F482648
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 830 | 307 | 826 | 333 |
Family's Representative Sequence
| Representative Sequence | 3300009176|Ga0105242_10066025|Ga0105242_100660254 |
| Length | 368 |
| Sequence | MARNSFRLDSRLRTKIHPATQAIALTGRMSTLETSMIDAVVSRSRPHMARACLAAILALTGATPVLAWEPTKPVEFVVPAGTGGGADQMARLIQGIIVKHKLMKESMIVSNKSGGAGAEGFLDVKSKKGEAHTIVITLSNLFTTPLHTGIPFSWRDLTPVARLALDEFILWVNADTSYKTAKEYLAAVKEQTGKPGQMKMGGTGSAQEDQILTIQLEQAMPGTKFTYVPFKGGGEVCVNLVGKHVDSTVNNPIECVSHWKAARVRPLAVFDTARISVGEWKDIPTIKEALGVDVSYLMLRGMPGAPKEAVDWYVAFFKKVTETPEWKKYMEDGALKPAFASGPEYVKWVEENEQLHRELMTKGGLLKK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 2 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 3 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 4 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 5 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 6 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 7 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 8 | 3300005277 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 10 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 17 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 39 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 51 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 53 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 54 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 55 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 57 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 58 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 59 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 60 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 61 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 62 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 63 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 64 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 65 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 66 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 67 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 68 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 69 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 71 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 72 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 73 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 75 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 76 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 77 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 78 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 79 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 80 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 81 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 82 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 83 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 84 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 86 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 87 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300012485 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 | Metagenome | Rhizosphere |
| 102 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 115 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 178 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 179 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 183 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 184 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 185 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 186 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 187 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 188 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 189 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 190 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 191 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 192 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 193 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 194 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 195 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 196 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 197 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 198 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 199 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 200 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 201 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 202 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 203 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 204 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 205 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 206 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 207 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 208 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 209 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 210 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 211 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 212 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 213 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 214 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 215 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 216 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 217 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 218 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 219 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 220 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 221 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 222 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 223 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 224 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 225 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 226 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 243 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 244 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 245 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 246 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 247 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 248 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 249 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 250 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 251 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 252 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 253 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 254 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 255 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 256 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 257 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 258 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 261 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 263 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 266 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 272 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 283 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 284 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 285 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 286 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 287 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 288 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 289 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 290 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 291 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 292 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 293 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 294 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 295 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 296 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 297 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 298 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 299 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 300 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 301 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 302 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 303 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 304 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 305 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 306 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.52 |
| Metatranscriptomes | 0 |
| Isolates | 0.48 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.34 |
| Nodule | 0 |
| Rhizoplane | 2.53 |
| Rhizosphere | 90.72 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.41 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | 2214922984 | 2209111006 | Bacteria | 1359 |
| 2 | Ga0055536_1001542 | 3300003781 | Bacteria | 13829 |
| 3 | Ga0055531_10001303 | 3300003794 | Bacteria | 18799 |
