Ga0307405_10013638 3300031731 Bacteria 4340
524 Ga0307410_10373502 3300031852 Bacteria 1145
525 Ga0307406_10072021 3300031901 Bacteria 2267
526 Ga0307412_10012351 3300031911 Bacteria 4975
527 Ga0307409_100011542 3300031995 Bacteria 5579
528 Ga0307411_10127295 3300032005 Bacteria 1855
529 Ga0373940_0031254 3300035088 Bacteria 1420
530 Ga0373936_0029320 3300035113 Bacteria 2166
531 Ga0373939_0022487 3300035114 Bacteria 1738
532 Ga0373960_0035600 3300035121 Bacteria 1414
533 Ga0373962_0047054 3300035242 Bacteria 1233
534 Ga0373931_0002271 3300035691 Bacteria 8496
535 Ga0373931_0009693 3300035691 Bacteria 4612
536 Ga0373931_0012731 3300035691 Bacteria 4082
537 Ga0373931_0013727 3300035691 Bacteria 3950
538 Ga0373925_0252341 3300037068 Bacteria 1415
539 Ga0373925_0290837 3300037068 Bacteria 1317
540 Ga0395899_0011209 3300037312 Bacteria 6869
541 Ga0395900_0001747 3300037418 Bacteria 25001
542 Ga0395900_0022197 3300037418 Bacteria 6493
543 Ga0395898_0003002 3300037466 Bacteria 19130
544 Ga0395905_0066540 3300037471 Bacteria 3374
545 Ga0395905_0093729 3300037471 Bacteria 2816
546 Ga0395905_0254105 3300037471 Bacteria 1642
547 Ga0395901_0001149 3300038443 Bacteria 28063
548 Ga0395901_0014577 3300038443 Bacteria 7990
549 Ga0395901_0051038 3300038443 Bacteria 4299
550 Ga0242420_023207 3300038996 Bacteria 1119
551 Ga0439439_0002176 3300041406 Bacteria 4115
552 Ga0451791_1836557 3300041451 Bacteria 1648
553 Ga0451851_1247133 3300041507 Bacteria 1317
554 Ga0451855_1812600 3300041511 Bacteria 1830
555 Ga0439432_005283 3300042006 Bacteria 4662
556 Ga0439449_0001123 3300042007 Bacteria 10530
557 Ga0439452_001727 3300042010 Bacteria 8557
558 Ga0439462_0006129 3300042015 Bacteria 2981
559 Ga0439462_0038644 3300042015 Bacteria 1272
560 Ga0450897_000666 3300042128 Bacteria 2020
561 Ga0450898_000063 3300042134 Bacteria 9276
562 Ga0450906_002684 3300042145 Bacteria 3873
563 Ga0439446_0011515 3300042156 Bacteria 2402
564 Ga0439434_0003855 3300042435 Bacteria 4382
565 Ga0451577_0088126 3300042876 Bacteria 2769
566 Ga0451577_0130714 3300042876 Bacteria 2252
567 Ga0451577_0145074 3300042876 Bacteria 2134
568 Ga0451577_0211712 3300042876 Bacteria 1751
569 Ga0451577_0405919 3300042876 Bacteria 1237
570 Ga0453683_0030684 3300044673 Bacteria 3398
571 Ga0453683_0036542 3300044673 Bacteria 3091
572 Ga0453683_0190318 3300044673 Bacteria 1302
573 Ga0453683_0193446 3300044673 Bacteria 1291
574 Ga0453684_0009330 3300044712 Bacteria 17209
575 Ga0453684_0092140 3300044712 Bacteria 3737
576 Ga0453684_0141440 3300044712 Bacteria 2873
577 Ga0453684_0174662 3300044712 Bacteria 2528
578 Ga0451576_0077314 3300045051 Bacteria 3463
579 Ga0451576_0078540 3300045051 Bacteria 3435
580 Ga0451576_0082742 3300045051 Bacteria 3338
581 Ga0451576_0131422 3300045051 Bacteria 2609
582 Ga0451576_0227613 3300045051 Bacteria 1947
583 Ga0495580_0001185 3300046472 Bacteria 22935
584 Ga0495580_0003832 3300046472 Bacteria 12716
585 Ga0495594_0047026 3300046499 Bacteria 2370
586 Ga0495631_0013301 3300046518 Bacteria 3996
587 Ga0495632_0096931 3300046519 Bacteria 1392
588 Ga0495637_0008879 3300046520 Bacteria 4919
589 Ga0495643_0058599 3300046522 Bacteria 2049
590 Ga0495642_0007566 3300046528 Bacteria 4162
591 Ga0495654_0005426 3300046530 Bacteria 7406
592 Ga0495598_0028075 3300046537 Bacteria 1558
593 Ga0495598_0035848 3300046537 Bacteria 1422
594 Ga0495668_0059634 3300046616 Bacteria 2106
595 Ga0495625_0001836 3300046660 Bacteria 24291
596 Ga0495659_0051169 3300046664 Bacteria 1504
597 Ga0495588_0037453 3300046674 Bacteria 2464
598 Ga0495647_0065083 3300046681 Bacteria 1447
599 Ga0495636_0040401 3300047318 Bacteria 1934
600 Ga0495593_0008983 3300047673 Bacteria 5799
601 Ga0496104_0027579 3300048907 Bacteria 5257
602 Ga0496106_0080388 3300048909 Bacteria 2503
603 Ga0496106_0235615 3300048909 Bacteria 1462
604 Ga0496107_0013562 3300048910 Bacteria 5698
605 Ga0496107_0120010 3300048910 Bacteria 1937
606 Ga0496107_0259972 3300048910 Bacteria 1292
607 Ga0496108_0015466 3300048911 Bacteria 6224
608 Ga0496108_0054499 3300048911 Bacteria 3356
609 Ga0496108_0525454 3300048911 Bacteria 1033
610 Ga0496109_0079993 3300048912 Bacteria 3011
611 Ga0496110_0044730 3300048913 Bacteria 3867
612 Ga0496110_0182036 3300048913 Unclassified 1908
613 Ga0496111_0157686 3300048914 Bacteria 1684
614 Ga0496112_0005186 3300048915 Bacteria 11204
615 Ga0496112_0006117 3300048915 Bacteria 10522
616 Ga0496112_0066380 3300048915 Bacteria 3560
617 Ga0496113_0048767 3300048916 Bacteria 3152
618 Ga0496114_0051838 3300048917 Bacteria 3417
619 Ga0496114_0166068 3300048917 Bacteria 1922
620 Ga0496115_0009096 3300048918 Bacteria 7371
621 Ga0496116_0125702 3300048919 Bacteria 1473
622 Ga0496118_0140937 3300048921 Bacteria 1528
623 Ga0496119_0036909 3300048922 Bacteria 3183
624 Ga0496121_0036819 3300048924 Bacteria 4355
625 Ga0496122_0023376 3300048925 Bacteria 5452
626 Ga0501031_0025410 3300049568 Bacteria 3863
627 Ga0501033_0109243 3300049570 Bacteria 2014
628 Ga0501036_0003619 3300049572 Bacteria 12356
629 Ga0501036_0216976 3300049572 Unclassified 1607
630 Ga0501036_0301632 3300049572 Bacteria 1340
631 Ga0501038_0137443 3300049574 Bacteria 2001
632 Ga0501038_0255124 3300049574 Bacteria 1388
633 Ga0501039_0174748 3300049575 Bacteria 1689
634 Ga0501040_0092053 3300049576 Bacteria 2108
635 Ga0501040_0208558 3300049576 Bacteria 1389
636 Ga0501040_0267172 3300049576 Bacteria 1221
637 Ga0501041_0009461 3300049577 Bacteria 5745
638 Ga0501041_0034253 3300049577 Bacteria 3074
639 Ga0501041_0123727 3300049577 Bacteria 1609
640 Ga0501041_0258169 3300049577 Bacteria 1096
641 Ga0501042_0081432 3300049578 Bacteria 2320
642 Ga0501046_0301024 3300049580 Bacteria 1171
643 Ga0501047_0037341 3300049581 Bacteria 4697
644 Ga0501048_0038735 3300049582 Bacteria 3421
645 Ga0501048_0081644 3300049582 Bacteria 2280
646 Ga0501067_0099215 3300049583 Bacteria 1617
647 Ga0501071_0002922 3300049587 Bacteria 10551
648 Ga0501072_0001954 3300049588 Bacteria 15357
649 Ga0501072_0040001 3300049588 Bacteria 3681
650 Ga0501074_0053896 3300049590 Bacteria 2901
651 Ga0501074_0116830 3300049590 Bacteria 1908
652 Ga0501074_0155644 3300049590 Unclassified 1633
653 Ga0501075_0000177 3300049591 Bacteria 33160
654 Ga0501075_0000904 3300049591 Bacteria 18763
655 Ga0501076_0000014 3300049592 Bacteria 97509
656 Ga0501076_0004543 3300049592 Bacteria 9887
657 Ga0501076_0017060 3300049592 Bacteria 5514
658 Ga0501076_0151372 3300049592 Bacteria 1887
659 Ga0501077_0010205 3300049593 Bacteria 5848
660 Ga0501077_0051774 3300049593 Bacteria 2608
661 Ga0501079_0027802 3300049741 Bacteria 4338
662 Ga0501079_0038707 3300049741 Bacteria 3677
663 Ga0501080_0191030 3300049742 Bacteria 1882
664 Ga0501080_0208510 3300049742 Bacteria 1792
665 Ga0501080_0349187 3300049742 Bacteria 1336
666 Ga0501081_0015410 3300049743 Bacteria 5044
667 Ga0501081_0016576 3300049743 Bacteria 4872
668 Ga0501081_0062219 3300049743 Bacteria 2589
669 Ga0501081_0129624 3300049743 Bacteria 1801
670 Ga0501081_0228566 3300049743 Bacteria 1354
671 Ga0501035_0327258 3300049822 Bacteria 1286
672 Ga0501044_0087640 3300049823 Bacteria 3144
673 Ga0501044_0140565 3300049823 Bacteria 2403
674 Ga0501045_0028539 3300049824 Bacteria 4026
675 Ga0501045_0135468 3300049824 Bacteria 1831
676 Ga0501045_0153852 3300049824 Bacteria 1711
677 nmdc:mga03683_17897_c1 3300050489 Bacteria 2687
678 nmdc:mga03683_8366_c1 3300050489 Bacteria 3636
679 nmdc:mga0yw44_21348_c1 3300050492 Bacteria 3610
680 nmdc:mga0k408_11190_c2 3300050493 Bacteria 3645
681 nmdc:mga0k408_25209_c1 3300050493 Bacteria 3367
682 nmdc:mga0k408_78623_c1 3300050493 Bacteria 1930
683 nmdc:mga0k408_96360_c1 3300050493 Bacteria 1742
684 nmdc:mga05p37_105529_c1 3300050507 Bacteria 3466
685 nmdc:mga05p37_106287_c1 3300050507 Bacteria 3453
686 nmdc:mga05p37_120390_c1 3300050507 Bacteria 3225
687 nmdc:mga05p37_172699_c1 3300050507 Unclassified 2635
688 nmdc:mga05p37_17921_c1 3300050507 Bacteria 8549
689 nmdc:mga05p37_200155_c1 3300050507 Bacteria 2420
690 nmdc:mga05p37_22024_c1 3300050507 Bacteria 7722
691 nmdc:mga05p37_223804_c1 3300050507 Bacteria 2270
692 nmdc:mga05p37_241691_c1 3300050507 Bacteria 2171
693 nmdc:mga05p37_323142_c1 3300050507 Bacteria 1826
694 nmdc:mga05p37_34529_c1 3300050507 Bacteria 6195
695 nmdc:mga05p37_41200_c1 3300050507 Bacteria 5671
696 nmdc:mga05p37_6225_c1 3300050507 Bacteria 14050
697 nmdc:mga05p37_64231_c1 3300050507 Bacteria 4517
698 nmdc:mga05p37_733_c1 3300050507 Bacteria 36361
699 nmdc:mga05p37_73969_c1 3300050507 Bacteria 4194
700 nmdc:mga05p37_74584_c1 3300050507 Bacteria 4176
701 nmdc:mga05p37_787268_c1 3300050507 Bacteria 1043
702 nmdc:mga05p37_87726_c1 3300050507 Bacteria 3835
703 nmdc:mga09592_1059_c1 3300050508 Bacteria 21817
704 nmdc:mga09592_141560_c1 3300050508 Bacteria 2074
705 nmdc:mga09592_1584_c1 3300050508 Bacteria 18322
706 nmdc:mga09592_22145_c1 3300050508 Bacteria 5243
707 nmdc:mga09592_22786_c2 3300050508 Bacteria 4280
708 nmdc:mga09592_43032_c1 3300050508 Bacteria 3800
709 nmdc:mga09592_4960_c1 3300050508 Bacteria 10785
710 nmdc:mga09592_53547_c1 3300050508 Bacteria 3408
711 nmdc:mga09592_56420_c1 3300050508 Bacteria 3319
712 nmdc:mga09592_56_c1 3300050508 Bacteria 62143
713 nmdc:mga09592_72346_c1 3300050508 Bacteria 2927
714 nmdc:mga0qj67_13933_c1 3300050509 Bacteria 6070
715 nmdc:mga0qj67_16942_c1 3300050509 Bacteria 5535
716 nmdc:mga0qj67_255374_c1 3300050509 Bacteria 1422
717 nmdc:mga0qj67_267612_c1 3300050509 Bacteria 1386
718 nmdc:mga0qj67_32441_c1 3300050509 Bacteria 4073
719 nmdc:mga0qj67_371969_c1 3300050509 Bacteria 1154
720 nmdc:mga0qj67_4943_c1 3300050509 Bacteria 9687
721 nmdc:mga0qj67_6405_c1 3300050509 Bacteria 8650
722 nmdc:mga0qj67_67830_c1 3300050509 Bacteria 2842
723 nmdc:mga0qj67_84501_c1 3300050509 Bacteria 2545
724 nmdc:mga06r32_114123_c1 3300050510 Bacteria 2659
725 nmdc:mga06r32_11821_c1 3300050510 Bacteria 7860
726 nmdc:mga06r32_132_c1 3300050510 Bacteria 54848
727 nmdc:mga06r32_133201_c1 3300050510 Bacteria 2459
728 nmdc:mga06r32_159281_c1 3300050510 Bacteria 2239
729 nmdc:mga06r32_16486_c1 3300050510 Bacteria 6734
730 nmdc:mga06r32_229563_c1 3300050510 Bacteria 1844
731 nmdc:mga06r32_244086_c1 3300050510 Bacteria 1783
732 nmdc:mga06r32_253514_c1 3300050510 Bacteria 1747
733 nmdc:mga06r32_301016_c1 3300050510 Bacteria 1590
734 nmdc:mga06r32_3570_c1 3300050510 Bacteria 13887
735 nmdc:mga06r32_404229_c1 3300050510 Bacteria 1348
736 nmdc:mga06r32_428_c1 3300050510 Bacteria 35405
737 nmdc:mga06r32_52039_c2 3300050510 Bacteria 2902
738 nmdc:mga06r32_555104_c1 3300050510 Bacteria 1122
739 nmdc:mga06r32_5613_c1 3300050510 Bacteria 11286
740 nmdc:mga06r32_8830_c2 3300050510 Bacteria 3707
741 nmdc:mga08y16_113813_c1 3300050511 Bacteria 2817
742 nmdc:mga08y16_131896_c1 3300050511 Bacteria 2598
743 nmdc:mga08y16_254649_c1 3300050511 Bacteria 1814
744 nmdc:mga08y16_29845_c1 3300050511 Bacteria 5743
745 nmdc:mga08y16_319173_c1 3300050511 Bacteria 1599
746 nmdc:mga08y16_5274_c1 3300050511 Bacteria 13510
747 nmdc:mga08y16_800_c1 3300050511 Bacteria 30094
748 nmdc:mga0n895_11851_c1 3300050512 Bacteria 7797
749 nmdc:mga0n895_146568_c1 3300050512 Bacteria 2390
750 nmdc:mga0n895_147472_c1 3300050512 Bacteria 2383
751 nmdc:mga0n895_180354_c1 3300050512 Bacteria 2143
752 nmdc:mga0n895_22204_c1 3300050512 Bacteria 5949
753 nmdc:mga0n895_26_c1 3300050512 Bacteria 89958
754 nmdc:mga0n895_34169_c1 3300050512 Bacteria 4893
755 nmdc:mga0n895_34414_c1 3300050512 Bacteria 4876
756 nmdc:mga0n895_36264_c1 3300050512 Bacteria 4762
757 nmdc:mga0n895_41376_c1 3300050512 Bacteria 4480
758 nmdc:mga0n895_508716_c1 3300050512 Bacteria 1213
759 nmdc:mga0n895_57551_c1 3300050512 Bacteria 3832
760 nmdc:mga0n895_63207_c1 3300050512 Bacteria 3660
761 nmdc:mga0n895_64237_c1 3300050512 Bacteria 3631
762 nmdc:mga0n895_65148_c1 3300050512 Bacteria 3606
763 nmdc:mga0n895_776_c1 3300050512 Bacteria 22697
764 nmdc:mga0n895_86333_c1 3300050512 Bacteria 3134
765 nmdc:mga0n895_90174_c1 3300050512 Bacteria 3067
766 nmdc:mga0rr50_108642_c1 3300050513 Bacteria 2192
767 nmdc:mga0rr50_112804_c1 3300050513 Bacteria 2154
768 nmdc:mga0rr50_1138_c1 3300050513 Bacteria 14452
769 nmdc:mga0rr50_143674_c1 3300050513 Bacteria 1922
770 nmdc:mga0rr50_179_c1 3300050513 Bacteria 34229
771 nmdc:mga0rr50_183295_c1 3300050513 Bacteria 1712
772 nmdc:mga0rr50_193788_c1 3300050513 Unclassified 1667
773 nmdc:mga0rr50_19697_c1 3300050513 Bacteria 4561
774 nmdc:mga0rr50_20128_c1 3300050513 Bacteria 4522
775 nmdc:mga0rr50_232183_c1 3300050513 Bacteria 1527
776 nmdc:mga0rr50_6589_c1 3300050513 Bacteria 7093
777 nmdc:mga0rr50_81363_c1 3300050513 Bacteria 2499
778 nmdc:mga0rr50_85562_c1 3300050513 Bacteria 2444
779 nmdc:mga0rr50_93483_c1 3300050513 Bacteria 2346
780 nmdc:mga08x19_17815_c1 3300050514 Bacteria 4348
781 nmdc:mga08x19_288166_c1 3300050514 Bacteria 1139
782 nmdc:mga08x19_35045_c1 3300050514 Bacteria 3174
783 nmdc:mga08x19_828_c1 3300050514 Bacteria 19629
784 nmdc:mga0a205_111152_c1 3300050515 Bacteria 2639
785 nmdc:mga0a205_11848_c2 3300050515 Bacteria 4810
786 nmdc:mga0a205_12048_c1 3300050515 Bacteria 7988
787 nmdc:mga0a205_134313_c1 3300050515 Bacteria 2375
788 nmdc:mga0a205_177404_c1 3300050515 Bacteria 2026
789 nmdc:mga0a205_236862_c1 3300050515 Unclassified 1707
790 nmdc:mga0a205_270298_c1 3300050515 Bacteria 1577
791 nmdc:mga0a205_28565_c1 3300050515 Bacteria 5334
792 nmdc:mga0a205_322849_c1 3300050515 Bacteria 1415
793 nmdc:mga0a205_329_c1 3300050515 Bacteria 35516
794 nmdc:mga0a205_39073_c1 3300050515 Bacteria 4567
795 nmdc:mga0a205_408277_c1 3300050515 Bacteria 1221
796 nmdc:mga0a205_44053_c1 3300050515 Bacteria 4301
797 nmdc:mga0a205_55298_c1 3300050515 Bacteria 3834
798 nmdc:mga0a205_6839_c1 3300050515 Bacteria 10315
799 nmdc:mga0a205_69619_c1 3300050515 Bacteria 3397
800 nmdc:mga0a205_75990_c1 3300050515 Bacteria 2690
801 nmdc:mga0a205_7857_c1 3300050515 Bacteria 9690
802 nmdc:mga0a205_881_c1 3300050515 Bacteria 10774
803 nmdc:mga0a205_9861_c1 3300050515 Bacteria 8762
804 Ga0500643_002513 3300053087 Bacteria 9398
805 Ga0500651_0000082 3300053093 Bacteria 60329
806 Ga0500651_0252935 3300053093 Bacteria 1024
807 Ga0500571_000152 3300053110 Bacteria 23934
808 Ga0500594_0002211 3300053118 Bacteria 4212
809 Ga0500607_000049 3300053121 Bacteria 80941
810 Ga0500655_000842 3300053133 Bacteria 5987
811 Ga0500658_0000038 3300053134 Bacteria 84273
812 Ga0500658_0002744 3300053134 Bacteria 6774
813 Ga0500564_004157 3300053138 Bacteria 5755
814 Ga0500568_0000338 3300053139 Bacteria 36755
815 Ga0500574_000501 3300053141 Bacteria 5001
816 Ga0500638_005113 3300053162 Bacteria 5174
817 Ga0500636_0060514 3300053177 Bacteria 2211
818 Ga0501084_0003441 3300054114 Bacteria 12849
819 Ga0501084_0005902 3300054114 Bacteria 10083
820 Ga0501084_0015490 3300054114 Bacteria 6323
821 Ga0501084_0016610 3300054114 Bacteria 6112
822 Ga0530510_0000045 3300061734 Bacteria 56772
823 Ga0530510_0001424 3300061734 Bacteria 16019
824 Ga0530510_0002079 3300061734 Bacteria 13746
825 Ga0530510_0043525 3300061734 Bacteria 3243
826 Ga0530510_0145371 3300061734 Bacteria 1749

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049575 Ga0501039_0174748 Ga0501039_0174748_840_1676 278
2 3300049572 Ga0501036_0301632 Ga0501036_0301632_437_1276 279
3 3300044673 Ga0453683_0193446 Ga0453683_0193446_84_944 282
4 3300007265 Ga0099794_10024348 Ga0099794_100243483 297
5 3300014326 Ga0157380_10275232 Ga0157380_102752322 300
6 3300050510 nmdc:mga06r32_244086_c1 nmdc:mga06r32_244086_c1_544_1452 300
7 3300053093 Ga0500651_0252935 Ga0500651_0252935_13_948 300
8 3300048911 Ga0496108_0525454 Ga0496108_0525454_49_987 301
9 3300003781 Ga0055536_1001542 Ga0055536_100154216 305
10 3300003794 Ga0055531_10001303 Ga0055531_1000130317 305
11 3300005457 Ga0070662_100045273 Ga0070662_1000452734 305
12 3300005467 Ga0070706_100001589 Ga0070706_10000158917 305
13 3300005578 Ga0068854_100113215 Ga0068854_1001132152 305
14 3300006195 Ga0075366_10046644 Ga0075366_100466441 305
15 3300006353 Ga0075370_10035473 Ga0075370_100354732 305
16 3300009036 Ga0105244_10025409 Ga0105244_100254093 305
17 3300009148 Ga0105243_10117532 Ga0105243_101175322 305
18 3300025292 Ga0209676_1001621 Ga0209676_100162118 305
19 3300025298 Ga0209050_1000511 Ga0209050_100051128 305
20 3300025303 Ga0209051_1000326 Ga0209051_100032637 305
21 3300025304 Ga0209257_1000249 Ga0209257_100024932 305
22 3300025910 Ga0207684_10006317 Ga0207684_100063173 305
23 3300025922 Ga0207646_10045699 Ga0207646_100456992 305
24 3300025935 Ga0207709_10081359 Ga0207709_100813593 305
25 3300045051 Ga0451576_0131422 Ga0451576_0131422_1654_2574 305
26 3300048919 Ga0496116_0125702 Ga0496116_0125702_309_1328 305
27 3300048921 Ga0496118_0140937 Ga0496118_0140937_160_1179 305
28 3300015262 Ga0182007_10001904 Ga0182007_100019046 306
29 3300037068 Ga0373925_0252341 Ga0373925_0252341_39_995 306
30 3300005341 Ga0070691_10009588 Ga0070691_100095884 307
31 3300005563 Ga0068855_100019538 Ga0068855_1000195383 307
32 3300025913 Ga0207695_10017451 Ga0207695_100174517 307
33 3300025921 Ga0207652_10008523 Ga0207652_100085235 307
34 3300025949 Ga0207667_10058694 Ga0207667_100586943 307