| 4 | Ga0065716_1003999 | 3300005277 | Bacteria | 1086 |
| 5 | Ga0065712_10067794 | 3300005290 | Bacteria | 34092 |
| 6 | Ga0065712_10073744 | 3300005290 | Bacteria | 4287 |
| 7 | Ga0065715_10000302 | 3300005293 | Bacteria | 23656 |
| 8 | Ga0065715_10282678 | 3300005293 | Bacteria | 1082 |
| 9 | Ga0070658_10022218 | 3300005327 | Bacteria | 5090 |
| 10 | Ga0070658_10100259 | 3300005327 | Bacteria | 2394 |
| 11 | Ga0070658_10193013 | 3300005327 | Bacteria | 1717 |
| 12 | Ga0070676_10004177 | 3300005328 | Bacteria | 7579 |
| 13 | Ga0070676_10062625 | 3300005328 | Bacteria | 2214 |
| 14 | Ga0070690_100005700 | 3300005330 | Bacteria | 7015 |
| 15 | Ga0070670_100005591 | 3300005331 | Bacteria | 10604 |
| 16 | Ga0070677_10011261 | 3300005333 | Bacteria | 3080 |
| 17 | Ga0070677_10030192 | 3300005333 | Bacteria | 2062 |
| 18 | Ga0068869_100000966 | 3300005334 | Bacteria | 16712 |
| 19 | Ga0068869_100032393 | 3300005334 | Bacteria | 3683 |
| 20 | Ga0068869_100049933 | 3300005334 | Bacteria | 3031 |
| 21 | Ga0070666_10010460 | 3300005335 | Bacteria | 5806 |
| 22 | Ga0070680_100011700 | 3300005336 | Bacteria | 6799 |
| 23 | Ga0070680_100017652 | 3300005336 | Bacteria | 5629 |
| 24 | Ga0070680_100312692 | 3300005336 | Bacteria | 1333 |
| 25 | Ga0068868_100022037 | 3300005338 | Bacteria | 4803 |
| 26 | Ga0068868_100050777 | 3300005338 | Bacteria | 3259 |
| 27 | Ga0068868_100202895 | 3300005338 | Bacteria | 1654 |
| 28 | Ga0070691_10009588 | 3300005341 | Bacteria | 4419 |
| 29 | Ga0070691_10011961 | 3300005341 | Bacteria | 3973 |
| 30 | Ga0070691_10051994 | 3300005341 | Unclassified | 1959 |
| 31 | Ga0070661_100051437 | 3300005344 | Bacteria | 3015 |
| 32 | Ga0070692_10113560 | 3300005345 | Bacteria | 1501 |
| 33 | Ga0070668_100022166 | 3300005347 | Bacteria | 4802 |
| 34 | Ga0070668_100029091 | 3300005347 | Bacteria | 4195 |
| 35 | Ga0070668_100095077 | 3300005347 | Bacteria | 2353 |
| 36 | Ga0070669_100030851 | 3300005353 | Bacteria | 3869 |
| 37 | Ga0070669_100064942 | 3300005353 | Bacteria | 2688 |
| 38 | Ga0070669_100111225 | 3300005353 | Bacteria | 2079 |
| 39 | Ga0070669_100130053 | 3300005353 | Bacteria | 1930 |
| 40 | Ga0070675_100008041 | 3300005354 | Bacteria | 8176 |
| 41 | Ga0070675_100012318 | 3300005354 | Bacteria | 6702 |
| 42 | Ga0070675_100143812 | 3300005354 | Bacteria | 2040 |
| 43 | Ga0070675_100431519 | 3300005354 | Bacteria | 1180 |
| 44 | Ga0070671_100003747 | 3300005355 | Bacteria | 11941 |
| 45 | Ga0070671_100011289 | 3300005355 | Bacteria | 7176 |
| 46 | Ga0070671_100150517 | 3300005355 | Bacteria | 1965 |
| 47 | Ga0070671_100178458 | 3300005355 | Bacteria | 1797 |
| 48 | Ga0070671_100222130 | 3300005355 | Bacteria | 1602 |
| 49 | Ga0070673_100007204 | 3300005364 | Bacteria | 7313 |
| 50 | Ga0070673_100009277 | 3300005364 | Bacteria | 6600 |
| 51 | Ga0070673_100029379 | 3300005364 | Bacteria | 4098 |
| 52 | Ga0070673_100081600 | 3300005364 | Bacteria | 2623 |
| 53 | Ga0070659_100173101 | 3300005366 | Bacteria | 1769 |
| 54 | Ga0070667_100012330 | 3300005367 | Bacteria | 7072 |
| 55 | Ga0070667_100088213 | 3300005367 | Bacteria | 2663 |
| 56 | Ga0070711_100044173 | 3300005439 | Bacteria | 3023 |
| 57 | Ga0070700_100030979 | 3300005441 | Bacteria | 3201 |
| 58 | Ga0070700_100093999 | 3300005441 | Bacteria | 1962 |
| 59 | Ga0070694_100087502 | 3300005444 | Bacteria | 2179 |
| 60 | Ga0070708_100007577 | 3300005445 | Bacteria | 8689 |
| 61 | Ga0070708_100009904 | 3300005445 | Bacteria | 7703 |
| 62 | Ga0070708_100010509 | 3300005445 | Bacteria | 7504 |
| 63 | Ga0070708_100032557 | 3300005445 | Bacteria | 4524 |
| 64 | Ga0070708_100062810 | 3300005445 | Bacteria | 3323 |
| 65 | Ga0070708_100251746 | 3300005445 | Bacteria | 1659 |
| 66 | Ga0070708_100357543 | 3300005445 | Bacteria | 1376 |
| 67 | Ga0070663_100037907 | 3300005455 | Bacteria | 3358 |
| 68 | Ga0070663_100227957 | 3300005455 | Bacteria | 1466 |
| 69 | Ga0070678_100011332 | 3300005456 | Bacteria | 5494 |
| 70 | Ga0070678_100040192 | 3300005456 | Bacteria | 3307 |
| 71 | Ga0070678_100155199 | 3300005456 | Bacteria | 1848 |
| 72 | Ga0070678_100184015 | 3300005456 | Bacteria | 1713 |
| 73 | Ga0070678_100286465 | 3300005456 | Bacteria | 1395 |
| 74 | Ga0070662_100014260 | 3300005457 | Bacteria | 5305 |
| 75 | Ga0070662_100019928 | 3300005457 | Bacteria | 4564 |
| 76 | Ga0070662_100021528 | 3300005457 | Bacteria | 4403 |
| 77 | Ga0070662_100026417 | 3300005457 | Bacteria | 4021 |
| 78 | Ga0070662_100036296 | 3300005457 | Bacteria | 3486 |
| 79 | Ga0070662_100045273 | 3300005457 | Bacteria | 3156 |
| 80 | Ga0070662_100112798 | 3300005457 | Bacteria | 2073 |
| 81 | Ga0070681_10002879 | 3300005458 | Bacteria | 15900 |
| 82 | Ga0070681_10012674 | 3300005458 | Bacteria | 8364 |
| 83 | Ga0070681_10060167 | 3300005458 | Bacteria | 3776 |
| 84 | Ga0070681_10324921 | 3300005458 | Bacteria | 1448 |
| 85 | Ga0068867_100031859 | 3300005459 | Bacteria | 3809 |
| 86 | Ga0068867_100088054 | 3300005459 | Bacteria | 2352 |
| 87 | Ga0068867_100236285 | 3300005459 | Bacteria | 1480 |
| 88 | Ga0070706_100001589 | 3300005467 | Bacteria | 23687 |
| 89 | Ga0070706_100005491 | 3300005467 | Bacteria | 12070 |
| 90 | Ga0070706_100010557 | 3300005467 | Bacteria | 8572 |
| 91 | Ga0070706_100032033 | 3300005467 | Bacteria | 4848 |
| 92 | Ga0070706_100070565 | 3300005467 | Bacteria | 3230 |
| 93 | Ga0070706_100077488 | 3300005467 | Bacteria | 3076 |
| 94 | Ga0070707_100001162 | 3300005468 | Bacteria | 25888 |
| 95 | Ga0070707_100001404 | 3300005468 | Bacteria | 23652 |
| 96 | Ga0070707_100100816 | 3300005468 | Bacteria | 2798 |
| 97 | Ga0070707_100332738 | 3300005468 | Bacteria | 1475 |
| 98 | Ga0070707_100458707 | 3300005468 | Bacteria | 1235 |
| 99 | Ga0070707_100550856 | 3300005468 | Bacteria | 1115 |
| 100 | Ga0070698_100009924 | 3300005471 | Bacteria | 10179 |
| 101 | Ga0070698_100039844 | 3300005471 | Bacteria | 4832 |
| 102 | Ga0070698_100040892 | 3300005471 | Bacteria | 4762 |
| 103 | Ga0070698_100344923 | 3300005471 | Bacteria | 1420 |
| 104 | Ga0070699_100018229 | 3300005518 | Bacteria | 6032 |
| 105 | Ga0070699_100225138 | 3300005518 | Bacteria | 1672 |
| 106 | Ga0070699_100280401 | 3300005518 | Bacteria | 1493 |
| 107 | Ga0070679_100047324 | 3300005530 | Bacteria | 4287 |
| 108 | Ga0070679_100067827 | 3300005530 | Bacteria | 3558 |
| 109 | Ga0070684_100052918 | 3300005535 | Bacteria | 3532 |
| 110 | Ga0070697_100021883 | 3300005536 | Bacteria | 5070 |
| 111 | Ga0070697_100035132 | 3300005536 | Bacteria | 4042 |
| 112 | Ga0070697_100079233 | 3300005536 | Bacteria | 2704 |
| 113 | Ga0070672_100007704 | 3300005543 | Bacteria | 7334 |
| 114 | Ga0070672_100029468 | 3300005543 | Bacteria | 4116 |
| 115 | Ga0070672_100067175 | 3300005543 | Bacteria | 2840 |
| 116 | Ga0070672_100073109 | 3300005543 | Bacteria | 2732 |
| 117 | Ga0070686_100168705 | 3300005544 | Bacteria | 1546 |
| 118 | Ga0070696_100120426 | 3300005546 | Bacteria | 1899 |
| 119 | Ga0070665_100157616 | 3300005548 | Bacteria | 2272 |
| 120 | Ga0068855_100010300 | 3300005563 | Bacteria | 11276 |
| 121 | Ga0068855_100019538 | 3300005563 | Bacteria | 8139 |
| 122 | Ga0068855_100031423 | 3300005563 | Bacteria | 6340 |
| 123 | Ga0070664_100002604 | 3300005564 | Bacteria | 14550 |
| 124 | Ga0070664_100010652 | 3300005564 | Bacteria | 7451 |
| 125 | Ga0068857_100033034 | 3300005577 | Bacteria | 4575 |
| 126 | Ga0068854_100017084 | 3300005578 | Bacteria | 4851 |
| 127 | Ga0068854_100092671 | 3300005578 | Bacteria | 2251 |
| 128 | Ga0068854_100113215 | 3300005578 | Bacteria | 2049 |
| 129 | Ga0068854_100316254 | 3300005578 | Bacteria | 1267 |
| 130 | Ga0068856_100085833 | 3300005614 | Bacteria | 3127 |
| 131 | Ga0070702_100030150 | 3300005615 | Bacteria | 2955 |
| 132 | Ga0070702_100114693 | 3300005615 | Bacteria | 1677 |
| 133 | Ga0068852_100084133 | 3300005616 | Bacteria | 2830 |
| 134 | Ga0068852_100182214 | 3300005616 | Bacteria | 1976 |
| 135 | Ga0068859_100005136 | 3300005617 | Bacteria | 13293 |
| 136 | Ga0068859_100102845 | 3300005617 | Bacteria | 2914 |
| 137 | Ga0068859_100715878 | 3300005617 | Bacteria | 1091 |
| 138 | Ga0068864_100009415 | 3300005618 | Bacteria | 8059 |
| 139 | Ga0068864_100053353 | 3300005618 | Bacteria | 3487 |
| 140 | Ga0068861_100000575 | 3300005719 | Bacteria | 21693 |
| 141 | Ga0068861_100137979 | 3300005719 | Bacteria | 1987 |
| 142 | Ga0068870_10005096 | 3300005840 | Bacteria | 5713 |
| 143 | Ga0068870_10016783 | 3300005840 | Bacteria | 3507 |
| 144 | Ga0068863_100029312 | 3300005841 | Bacteria | 5253 |
| 145 | Ga0068863_100076781 | 3300005841 | Bacteria | 3160 |
| 146 | Ga0068863_100109776 | 3300005841 | Bacteria | 2626 |
| 147 | Ga0068858_100008304 | 3300005842 | Bacteria | 9984 |
| 148 | Ga0068858_100035532 | 3300005842 | Bacteria | 4622 |
| 149 | Ga0068858_100108403 | 3300005842 | Bacteria | 2592 |
| 150 | Ga0068858_100200318 | 3300005842 | Bacteria | 1888 |
| 151 | Ga0068860_100030814 | 3300005843 | Bacteria | 5157 |
| 152 | Ga0068860_100058908 | 3300005843 | Bacteria | 3652 |