35 3300005327 Ga0070658_10022218 Ga0070658_100222183 308
36 3300005336 Ga0070680_100011700 Ga0070680_1000117004 308
37 3300005458 Ga0070681_10012674 Ga0070681_100126746 308
38 3300005564 Ga0070664_100010652 Ga0070664_1000106527 308
39 3300006847 Ga0075431_100182374 Ga0075431_1001823742 308
40 3300009098 Ga0105245_10399728 Ga0105245_103997282 308
41 3300013308 Ga0157375_10163231 Ga0157375_101632312 308
42 3300025728 Ga0207655_1003575 Ga0207655_100357511 308
43 3300025912 Ga0207707_10006041 Ga0207707_100060414 308
44 3300025933 Ga0207706_10010908 Ga0207706_100109089 308
45 3300046537 Ga0495598_0028075 Ga0495598_0028075_156_1157 308
46 3300048924 Ga0496121_0036819 Ga0496121_0036819_1774_2793 308
47 3300050510 nmdc:mga06r32_159281_c1 nmdc:mga06r32_159281_c1_824_1897 308
48 3300050510 nmdc:mga06r32_555104_c1 nmdc:mga06r32_555104_c1_125_1063 308
49 3300009094 Ga0111539_10226547 Ga0111539_102265472 309
50 3300009147 Ga0114129_10431285 Ga0114129_104312852 309
51 3300049583 Ga0501067_0099215 Ga0501067_0099215_86_1021 309
52 3300006852 Ga0075433_10059887 Ga0075433_100598873 310
53 3300006871 Ga0075434_100083481 Ga0075434_1000834813 310
54 3300006880 Ga0075429_100041711 Ga0075429_1000417115 310
55 3300006914 Ga0075436_100001438 Ga0075436_1000014387 310
56 3300050508 nmdc:mga09592_43032_c1 nmdc:mga09592_43032_c1_1147_2094 310
57 3300050509 nmdc:mga0qj67_67830_c1 nmdc:mga0qj67_67830_c1_224_1171 310
58 3300050510 nmdc:mga06r32_114123_c1 nmdc:mga06r32_114123_c1_769_1722 310
59 3300050510 nmdc:mga06r32_132_c1 nmdc:mga06r32_132_c1_41153_42100 310
60 3300009148 Ga0105243_10009794 Ga0105243_100097943 311
61 3300009176 Ga0105242_10003647 Ga0105242_100036478 311
62 3300032005 Ga0307411_10127295 Ga0307411_101272951 311
63 3300035691 Ga0373931_0002271 Ga0373931_0002271_2930_3886 311
64 3300042876 Ga0451577_0088126 Ga0451577_0088126_962_1918 311
65 3300048909 Ga0496106_0235615 Ga0496106_0235615_98_1054 311
66 3300048916 Ga0496113_0048767 Ga0496113_0048767_16_996 311
67 3300009101 Ga0105247_10100466 Ga0105247_101004661 312
68 3300037418 Ga0395900_0022197 Ga0395900_0022197_929_1882 312
69 3300038443 Ga0395901_0051038 Ga0395901_0051038_2703_3656 312
70 3300050509 nmdc:mga0qj67_371969_c1 nmdc:mga0qj67_371969_c1_112_1071 312
71 3300005981 Ga0081538_10002834 Ga0081538_100028349 313
72 3300050510 nmdc:mga06r32_428_c1 nmdc:mga06r32_428_c1_31701_32687 313
73 3300009553 Ga0105249_10430811 Ga0105249_104308111 314
74 3300013297 Ga0157378_10039990 Ga0157378_100399903 314
75 3300013306 Ga0163162_10156757 Ga0163162_101567573 314
76 3300025899 Ga0207642_10031608 Ga0207642_100316081 314
77 3300028794 Ga0307515_10006221 Ga0307515_1000622117 314
78 3300031507 Ga0307509_10008236 Ga0307509_100082368 314
79 3300035113 Ga0373936_0029320 Ga0373936_0029320_865_1809 314
80 3300045051 Ga0451576_0227613 Ga0451576_0227613_320_1312 314
81 3300048917 Ga0496114_0166068 Ga0496114_0166068_705_1694 314
82 3300050515 nmdc:mga0a205_408277_c1 nmdc:mga0a205_408277_c1_224_1168 314
83 3300053087 Ga0500643_002513 Ga0500643_002513_3135_4238 314
84 3300053134 Ga0500658_0002744 Ga0500658_0002744_2372_3475 314
85 3300045051 Ga0451576_0077314 Ga0451576_0077314_85_1083 315
86 3300046520 Ga0495637_0008879 Ga0495637_0008879_1856_2884 315
87 3300049822 Ga0501035_0327258 Ga0501035_0327258_144_1133 315
88 3300049823 Ga0501044_0140565 Ga0501044_0140565_1275_2264 315
89 3300050507 nmdc:mga05p37_6225_c1 nmdc:mga05p37_6225_c1_6416_7384 315
90 3300050508 nmdc:mga09592_72346_c1 nmdc:mga09592_72346_c1_664_1632 315
91 3300050509 nmdc:mga0qj67_4943_c1 nmdc:mga0qj67_4943_c1_664_1632 315
92 3300050510 nmdc:mga06r32_3570_c1 nmdc:mga06r32_3570_c1_8270_9238 315
93 3300050512 nmdc:mga0n895_26_c1 nmdc:mga0n895_26_c1_28438_29400 315
94 3300050513 nmdc:mga0rr50_179_c1 nmdc:mga0rr50_179_c1_17323_18285 315
95 3300050514 nmdc:mga08x19_828_c1 nmdc:mga08x19_828_c1_1604_2566 315
96 3300050515 nmdc:mga0a205_329_c1 nmdc:mga0a205_329_c1_1731_2693 315
97 3300053121 Ga0500607_000049 Ga0500607_000049_58407_59435 315
98 3300005293 Ga0065715_10282678 Ga0065715_102826781 316
99 3300005842 Ga0068858_100108403 Ga0068858_1001084032 316
100 3300013306 Ga0163162_10221658 Ga0163162_102216582 316
101 3300026095 Ga0207676_10095071 Ga0207676_100950712 316
102 3300027395 Ga0209996_1006774 Ga0209996_10067741 316
103 3300027543 Ga0209999_1021436 Ga0209999_10214362 316
104 3300049568 Ga0501031_0025410 Ga0501031_0025410_111_1079 316
105 3300049582 Ga0501048_0081644 Ga0501048_0081644_628_1596 316
106 3300049591 Ga0501075_0000904 Ga0501075_0000904_1413_2381 316
107 3300049592 Ga0501076_0004543 Ga0501076_0004543_8078_9046 316
108 3300049742 Ga0501080_0208510 Ga0501080_0208510_163_1131 316
109 3300049824 Ga0501045_0028539 Ga0501045_0028539_1527_2495 316
110 3300061734 Ga0530510_0001424 Ga0530510_0001424_8209_9177 316
111 3300005334 Ga0068869_100000966 Ga0068869_1000009663 317
112 3300005344 Ga0070661_100051437 Ga0070661_1000514372 317
113 3300005353 Ga0070669_100030851 Ga0070669_1000308513 317
114 3300005354 Ga0070675_100008041 Ga0070675_1000080416 317
115 3300005455 Ga0070663_100037907 Ga0070663_1000379072 317
116 3300005456 Ga0070678_100184015 Ga0070678_1001840152 317
117 3300005456 Ga0070678_100286465 Ga0070678_1002864652 317
118 3300005457 Ga0070662_100014260 Ga0070662_1000142603 317
119 3300005467 Ga0070706_100032033 Ga0070706_1000320334 317
120 3300005468 Ga0070707_100001404 Ga0070707_1000014043 317
121 3300005471 Ga0070698_100009924 Ga0070698_1000099244 317
122 3300005518 Ga0070699_100018229 Ga0070699_1000182295 317
123 3300005535 Ga0070684_100052918 Ga0070684_1000529182 317
124 3300005536 Ga0070697_100021883 Ga0070697_1000218834 317
125 3300005543 Ga0070672_100007704 Ga0070672_1000077046 317
126 3300005563 Ga0068855_100010300 Ga0068855_1000103003 317
127 3300005578 Ga0068854_100017084 Ga0068854_1000170843 317
128 3300005614 Ga0068856_100085833 Ga0068856_1000858333 317
129 3300005615 Ga0070702_100114693 Ga0070702_1001146932 317
130 3300005616 Ga0068852_100084133 Ga0068852_1000841333 317
131 3300005719 Ga0068861_100000575 Ga0068861_1000005757 317
132 3300005841 Ga0068863_100076781 Ga0068863_1000767812 317
133 3300005842 Ga0068858_100035532 Ga0068858_1000355323 317
134 3300005842 Ga0068858_100200318 Ga0068858_1002003182 317
135 3300005843 Ga0068860_100058908 Ga0068860_1000589082 317
136 3300005985 Ga0081539_10000092 Ga0081539_10000092152 317
137 3300005985 Ga0081539_10017494 Ga0081539_100174943 317
138 3300006237 Ga0097621_100095756 Ga0097621_1000957561 317
139 3300006844 Ga0075428_100012043 Ga0075428_1000120432 317
140 3300006844 Ga0075428_100029862 Ga0075428_1000298623 317
141 3300006846 Ga0075430_100021586 Ga0075430_1000215863 317
142 3300006847 Ga0075431_100004273 Ga0075431_10000427314 317
143 3300006847 Ga0075431_100091558 Ga0075431_1000915583 317
144 3300006852 Ga0075433_10138804 Ga0075433_101388042 317
145 3300006871 Ga0075434_100214923 Ga0075434_1002149231 317
146 3300006880 Ga0075429_100010953 Ga0075429_1000109536 317
147 3300009098 Ga0105245_10101720 Ga0105245_101017202 317
148 3300009147 Ga0114129_10022405 Ga0114129_100224055 317
149 3300009147 Ga0114129_10083235 Ga0114129_100832353 317
150 3300009147 Ga0114129_10259863 Ga0114129_102598632 317
151 3300009174 Ga0105241_10403397 Ga0105241_104033971 317
152 3300009177 Ga0105248_10132458 Ga0105248_101324582 317
153 3300009545 Ga0105237_10203201 Ga0105237_102032012 317
154 3300009551 Ga0105238_10263627 Ga0105238_102636271 317
155 3300010375 Ga0105239_10183357 Ga0105239_101833572 317
156 3300013102 Ga0157371_10066298 Ga0157371_100662983 317
157 3300013296 Ga0157374_10056675 Ga0157374_100566752 317
158 3300013306 Ga0163162_10070558 Ga0163162_100705583 317
159 3300013307 Ga0157372_10021948 Ga0157372_100219485 317
160 3300013308 Ga0157375_10208326 Ga0157375_102083262 317
161 3300014326 Ga0157380_10012144 Ga0157380_100121446 317
162 3300014745 Ga0157377_10053709 Ga0157377_100537091 317
163 3300014968 Ga0157379_10048037 Ga0157379_100480372 317
164 3300014968 Ga0157379_10072723 Ga0157379_100727233 317
165 3300014969 Ga0157376_10004342 Ga0157376_100043427 317
166 3300017792 Ga0163161_10049693 Ga0163161_100496933 317
167 3300025901 Ga0207688_10015621 Ga0207688_100156214 317
168 3300025903 Ga0207680_10263563 Ga0207680_102635631 317
169 3300025907 Ga0207645_10105918 Ga0207645_101059182 317
170 3300025910 Ga0207684_10000242 Ga0207684_1000024254 317
171 3300025920 Ga0207649_10170219 Ga0207649_101702191 317
172 3300025922 Ga0207646_10000574 Ga0207646_100005749 317
173 3300025923 Ga0207681_10102521 Ga0207681_101025212 317