| 153 | Ga0068860_100117085 | 3300005843 | Bacteria | 2549 |
| 154 | Ga0068860_100525064 | 3300005843 | Bacteria | 1184 |
| 155 | Ga0068862_100197452 | 3300005844 | Bacteria | 1813 |
| 156 | Ga0068862_100367943 | 3300005844 | Bacteria | 1337 |
| 157 | Ga0081538_10002834 | 3300005981 | Bacteria | 16585 |
| 158 | Ga0081540_1081992 | 3300005983 | Bacteria | 1448 |
| 159 | Ga0081539_10000092 | 3300005985 | Bacteria | 208968 |
| 160 | Ga0081539_10017494 | 3300005985 | Bacteria | 5028 |
| 161 | Ga0075365_10040606 | 3300006038 | Bacteria | 3034 |
| 162 | Ga0070712_100062413 | 3300006175 | Bacteria | 2635 |
| 163 | Ga0070712_100093727 | 3300006175 | Bacteria | 2205 |
| 164 | Ga0075362_10010992 | 3300006177 | Bacteria | 3554 |
| 165 | Ga0075367_10020965 | 3300006178 | Bacteria | 3647 |
| 166 | Ga0075366_10009924 | 3300006195 | Bacteria | 5329 |
| 167 | Ga0075366_10013053 | 3300006195 | Bacteria | 4724 |
| 168 | Ga0075366_10046644 | 3300006195 | Bacteria | 2568 |
| 169 | Ga0075366_10113838 | 3300006195 | Bacteria | 1628 |
| 170 | Ga0097621_100034178 | 3300006237 | Bacteria | 4054 |
| 171 | Ga0097621_100034948 | 3300006237 | Bacteria | 4012 |
| 172 | Ga0097621_100065873 | 3300006237 | Bacteria | 2983 |
| 173 | Ga0097621_100095756 | 3300006237 | Bacteria | 2490 |
| 174 | Ga0075370_10035473 | 3300006353 | Bacteria | 2799 |
| 175 | Ga0068871_100017804 | 3300006358 | Bacteria | 5386 |
| 176 | Ga0068871_100024771 | 3300006358 | Bacteria | 4657 |
| 177 | Ga0068871_100150122 | 3300006358 | Bacteria | 1987 |
| 178 | Ga0075428_100000436 | 3300006844 | Bacteria | 41529 |
| 179 | Ga0075428_100012043 | 3300006844 | Bacteria | 9623 |
| 180 | Ga0075428_100012245 | 3300006844 | Bacteria | 9538 |
| 181 | Ga0075428_100013199 | 3300006844 | Bacteria | 9190 |
| 182 | Ga0075428_100029862 | 3300006844 | Bacteria | 6030 |
| 183 | Ga0075428_100034150 | 3300006844 | Bacteria | 5612 |
| 184 | Ga0075428_100091471 | 3300006844 | Bacteria | 3318 |
| 185 | Ga0075428_100137898 | 3300006844 | Bacteria | 2652 |
| 186 | Ga0075428_100234543 | 3300006844 | Bacteria | 1980 |
| 187 | Ga0075430_100000002 | 3300006846 | Bacteria | 150510 |
| 188 | Ga0075430_100000678 | 3300006846 | Bacteria | 26055 |
| 189 | Ga0075430_100004567 | 3300006846 | Bacteria | 11652 |
| 190 | Ga0075430_100021586 | 3300006846 | Bacteria | 5471 |
| 191 | Ga0075430_100052664 | 3300006846 | Bacteria | 3429 |
| 192 | Ga0075430_100053397 | 3300006846 | Bacteria | 3402 |
| 193 | Ga0075430_100064840 | 3300006846 | Bacteria | 3069 |
| 194 | Ga0075431_100000452 | 3300006847 | Bacteria | 33772 |
| 195 | Ga0075431_100001143 | 3300006847 | Bacteria | 23854 |
| 196 | Ga0075431_100004273 | 3300006847 | Bacteria | 13990 |
| 197 | Ga0075431_100006431 | 3300006847 | Bacteria | 11663 |
| 198 | Ga0075431_100006738 | 3300006847 | Bacteria | 11408 |
| 199 | Ga0075431_100091558 | 3300006847 | Bacteria | 3138 |
| 200 | Ga0075431_100108770 | 3300006847 | Bacteria | 2861 |
| 201 | Ga0075431_100127404 | 3300006847 | Bacteria | 2627 |
| 202 | Ga0075431_100182374 | 3300006847 | Bacteria | 2154 |
| 203 | Ga0075433_10003800 | 3300006852 | Bacteria | 11696 |
| 204 | Ga0075433_10006010 | 3300006852 | Bacteria | 9564 |
| 205 | Ga0075433_10008009 | 3300006852 | Bacteria | 8414 |
| 206 | Ga0075433_10019115 | 3300006852 | Bacteria | 5700 |
| 207 | Ga0075433_10049089 | 3300006852 | Bacteria | 3671 |
| 208 | Ga0075433_10059887 | 3300006852 | Bacteria | 3332 |
| 209 | Ga0075433_10110084 | 3300006852 | Bacteria | 2444 |
| 210 | Ga0075433_10123164 | 3300006852 | Bacteria | 2303 |
| 211 | Ga0075433_10138804 | 3300006852 | Bacteria | 2161 |
| 212 | Ga0075433_10141093 | 3300006852 | Bacteria | 2142 |
| 213 | Ga0075433_10170332 | 3300006852 | Bacteria | 1938 |
| 214 | Ga0075433_10245953 | 3300006852 | Bacteria | 1588 |
| 215 | Ga0075433_10397558 | 3300006852 | Bacteria | 1216 |
| 216 | Ga0075434_100002356 | 3300006871 | Bacteria | 16547 |
| 217 | Ga0075434_100005140 | 3300006871 | Bacteria | 11880 |
| 218 | Ga0075434_100009161 | 3300006871 | Bacteria | 9221 |
| 219 | Ga0075434_100026125 | 3300006871 | Bacteria | 5719 |
| 220 | Ga0075434_100029969 | 3300006871 | Bacteria | 5356 |
| 221 | Ga0075434_100032201 | 3300006871 | Bacteria | 5169 |
| 222 | Ga0075434_100049867 | 3300006871 | Bacteria | 4157 |
| 223 | Ga0075434_100069050 | 3300006871 | Bacteria | 3522 |
| 224 | Ga0075434_100078710 | 3300006871 | Bacteria | 3293 |
| 225 | Ga0075434_100083481 | 3300006871 | Bacteria | 3192 |
| 226 | Ga0075434_100113841 | 3300006871 | Bacteria | 2718 |
| 227 | Ga0075434_100124067 | 3300006871 | Bacteria | 2599 |
| 228 | Ga0075434_100177262 | 3300006871 | Bacteria | 2151 |
| 229 | Ga0075434_100214923 | 3300006871 | Bacteria | 1943 |
| 230 | Ga0075434_100523460 | 3300006871 | Bacteria | 1206 |
| 231 | Ga0075434_100549203 | 3300006871 | Bacteria | 1175 |
| 232 | Ga0075434_100582910 | 3300006871 | Bacteria | 1138 |
| 233 | Ga0075429_100000460 | 3300006880 | Bacteria | 30370 |
| 234 | Ga0075429_100001854 | 3300006880 | Bacteria | 17514 |
| 235 | Ga0075429_100010953 | 3300006880 | Bacteria | 7844 |
| 236 | Ga0075429_100041711 | 3300006880 | Bacteria | 3996 |
| 237 | Ga0075429_100046370 | 3300006880 | Bacteria | 3781 |
| 238 | Ga0075429_100093929 | 3300006880 | Bacteria | 2616 |
| 239 | Ga0075429_100270905 | 3300006880 | Bacteria | 1487 |
| 240 | Ga0068865_100026816 | 3300006881 | Bacteria | 3801 |
| 241 | Ga0075436_100001438 | 3300006914 | Bacteria | 16202 |
| 242 | Ga0075436_100015795 | 3300006914 | Bacteria | 5170 |
| 243 | Ga0097620_100005136 | 3300006931 | Bacteria | 13293 |
| 244 | Ga0097620_100102842 | 3300006931 | Bacteria | 2914 |
| 245 | Ga0097620_100715770 | 3300006931 | Bacteria | 1091 |
| 246 | Ga0075435_100003478 | 3300007076 | Bacteria | 10682 |
| 247 | Ga0075435_100013001 | 3300007076 | Bacteria | 6178 |
| 248 | Ga0075435_100016217 | 3300007076 | Bacteria | 5615 |
| 249 | Ga0075435_100040318 | 3300007076 | Unclassified | 3729 |
| 250 | Ga0075435_100040978 | 3300007076 | Bacteria | 3700 |
| 251 | Ga0075435_100055170 | 3300007076 | Bacteria | 3208 |
| 252 | Ga0075435_100056645 | 3300007076 | Bacteria | 3169 |
| 253 | Ga0075435_100095060 | 3300007076 | Bacteria | 2464 |
| 254 | Ga0075435_100128226 | 3300007076 | Bacteria | 2121 |
| 255 | Ga0075435_100203807 | 3300007076 | Bacteria | 1676 |
| 256 | Ga0075435_100212135 | 3300007076 | Bacteria | 1643 |
| 257 | Ga0075435_100240129 | 3300007076 | Bacteria | 1541 |
| 258 | Ga0075435_100284504 | 3300007076 | Bacteria | 1412 |
| 259 | Ga0099794_10012766 | 3300007265 | Bacteria | 3638 |
| 260 | Ga0099794_10024348 | 3300007265 | Bacteria | 2778 |
| 261 | Ga0099794_10049142 | 3300007265 | Bacteria | 2026 |
| 262 | Ga0105244_10025409 | 3300009036 | Bacteria | 3219 |
| 263 | Ga0111539_10000557 | 3300009094 | Bacteria | 47767 |
| 264 | Ga0111539_10007349 | 3300009094 | Bacteria | 14109 |
| 265 | Ga0111539_10163932 | 3300009094 | Bacteria | 2600 |
| 266 | Ga0111539_10226547 | 3300009094 | Bacteria | 2177 |
| 267 | Ga0111539_10248176 | 3300009094 | Bacteria | 2073 |
| 268 | Ga0111539_10327515 | 3300009094 | Bacteria | 1783 |
| 269 | Ga0111539_10367544 | 3300009094 | Bacteria | 1674 |
| 270 | Ga0111539_10407084 | 3300009094 | Bacteria | 1584 |
| 271 | Ga0105245_10101720 | 3300009098 | Bacteria | 2661 |
| 272 | Ga0105245_10399728 | 3300009098 | Bacteria | 1373 |
| 273 | Ga0105247_10100466 | 3300009101 | Bacteria | 1849 |
| 274 | Ga0114129_10013913 | 3300009147 | Bacteria | 11464 |
| 275 | Ga0114129_10015808 | 3300009147 | Bacteria | 10730 |
| 276 | Ga0114129_10018918 | 3300009147 | Bacteria | 9814 |
| 277 | Ga0114129_10022405 | 3300009147 | Bacteria | 8969 |
| 278 | Ga0114129_10023727 | 3300009147 | Bacteria | 8695 |
| 279 | Ga0114129_10027955 | 3300009147 | Bacteria | 7986 |
| 280 | Ga0114129_10028080 | 3300009147 | Bacteria | 7972 |
| 281 | Ga0114129_10031378 | 3300009147 | Bacteria | 7512 |
| 282 | Ga0114129_10061558 | 3300009147 | Bacteria | 5245 |
| 283 | Ga0114129_10083235 | 3300009147 | Bacteria | 4446 |
| 284 | Ga0114129_10099597 | 3300009147 | Bacteria | 4023 |
| 285 | Ga0114129_10149663 | 3300009147 | Bacteria | 3195 |
| 286 | Ga0114129_10215283 | 3300009147 | Bacteria | 2594 |
| 287 | Ga0114129_10259863 | 3300009147 | Bacteria | 2328 |
| 288 | Ga0114129_10272460 | 3300009147 | Bacteria | 2264 |
| 289 | Ga0114129_10309773 | 3300009147 | Bacteria | 2102 |
| 290 | Ga0114129_10342592 | 3300009147 | Bacteria | 1982 |
| 291 | Ga0114129_10379746 | 3300009147 | Bacteria | 1866 |
| 292 | Ga0114129_10411631 | 3300009147 | Bacteria | 1780 |
| 293 | Ga0114129_10431285 | 3300009147 | Bacteria | 1732 |
| 294 | Ga0114129_10457427 | 3300009147 | Bacteria | 1673 |
| 295 | Ga0114129_10461567 | 3300009147 | Bacteria | 1664 |
| 296 | Ga0114129_10462710 | 3300009147 | Bacteria | 1662 |
| 297 | Ga0114129_10479024 | 3300009147 | Bacteria | 1629 |
| 298 | Ga0105243_10009794 | 3300009148 | Bacteria | 7293 |
| 299 | Ga0105243_10117532 | 3300009148 | Bacteria | 2236 |
| 300 | Ga0105243_10175226 | 3300009148 | Bacteria | 1861 |
| 301 | Ga0105241_10040435 | 3300009174 | Bacteria | 3520 |
| 302 | Ga0105241_10068787 | 3300009174 | Bacteria | 2744 |
| 303 | Ga0105241_10403397 | 3300009174 | Bacteria | 1199 |
| 304 | Ga0105242_10003647 | 3300009176 | Bacteria | 11985 |
| 305 | Ga0105242_10066025 | 3300009176 | Bacteria | 2987 |
| 306 | Ga0105242_10198533 | 3300009176 | Unclassified | 1780 |
| 307 | Ga0105242_10228060 | 3300009176 | Bacteria | 1668 |
| 308 | Ga0105242_10272672 | 3300009176 | Unclassified | 1533 |
| 309 | Ga0105242_10298573 | 3300009176 | Bacteria | 1469 |
| 310 | Ga0105248_10040261 | 3300009177 | Bacteria | 5238 |
| 311 | Ga0105248_10132458 | 3300009177 | Bacteria | 2813 |
| 312 | Ga0105248_10150680 | 3300009177 | Bacteria | 2624 |
| 313 | Ga0105237_10203201 | 3300009545 | Bacteria | 1982 |
| 314 | Ga0105238_10263627 | 3300009551 | Bacteria | 1703 |
| 315 | Ga0105249_10004175 | 3300009553 | Bacteria | 12475 |
| 316 | Ga0105249_10239632 | 3300009553 | Bacteria | 1793 |
| 317 | Ga0105249_10430811 | 3300009553 | Bacteria | 1354 |
| 318 | Ga0105239_10183357 | 3300010375 | Bacteria | 2342 |
| 319 | Ga0105239_10357149 | 3300010375 | Bacteria | 1650 |
| 320 | Ga0105246_10054413 | 3300011119 | Bacteria | 2758 |
| 321 | Ga0157325_1001329 | 3300012485 | Bacteria | 1117 |
| 322 | Ga0157373_10112894 | 3300013100 | Bacteria | 1910 |
| 323 | Ga0157371_10066298 | 3300013102 | Bacteria | 2556 |
| 324 | Ga0157374_10034097 | 3300013296 | Bacteria | 4648 |
| 325 | Ga0157374_10056675 | 3300013296 | Bacteria | 3659 |
| 326 | Ga0157374_10069604 | 3300013296 | Bacteria | 3313 |
| 327 | Ga0157378_10020644 | 3300013297 | Bacteria | 5794 |
| 328 | Ga0157378_10039990 | 3300013297 | Bacteria | 4159 |
| 329 | Ga0157378_10118200 | 3300013297 | Bacteria | 2440 |
| 330 | Ga0163162_10056936 | 3300013306 | Bacteria | 3937 |
| 331 | Ga0163162_10060920 | 3300013306 | Bacteria | 3811 |
| 332 | Ga0163162_10070558 | 3300013306 | Bacteria | 3545 |
| 333 | Ga0163162_10156757 | 3300013306 | Bacteria | 2397 |
| 334 | Ga0163162_10221658 | 3300013306 | Bacteria | 2021 |
| 335 | Ga0163162_10245008 | 3300013306 | Unclassified | 1924 |
| 336 | Ga0157372_10021948 | 3300013307 | Bacteria | 6901 |
| 337 | Ga0157372_10334191 | 3300013307 | Bacteria | 1765 |
| 338 | Ga0157375_10037314 | 3300013308 | Bacteria | 4655 |
| 339 | Ga0157375_10163231 | 3300013308 | Bacteria | 2371 |
| 340 | Ga0157375_10208326 | 3300013308 | Bacteria | 2112 |
| 341 | Ga0163163_10007322 | 3300014325 | Bacteria | 9733 |
| 342 | Ga0157380_10012144 | 3300014326 | Bacteria | 6237 |
| 343 | Ga0157380_10071391 | 3300014326 | Bacteria | 2809 |
| 344 | Ga0157380_10275232 | 3300014326 | Bacteria | 1537 |
| 345 | Ga0157377_10053709 | 3300014745 | Bacteria | 2279 |
| 346 | Ga0157379_10048037 | 3300014968 | Bacteria | 3809 |
| 347 | Ga0157379_10050042 | 3300014968 | Bacteria | 3729 |
| 348 | Ga0157379_10072723 | 3300014968 | Bacteria | 3077 |
| 349 | Ga0157376_10004342 | 3300014969 | Bacteria | 9856 |
| 350 | Ga0157376_10004443 | 3300014969 | Bacteria | 9770 |
| 351 | Ga0157376_10062886 | 3300014969 | Bacteria | 3125 |
| 352 | Ga0157376_10282256 | 3300014969 | Bacteria | 1564 |
| 353 | Ga0182007_10001904 | 3300015262 | Bacteria | 10866 |
| 354 | Ga0163161_10000201 | 3300017792 | Bacteria | 54704 |
| 355 | Ga0163161_10037878 | 3300017792 | Bacteria | 3457 |
| 356 | Ga0163161_10049693 | 3300017792 | Bacteria | 3032 |
| 357 | Ga0207666_1002179 | 3300025271 | Bacteria | 2348 |
| 358 | Ga0209676_1001621 | 3300025292 | Bacteria | 19914 |
| 359 | Ga0209050_1000511 | 3300025298 | Bacteria | 65746 |
| 360 | Ga0209051_1000326 | 3300025303 | Bacteria | 71572 |
| 361 | Ga0209257_1000249 | 3300025304 | Bacteria | 124522 |
| 362 | Ga0207697_10013998 | 3300025315 | Bacteria | 3339 |
| 363 | Ga0207655_1003575 | 3300025728 | Bacteria | 11504 |
| 364 | Ga0207682_10010199 | 3300025893 | Bacteria | 3686 |
| 365 | Ga0207682_10010960 | 3300025893 | Bacteria | 3549 |
| 366 | Ga0207642_10031608 | 3300025899 | Bacteria | 2219 |
| 367 | Ga0207688_10015621 | 3300025901 | Bacteria | 4117 |
| 368 | Ga0207680_10013062 | 3300025903 | Bacteria | 4252 |
| 369 | Ga0207680_10263563 | 3300025903 | Bacteria | 1193 |
| 370 | Ga0207685_10029541 | 3300025905 | Bacteria | 1941 |
| 371 | Ga0207645_10003317 | 3300025907 | Bacteria | 12283 |
| 372 | Ga0207645_10105918 | 3300025907 | Bacteria | 1817 |
| 373 | Ga0207643_10011086 | 3300025908 | Bacteria | 4865 |
| 374 | Ga0207643_10011571 | 3300025908 | Bacteria | 4764 |
| 375 | Ga0207643_10104622 | 3300025908 | Bacteria | 1662 |
| 376 | Ga0207705_10170128 | 3300025909 | Bacteria | 1640 |
| 377 | Ga0207684_10000242 | 3300025910 | Bacteria | 81735 |
| 378 | Ga0207684_10002560 | 3300025910 | Bacteria | 18242 |
| 379 | Ga0207684_10006317 | 3300025910 | Bacteria | 10809 |
| 380 | Ga0207684_10017290 | 3300025910 | Bacteria | 6185 |
| 381 | Ga0207684_10096540 | 3300025910 | Bacteria | 2523 |
| 382 | Ga0207684_10331392 | 3300025910 | Bacteria | 1311 |
| 383 | Ga0207654_10100827 | 3300025911 | Bacteria | 1779 |
| 384 | Ga0207707_10006041 | 3300025912 | Bacteria | 10592 |
| 385 | Ga0207707_10014037 | 3300025912 | Bacteria | 6983 |
| 386 | Ga0207707_10061944 | 3300025912 | Bacteria | 3255 |
| 387 | Ga0207695_10017451 | 3300025913 | Bacteria | 8354 |
| 388 | Ga0207693_10010103 | 3300025915 | Bacteria | 7668 |
| 389 | Ga0207693_10126656 | 3300025915 | Bacteria | 2007 |
| 390 | Ga0207657_10053475 | 3300025919 | Bacteria | 3498 |
| 391 | Ga0207649_10021044 | 3300025920 | Bacteria | 3748 |
| 392 | Ga0207649_10170219 | 3300025920 | Bacteria | 1517 |
| 393 | Ga0207652_10008523 | 3300025921 | Bacteria | 8251 |
| 394 | Ga0207652_10008998 | 3300025921 | Bacteria | 8047 |
| 395 | Ga0207646_10000574 | 3300025922 | Bacteria | 48122 |
| 396 | Ga0207646_10001059 | 3300025922 | Bacteria | 35029 |
| 397 | Ga0207646_10014377 | 3300025922 | Bacteria | 7521 |
| 398 | Ga0207646_10019416 | 3300025922 | Bacteria | 6318 |
| 399 | Ga0207646_10021809 | 3300025922 | Bacteria | 5910 |
| 400 | Ga0207646_10032739 | 3300025922 | Bacteria | 4703 |
| 401 | Ga0207646_10045699 | 3300025922 | Bacteria | 3930 |
| 402 | Ga0207646_10162679 | 3300025922 | Bacteria | 2014 |
| 403 | Ga0207681_10043058 | 3300025923 | Bacteria | 3020 |
| 404 | Ga0207681_10061243 | 3300025923 | Bacteria | 2586 |
| 405 | Ga0207681_10102521 | 3300025923 | Bacteria | 2066 |
| 406 | Ga0207681_10186358 | 3300025923 | Bacteria | 1584 |
| 407 | Ga0207650_10007400 | 3300025925 | Bacteria | 7477 |
| 408 | Ga0207650_10056804 | 3300025925 | Bacteria | 2909 |
| 409 | Ga0207659_10001714 | 3300025926 | Bacteria | 13016 |
| 410 | Ga0207659_10003908 | 3300025926 | Bacteria | 8987 |
| 411 | Ga0207659_10126306 | 3300025926 | Bacteria | 1967 |
| 412 | Ga0207687_10133153 | 3300025927 | Bacteria | 1877 |
| 413 | Ga0207644_10009027 | 3300025931 | Bacteria | 6534 |
| 414 | Ga0207644_10062435 | 3300025931 | Bacteria | 2702 |
| 415 | Ga0207644_10180387 | 3300025931 | Bacteria | 1654 |
| 416 | Ga0207644_10210719 | 3300025931 | Bacteria | 1536 |
| 417 | Ga0207690_10038315 | 3300025932 | Bacteria | 3119 |
| 418 | Ga0207706_10005505 | 3300025933 | Bacteria | 11807 |
| 419 | Ga0207706_10010676 | 3300025933 | Bacteria | 8389 |
| 420 | Ga0207706_10010908 | 3300025933 | Bacteria | 8292 |
| 421 | Ga0207706_10058823 | 3300025933 | Bacteria | 3385 |
| 422 | Ga0207706_10071674 | 3300025933 | Bacteria | 3048 |
| 423 | Ga0207686_10047398 | 3300025934 | Bacteria | 2656 |
| 424 | Ga0207709_10009580 | 3300025935 | Bacteria | 5332 |
| 425 | Ga0207709_10081359 | 3300025935 | Bacteria | 2088 |
| 426 | Ga0207709_10118291 | 3300025935 | Bacteria | 1785 |
| 427 | Ga0207669_10267070 | 3300025937 | Bacteria | 1283 |
| 428 | Ga0207704_10053082 | 3300025938 | Bacteria | 2461 |
| 429 | Ga0207691_10016579 | 3300025940 | Bacteria | 6993 |
| 430 | Ga0207691_10029124 | 3300025940 | Bacteria | 5166 |
| 431 | Ga0207691_10040836 | 3300025940 | Bacteria | 4286 |
| 432 | Ga0207711_10025878 | 3300025941 | Bacteria | 4921 |
| 433 | Ga0207711_10029877 | 3300025941 | Bacteria | 4597 |
| 434 | Ga0207711_10054531 | 3300025941 | Bacteria | 3431 |
| 435 | Ga0207689_10000578 | 3300025942 | Bacteria | 34981 |
| 436 | Ga0207689_10008649 | 3300025942 | Bacteria | 8864 |
| 437 | Ga0207689_10037686 | 3300025942 | Bacteria | 4009 |
| 438 | Ga0207689_10058161 | 3300025942 | Bacteria | 3180 |
| 439 | Ga0207679_10180775 | 3300025945 | Bacteria | 1745 |
| 440 | Ga0207667_10039202 | 3300025949 | Bacteria | 5051 |
| 441 | Ga0207667_10058694 | 3300025949 | Bacteria | 4034 |
| 442 | Ga0207651_10001572 | 3300025960 | Bacteria | 10454 |
| 443 | Ga0207651_10093360 | 3300025960 | Bacteria | 2209 |
| 444 | Ga0207651_10225090 | 3300025960 | Bacteria | 1519 |
| 445 | Ga0207712_10008657 | 3300025961 | Bacteria | 6436 |
| 446 | Ga0207712_10085590 | 3300025961 | Bacteria | 2308 |
| 447 | Ga0207668_10140461 | 3300025972 | Bacteria | 1856 |
| 448 | Ga0207668_10245038 | 3300025972 | Bacteria | 1452 |