174 3300025926 Ga0207659_10001714 Ga0207659_1000171412 317
175 3300025927 Ga0207687_10133153 Ga0207687_101331532 317
176 3300025932 Ga0207690_10038315 Ga0207690_100383152 317
177 3300025933 Ga0207706_10071674 Ga0207706_100716742 317
178 3300025940 Ga0207691_10016579 Ga0207691_100165796 317
179 3300025941 Ga0207711_10025878 Ga0207711_100258782 317
180 3300025942 Ga0207689_10000578 Ga0207689_100005782 317
181 3300025949 Ga0207667_10039202 Ga0207667_100392023 317
182 3300025981 Ga0207640_10073024 Ga0207640_100730242 317
183 3300026023 Ga0207677_10008037 Ga0207677_100080373 317
184 3300026035 Ga0207703_10076591 Ga0207703_100765912 317
185 3300026035 Ga0207703_10122412 Ga0207703_101224122 317
186 3300026041 Ga0207639_10057989 Ga0207639_100579892 317
187 3300026078 Ga0207702_10114699 Ga0207702_101146993 317
188 3300026095 Ga0207676_10017649 Ga0207676_100176492 317
189 3300026116 Ga0207674_10024823 Ga0207674_100248236 317
190 3300026118 Ga0207675_100050157 Ga0207675_1000501573 317
191 3300026121 Ga0207683_10129945 Ga0207683_101299453 317
192 3300026142 Ga0207698_10046728 Ga0207698_100467282 317
193 3300027671 Ga0209588_1020355 Ga0209588_10203553 317
194 3300028381 Ga0268264_10009846 Ga0268264_100098463 317
195 3300031548 Ga0307408_100055346 Ga0307408_1000553463 317
196 3300031901 Ga0307406_10072021 Ga0307406_100720212 317
197 3300035242 Ga0373962_0047054 Ga0373962_0047054_77_1096 317
198 3300037471 Ga0395905_0066540 Ga0395905_0066540_2213_3214 317
199 3300044673 Ga0453683_0036542 Ga0453683_0036542_571_1563 317
200 3300045051 Ga0451576_0078540 Ga0451576_0078540_711_1703 317
201 3300046528 Ga0495642_0007566 Ga0495642_0007566_2858_3874 317
202 3300048909 Ga0496106_0080388 Ga0496106_0080388_701_1720 317
203 3300048910 Ga0496107_0013562 Ga0496107_0013562_1789_2808 317
204 3300048912 Ga0496109_0079993 Ga0496109_0079993_1044_2063 317
205 3300048913 Ga0496110_0044730 Ga0496110_0044730_1288_2307 317
206 3300048914 Ga0496111_0157686 Ga0496111_0157686_610_1629 317
207 3300048915 Ga0496112_0066380 Ga0496112_0066380_2363_3382 317
208 3300048917 Ga0496114_0051838 Ga0496114_0051838_1186_2205 317
209 3300048918 Ga0496115_0009096 Ga0496115_0009096_5121_6140 317
210 3300049743 Ga0501081_0228566 Ga0501081_0228566_76_1053 317
211 3300050507 nmdc:mga05p37_223804_c1 nmdc:mga05p37_223804_c1_720_1697 317
212 3300050507 nmdc:mga05p37_73969_c1 nmdc:mga05p37_73969_c1_2230_3201 317
213 3300050508 nmdc:mga09592_4960_c1 nmdc:mga09592_4960_c1_978_1961 317
214 3300050509 nmdc:mga0qj67_267612_c1 nmdc:mga0qj67_267612_c1_352_1344 317
215 3300050509 nmdc:mga0qj67_32441_c1 nmdc:mga0qj67_32441_c1_2800_3825 317
216 3300050510 nmdc:mga06r32_52039_c2 nmdc:mga06r32_52039_c2_25_996 317
217 3300050511 nmdc:mga08y16_319173_c1 nmdc:mga08y16_319173_c1_87_1103 317
218 3300050515 nmdc:mga0a205_11848_c2 nmdc:mga0a205_11848_c2_3622_4599 317
219 3300053093 Ga0500651_0000082 Ga0500651_0000082_21318_22412 317
220 3300061734 Ga0530510_0145371 Ga0530510_0145371_283_1260 317
221 3300005330 Ga0070690_100005700 Ga0070690_1000057005 318
222 3300005333 Ga0070677_10030192 Ga0070677_100301922 318
223 3300005334 Ga0068869_100049933 Ga0068869_1000499331 318
224 3300005335 Ga0070666_10010460 Ga0070666_100104605 318
225 3300005338 Ga0068868_100022037 Ga0068868_1000220374 318
226 3300005347 Ga0070668_100095077 Ga0070668_1000950771 318
227 3300005354 Ga0070675_100012318 Ga0070675_1000123185 318
228 3300005355 Ga0070671_100003747 Ga0070671_10000374711 318
229 3300005364 Ga0070673_100007204 Ga0070673_1000072045 318
230 3300005364 Ga0070673_100081600 Ga0070673_1000816003 318
231 3300005367 Ga0070667_100012330 Ga0070667_1000123304 318
232 3300005456 Ga0070678_100011332 Ga0070678_1000113323 318
233 3300005457 Ga0070662_100036296 Ga0070662_1000362964 318
234 3300005459 Ga0068867_100031859 Ga0068867_1000318594 318
235 3300005543 Ga0070672_100067175 Ga0070672_1000671753 318
236 3300005548 Ga0070665_100157616 Ga0070665_1001576161 318
237 3300005616 Ga0068852_100182214 Ga0068852_1001822142 318
238 3300005617 Ga0068859_100005136 Ga0068859_1000051367 318
239 3300005618 Ga0068864_100009415 Ga0068864_1000094156 318
240 3300005719 Ga0068861_100137979 Ga0068861_1001379792 318
241 3300005841 Ga0068863_100029312 Ga0068863_1000293124 318
242 3300005842 Ga0068858_100008304 Ga0068858_1000083043 318
243 3300005844 Ga0068862_100367943 Ga0068862_1003679432 318
244 3300006237 Ga0097621_100034178 Ga0097621_1000341783 318
245 3300006358 Ga0068871_100024771 Ga0068871_1000247715 318
246 3300006931 Ga0097620_100005136 Ga0097620_1000051367 318
247 3300009147 Ga0114129_10018918 Ga0114129_100189188 318
248 3300009176 Ga0105242_10298573 Ga0105242_102985731 318
249 3300009177 Ga0105248_10040261 Ga0105248_100402614 318
250 3300009177 Ga0105248_10150680 Ga0105248_101506803 318
251 3300013296 Ga0157374_10034097 Ga0157374_100340974 318
252 3300013297 Ga0157378_10118200 Ga0157378_101182002 318
253 3300013306 Ga0163162_10060920 Ga0163162_100609204 318
254 3300013308 Ga0157375_10037314 Ga0157375_100373144 318
255 3300014325 Ga0163163_10007322 Ga0163163_100073225 318
256 3300014326 Ga0157380_10071391 Ga0157380_100713913 318
257 3300014968 Ga0157379_10050042 Ga0157379_100500423 318
258 3300017792 Ga0163161_10037878 Ga0163161_100378784 318
259 3300025893 Ga0207682_10010960 Ga0207682_100109602 318
260 3300025903 Ga0207680_10013062 Ga0207680_100130623 318
261 3300025905 Ga0207685_10029541 Ga0207685_100295411 318
262 3300025926 Ga0207659_10003908 Ga0207659_100039087 318
263 3300025931 Ga0207644_10009027 Ga0207644_100090273 318
264 3300025933 Ga0207706_10058823 Ga0207706_100588234 318
265 3300025934 Ga0207686_10047398 Ga0207686_100473983 318
266 3300025938 Ga0207704_10053082 Ga0207704_100530822 318
267 3300025941 Ga0207711_10029877 Ga0207711_100298774 318
268 3300025942 Ga0207689_10058161 Ga0207689_100581611 318
269 3300025960 Ga0207651_10001572 Ga0207651_100015724 318
270 3300025986 Ga0207658_10008700 Ga0207658_100087003 318
271 3300026023 Ga0207677_10001764 Ga0207677_100017648 318
272 3300026075 Ga0207708_10111402 Ga0207708_101114023 318
273 3300026088 Ga0207641_10034332 Ga0207641_100343324 318
274 3300026089 Ga0207648_10077095 Ga0207648_100770953 318
275 3300026095 Ga0207676_10000860 Ga0207676_1000086018 318
276 3300026118 Ga0207675_100168002 Ga0207675_1001680022 318
277 3300026121 Ga0207683_10002475 Ga0207683_1000247514 318
278 3300028379 Ga0268266_10139377 Ga0268266_101393771 318
279 3300028380 Ga0268265_10387699 Ga0268265_103876991 318
280 3300046518 Ga0495631_0013301 Ga0495631_0013301_1498_2601 318
281 3300046530 Ga0495654_0005426 Ga0495654_0005426_4885_5988 318
282 3300046616 Ga0495668_0059634 Ga0495668_0059634_887_1990 318
283 3300046674 Ga0495588_0037453 Ga0495588_0037453_858_1961 318
284 3300047673 Ga0495593_0008983 Ga0495593_0008983_3139_4242 318
285 3300048907 Ga0496104_0027579 Ga0496104_0027579_909_1928 318
286 3300048911 Ga0496108_0015466 Ga0496108_0015466_4181_5305 318
287 3300048922 Ga0496119_0036909 Ga0496119_0036909_505_1608 318
288 3300048925 Ga0496122_0023376 Ga0496122_0023376_1155_2258 318
289 3300050507 nmdc:mga05p37_105529_c1 nmdc:mga05p37_105529_c1_1896_2861 318
290 3300050507 nmdc:mga05p37_64231_c1 nmdc:mga05p37_64231_c1_720_1679 318
291 3300050510 nmdc:mga06r32_404229_c1 nmdc:mga06r32_404229_c1_329_1291 318
292 3300050512 nmdc:mga0n895_90174_c1 nmdc:mga0n895_90174_c1_137_1096 318
293 3300050515 nmdc:mga0a205_7857_c1 nmdc:mga0a205_7857_c1_313_1272 318
294 3300053110 Ga0500571_000152 Ga0500571_000152_21345_22448 318
295 3300053118 Ga0500594_0002211 Ga0500594_0002211_1750_2853 318
296 3300053133 Ga0500655_000842 Ga0500655_000842_4190_5293 318
297 3300053134 Ga0500658_0000038 Ga0500658_0000038_79851_80954 318
298 3300053138 Ga0500564_004157 Ga0500564_004157_4420_5523 318
299 3300053139 Ga0500568_0000338 Ga0500568_0000338_35147_36250 318
300 3300053141 Ga0500574_000501 Ga0500574_000501_3130_4233 318
301 3300053162 Ga0500638_005113 Ga0500638_005113_948_2051 318
302 3300053177 Ga0500636_0060514 Ga0500636_0060514_833_1936 318
303 3300061734 Ga0530510_0002079 Ga0530510_0002079_5120_6100 318
304 iso_pu_bacteria 2513020051 2513228096 318
305 iso_pu_bacteria 2643221672 2644399861 318
306 iso_pu_bacteria 2928084124 2928088400 318
307 3300005441 Ga0070700_100093999 Ga0070700_1000939992 319
308 3300006178 Ga0075367_10020965 Ga0075367_100209652 319
309 3300006195 Ga0075366_10009924 Ga0075366_100099244 319
310 3300009147 Ga0114129_10015808 Ga0114129_100158083 319
311 3300028794 Ga0307515_10000179 Ga0307515_1000017926 319
312 3300028794 Ga0307515_10000586 Ga0307515_1000058622 319