| 449 | Ga0207668_10383227 | 3300025972 | Bacteria | 1184 |
| 450 | Ga0207640_10038096 | 3300025981 | Bacteria | 3031 |
| 451 | Ga0207640_10073024 | 3300025981 | Bacteria | 2317 |
| 452 | Ga0207658_10002890 | 3300025986 | Bacteria | 12312 |
| 453 | Ga0207658_10008700 | 3300025986 | Bacteria | 6897 |
| 454 | Ga0207658_10105321 | 3300025986 | Bacteria | 2218 |
| 455 | Ga0207658_10247393 | 3300025986 | Bacteria | 1514 |
| 456 | Ga0207677_10001764 | 3300026023 | Bacteria | 11437 |
| 457 | Ga0207677_10008037 | 3300026023 | Bacteria | 5872 |
| 458 | Ga0207703_10076591 | 3300026035 | Bacteria | 2775 |
| 459 | Ga0207703_10122412 | 3300026035 | Bacteria | 2235 |
| 460 | Ga0207639_10057989 | 3300026041 | Bacteria | 2976 |
| 461 | Ga0207678_10064226 | 3300026067 | Bacteria | 3154 |
| 462 | Ga0207678_10124647 | 3300026067 | Bacteria | 2198 |
| 463 | Ga0207678_10203816 | 3300026067 | Bacteria | 1692 |
| 464 | Ga0207708_10038044 | 3300026075 | Bacteria | 3664 |
| 465 | Ga0207708_10078665 | 3300026075 | Bacteria | 2532 |
| 466 | Ga0207708_10111402 | 3300026075 | Bacteria | 2125 |
| 467 | Ga0207702_10114699 | 3300026078 | Bacteria | 2401 |
| 468 | Ga0207641_10000594 | 3300026088 | Bacteria | 39811 |
| 469 | Ga0207641_10034332 | 3300026088 | Bacteria | 4218 |
| 470 | Ga0207641_10098334 | 3300026088 | Bacteria | 2573 |
| 471 | Ga0207641_10272256 | 3300026088 | Bacteria | 1589 |
| 472 | Ga0207641_10344860 | 3300026088 | Unclassified | 1418 |
| 473 | Ga0207648_10041353 | 3300026089 | Bacteria | 4047 |
| 474 | Ga0207648_10077095 | 3300026089 | Bacteria | 2905 |
| 475 | Ga0207648_10170905 | 3300026089 | Bacteria | 1921 |
| 476 | Ga0207648_10223741 | 3300026089 | Bacteria | 1673 |
| 477 | Ga0207676_10000860 | 3300026095 | Bacteria | 23595 |
| 478 | Ga0207676_10017649 | 3300026095 | Bacteria | 5174 |
| 479 | Ga0207676_10095071 | 3300026095 | Bacteria | 2457 |
| 480 | Ga0207674_10024823 | 3300026116 | Bacteria | 6398 |
| 481 | Ga0207674_10027649 | 3300026116 | Bacteria | 5996 |
| 482 | Ga0207675_100027354 | 3300026118 | Bacteria | 5312 |
| 483 | Ga0207675_100034386 | 3300026118 | Bacteria | 4725 |
| 484 | Ga0207675_100050157 | 3300026118 | Bacteria | 3894 |
| 485 | Ga0207675_100168002 | 3300026118 | Bacteria | 2095 |
| 486 | Ga0207683_10000890 | 3300026121 | Bacteria | 27458 |
| 487 | Ga0207683_10002475 | 3300026121 | Bacteria | 16113 |
| 488 | Ga0207683_10129945 | 3300026121 | Bacteria | 2265 |
| 489 | Ga0207698_10046728 | 3300026142 | Bacteria | 3272 |
| 490 | Ga0207698_10178288 | 3300026142 | Bacteria | 1879 |
| 491 | Ga0209996_1006774 | 3300027395 | Bacteria | 1486 |
| 492 | Ga0209999_1021436 | 3300027543 | Bacteria | 1186 |
| 493 | Ga0209588_1010717 | 3300027671 | Bacteria | 2760 |
| 494 | Ga0209588_1016016 | 3300027671 | Bacteria | 2310 |
| 495 | Ga0209588_1020355 | 3300027671 | Bacteria | 2078 |
| 496 | Ga0209588_1035179 | 3300027671 | Bacteria | 1610 |
| 497 | Ga0209813_10033417 | 3300027866 | Bacteria | 1529 |
| 498 | Ga0207428_10000033 | 3300027907 | Bacteria | 232081 |
| 499 | Ga0207428_10000054 | 3300027907 | Bacteria | 175237 |
| 500 | Ga0207428_10030997 | 3300027907 | Bacteria | 4418 |
| 501 | Ga0207428_10087894 | 3300027907 | Bacteria | 2417 |
| 502 | Ga0207428_10163063 | 3300027907 | Bacteria | 1692 |
| 503 | Ga0268266_10139377 | 3300028379 | Bacteria | 2176 |
| 504 | Ga0268265_10387699 | 3300028380 | Bacteria | 1287 |
| 505 | Ga0268264_10003635 | 3300028381 | Bacteria | 13261 |
| 506 | Ga0268264_10009846 | 3300028381 | Bacteria | 7912 |
| 507 | Ga0268264_10047987 | 3300028381 | Bacteria | 3551 |
| 508 | Ga0268264_10557296 | 3300028381 | Bacteria | 1125 |
| 509 | Ga0307515_10000179 | 3300028794 | Bacteria | 156716 |
| 510 | Ga0307515_10000586 | 3300028794 | Bacteria | 85517 |
| 511 | Ga0307515_10006221 | 3300028794 | Bacteria | 23979 |
| 512 | Ga0307515_10069999 | 3300028794 | Bacteria | 4783 |
| 513 | Ga0307512_10142109 | 3300030522 | Bacteria | 1465 |
| 514 | Ga0307513_10047767 | 3300031456 | Bacteria | 4653 |
| 515 | Ga0307509_10008236 | 3300031507 | Bacteria | 13333 |
| 516 | Ga0307509_10128577 | 3300031507 | Bacteria | 2494 |
| 517 | Ga0307408_100007871 | 3300031548 | Bacteria | 7046 |
| 518 | Ga0307408_100055346 | 3300031548 | Bacteria | 2872 |
| 519 | Ga0307408_100148525 | 3300031548 | Bacteria | 1848 |
| 520 | Ga0307508_10000649 | 3300031616 | Bacteria | 41802 |
| 521 | Ga0307514_10031436 | 3300031649 | Bacteria | 4258 |
| 522 | Ga0307516_10166651 | 3300031730 | Bacteria | 1947 |
| 523 | Ga0307405_10013638 | 3300031731 | Bacteria | 4340 |
| 524 | Ga0307410_10373502 | 3300031852 | Bacteria | 1145 |
| 525 | Ga0307406_10072021 | 3300031901 | Bacteria | 2267 |
| 526 | Ga0307412_10012351 | 3300031911 | Bacteria | 4975 |
| 527 | Ga0307409_100011542 | 3300031995 | Bacteria | 5579 |
| 528 | Ga0307411_10127295 | 3300032005 | Bacteria | 1855 |
| 529 | Ga0373940_0031254 | 3300035088 | Bacteria | 1420 |
| 530 | Ga0373936_0029320 | 3300035113 | Bacteria | 2166 |
| 531 | Ga0373939_0022487 | 3300035114 | Bacteria | 1738 |
| 532 | Ga0373960_0035600 | 3300035121 | Bacteria | 1414 |
| 533 | Ga0373962_0047054 | 3300035242 | Bacteria | 1233 |
| 534 | Ga0373931_0002271 | 3300035691 | Bacteria | 8496 |
| 535 | Ga0373931_0009693 | 3300035691 | Bacteria | 4612 |
| 536 | Ga0373931_0012731 | 3300035691 | Bacteria | 4082 |
| 537 | Ga0373931_0013727 | 3300035691 | Bacteria | 3950 |
| 538 | Ga0373925_0252341 | 3300037068 | Bacteria | 1415 |
| 539 | Ga0373925_0290837 | 3300037068 | Bacteria | 1317 |
| 540 | Ga0395899_0011209 | 3300037312 | Bacteria | 6869 |
| 541 | Ga0395900_0001747 | 3300037418 | Bacteria | 25001 |
| 542 | Ga0395900_0022197 | 3300037418 | Bacteria | 6493 |
| 543 | Ga0395898_0003002 | 3300037466 | Bacteria | 19130 |
| 544 | Ga0395905_0066540 | 3300037471 | Bacteria | 3374 |
| 545 | Ga0395905_0093729 | 3300037471 | Bacteria | 2816 |
| 546 | Ga0395905_0254105 | 3300037471 | Bacteria | 1642 |
| 547 | Ga0395901_0001149 | 3300038443 | Bacteria | 28063 |
| 548 | Ga0395901_0014577 | 3300038443 | Bacteria | 7990 |
| 549 | Ga0395901_0051038 | 3300038443 | Bacteria | 4299 |
| 550 | Ga0242420_023207 | 3300038996 | Bacteria | 1119 |
| 551 | Ga0439439_0002176 | 3300041406 | Bacteria | 4115 |
| 552 | Ga0451791_1836557 | 3300041451 | Bacteria | 1648 |
| 553 | Ga0451851_1247133 | 3300041507 | Bacteria | 1317 |
| 554 | Ga0451855_1812600 | 3300041511 | Bacteria | 1830 |
| 555 | Ga0439432_005283 | 3300042006 | Bacteria | 4662 |
| 556 | Ga0439449_0001123 | 3300042007 | Bacteria | 10530 |
| 557 | Ga0439452_001727 | 3300042010 | Bacteria | 8557 |
| 558 | Ga0439462_0006129 | 3300042015 | Bacteria | 2981 |
| 559 | Ga0439462_0038644 | 3300042015 | Bacteria | 1272 |
| 560 | Ga0450897_000666 | 3300042128 | Bacteria | 2020 |
| 561 | Ga0450898_000063 | 3300042134 | Bacteria | 9276 |
| 562 | Ga0450906_002684 | 3300042145 | Bacteria | 3873 |
| 563 | Ga0439446_0011515 | 3300042156 | Bacteria | 2402 |
| 564 | Ga0439434_0003855 | 3300042435 | Bacteria | 4382 |
| 565 | Ga0451577_0088126 | 3300042876 | Bacteria | 2769 |
| 566 | Ga0451577_0130714 | 3300042876 | Bacteria | 2252 |
| 567 | Ga0451577_0145074 | 3300042876 | Bacteria | 2134 |
| 568 | Ga0451577_0211712 | 3300042876 | Bacteria | 1751 |
| 569 | Ga0451577_0405919 | 3300042876 | Bacteria | 1237 |
| 570 | Ga0453683_0030684 | 3300044673 | Bacteria | 3398 |
| 571 | Ga0453683_0036542 | 3300044673 | Bacteria | 3091 |
| 572 | Ga0453683_0190318 | 3300044673 | Bacteria | 1302 |
| 573 | Ga0453683_0193446 | 3300044673 | Bacteria | 1291 |
| 574 | Ga0453684_0009330 | 3300044712 | Bacteria | 17209 |
| 575 | Ga0453684_0092140 | 3300044712 | Bacteria | 3737 |
| 576 | Ga0453684_0141440 | 3300044712 | Bacteria | 2873 |
| 577 | Ga0453684_0174662 | 3300044712 | Bacteria | 2528 |
| 578 | Ga0451576_0077314 | 3300045051 | Bacteria | 3463 |
| 579 | Ga0451576_0078540 | 3300045051 | Bacteria | 3435 |
| 580 | Ga0451576_0082742 | 3300045051 | Bacteria | 3338 |
| 581 | Ga0451576_0131422 | 3300045051 | Bacteria | 2609 |
| 582 | Ga0451576_0227613 | 3300045051 | Bacteria | 1947 |
| 583 | Ga0495580_0001185 | 3300046472 | Bacteria | 22935 |
| 584 | Ga0495580_0003832 | 3300046472 | Bacteria | 12716 |
| 585 | Ga0495594_0047026 | 3300046499 | Bacteria | 2370 |
| 586 | Ga0495631_0013301 | 3300046518 | Bacteria | 3996 |
| 587 | Ga0495632_0096931 | 3300046519 | Bacteria | 1392 |
| 588 | Ga0495637_0008879 | 3300046520 | Bacteria | 4919 |
| 589 | Ga0495643_0058599 | 3300046522 | Bacteria | 2049 |
| 590 | Ga0495642_0007566 | 3300046528 | Bacteria | 4162 |
| 591 | Ga0495654_0005426 | 3300046530 | Bacteria | 7406 |
| 592 | Ga0495598_0028075 | 3300046537 | Bacteria | 1558 |
| 593 | Ga0495598_0035848 | 3300046537 | Bacteria | 1422 |
| 594 | Ga0495668_0059634 | 3300046616 | Bacteria | 2106 |
| 595 | Ga0495625_0001836 | 3300046660 | Bacteria | 24291 |
| 596 | Ga0495659_0051169 | 3300046664 | Bacteria | 1504 |
| 597 | Ga0495588_0037453 | 3300046674 | Bacteria | 2464 |
| 598 | Ga0495647_0065083 | 3300046681 | Bacteria | 1447 |
| 599 | Ga0495636_0040401 | 3300047318 | Bacteria | 1934 |
| 600 | Ga0495593_0008983 | 3300047673 | Bacteria | 5799 |
| 601 | Ga0496104_0027579 | 3300048907 | Bacteria | 5257 |
| 602 | Ga0496106_0080388 | 3300048909 | Bacteria | 2503 |
| 603 | Ga0496106_0235615 | 3300048909 | Bacteria | 1462 |
| 604 | Ga0496107_0013562 | 3300048910 | Bacteria | 5698 |
| 605 | Ga0496107_0120010 | 3300048910 | Bacteria | 1937 |
| 606 | Ga0496107_0259972 | 3300048910 | Bacteria | 1292 |
| 607 | Ga0496108_0015466 | 3300048911 | Bacteria | 6224 |
| 608 | Ga0496108_0054499 | 3300048911 | Bacteria | 3356 |
| 609 | Ga0496108_0525454 | 3300048911 | Bacteria | 1033 |
| 610 | Ga0496109_0079993 | 3300048912 | Bacteria | 3011 |
| 611 | Ga0496110_0044730 | 3300048913 | Bacteria | 3867 |
| 612 | Ga0496110_0182036 | 3300048913 | Unclassified | 1908 |
| 613 | Ga0496111_0157686 | 3300048914 | Bacteria | 1684 |
| 614 | Ga0496112_0005186 | 3300048915 | Bacteria | 11204 |
| 615 | Ga0496112_0006117 | 3300048915 | Bacteria | 10522 |
| 616 | Ga0496112_0066380 | 3300048915 | Bacteria | 3560 |
| 617 | Ga0496113_0048767 | 3300048916 | Bacteria | 3152 |
| 618 | Ga0496114_0051838 | 3300048917 | Bacteria | 3417 |
| 619 | Ga0496114_0166068 | 3300048917 | Bacteria | 1922 |
| 620 | Ga0496115_0009096 | 3300048918 | Bacteria | 7371 |
| 621 | Ga0496116_0125702 | 3300048919 | Bacteria | 1473 |
| 622 | Ga0496118_0140937 | 3300048921 | Bacteria | 1528 |
| 623 | Ga0496119_0036909 | 3300048922 | Bacteria | 3183 |
| 624 | Ga0496121_0036819 | 3300048924 | Bacteria | 4355 |
| 625 | Ga0496122_0023376 | 3300048925 | Bacteria | 5452 |
| 626 | Ga0501031_0025410 | 3300049568 | Bacteria | 3863 |
| 627 | Ga0501033_0109243 | 3300049570 | Bacteria | 2014 |
| 628 | Ga0501036_0003619 | 3300049572 | Bacteria | 12356 |
| 629 | Ga0501036_0216976 | 3300049572 | Unclassified | 1607 |
| 630 | Ga0501036_0301632 | 3300049572 | Bacteria | 1340 |
| 631 | Ga0501038_0137443 | 3300049574 | Bacteria | 2001 |
| 632 | Ga0501038_0255124 | 3300049574 | Bacteria | 1388 |
| 633 | Ga0501039_0174748 | 3300049575 | Bacteria | 1689 |
| 634 | Ga0501040_0092053 | 3300049576 | Bacteria | 2108 |
| 635 | Ga0501040_0208558 | 3300049576 | Bacteria | 1389 |
| 636 | Ga0501040_0267172 | 3300049576 | Bacteria | 1221 |
| 637 | Ga0501041_0009461 | 3300049577 | Bacteria | 5745 |
| 638 | Ga0501041_0034253 | 3300049577 | Bacteria | 3074 |
| 639 | Ga0501041_0123727 | 3300049577 | Bacteria | 1609 |
| 640 | Ga0501041_0258169 | 3300049577 | Bacteria | 1096 |
| 641 | Ga0501042_0081432 | 3300049578 | Bacteria | 2320 |
| 642 | Ga0501046_0301024 | 3300049580 | Bacteria | 1171 |
| 643 | Ga0501047_0037341 | 3300049581 | Bacteria | 4697 |
| 644 | Ga0501048_0038735 | 3300049582 | Bacteria | 3421 |
| 645 | Ga0501048_0081644 | 3300049582 | Bacteria | 2280 |
| 646 | Ga0501067_0099215 | 3300049583 | Bacteria | 1617 |
| 647 | Ga0501071_0002922 | 3300049587 | Bacteria | 10551 |
| 648 | Ga0501072_0001954 | 3300049588 | Bacteria | 15357 |
| 649 | Ga0501072_0040001 | 3300049588 | Bacteria | 3681 |
| 650 | Ga0501074_0053896 | 3300049590 | Bacteria | 2901 |
| 651 | Ga0501074_0116830 | 3300049590 | Bacteria | 1908 |
| 652 | Ga0501074_0155644 | 3300049590 | Unclassified | 1633 |
| 653 | Ga0501075_0000177 | 3300049591 | Bacteria | 33160 |
| 654 | Ga0501075_0000904 | 3300049591 | Bacteria | 18763 |
| 655 | Ga0501076_0000014 | 3300049592 | Bacteria | 97509 |
| 656 | Ga0501076_0004543 | 3300049592 | Bacteria | 9887 |
| 657 | Ga0501076_0017060 | 3300049592 | Bacteria | 5514 |
| 658 | Ga0501076_0151372 | 3300049592 | Bacteria | 1887 |
| 659 | Ga0501077_0010205 | 3300049593 | Bacteria | 5848 |
| 660 | Ga0501077_0051774 | 3300049593 | Bacteria | 2608 |
| 661 | Ga0501079_0027802 | 3300049741 | Bacteria | 4338 |
| 662 | Ga0501079_0038707 | 3300049741 | Bacteria | 3677 |
| 663 | Ga0501080_0191030 | 3300049742 | Bacteria | 1882 |
| 664 | Ga0501080_0208510 | 3300049742 | Bacteria | 1792 |
| 665 | Ga0501080_0349187 | 3300049742 | Bacteria | 1336 |
| 666 | Ga0501081_0015410 | 3300049743 | Bacteria | 5044 |
| 667 | Ga0501081_0016576 | 3300049743 | Bacteria | 4872 |
| 668 | Ga0501081_0062219 | 3300049743 | Bacteria | 2589 |
| 669 | Ga0501081_0129624 | 3300049743 | Bacteria | 1801 |
| 670 | Ga0501081_0228566 | 3300049743 | Bacteria | 1354 |
| 671 | Ga0501035_0327258 | 3300049822 | Bacteria | 1286 |
| 672 | Ga0501044_0087640 | 3300049823 | Bacteria | 3144 |
| 673 | Ga0501044_0140565 | 3300049823 | Bacteria | 2403 |
| 674 | Ga0501045_0028539 | 3300049824 | Bacteria | 4026 |
| 675 | Ga0501045_0135468 | 3300049824 | Bacteria | 1831 |
| 676 | Ga0501045_0153852 | 3300049824 | Bacteria | 1711 |
| 677 | nmdc:mga03683_17897_c1 | 3300050489 | Bacteria | 2687 |
| 678 | nmdc:mga03683_8366_c1 | 3300050489 | Bacteria | 3636 |
| 679 | nmdc:mga0yw44_21348_c1 | 3300050492 | Bacteria | 3610 |
| 680 | nmdc:mga0k408_11190_c2 | 3300050493 | Bacteria | 3645 |
| 681 | nmdc:mga0k408_25209_c1 | 3300050493 | Bacteria | 3367 |
| 682 | nmdc:mga0k408_78623_c1 | 3300050493 | Bacteria | 1930 |
| 683 | nmdc:mga0k408_96360_c1 | 3300050493 | Bacteria | 1742 |
| 684 | nmdc:mga05p37_105529_c1 | 3300050507 | Bacteria | 3466 |
| 685 | nmdc:mga05p37_106287_c1 | 3300050507 | Bacteria | 3453 |
| 686 | nmdc:mga05p37_120390_c1 | 3300050507 | Bacteria | 3225 |
| 687 | nmdc:mga05p37_172699_c1 | 3300050507 | Unclassified | 2635 |
| 688 | nmdc:mga05p37_17921_c1 | 3300050507 | Bacteria | 8549 |
| 689 | nmdc:mga05p37_200155_c1 | 3300050507 | Bacteria | 2420 |
| 690 | nmdc:mga05p37_22024_c1 | 3300050507 | Bacteria | 7722 |
| 691 | nmdc:mga05p37_223804_c1 | 3300050507 | Bacteria | 2270 |
| 692 | nmdc:mga05p37_241691_c1 | 3300050507 | Bacteria | 2171 |
| 693 | nmdc:mga05p37_323142_c1 | 3300050507 | Bacteria | 1826 |
| 694 | nmdc:mga05p37_34529_c1 | 3300050507 | Bacteria | 6195 |
| 695 | nmdc:mga05p37_41200_c1 | 3300050507 | Bacteria | 5671 |
| 696 | nmdc:mga05p37_6225_c1 | 3300050507 | Bacteria | 14050 |
| 697 | nmdc:mga05p37_64231_c1 | 3300050507 | Bacteria | 4517 |
| 698 | nmdc:mga05p37_733_c1 | 3300050507 | Bacteria | 36361 |
| 699 | nmdc:mga05p37_73969_c1 | 3300050507 | Bacteria | 4194 |
| 700 | nmdc:mga05p37_74584_c1 | 3300050507 | Bacteria | 4176 |
| 701 | nmdc:mga05p37_787268_c1 | 3300050507 | Bacteria | 1043 |
| 702 | nmdc:mga05p37_87726_c1 | 3300050507 | Bacteria | 3835 |
| 703 | nmdc:mga09592_1059_c1 | 3300050508 | Bacteria | 21817 |
| 704 | nmdc:mga09592_141560_c1 | 3300050508 | Bacteria | 2074 |
| 705 | nmdc:mga09592_1584_c1 | 3300050508 | Bacteria | 18322 |
| 706 | nmdc:mga09592_22145_c1 | 3300050508 | Bacteria | 5243 |
| 707 | nmdc:mga09592_22786_c2 | 3300050508 | Bacteria | 4280 |
| 708 | nmdc:mga09592_43032_c1 | 3300050508 | Bacteria | 3800 |
| 709 | nmdc:mga09592_4960_c1 | 3300050508 | Bacteria | 10785 |
| 710 | nmdc:mga09592_53547_c1 | 3300050508 | Bacteria | 3408 |
| 711 | nmdc:mga09592_56420_c1 | 3300050508 | Bacteria | 3319 |
| 712 | nmdc:mga09592_56_c1 | 3300050508 | Bacteria | 62143 |
| 713 | nmdc:mga09592_72346_c1 | 3300050508 | Bacteria | 2927 |
| 714 | nmdc:mga0qj67_13933_c1 | 3300050509 | Bacteria | 6070 |
| 715 | nmdc:mga0qj67_16942_c1 | 3300050509 | Bacteria | 5535 |
| 716 | nmdc:mga0qj67_255374_c1 | 3300050509 | Bacteria | 1422 |
| 717 | nmdc:mga0qj67_267612_c1 | 3300050509 | Bacteria | 1386 |
| 718 | nmdc:mga0qj67_32441_c1 | 3300050509 | Bacteria | 4073 |
| 719 | nmdc:mga0qj67_371969_c1 | 3300050509 | Bacteria | 1154 |
| 720 | nmdc:mga0qj67_4943_c1 | 3300050509 | Bacteria | 9687 |
| 721 | nmdc:mga0qj67_6405_c1 | 3300050509 | Bacteria | 8650 |
| 722 | nmdc:mga0qj67_67830_c1 | 3300050509 | Bacteria | 2842 |
| 723 | nmdc:mga0qj67_84501_c1 | 3300050509 | Bacteria | 2545 |
| 724 | nmdc:mga06r32_114123_c1 | 3300050510 | Bacteria | 2659 |
| 725 | nmdc:mga06r32_11821_c1 | 3300050510 | Bacteria | 7860 |
| 726 | nmdc:mga06r32_132_c1 | 3300050510 | Bacteria | 54848 |
| 727 | nmdc:mga06r32_133201_c1 | 3300050510 | Bacteria | 2459 |
| 728 | nmdc:mga06r32_159281_c1 | 3300050510 | Bacteria | 2239 |
| 729 | nmdc:mga06r32_16486_c1 | 3300050510 | Bacteria | 6734 |
| 730 | nmdc:mga06r32_229563_c1 | 3300050510 | Bacteria | 1844 |
| 731 | nmdc:mga06r32_244086_c1 | 3300050510 | Bacteria | 1783 |
| 732 | nmdc:mga06r32_253514_c1 | 3300050510 | Bacteria | 1747 |
| 733 | nmdc:mga06r32_301016_c1 | 3300050510 | Bacteria | 1590 |
| 734 | nmdc:mga06r32_3570_c1 | 3300050510 | Bacteria | 13887 |
| 735 | nmdc:mga06r32_404229_c1 | 3300050510 | Bacteria | 1348 |
| 736 | nmdc:mga06r32_428_c1 | 3300050510 | Bacteria | 35405 |
| 737 | nmdc:mga06r32_52039_c2 | 3300050510 | Bacteria | 2902 |
| 738 | nmdc:mga06r32_555104_c1 | 3300050510 | Bacteria | 1122 |
| 739 | nmdc:mga06r32_5613_c1 | 3300050510 | Bacteria | 11286 |
| 740 | nmdc:mga06r32_8830_c2 | 3300050510 | Bacteria | 3707 |
| 741 | nmdc:mga08y16_113813_c1 | 3300050511 | Bacteria | 2817 |
| 742 | nmdc:mga08y16_131896_c1 | 3300050511 | Bacteria | 2598 |
| 743 | nmdc:mga08y16_254649_c1 | 3300050511 | Bacteria | 1814 |