313 3300028794 Ga0307515_10069999 Ga0307515_100699994 319
314 3300030522 Ga0307512_10142109 Ga0307512_101421091 319
315 3300031456 Ga0307513_10047767 Ga0307513_100477672 319
316 3300031507 Ga0307509_10128577 Ga0307509_101285773 319
317 3300031548 Ga0307408_100148525 Ga0307408_1001485252 319
318 3300031616 Ga0307508_10000649 Ga0307508_1000064927 319
319 3300031730 Ga0307516_10166651 Ga0307516_101666512 319
320 3300031731 Ga0307405_10013638 Ga0307405_100136383 319
321 3300031852 Ga0307410_10373502 Ga0307410_103735021 319
322 3300031911 Ga0307412_10012351 Ga0307412_100123514 319
323 3300037471 Ga0395905_0093729 Ga0395905_0093729_1247_2254 319
324 3300041406 Ga0439439_0002176 Ga0439439_0002176_1578_2606 319
325 3300041507 Ga0451851_1247133 Ga0451851_1247133_192_1214 319
326 3300041511 Ga0451855_1812600 Ga0451855_1812600_267_1289 319
327 3300042006 Ga0439432_005283 Ga0439432_005283_1727_2755 319
328 3300042007 Ga0439449_0001123 Ga0439449_0001123_6681_7709 319
329 3300042010 Ga0439452_001727 Ga0439452_001727_1229_2356 319
330 3300042015 Ga0439462_0006129 Ga0439462_0006129_410_1438 319
331 3300042128 Ga0450897_000666 Ga0450897_000666_123_1151 319
332 3300042134 Ga0450898_000063 Ga0450898_000063_5611_6639 319
333 3300042145 Ga0450906_002684 Ga0450906_002684_1546_2574 319
334 3300042156 Ga0439446_0011515 Ga0439446_0011515_1186_2214 319
335 3300042435 Ga0439434_0003855 Ga0439434_0003855_1604_2632 319
336 3300046519 Ga0495632_0096931 Ga0495632_0096931_346_1368 319
337 3300046522 Ga0495643_0058599 Ga0495643_0058599_988_2010 319
338 3300046660 Ga0495625_0001836 Ga0495625_0001836_11431_12453 319
339 3300049576 Ga0501040_0208558 Ga0501040_0208558_201_1181 319
340 3300049576 Ga0501040_0267172 Ga0501040_0267172_96_1076 319
341 3300049577 Ga0501041_0009461 Ga0501041_0009461_396_1376 319
342 3300049588 Ga0501072_0040001 Ga0501072_0040001_1644_2642 319
343 3300049590 Ga0501074_0116830 Ga0501074_0116830_221_1219 319
344 3300049592 Ga0501076_0017060 Ga0501076_0017060_800_1798 319
345 3300049593 Ga0501077_0051774 Ga0501077_0051774_641_1639 319
346 3300049741 Ga0501079_0027802 Ga0501079_0027802_2872_3870 319
347 3300049741 Ga0501079_0038707 Ga0501079_0038707_1585_2565 319
348 3300049742 Ga0501080_0349187 Ga0501080_0349187_202_1200 319
349 3300049743 Ga0501081_0016576 Ga0501081_0016576_2265_3263 319
350 3300049743 Ga0501081_0129624 Ga0501081_0129624_160_1140 319
351 3300050489 nmdc:mga03683_8366_c1 nmdc:mga03683_8366_c1_1527_2651 319
352 3300050493 nmdc:mga0k408_11190_c2 nmdc:mga0k408_11190_c2_1592_2716 319
353 3300050493 nmdc:mga0k408_96360_c1 nmdc:mga0k408_96360_c1_199_1221 319
354 3300050507 nmdc:mga05p37_241691_c1 nmdc:mga05p37_241691_c1_24_983 319
355 3300050507 nmdc:mga05p37_733_c1 nmdc:mga05p37_733_c1_2837_3805 319
356 3300050507 nmdc:mga05p37_787268_c1 nmdc:mga05p37_787268_c1_24_983 319
357 3300050508 nmdc:mga09592_22786_c2 nmdc:mga09592_22786_c2_1260_2228 319
358 3300050510 nmdc:mga06r32_301016_c1 nmdc:mga06r32_301016_c1_17_976 319
359 3300050512 nmdc:mga0n895_22204_c1 nmdc:mga0n895_22204_c1_1190_2149 319
360 3300050512 nmdc:mga0n895_776_c1 nmdc:mga0n895_776_c1_6260_7219 319
361 3300050513 nmdc:mga0rr50_143674_c1 nmdc:mga0rr50_143674_c1_454_1413 319
362 3300050514 nmdc:mga08x19_17815_c1 nmdc:mga08x19_17815_c1_2692_3651 319
363 3300050515 nmdc:mga0a205_881_c1 nmdc:mga0a205_881_c1_4577_5536 319
364 3300054114 Ga0501084_0003441 Ga0501084_0003441_121_1101 319
365 3300054114 Ga0501084_0005902 Ga0501084_0005902_1060_2058 319
366 iso_pu_bacteria 2585428062 2587757740 319
367 3300005327 Ga0070658_10100259 Ga0070658_101002594 320
368 3300006844 Ga0075428_100013199 Ga0075428_1000131997 320
369 3300006844 Ga0075428_100234543 Ga0075428_1002345432 320
370 3300006847 Ga0075431_100006738 Ga0075431_1000067387 320
371 3300006847 Ga0075431_100108770 Ga0075431_1001087702 320
372 3300006871 Ga0075434_100009161 Ga0075434_1000091619 320
373 3300006880 Ga0075429_100270905 Ga0075429_1002709052 320
374 3300009147 Ga0114129_10149663 Ga0114129_101496632 320
375 3300017792 Ga0163161_10000201 Ga0163161_100002016 320
376 3300031649 Ga0307514_10031436 Ga0307514_100314361 320
377 3300049581 Ga0501047_0037341 Ga0501047_0037341_1447_2454 320
378 3300049823 Ga0501044_0087640 Ga0501044_0087640_986_1993 320
379 3300050507 nmdc:mga05p37_87726_c1 nmdc:mga05p37_87726_c1_1721_2719 320
380 3300050508 nmdc:mga09592_22145_c1 nmdc:mga09592_22145_c1_131_1129 320
381 3300050510 nmdc:mga06r32_133201_c1 nmdc:mga06r32_133201_c1_851_1849 320
382 3300050513 nmdc:mga0rr50_85562_c1 nmdc:mga0rr50_85562_c1_1347_2321 320
383 3300005333 Ga0070677_10011261 Ga0070677_100112613 321
384 3300005338 Ga0068868_100202895 Ga0068868_1002028952 321
385 3300005347 Ga0070668_100029091 Ga0070668_1000290912 321
386 3300005354 Ga0070675_100143812 Ga0070675_1001438123 321
387 3300005354 Ga0070675_100431519 Ga0070675_1004315191 321
388 3300005355 Ga0070671_100178458 Ga0070671_1001784581 321
389 3300005355 Ga0070671_100222130 Ga0070671_1002221302 321
390 3300005364 Ga0070673_100029379 Ga0070673_1000293794 321
391 3300005367 Ga0070667_100088213 Ga0070667_1000882132 321
392 3300005441 Ga0070700_100030979 Ga0070700_1000309793 321
393 3300005456 Ga0070678_100040192 Ga0070678_1000401923 321
394 3300005456 Ga0070678_100155199 Ga0070678_1001551991 321
395 3300005457 Ga0070662_100026417 Ga0070662_1000264173 321
396 3300005458 Ga0070681_10060167 Ga0070681_100601673 321
397 3300005467 Ga0070706_100070565 Ga0070706_1000705653 321
398 3300005530 Ga0070679_100067827 Ga0070679_1000678271 321
399 3300005543 Ga0070672_100029468 Ga0070672_1000294683 321
400 3300005543 Ga0070672_100073109 Ga0070672_1000731092 321
401 3300005544 Ga0070686_100168705 Ga0070686_1001687051 321
402 3300005578 Ga0068854_100316254 Ga0068854_1003162542 321
403 3300005617 Ga0068859_100102845 Ga0068859_1001028453 321
404 3300005618 Ga0068864_100053353 Ga0068864_1000533533 321
405 3300005841 Ga0068863_100109776 Ga0068863_1001097763 321
406 3300006237 Ga0097621_100034948 Ga0097621_1000349481 321
407 3300006358 Ga0068871_100017804 Ga0068871_1000178044 321
408 3300006358 Ga0068871_100150122 Ga0068871_1001501221 321
409 3300006844 Ga0075428_100000436 Ga0075428_1000004369 321
410 3300006844 Ga0075428_100034150 Ga0075428_1000341502 321
411 3300006846 Ga0075430_100000002 Ga0075430_100000002150 321
412 3300006846 Ga0075430_100004567 Ga0075430_1000045674 321
413 3300006846 Ga0075430_100064840 Ga0075430_1000648402 321
414 3300006847 Ga0075431_100001143 Ga0075431_1000011436 321
415 3300006847 Ga0075431_100006431 Ga0075431_1000064319 321
416 3300006847 Ga0075431_100127404 Ga0075431_1001274041 321
417 3300006880 Ga0075429_100000460 Ga0075429_10000046028 321
418 3300006880 Ga0075429_100046370 Ga0075429_1000463702 321
419 3300006931 Ga0097620_100102842 Ga0097620_1001028423 321
420 3300009147 Ga0114129_10013913 Ga0114129_100139139 321
421 3300009147 Ga0114129_10027955 Ga0114129_100279554 321
422 3300009147 Ga0114129_10215283 Ga0114129_102152832 321
423 3300009553 Ga0105249_10004175 Ga0105249_100041757 321
424 3300012485 Ga0157325_1001329 Ga0157325_10013291 321
425 3300014969 Ga0157376_10004443 Ga0157376_100044433 321
426 3300014969 Ga0157376_10062886 Ga0157376_100628863 321
427 3300025271 Ga0207666_1002179 Ga0207666_10021792 321
428 3300025893 Ga0207682_10010199 Ga0207682_100101993 321
429 3300025908 Ga0207643_10104622 Ga0207643_101046222 321
430 3300025912 Ga0207707_10014037 Ga0207707_100140373 321
431 3300025926 Ga0207659_10126306 Ga0207659_101263062 321
432 3300025931 Ga0207644_10062435 Ga0207644_100624353 321
433 3300025931 Ga0207644_10180387 Ga0207644_101803872 321
434 3300025931 Ga0207644_10210719 Ga0207644_102107192 321
435 3300025935 Ga0207709_10118291 Ga0207709_101182912 321
436 3300025940 Ga0207691_10029124 Ga0207691_100291243 321
437 3300025942 Ga0207689_10008649 Ga0207689_100086497 321
438 3300025960 Ga0207651_10093360 Ga0207651_100933603 321
439 3300025961 Ga0207712_10008657 Ga0207712_100086575 321
440 3300025972 Ga0207668_10140461 Ga0207668_101404612 321
441 3300025986 Ga0207658_10002890 Ga0207658_1000289011 321
442 3300025986 Ga0207658_10105321 Ga0207658_101053211 321
443 3300026067 Ga0207678_10064226 Ga0207678_100642262 321
444 3300026075 Ga0207708_10078665 Ga0207708_100786652 321
445 3300026088 Ga0207641_10000594 Ga0207641_1000059433 321
446 3300026088 Ga0207641_10098334 Ga0207641_100983342 321
447 3300026088 Ga0207641_10272256 Ga0207641_102722562 321
448 3300026118 Ga0207675_100027354 Ga0207675_1000273545 321
449 3300026142 Ga0207698_10178288 Ga0207698_101782882 321
450 3300028381 Ga0268264_10003635 Ga0268264_1000363512 321