| 744 | nmdc:mga08y16_29845_c1 | 3300050511 | Bacteria | 5743 |
| 745 | nmdc:mga08y16_319173_c1 | 3300050511 | Bacteria | 1599 |
| 746 | nmdc:mga08y16_5274_c1 | 3300050511 | Bacteria | 13510 |
| 747 | nmdc:mga08y16_800_c1 | 3300050511 | Bacteria | 30094 |
| 748 | nmdc:mga0n895_11851_c1 | 3300050512 | Bacteria | 7797 |
| 749 | nmdc:mga0n895_146568_c1 | 3300050512 | Bacteria | 2390 |
| 750 | nmdc:mga0n895_147472_c1 | 3300050512 | Bacteria | 2383 |
| 751 | nmdc:mga0n895_180354_c1 | 3300050512 | Bacteria | 2143 |
| 752 | nmdc:mga0n895_22204_c1 | 3300050512 | Bacteria | 5949 |
| 753 | nmdc:mga0n895_26_c1 | 3300050512 | Bacteria | 89958 |
| 754 | nmdc:mga0n895_34169_c1 | 3300050512 | Bacteria | 4893 |
| 755 | nmdc:mga0n895_34414_c1 | 3300050512 | Bacteria | 4876 |
| 756 | nmdc:mga0n895_36264_c1 | 3300050512 | Bacteria | 4762 |
| 757 | nmdc:mga0n895_41376_c1 | 3300050512 | Bacteria | 4480 |
| 758 | nmdc:mga0n895_508716_c1 | 3300050512 | Bacteria | 1213 |
| 759 | nmdc:mga0n895_57551_c1 | 3300050512 | Bacteria | 3832 |
| 760 | nmdc:mga0n895_63207_c1 | 3300050512 | Bacteria | 3660 |
| 761 | nmdc:mga0n895_64237_c1 | 3300050512 | Bacteria | 3631 |
| 762 | nmdc:mga0n895_65148_c1 | 3300050512 | Bacteria | 3606 |
| 763 | nmdc:mga0n895_776_c1 | 3300050512 | Bacteria | 22697 |
| 764 | nmdc:mga0n895_86333_c1 | 3300050512 | Bacteria | 3134 |
| 765 | nmdc:mga0n895_90174_c1 | 3300050512 | Bacteria | 3067 |
| 766 | nmdc:mga0rr50_108642_c1 | 3300050513 | Bacteria | 2192 |
| 767 | nmdc:mga0rr50_112804_c1 | 3300050513 | Bacteria | 2154 |
| 768 | nmdc:mga0rr50_1138_c1 | 3300050513 | Bacteria | 14452 |
| 769 | nmdc:mga0rr50_143674_c1 | 3300050513 | Bacteria | 1922 |
| 770 | nmdc:mga0rr50_179_c1 | 3300050513 | Bacteria | 34229 |
| 771 | nmdc:mga0rr50_183295_c1 | 3300050513 | Bacteria | 1712 |
| 772 | nmdc:mga0rr50_193788_c1 | 3300050513 | Unclassified | 1667 |
| 773 | nmdc:mga0rr50_19697_c1 | 3300050513 | Bacteria | 4561 |
| 774 | nmdc:mga0rr50_20128_c1 | 3300050513 | Bacteria | 4522 |
| 775 | nmdc:mga0rr50_232183_c1 | 3300050513 | Bacteria | 1527 |
| 776 | nmdc:mga0rr50_6589_c1 | 3300050513 | Bacteria | 7093 |
| 777 | nmdc:mga0rr50_81363_c1 | 3300050513 | Bacteria | 2499 |
| 778 | nmdc:mga0rr50_85562_c1 | 3300050513 | Bacteria | 2444 |
| 779 | nmdc:mga0rr50_93483_c1 | 3300050513 | Bacteria | 2346 |
| 780 | nmdc:mga08x19_17815_c1 | 3300050514 | Bacteria | 4348 |
| 781 | nmdc:mga08x19_288166_c1 | 3300050514 | Bacteria | 1139 |
| 782 | nmdc:mga08x19_35045_c1 | 3300050514 | Bacteria | 3174 |
| 783 | nmdc:mga08x19_828_c1 | 3300050514 | Bacteria | 19629 |
| 784 | nmdc:mga0a205_111152_c1 | 3300050515 | Bacteria | 2639 |
| 785 | nmdc:mga0a205_11848_c2 | 3300050515 | Bacteria | 4810 |
| 786 | nmdc:mga0a205_12048_c1 | 3300050515 | Bacteria | 7988 |
| 787 | nmdc:mga0a205_134313_c1 | 3300050515 | Bacteria | 2375 |
| 788 | nmdc:mga0a205_177404_c1 | 3300050515 | Bacteria | 2026 |
| 789 | nmdc:mga0a205_236862_c1 | 3300050515 | Unclassified | 1707 |
| 790 | nmdc:mga0a205_270298_c1 | 3300050515 | Bacteria | 1577 |
| 791 | nmdc:mga0a205_28565_c1 | 3300050515 | Bacteria | 5334 |
| 792 | nmdc:mga0a205_322849_c1 | 3300050515 | Bacteria | 1415 |
| 793 | nmdc:mga0a205_329_c1 | 3300050515 | Bacteria | 35516 |
| 794 | nmdc:mga0a205_39073_c1 | 3300050515 | Bacteria | 4567 |
| 795 | nmdc:mga0a205_408277_c1 | 3300050515 | Bacteria | 1221 |
| 796 | nmdc:mga0a205_44053_c1 | 3300050515 | Bacteria | 4301 |
| 797 | nmdc:mga0a205_55298_c1 | 3300050515 | Bacteria | 3834 |
| 798 | nmdc:mga0a205_6839_c1 | 3300050515 | Bacteria | 10315 |
| 799 | nmdc:mga0a205_69619_c1 | 3300050515 | Bacteria | 3397 |
| 800 | nmdc:mga0a205_75990_c1 | 3300050515 | Bacteria | 2690 |
| 801 | nmdc:mga0a205_7857_c1 | 3300050515 | Bacteria | 9690 |
| 802 | nmdc:mga0a205_881_c1 | 3300050515 | Bacteria | 10774 |
| 803 | nmdc:mga0a205_9861_c1 | 3300050515 | Bacteria | 8762 |
| 804 | Ga0500643_002513 | 3300053087 | Bacteria | 9398 |
| 805 | Ga0500651_0000082 | 3300053093 | Bacteria | 60329 |
| 806 | Ga0500651_0252935 | 3300053093 | Bacteria | 1024 |
| 807 | Ga0500571_000152 | 3300053110 | Bacteria | 23934 |
| 808 | Ga0500594_0002211 | 3300053118 | Bacteria | 4212 |
| 809 | Ga0500607_000049 | 3300053121 | Bacteria | 80941 |
| 810 | Ga0500655_000842 | 3300053133 | Bacteria | 5987 |
| 811 | Ga0500658_0000038 | 3300053134 | Bacteria | 84273 |
| 812 | Ga0500658_0002744 | 3300053134 | Bacteria | 6774 |
| 813 | Ga0500564_004157 | 3300053138 | Bacteria | 5755 |
| 814 | Ga0500568_0000338 | 3300053139 | Bacteria | 36755 |
| 815 | Ga0500574_000501 | 3300053141 | Bacteria | 5001 |
| 816 | Ga0500638_005113 | 3300053162 | Bacteria | 5174 |
| 817 | Ga0500636_0060514 | 3300053177 | Bacteria | 2211 |
| 818 | Ga0501084_0003441 | 3300054114 | Bacteria | 12849 |
| 819 | Ga0501084_0005902 | 3300054114 | Bacteria | 10083 |
| 820 | Ga0501084_0015490 | 3300054114 | Bacteria | 6323 |
| 821 | Ga0501084_0016610 | 3300054114 | Bacteria | 6112 |
| 822 | Ga0530510_0000045 | 3300061734 | Bacteria | 56772 |
| 823 | Ga0530510_0001424 | 3300061734 | Bacteria | 16019 |
| 824 | Ga0530510_0002079 | 3300061734 | Bacteria | 13746 |
| 825 | Ga0530510_0043525 | 3300061734 | Bacteria | 3243 |
| 826 | Ga0530510_0145371 | 3300061734 | Bacteria | 1749 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049575 | Ga0501039_0174748 | Ga0501039_0174748_840_1676 | 278 |
| 2 | 3300049572 | Ga0501036_0301632 | Ga0501036_0301632_437_1276 | 279 |
| 3 | 3300044673 | Ga0453683_0193446 | Ga0453683_0193446_84_944 | 282 |
| 4 | 3300007265 | Ga0099794_10024348 | Ga0099794_100243483 | 297 |
| 5 | 3300014326 | Ga0157380_10275232 | Ga0157380_102752322 | 300 |
| 6 | 3300050510 | nmdc:mga06r32_244086_c1 | nmdc:mga06r32_244086_c1_544_1452 | 300 |
| 7 | 3300053093 | Ga0500651_0252935 | Ga0500651_0252935_13_948 | 300 |
| 8 | 3300048911 | Ga0496108_0525454 | Ga0496108_0525454_49_987 | 301 |
| 9 | 3300003781 | Ga0055536_1001542 | Ga0055536_100154216 | 305 |
| 10 | 3300003794 | Ga0055531_10001303 | Ga0055531_1000130317 | 305 |
| 11 | 3300005457 | Ga0070662_100045273 | Ga0070662_1000452734 | 305 |
| 12 | 3300005467 | Ga0070706_100001589 | Ga0070706_10000158917 | 305 |
| 13 | 3300005578 | Ga0068854_100113215 | Ga0068854_1001132152 | 305 |
| 14 | 3300006195 | Ga0075366_10046644 | Ga0075366_100466441 | 305 |
| 15 | 3300006353 | Ga0075370_10035473 | Ga0075370_100354732 | 305 |
| 16 | 3300009036 | Ga0105244_10025409 | Ga0105244_100254093 | 305 |
| 17 | 3300009148 | Ga0105243_10117532 | Ga0105243_101175322 | 305 |
| 18 | 3300025292 | Ga0209676_1001621 | Ga0209676_100162118 | 305 |
| 19 | 3300025298 | Ga0209050_1000511 | Ga0209050_100051128 | 305 |
| 20 | 3300025303 | Ga0209051_1000326 | Ga0209051_100032637 | 305 |
| 21 | 3300025304 | Ga0209257_1000249 | Ga0209257_100024932 | 305 |
| 22 | 3300025910 | Ga0207684_10006317 | Ga0207684_100063173 | 305 |
| 23 | 3300025922 | Ga0207646_10045699 | Ga0207646_100456992 | 305 |
| 24 | 3300025935 | Ga0207709_10081359 | Ga0207709_100813593 | 305 |
| 25 | 3300045051 | Ga0451576_0131422 | Ga0451576_0131422_1654_2574 | 305 |
| 26 | 3300048919 | Ga0496116_0125702 | Ga0496116_0125702_309_1328 | 305 |
| 27 | 3300048921 | Ga0496118_0140937 | Ga0496118_0140937_160_1179 | 305 |
| 28 | 3300015262 | Ga0182007_10001904 | Ga0182007_100019046 | 306 |
| 29 | 3300037068 | Ga0373925_0252341 | Ga0373925_0252341_39_995 | 306 |
| 30 | 3300005341 | Ga0070691_10009588 | Ga0070691_100095884 | 307 |
| 31 | 3300005563 | Ga0068855_100019538 | Ga0068855_1000195383 | 307 |
| 32 | 3300025913 | Ga0207695_10017451 | Ga0207695_100174517 | 307 |
| 33 | 3300025921 | Ga0207652_10008523 | Ga0207652_100085235 | 307 |
| 34 | 3300025949 | Ga0207667_10058694 | Ga0207667_100586943 | 307 |
| 35 | 3300005327 | Ga0070658_10022218 | Ga0070658_100222183 | 308 |
| 36 | 3300005336 | Ga0070680_100011700 | Ga0070680_1000117004 | 308 |
| 37 | 3300005458 | Ga0070681_10012674 | Ga0070681_100126746 | 308 |
| 38 | 3300005564 | Ga0070664_100010652 | Ga0070664_1000106527 | 308 |
| 39 | 3300006847 | Ga0075431_100182374 | Ga0075431_1001823742 | 308 |
| 40 | 3300009098 | Ga0105245_10399728 | Ga0105245_103997282 | 308 |
| 41 | 3300013308 | Ga0157375_10163231 | Ga0157375_101632312 | 308 |
| 42 | 3300025728 | Ga0207655_1003575 | Ga0207655_100357511 | 308 |
| 43 | 3300025912 | Ga0207707_10006041 | Ga0207707_100060414 | 308 |
| 44 | 3300025933 | Ga0207706_10010908 | Ga0207706_100109089 | 308 |
| 45 | 3300046537 | Ga0495598_0028075 | Ga0495598_0028075_156_1157 | 308 |
| 46 | 3300048924 | Ga0496121_0036819 | Ga0496121_0036819_1774_2793 | 308 |
| 47 | 3300050510 | nmdc:mga06r32_159281_c1 | nmdc:mga06r32_159281_c1_824_1897 | 308 |
| 48 | 3300050510 | nmdc:mga06r32_555104_c1 | nmdc:mga06r32_555104_c1_125_1063 | 308 |
| 49 | 3300009094 | Ga0111539_10226547 | Ga0111539_102265472 | 309 |
| 50 | 3300009147 | Ga0114129_10431285 | Ga0114129_104312852 | 309 |
| 51 | 3300049583 | Ga0501067_0099215 | Ga0501067_0099215_86_1021 | 309 |
| 52 | 3300006852 | Ga0075433_10059887 | Ga0075433_100598873 | 310 |