451 3300037312 Ga0395899_0011209 Ga0395899_0011209_2344_3345 321
452 3300037418 Ga0395900_0001747 Ga0395900_0001747_15588_16589 321
453 3300037466 Ga0395898_0003002 Ga0395898_0003002_13671_14672 321
454 3300037471 Ga0395905_0254105 Ga0395905_0254105_628_1629 321
455 3300038443 Ga0395901_0001149 Ga0395901_0001149_23921_24922 321
456 3300038443 Ga0395901_0014577 Ga0395901_0014577_2725_3816 321
457 3300046537 Ga0495598_0035848 Ga0495598_0035848_223_1251 321
458 3300048910 Ga0496107_0120010 Ga0496107_0120010_500_1528 321
459 3300048911 Ga0496108_0054499 Ga0496108_0054499_2165_3193 321
460 3300049574 Ga0501038_0255124 Ga0501038_0255124_124_1116 321
461 3300049576 Ga0501040_0092053 Ga0501040_0092053_1072_2064 321
462 3300049577 Ga0501041_0123727 Ga0501041_0123727_197_1189 321
463 3300049590 Ga0501074_0155644 Ga0501074_0155644_238_1230 321
464 3300049743 Ga0501081_0015410 Ga0501081_0015410_1314_2306 321
465 3300050507 nmdc:mga05p37_17921_c1 nmdc:mga05p37_17921_c1_1488_2489 321
466 3300050508 nmdc:mga09592_56_c1 nmdc:mga09592_56_c1_24540_25541 321
467 3300050509 nmdc:mga0qj67_6405_c1 nmdc:mga0qj67_6405_c1_5224_6225 321
468 3300050510 nmdc:mga06r32_5613_c1 nmdc:mga06r32_5613_c1_8807_9808 321
469 3300054114 Ga0501084_0016610 Ga0501084_0016610_2551_3543 321
470 3300005328 Ga0070676_10062625 Ga0070676_100626251 322
471 3300005336 Ga0070680_100017652 Ga0070680_1000176525 322
472 3300005458 Ga0070681_10324921 Ga0070681_103249212 322
473 3300005459 Ga0068867_100088054 Ga0068867_1000880541 322
474 3300005467 Ga0070706_100005491 Ga0070706_1000054919 322
475 3300005468 Ga0070707_100001162 Ga0070707_10000116218 322
476 3300005518 Ga0070699_100280401 Ga0070699_1002804012 322
477 3300005840 Ga0068870_10005096 Ga0068870_100050963 322
478 3300005843 Ga0068860_100030814 Ga0068860_1000308145 322
479 3300006195 Ga0075366_10113838 Ga0075366_101138381 322
480 3300006846 Ga0075430_100052664 Ga0075430_1000526643 322
481 3300025908 Ga0207643_10011086 Ga0207643_100110863 322
482 3300025910 Ga0207684_10002560 Ga0207684_100025609 322
483 3300025922 Ga0207646_10001059 Ga0207646_100010594 322
484 3300025972 Ga0207668_10383227 Ga0207668_103832271 322
485 3300026089 Ga0207648_10041353 Ga0207648_100413532 322
486 3300028381 Ga0268264_10047987 Ga0268264_100479873 322
487 3300042015 Ga0439462_0038644 Ga0439462_0038644_52_1032 322
488 3300046681 Ga0495647_0065083 Ga0495647_0065083_36_1055 322
489 3300049572 Ga0501036_0216976 Ga0501036_0216976_94_1074 322
490 3300049577 Ga0501041_0258169 Ga0501041_0258169_61_1041 322
491 3300049592 Ga0501076_0151372 Ga0501076_0151372_677_1657 322
492 3300049742 Ga0501080_0191030 Ga0501080_0191030_536_1516 322
493 3300049824 Ga0501045_0153852 Ga0501045_0153852_71_1051 322
494 3300050493 nmdc:mga0k408_25209_c1 nmdc:mga0k408_25209_c1_1948_2970 322
495 3300005334 Ga0068869_100032393 Ga0068869_1000323933 323
496 3300005336 Ga0070680_100312692 Ga0070680_1003126921 323
497 3300005341 Ga0070691_10011961 Ga0070691_100119611 323
498 3300005345 Ga0070692_10113560 Ga0070692_101135601 323
499 3300005353 Ga0070669_100111225 Ga0070669_1001112251 323
500 3300005444 Ga0070694_100087502 Ga0070694_1000875022 323
501 3300005445 Ga0070708_100357543 Ga0070708_1003575431 323
502 3300005459 Ga0068867_100236285 Ga0068867_1002362851 323
503 3300005471 Ga0070698_100039844 Ga0070698_1000398442 323
504 3300005471 Ga0070698_100344923 Ga0070698_1003449232 323
505 3300005577 Ga0068857_100033034 Ga0068857_1000330343 323
506 3300005615 Ga0070702_100030150 Ga0070702_1000301503 323
507 3300005840 Ga0068870_10016783 Ga0068870_100167833 323
508 3300005843 Ga0068860_100117085 Ga0068860_1001170853 323
509 3300005844 Ga0068862_100197452 Ga0068862_1001974523 323
510 3300005983 Ga0081540_1081992 Ga0081540_10819921 323
511 3300006844 Ga0075428_100012245 Ga0075428_1000122452 323
512 3300006844 Ga0075428_100091471 Ga0075428_1000914712 323
513 3300006852 Ga0075433_10006010 Ga0075433_100060107 323
514 3300006852 Ga0075433_10049089 Ga0075433_100490892 323
515 3300006852 Ga0075433_10110084 Ga0075433_101100843 323
516 3300006852 Ga0075433_10123164 Ga0075433_101231642 323
517 3300006852 Ga0075433_10141093 Ga0075433_101410933 323
518 3300006871 Ga0075434_100026125 Ga0075434_1000261252 323
519 3300006871 Ga0075434_100032201 Ga0075434_1000322015 323
520 3300006871 Ga0075434_100069050 Ga0075434_1000690503 323
521 3300006871 Ga0075434_100124067 Ga0075434_1001240672 323
522 3300006880 Ga0075429_100001854 Ga0075429_1000018541 323
523 3300007076 Ga0075435_100003478 Ga0075435_1000034786 323
524 3300007076 Ga0075435_100055170 Ga0075435_1000551702 323
525 3300007076 Ga0075435_100095060 Ga0075435_1000950603 323
526 3300007076 Ga0075435_100128226 Ga0075435_1001282263 323
527 3300007265 Ga0099794_10012766 Ga0099794_100127662 323
528 3300009094 Ga0111539_10007349 Ga0111539_1000734912 323
529 3300009094 Ga0111539_10407084 Ga0111539_104070841 323
530 3300009147 Ga0114129_10023727 Ga0114129_100237277 323
531 3300009147 Ga0114129_10031378 Ga0114129_100313784 323
532 3300009147 Ga0114129_10099597 Ga0114129_100995972 323
533 3300009147 Ga0114129_10272460 Ga0114129_102724602 323
534 3300009147 Ga0114129_10457427 Ga0114129_104574272 323
535 3300009147 Ga0114129_10461567 Ga0114129_104615672 323
536 3300009176 Ga0105242_10066025 Ga0105242_100660254 323
537 3300025908 Ga0207643_10011571 Ga0207643_100115713 323
538 3300025910 Ga0207684_10017290 Ga0207684_100172902 323
539 3300025922 Ga0207646_10019416 Ga0207646_100194164 323
540 3300025935 Ga0207709_10009580 Ga0207709_100095802 323
541 3300025942 Ga0207689_10037686 Ga0207689_100376863 323
542 3300025961 Ga0207712_10085590 Ga0207712_100855903 323
543 3300026088 Ga0207641_10344860 Ga0207641_103448601 323
544 3300026089 Ga0207648_10170905 Ga0207648_101709052 323
545 3300026116 Ga0207674_10027649 Ga0207674_100276493 323
546 3300027671 Ga0209588_1035179 Ga0209588_10351792 323
547 3300027907 Ga0207428_10000033 Ga0207428_1000003356 323
548 3300035088 Ga0373940_0031254 Ga0373940_0031254_42_1034 323
549 3300035114 Ga0373939_0022487 Ga0373939_0022487_139_1122 323
550 3300035691 Ga0373931_0012731 Ga0373931_0012731_1368_2360 323
551 3300035691 Ga0373931_0013727 Ga0373931_0013727_1010_1993 323
552 3300044712 Ga0453684_0174662 Ga0453684_0174662_231_1229 323
553 3300045051 Ga0451576_0082742 Ga0451576_0082742_432_1415 323
554 3300046472 Ga0495580_0001185 Ga0495580_0001185_13021_14004 323
555 3300046664 Ga0495659_0051169 Ga0495659_0051169_361_1353 323
556 3300047318 Ga0495636_0040401 Ga0495636_0040401_817_1800 323
557 3300050507 nmdc:mga05p37_120390_c1 nmdc:mga05p37_120390_c1_1333_2328 323
558 3300050507 nmdc:mga05p37_200155_c1 nmdc:mga05p37_200155_c1_690_1682 323
559 3300050507 nmdc:mga05p37_34529_c1 nmdc:mga05p37_34529_c1_427_1410 323
560 3300050507 nmdc:mga05p37_41200_c1 nmdc:mga05p37_41200_c1_4450_5433 323
561 3300050507 nmdc:mga05p37_74584_c1 nmdc:mga05p37_74584_c1_2531_3523 323
562 3300050508 nmdc:mga09592_1059_c1 nmdc:mga09592_1059_c1_19957_20949 323
563 3300050508 nmdc:mga09592_141560_c1 nmdc:mga09592_141560_c1_139_1131 323
564 3300050508 nmdc:mga09592_1584_c1 nmdc:mga09592_1584_c1_43_1026 323
565 3300050509 nmdc:mga0qj67_13933_c1 nmdc:mga0qj67_13933_c1_4927_5919 323
566 3300050510 nmdc:mga06r32_16486_c1 nmdc:mga06r32_16486_c1_754_1746 323
567 3300050510 nmdc:mga06r32_253514_c1 nmdc:mga06r32_253514_c1_534_1517 323
568 3300050511 nmdc:mga08y16_29845_c1 nmdc:mga08y16_29845_c1_1206_2189 323
569 3300050511 nmdc:mga08y16_800_c1 nmdc:mga08y16_800_c1_17950_18933 323
570 3300050512 nmdc:mga0n895_147472_c1 nmdc:mga0n895_147472_c1_1217_2200 323
571 3300050512 nmdc:mga0n895_36264_c1 nmdc:mga0n895_36264_c1_1573_2565 323
572 3300050512 nmdc:mga0n895_41376_c1 nmdc:mga0n895_41376_c1_913_1905 323
573 3300050512 nmdc:mga0n895_63207_c1 nmdc:mga0n895_63207_c1_892_1887 323
574 3300050513 nmdc:mga0rr50_108642_c1 nmdc:mga0rr50_108642_c1_797_1789 323
575 3300050513 nmdc:mga0rr50_112804_c1 nmdc:mga0rr50_112804_c1_486_1469 323
576 3300050513 nmdc:mga0rr50_19697_c1 nmdc:mga0rr50_19697_c1_361_1344 323
577 3300050513 nmdc:mga0rr50_81363_c1 nmdc:mga0rr50_81363_c1_796_1788 323
578 3300050514 nmdc:mga08x19_288166_c1 nmdc:mga08x19_288166_c1_63_1046 323
579 3300050515 nmdc:mga0a205_111152_c1 nmdc:mga0a205_111152_c1_1013_2008 323
580 3300050515 nmdc:mga0a205_134313_c1 nmdc:mga0a205_134313_c1_446_1429 323
581 3300050515 nmdc:mga0a205_177404_c1 nmdc:mga0a205_177404_c1_686_1669 323
582 3300050515 nmdc:mga0a205_236862_c1 nmdc:mga0a205_236862_c1_378_1370 323
583 3300050515 nmdc:mga0a205_55298_c1 nmdc:mga0a205_55298_c1_867_1850 323
584 3300050515 nmdc:mga0a205_69619_c1 nmdc:mga0a205_69619_c1_903_1886 323
585 3300050515 nmdc:mga0a205_9861_c1 nmdc:mga0a205_9861_c1_818_1810 323
586 3300005445 Ga0070708_100007577 Ga0070708_1000075773 324
587 3300005467 Ga0070706_100010557 Ga0070706_1000105572 324
588 3300005468 Ga0070707_100100816 Ga0070707_1001008163 324
589 3300005468 Ga0070707_100332738 Ga0070707_1003327382 324
590 3300006038 Ga0075365_10040606 Ga0075365_100406063 324
591 3300006177 Ga0075362_10010992 Ga0075362_100109923 324
592 3300006195 Ga0075366_10013053 Ga0075366_100130531 324
593 3300006871 Ga0075434_100177262 Ga0075434_1001772622 324
594 3300007076 Ga0075435_100203807 Ga0075435_1002038072 324
595 3300025922 Ga0207646_10032739 Ga0207646_100327394 324
596 3300027866 Ga0209813_10033417 Ga0209813_100334171 324
597 3300041451 Ga0451791_1836557 Ga0451791_1836557_27_1049 324
598 3300049570 Ga0501033_0109243 Ga0501033_0109243_1010_1996 324
599 3300049572 Ga0501036_0003619 Ga0501036_0003619_3422_4408 324
600 3300049574 Ga0501038_0137443 Ga0501038_0137443_557_1543 324
601 3300049577 Ga0501041_0034253 Ga0501041_0034253_1278_2264 324
602 3300049578 Ga0501042_0081432 Ga0501042_0081432_608_1594 324
603 3300049580 Ga0501046_0301024 Ga0501046_0301024_119_1105 324
604 3300049582 Ga0501048_0038735 Ga0501048_0038735_1693_2679 324
605 3300049587 Ga0501071_0002922 Ga0501071_0002922_1429_2415 324
606 3300049588 Ga0501072_0001954 Ga0501072_0001954_913_1899 324
607 3300049590 Ga0501074_0053896 Ga0501074_0053896_1733_2719 324
608 3300049591 Ga0501075_0000177 Ga0501075_0000177_23043_24029 324
609 3300049592 Ga0501076_0000014 Ga0501076_0000014_79484_80470 324
610 3300049743 Ga0501081_0062219 Ga0501081_0062219_40_1026 324
611 3300049824 Ga0501045_0135468 Ga0501045_0135468_692_1678 324
612 3300050489 nmdc:mga03683_17897_c1 nmdc:mga03683_17897_c1_844_1869 324
613 3300050492 nmdc:mga0yw44_21348_c1 nmdc:mga0yw44_21348_c1_998_2023 324
614 3300050493 nmdc:mga0k408_78623_c1 nmdc:mga0k408_78623_c1_881_1906 324
615 3300050512 nmdc:mga0n895_86333_c1 nmdc:mga0n895_86333_c1_1771_2769 324
616 3300054114 Ga0501084_0015490 Ga0501084_0015490_202_1188 324
617 3300061734 Ga0530510_0000045 Ga0530510_0000045_9145_10131 324
618 3300005353 Ga0070669_100064942 Ga0070669_1000649422 325
619 3300005445 Ga0070708_100062810 Ga0070708_1000628103 325
620 3300005445 Ga0070708_100251746 Ga0070708_1002517462 325
621 3300005471 Ga0070698_100040892 Ga0070698_1000408924 325
622 3300005536 Ga0070697_100079233 Ga0070697_1000792332 325
623 3300006175 Ga0070712_100062413 Ga0070712_1000624133 325
624 3300006852 Ga0075433_10019115 Ga0075433_100191155 325
625 3300006871 Ga0075434_100002356 Ga0075434_10000235615 325
626 3300006871 Ga0075434_100078710 Ga0075434_1000787102 325
627 3300006880 Ga0075429_100093929 Ga0075429_1000939292 325
628 3300007076 Ga0075435_100016217 Ga0075435_1000162176 325
629 3300009094 Ga0111539_10000557 Ga0111539_1000055735 325
630 3300009094 Ga0111539_10248176 Ga0111539_102481762 325
631 3300009147 Ga0114129_10061558 Ga0114129_100615584 325
632 3300009147 Ga0114129_10379746 Ga0114129_103797462 325
633 3300009147 Ga0114129_10479024 Ga0114129_104790242 325
634 3300025910 Ga0207684_10096540 Ga0207684_100965403 325
635 3300025915 Ga0207693_10010103 Ga0207693_100101032 325
636 3300025922 Ga0207646_10014377 Ga0207646_100143777 325
637 3300025923 Ga0207681_10043058 Ga0207681_100430582 325
638 3300025941 Ga0207711_10054531 Ga0207711_100545312 325
639 3300026118 Ga0207675_100034386 Ga0207675_1000343864 325
640 3300027907 Ga0207428_10000054 Ga0207428_1000005489 325
641 3300027907 Ga0207428_10163063 Ga0207428_101630631 325
642 3300038996 Ga0242420_023207 Ga0242420_023207_66_1076 325
643 3300042876 Ga0451577_0130714 Ga0451577_0130714_57_1058 325
644 3300042876 Ga0451577_0211712 Ga0451577_0211712_223_1212 325
645 3300042876 Ga0451577_0405919 Ga0451577_0405919_73_1074 325
646 3300044673 Ga0453683_0030684 Ga0453683_0030684_2218_3228 325
647 3300044712 Ga0453684_0009330 Ga0453684_0009330_10524_11534 325
648 3300044712 Ga0453684_0092140 Ga0453684_0092140_65_1066 325
649 3300050507 nmdc:mga05p37_172699_c1 nmdc:mga05p37_172699_c1_597_1574 325
650 3300050508 nmdc:mga09592_56420_c1 nmdc:mga09592_56420_c1_1684_2682 325
651 3300050510 nmdc:mga06r32_11821_c1 nmdc:mga06r32_11821_c1_5273_6271 325
652 3300050511 nmdc:mga08y16_254649_c1 nmdc:mga08y16_254649_c1_623_1633 325
653 3300050511 nmdc:mga08y16_5274_c1 nmdc:mga08y16_5274_c1_2104_3114 325
654 3300050512 nmdc:mga0n895_146568_c1 nmdc:mga0n895_146568_c1_52_1041 325
655 3300050512 nmdc:mga0n895_57551_c1 nmdc:mga0n895_57551_c1_346_1332 325
656 3300050512 nmdc:mga0n895_64237_c1 nmdc:mga0n895_64237_c1_247_1257 325
657 3300050512 nmdc:mga0n895_65148_c1 nmdc:mga0n895_65148_c1_653_1663 325
658 3300050513 nmdc:mga0rr50_193788_c1 nmdc:mga0rr50_193788_c1_643_1629 325
659 3300050514 nmdc:mga08x19_35045_c1 nmdc:mga08x19_35045_c1_630_1616 325
660 3300050515 nmdc:mga0a205_322849_c1 nmdc:mga0a205_322849_c1_227_1240 325
661 3300005353 Ga0070669_100130053 Ga0070669_1001300532 326
662 3300005445 Ga0070708_100010509 Ga0070708_1000105094 326
663 3300005445 Ga0070708_100032557 Ga0070708_1000325573 326
664 3300005467 Ga0070706_100077488 Ga0070706_1000774882 326
665 3300005468 Ga0070707_100458707 Ga0070707_1004587072 326
666 3300005468 Ga0070707_100550856 Ga0070707_1005508561 326
667 3300006846 Ga0075430_100053397 Ga0075430_1000533971 326
668 3300006852 Ga0075433_10245953 Ga0075433_102459533 326
669 3300006871 Ga0075434_100549203 Ga0075434_1005492031 326
670 3300007076 Ga0075435_100040978 Ga0075435_1000409782 326
671 3300009147 Ga0114129_10462710 Ga0114129_104627102 326
672 3300009148 Ga0105243_10175226 Ga0105243_101752262 326
673 3300009174 Ga0105241_10040435 Ga0105241_100404352 326
674 3300009176 Ga0105242_10228060 Ga0105242_102280601 326
675 3300025911 Ga0207654_10100827 Ga0207654_101008272 326
676 3300025922 Ga0207646_10021809 Ga0207646_100218091 326
677 3300025923 Ga0207681_10186358 Ga0207681_101863581 326
678 3300025940 Ga0207691_10040836 Ga0207691_100408364 326
679 3300026089 Ga0207648_10223741 Ga0207648_102237412 326
680 3300044673 Ga0453683_0190318 Ga0453683_0190318_59_1051 326
681 3300046499 Ga0495594_0047026 Ga0495594_0047026_105_1097 326
682 3300048910 Ga0496107_0259972 Ga0496107_0259972_149_1141 326
683 3300050509 nmdc:mga0qj67_255374_c1 nmdc:mga0qj67_255374_c1_222_1205 326
684 3300050512 nmdc:mga0n895_508716_c1 nmdc:mga0n895_508716_c1_142_1140 326
685 3300050513 nmdc:mga0rr50_93483_c1 nmdc:mga0rr50_93483_c1_996_1994 326
686 3300050515 nmdc:mga0a205_270298_c1 nmdc:mga0a205_270298_c1_563_1561 326
687 3300005355 Ga0070671_100150517 Ga0070671_1001505173 327
688 3300005457 Ga0070662_100112798 Ga0070662_1001127982 327
689 3300005843 Ga0068860_100525064 Ga0068860_1005250642 327
690 3300006846 Ga0075430_100000678 Ga0075430_1000006782 327
691 3300006847 Ga0075431_100000452 Ga0075431_1000004522 327
692 3300006852 Ga0075433_10003800 Ga0075433_100038006 327
693 3300006852 Ga0075433_10397558 Ga0075433_103975581 327
694 3300006871 Ga0075434_100005140 Ga0075434_1000051402 327
695 3300006914 Ga0075436_100015795 Ga0075436_1000157955 327
696 3300007076 Ga0075435_100056645 Ga0075435_1000566453 327
697 3300025937 Ga0207669_10267070 Ga0207669_102670701 327
698 3300028381 Ga0268264_10557296 Ga0268264_105572962 327
699 3300031548 Ga0307408_100007871 Ga0307408_1000078718 327
700 3300031995 Ga0307409_100011542 Ga0307409_1000115424 327
701 3300037068 Ga0373925_0290837 Ga0373925_0290837_320_1303 327
702 3300046472 Ga0495580_0003832 Ga0495580_0003832_8583_9566 327
703 3300050509 nmdc:mga0qj67_16942_c1 nmdc:mga0qj67_16942_c1_2268_3263 327
704 3300050510 nmdc:mga06r32_8830_c2 nmdc:mga06r32_8830_c2_961_1956 327
705 3300006871 Ga0075434_100582910 Ga0075434_1005829101 328
706 3300007076 Ga0075435_100240129 Ga0075435_1002401292 328
707 3300009147 Ga0114129_10028080 Ga0114129_100280806 328
708 3300009147 Ga0114129_10342592 Ga0114129_103425922 328
709 3300025910 Ga0207684_10331392 Ga0207684_103313921 328
710 3300025922 Ga0207646_10162679 Ga0207646_101626793 328
711 3300035121 Ga0373960_0035600 Ga0373960_0035600_106_1092 328
712 3300049593 Ga0501077_0010205 Ga0501077_0010205_4000_4986 328
713 3300050507 nmdc:mga05p37_22024_c1 nmdc:mga05p37_22024_c1_5997_6983 328
714 3300050507 nmdc:mga05p37_323142_c1 nmdc:mga05p37_323142_c1_282_1268 328
715 3300050508 nmdc:mga09592_53547_c1 nmdc:mga09592_53547_c1_186_1172 328
716 3300050509 nmdc:mga0qj67_84501_c1 nmdc:mga0qj67_84501_c1_154_1140 328
717 3300050510 nmdc:mga06r32_229563_c1 nmdc:mga06r32_229563_c1_543_1529 328
718 3300050512 nmdc:mga0n895_180354_c1 nmdc:mga0n895_180354_c1_476_1462 328
719 3300050512 nmdc:mga0n895_34414_c1 nmdc:mga0n895_34414_c1_310_1296 328
720 3300050513 nmdc:mga0rr50_20128_c1 nmdc:mga0rr50_20128_c1_3443_4429 328
721 3300050513 nmdc:mga0rr50_232183_c1 nmdc:mga0rr50_232183_c1_229_1215 328
722 3300050515 nmdc:mga0a205_12048_c1 nmdc:mga0a205_12048_c1_1803_2789 328
723 3300050515 nmdc:mga0a205_28565_c1 nmdc:mga0a205_28565_c1_3777_4763 328
724 3300050515 nmdc:mga0a205_39073_c1 nmdc:mga0a205_39073_c1_3053_4039 328
725 3300061734 Ga0530510_0043525 Ga0530510_0043525_634_1620 328
726 3300005546 Ga0070696_100120426 Ga0070696_1001204262 330
727 3300005617 Ga0068859_100715878 Ga0068859_1007158781 330
728 3300006852 Ga0075433_10008009 Ga0075433_100080093 330
729 3300006871 Ga0075434_100029969 Ga0075434_1000299692 330
730 3300006871 Ga0075434_100113841 Ga0075434_1001138413 330
731 3300006871 Ga0075434_100523460 Ga0075434_1005234601 330
732 3300006931 Ga0097620_100715770 Ga0097620_1007157701 330
733 3300007076 Ga0075435_100040318 Ga0075435_1000403183 330
734 3300007076 Ga0075435_100212135 Ga0075435_1002121352 330
735 3300007076 Ga0075435_100284504 Ga0075435_1002845042 330
736 3300009094 Ga0111539_10163932 Ga0111539_101639323 330
737 3300027907 Ga0207428_10087894 Ga0207428_100878943 330
738 3300050511 nmdc:mga08y16_131896_c1 nmdc:mga08y16_131896_c1_993_1985 330
739 3300050512 nmdc:mga0n895_11851_c1 nmdc:mga0n895_11851_c1_3933_4925 330
740 3300050513 nmdc:mga0rr50_6589_c1 nmdc:mga0rr50_6589_c1_707_1699 330
741 3300050515 nmdc:mga0a205_6839_c1 nmdc:mga0a205_6839_c1_5182_6174 330
742 3300050515 nmdc:mga0a205_75990_c1 nmdc:mga0a205_75990_c1_381_1373 330
743 2209111006 2214922984 2213983589 331
744 3300005277 Ga0065716_1003999 Ga0065716_10039991 331
745 3300005290 Ga0065712_10067794 Ga0065712_1006779429 331
746 3300005290 Ga0065712_10073744 Ga0065712_100737444 331
747 3300005293 Ga0065715_10000302 Ga0065715_1000030223 331
748 3300005327 Ga0070658_10193013 Ga0070658_101930132 331
749 3300005328 Ga0070676_10004177 Ga0070676_100041771 331
750 3300005331 Ga0070670_100005591 Ga0070670_1000055918 331
751 3300005338 Ga0068868_100050777 Ga0068868_1000507773 331
752 3300005341 Ga0070691_10051994 Ga0070691_100519942 331
753 3300005347 Ga0070668_100022166 Ga0070668_1000221661 331
754 3300005355 Ga0070671_100011289 Ga0070671_1000112894 331
755 3300005364 Ga0070673_100009277 Ga0070673_1000092775 331
756 3300005366 Ga0070659_100173101 Ga0070659_1001731012 331
757 3300005439 Ga0070711_100044173 Ga0070711_1000441733 331
758 3300005445 Ga0070708_100009904 Ga0070708_1000099047 331
759 3300005455 Ga0070663_100227957 Ga0070663_1002279571 331
760 3300005457 Ga0070662_100019928 Ga0070662_1000199284 331
761 3300005457 Ga0070662_100021528 Ga0070662_1000215284 331
762 3300005458 Ga0070681_10002879 Ga0070681_100028798 331
763 3300005518 Ga0070699_100225138 Ga0070699_1002251382 331
764 3300005530 Ga0070679_100047324 Ga0070679_1000473245 331
765 3300005536 Ga0070697_100035132 Ga0070697_1000351323 331
766 3300005563 Ga0068855_100031423 Ga0068855_1000314236 331
767 3300005564 Ga0070664_100002604 Ga0070664_10000260412 331
768 3300005578 Ga0068854_100092671 Ga0068854_1000926713 331
769 3300006175 Ga0070712_100093727 Ga0070712_1000937273 331
770 3300006237 Ga0097621_100065873 Ga0097621_1000658731 331
771 3300006844 Ga0075428_100137898 Ga0075428_1001378982 331
772 3300006852 Ga0075433_10170332 Ga0075433_101703323 331
773 3300006871 Ga0075434_100049867 Ga0075434_1000498675 331
774 3300006881 Ga0068865_100026816 Ga0068865_1000268163 331
775 3300007076 Ga0075435_100013001 Ga0075435_1000130015 331
776 3300007265 Ga0099794_10049142 Ga0099794_100491423 331
777 3300009094 Ga0111539_10327515 Ga0111539_103275152 331
778 3300009094 Ga0111539_10367544 Ga0111539_103675441 331
779 3300009147 Ga0114129_10309773 Ga0114129_103097732 331
780 3300009147 Ga0114129_10411631 Ga0114129_104116312 331
781 3300009174 Ga0105241_10068787 Ga0105241_100687873 331
782 3300009176 Ga0105242_10198533 Ga0105242_101985331 331
783 3300009176 Ga0105242_10272672 Ga0105242_102726722 331
784 3300009553 Ga0105249_10239632 Ga0105249_102396322 331
785 3300010375 Ga0105239_10357149 Ga0105239_103571492 331
786 3300011119 Ga0105246_10054413 Ga0105246_100544133 331
787 3300013100 Ga0157373_10112894 Ga0157373_101128942 331
788 3300013296 Ga0157374_10069604 Ga0157374_100696043 331
789 3300013297 Ga0157378_10020644 Ga0157378_100206442 331
790 3300013306 Ga0163162_10056936 Ga0163162_100569361 331
791 3300013306 Ga0163162_10245008 Ga0163162_102450081 331
792 3300013307 Ga0157372_10334191 Ga0157372_103341912 331
793 3300014969 Ga0157376_10282256 Ga0157376_102822561 331
794 3300025315 Ga0207697_10013998 Ga0207697_100139983 331
795 3300025907 Ga0207645_10003317 Ga0207645_100033174 331
796 3300025909 Ga0207705_10170128 Ga0207705_101701281 331
797 3300025912 Ga0207707_10061944 Ga0207707_100619442 331
798 3300025915 Ga0207693_10126656 Ga0207693_101266561 331
799 3300025919 Ga0207657_10053475 Ga0207657_100534751 331
800 3300025920 Ga0207649_10021044 Ga0207649_100210441 331
801 3300025921 Ga0207652_10008998 Ga0207652_100089987 331
802 3300025923 Ga0207681_10061243 Ga0207681_100612433 331
803 3300025925 Ga0207650_10007400 Ga0207650_100074001 331
804 3300025925 Ga0207650_10056804 Ga0207650_100568042 331
805 3300025933 Ga0207706_10005505 Ga0207706_100055051 331
806 3300025933 Ga0207706_10010676 Ga0207706_100106766 331
807 3300025945 Ga0207679_10180775 Ga0207679_101807752 331
808 3300025960 Ga0207651_10225090 Ga0207651_102250902 331
809 3300025972 Ga0207668_10245038 Ga0207668_102450381 331
810 3300025981 Ga0207640_10038096 Ga0207640_100380962 331
811 3300025986 Ga0207658_10247393 Ga0207658_102473932 331
812 3300026067 Ga0207678_10124647 Ga0207678_101246472 331
813 3300026067 Ga0207678_10203816 Ga0207678_102038162 331
814 3300026075 Ga0207708_10038044 Ga0207708_100380441 331
815 3300026121 Ga0207683_10000890 Ga0207683_100008904 331
816 3300027671 Ga0209588_1010717 Ga0209588_10107173 331
817 3300027671 Ga0209588_1016016 Ga0209588_10160163 331
818 3300027907 Ga0207428_10030997 Ga0207428_100309973 331
819 3300035691 Ga0373931_0009693 Ga0373931_0009693_3272_4267 331
820 3300042876 Ga0451577_0145074 Ga0451577_0145074_277_1272 331
821 3300044712 Ga0453684_0141440 Ga0453684_0141440_237_1232 331
822 3300048913 Ga0496110_0182036 Ga0496110_0182036_638_1633 331
823 3300048915 Ga0496112_0005186 Ga0496112_0005186_2646_3641 331
824 3300048915 Ga0496112_0006117 Ga0496112_0006117_356_1351 331
825 3300050507 nmdc:mga05p37_106287_c1 nmdc:mga05p37_106287_c1_2230_3225 331
826 3300050511 nmdc:mga08y16_113813_c1 nmdc:mga08y16_113813_c1_545_1540 331
827 3300050512 nmdc:mga0n895_34169_c1 nmdc:mga0n895_34169_c1_96_1091 331
828 3300050513 nmdc:mga0rr50_1138_c1 nmdc:mga0rr50_1138_c1_5248_6243 331
829 3300050513 nmdc:mga0rr50_183295_c1 nmdc:mga0rr50_183295_c1_476_1486 331
830 3300050515 nmdc:mga0a205_44053_c1 nmdc:mga0a205_44053_c1_1406_2401 331

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03401

TctC

Tripartite tricarboxylate transporter family receptor

89

365

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
5oku-assembly1.cif.gz_A r. palustris rpa4515 with adipate 0.9012 31 331
8hkb-assembly1.cif.gz_A tpa bound-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis mutant k184d 0.8964 34 331
5oku-assembly1.cif.gz_A r. palustris rpa4515 with adipate 0.8927 31 331
2dvz-assembly1.cif.gz_A structure of a periplasmic transporter 0.8897 31 329
2qpq-assembly2.cif.gz_B structure of bug27 from bordetella pertussis 0.8832 31 331
ID Description Score Start End Superfamily
4x9tA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9522 129 256 3.40.190.10
4x9tA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.937 129 256 3.40.190.10
2qpqC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8839 129 256 3.40.190.10
2dvzA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8764 129 253 3.40.190.10
2qpqC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8709 129 256 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A536ZIM3-F1-model_v4 2Fe-2S iron-sulfur cluster binding domain-containing protein 0.9432 67 328 GO:0051537
AF-A0A258K2P3-F1-model_v4 Tricarboxylate transporter 0.9423 23 286
AF-A0A2S5P4Q9-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9347 23 331
AF-A0A519I8E8-F1-model_v4 deleted 0.9344 118 327
AF-A0A4P5U297-F1-model_v4 Tricarboxylate transporter 0.9319 20 331

Feature Viewer

pLDDT pTM Quality
91.91 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map