| 53 | 3300006871 | Ga0075434_100083481 | Ga0075434_1000834813 | 310 |
| 54 | 3300006880 | Ga0075429_100041711 | Ga0075429_1000417115 | 310 |
| 55 | 3300006914 | Ga0075436_100001438 | Ga0075436_1000014387 | 310 |
| 56 | 3300050508 | nmdc:mga09592_43032_c1 | nmdc:mga09592_43032_c1_1147_2094 | 310 |
| 57 | 3300050509 | nmdc:mga0qj67_67830_c1 | nmdc:mga0qj67_67830_c1_224_1171 | 310 |
| 58 | 3300050510 | nmdc:mga06r32_114123_c1 | nmdc:mga06r32_114123_c1_769_1722 | 310 |
| 59 | 3300050510 | nmdc:mga06r32_132_c1 | nmdc:mga06r32_132_c1_41153_42100 | 310 |
| 60 | 3300009148 | Ga0105243_10009794 | Ga0105243_100097943 | 311 |
| 61 | 3300009176 | Ga0105242_10003647 | Ga0105242_100036478 | 311 |
| 62 | 3300032005 | Ga0307411_10127295 | Ga0307411_101272951 | 311 |
| 63 | 3300035691 | Ga0373931_0002271 | Ga0373931_0002271_2930_3886 | 311 |
| 64 | 3300042876 | Ga0451577_0088126 | Ga0451577_0088126_962_1918 | 311 |
| 65 | 3300048909 | Ga0496106_0235615 | Ga0496106_0235615_98_1054 | 311 |
| 66 | 3300048916 | Ga0496113_0048767 | Ga0496113_0048767_16_996 | 311 |
| 67 | 3300009101 | Ga0105247_10100466 | Ga0105247_101004661 | 312 |
| 68 | 3300037418 | Ga0395900_0022197 | Ga0395900_0022197_929_1882 | 312 |
| 69 | 3300038443 | Ga0395901_0051038 | Ga0395901_0051038_2703_3656 | 312 |
| 70 | 3300050509 | nmdc:mga0qj67_371969_c1 | nmdc:mga0qj67_371969_c1_112_1071 | 312 |
| 71 | 3300005981 | Ga0081538_10002834 | Ga0081538_100028349 | 313 |
| 72 | 3300050510 | nmdc:mga06r32_428_c1 | nmdc:mga06r32_428_c1_31701_32687 | 313 |
| 73 | 3300009553 | Ga0105249_10430811 | Ga0105249_104308111 | 314 |
| 74 | 3300013297 | Ga0157378_10039990 | Ga0157378_100399903 | 314 |
| 75 | 3300013306 | Ga0163162_10156757 | Ga0163162_101567573 | 314 |
| 76 | 3300025899 | Ga0207642_10031608 | Ga0207642_100316081 | 314 |
| 77 | 3300028794 | Ga0307515_10006221 | Ga0307515_1000622117 | 314 |
| 78 | 3300031507 | Ga0307509_10008236 | Ga0307509_100082368 | 314 |
| 79 | 3300035113 | Ga0373936_0029320 | Ga0373936_0029320_865_1809 | 314 |
| 80 | 3300045051 | Ga0451576_0227613 | Ga0451576_0227613_320_1312 | 314 |
| 81 | 3300048917 | Ga0496114_0166068 | Ga0496114_0166068_705_1694 | 314 |
| 82 | 3300050515 | nmdc:mga0a205_408277_c1 | nmdc:mga0a205_408277_c1_224_1168 | 314 |
| 83 | 3300053087 | Ga0500643_002513 | Ga0500643_002513_3135_4238 | 314 |
| 84 | 3300053134 | Ga0500658_0002744 | Ga0500658_0002744_2372_3475 | 314 |
| 85 | 3300045051 | Ga0451576_0077314 | Ga0451576_0077314_85_1083 | 315 |
| 86 | 3300046520 | Ga0495637_0008879 | Ga0495637_0008879_1856_2884 | 315 |
| 87 | 3300049822 | Ga0501035_0327258 | Ga0501035_0327258_144_1133 | 315 |
| 88 | 3300049823 | Ga0501044_0140565 | Ga0501044_0140565_1275_2264 | 315 |
| 89 | 3300050507 | nmdc:mga05p37_6225_c1 | nmdc:mga05p37_6225_c1_6416_7384 | 315 |
| 90 | 3300050508 | nmdc:mga09592_72346_c1 | nmdc:mga09592_72346_c1_664_1632 | 315 |
| 91 | 3300050509 | nmdc:mga0qj67_4943_c1 | nmdc:mga0qj67_4943_c1_664_1632 | 315 |
| 92 | 3300050510 | nmdc:mga06r32_3570_c1 | nmdc:mga06r32_3570_c1_8270_9238 | 315 |
| 93 | 3300050512 | nmdc:mga0n895_26_c1 | nmdc:mga0n895_26_c1_28438_29400 | 315 |
| 94 | 3300050513 | nmdc:mga0rr50_179_c1 | nmdc:mga0rr50_179_c1_17323_18285 | 315 |
| 95 | 3300050514 | nmdc:mga08x19_828_c1 | nmdc:mga08x19_828_c1_1604_2566 | 315 |
| 96 | 3300050515 | nmdc:mga0a205_329_c1 | nmdc:mga0a205_329_c1_1731_2693 | 315 |
| 97 | 3300053121 | Ga0500607_000049 | Ga0500607_000049_58407_59435 | 315 |
| 98 | 3300005293 | Ga0065715_10282678 | Ga0065715_102826781 | 316 |
| 99 | 3300005842 | Ga0068858_100108403 | Ga0068858_1001084032 | 316 |
| 100 | 3300013306 | Ga0163162_10221658 | Ga0163162_102216582 | 316 |
| 101 | 3300026095 | Ga0207676_10095071 | Ga0207676_100950712 | 316 |
| 102 | 3300027395 | Ga0209996_1006774 | Ga0209996_10067741 | 316 |
| 103 | 3300027543 | Ga0209999_1021436 | Ga0209999_10214362 | 316 |
| 104 | 3300049568 | Ga0501031_0025410 | Ga0501031_0025410_111_1079 | 316 |
| 105 | 3300049582 | Ga0501048_0081644 | Ga0501048_0081644_628_1596 | 316 |
| 106 | 3300049591 | Ga0501075_0000904 | Ga0501075_0000904_1413_2381 | 316 |
| 107 | 3300049592 | Ga0501076_0004543 | Ga0501076_0004543_8078_9046 | 316 |
| 108 | 3300049742 | Ga0501080_0208510 | Ga0501080_0208510_163_1131 | 316 |
| 109 | 3300049824 | Ga0501045_0028539 | Ga0501045_0028539_1527_2495 | 316 |
| 110 | 3300061734 | Ga0530510_0001424 | Ga0530510_0001424_8209_9177 | 316 |
| 111 | 3300005334 | Ga0068869_100000966 | Ga0068869_1000009663 | 317 |
| 112 | 3300005344 | Ga0070661_100051437 | Ga0070661_1000514372 | 317 |
| 113 | 3300005353 | Ga0070669_100030851 | Ga0070669_1000308513 | 317 |
| 114 | 3300005354 | Ga0070675_100008041 | Ga0070675_1000080416 | 317 |
| 115 | 3300005455 | Ga0070663_100037907 | Ga0070663_1000379072 | 317 |
| 116 | 3300005456 | Ga0070678_100184015 | Ga0070678_1001840152 | 317 |
| 117 | 3300005456 | Ga0070678_100286465 | Ga0070678_1002864652 | 317 |
| 118 | 3300005457 | Ga0070662_100014260 | Ga0070662_1000142603 | 317 |
| 119 | 3300005467 | Ga0070706_100032033 | Ga0070706_1000320334 | 317 |
| 120 | 3300005468 | Ga0070707_100001404 | Ga0070707_1000014043 | 317 |
| 121 | 3300005471 | Ga0070698_100009924 | Ga0070698_1000099244 | 317 |
| 122 | 3300005518 | Ga0070699_100018229 | Ga0070699_1000182295 | 317 |
| 123 | 3300005535 | Ga0070684_100052918 | Ga0070684_1000529182 | 317 |
| 124 | 3300005536 | Ga0070697_100021883 | Ga0070697_1000218834 | 317 |
| 125 | 3300005543 | Ga0070672_100007704 | Ga0070672_1000077046 | 317 |
| 126 | 3300005563 | Ga0068855_100010300 | Ga0068855_1000103003 | 317 |
| 127 | 3300005578 | Ga0068854_100017084 | Ga0068854_1000170843 | 317 |
| 128 | 3300005614 | Ga0068856_100085833 | Ga0068856_1000858333 | 317 |
| 129 | 3300005615 | Ga0070702_100114693 | Ga0070702_1001146932 | 317 |
| 130 | 3300005616 | Ga0068852_100084133 | Ga0068852_1000841333 | 317 |
| 131 | 3300005719 | Ga0068861_100000575 | Ga0068861_1000005757 | 317 |
| 132 | 3300005841 | Ga0068863_100076781 | Ga0068863_1000767812 | 317 |
| 133 | 3300005842 | Ga0068858_100035532 | Ga0068858_1000355323 | 317 |
| 134 | 3300005842 | Ga0068858_100200318 | Ga0068858_1002003182 | 317 |
| 135 | 3300005843 | Ga0068860_100058908 | Ga0068860_1000589082 | 317 |
| 136 | 3300005985 | Ga0081539_10000092 | Ga0081539_10000092152 | 317 |
| 137 | 3300005985 | Ga0081539_10017494 | Ga0081539_100174943 | 317 |
| 138 | 3300006237 | Ga0097621_100095756 | Ga0097621_1000957561 | 317 |
| 139 | 3300006844 | Ga0075428_100012043 | Ga0075428_1000120432 | 317 |
| 140 | 3300006844 | Ga0075428_100029862 | Ga0075428_1000298623 | 317 |
| 141 | 3300006846 | Ga0075430_100021586 | Ga0075430_1000215863 | 317 |
| 142 | 3300006847 | Ga0075431_100004273 | Ga0075431_10000427314 | 317 |
| 143 | 3300006847 | Ga0075431_100091558 | Ga0075431_1000915583 | 317 |
| 144 | 3300006852 | Ga0075433_10138804 | Ga0075433_101388042 | 317 |
| 145 | 3300006871 | Ga0075434_100214923 | Ga0075434_1002149231 | 317 |
| 146 | 3300006880 | Ga0075429_100010953 | Ga0075429_1000109536 | 317 |
| 147 | 3300009098 | Ga0105245_10101720 | Ga0105245_101017202 | 317 |
| 148 | 3300009147 | Ga0114129_10022405 | Ga0114129_100224055 | 317 |
| 149 | 3300009147 | Ga0114129_10083235 | Ga0114129_100832353 | 317 |
| 150 | 3300009147 | Ga0114129_10259863 | Ga0114129_102598632 | 317 |
| 151 | 3300009174 | Ga0105241_10403397 | Ga0105241_104033971 | 317 |
| 152 | 3300009177 | Ga0105248_10132458 | Ga0105248_101324582 | 317 |
| 153 | 3300009545 | Ga0105237_10203201 | Ga0105237_102032012 | 317 |
| 154 | 3300009551 | Ga0105238_10263627 | Ga0105238_102636271 | 317 |
| 155 | 3300010375 | Ga0105239_10183357 | Ga0105239_101833572 | 317 |
| 156 | 3300013102 | Ga0157371_10066298 | Ga0157371_100662983 | 317 |
| 157 | 3300013296 | Ga0157374_10056675 | Ga0157374_100566752 | 317 |
| 158 | 3300013306 | Ga0163162_10070558 | Ga0163162_100705583 | 317 |
| 159 | 3300013307 | Ga0157372_10021948 | Ga0157372_100219485 | 317 |
| 160 | 3300013308 | Ga0157375_10208326 | Ga0157375_102083262 | 317 |
| 161 | 3300014326 | Ga0157380_10012144 | Ga0157380_100121446 | 317 |
| 162 | 3300014745 | Ga0157377_10053709 | Ga0157377_100537091 | 317 |
| 163 | 3300014968 | Ga0157379_10048037 | Ga0157379_100480372 | 317 |
| 164 | 3300014968 | Ga0157379_10072723 | Ga0157379_100727233 | 317 |
| 165 | 3300014969 | Ga0157376_10004342 | Ga0157376_100043427 | 317 |
| 166 | 3300017792 | Ga0163161_10049693 | Ga0163161_100496933 | 317 |
| 167 | 3300025901 | Ga0207688_10015621 | Ga0207688_100156214 | 317 |
| 168 | 3300025903 | Ga0207680_10263563 | Ga0207680_102635631 | 317 |
| 169 | 3300025907 | Ga0207645_10105918 | Ga0207645_101059182 | 317 |
| 170 | 3300025910 | Ga0207684_10000242 | Ga0207684_1000024254 | 317 |
| 171 | 3300025920 | Ga0207649_10170219 | Ga0207649_101702191 | 317 |
| 172 | 3300025922 | Ga0207646_10000574 | Ga0207646_100005749 | 317 |
| 173 | 3300025923 | Ga0207681_10102521 | Ga0207681_101025212 | 317 |
| 174 | 3300025926 | Ga0207659_10001714 | Ga0207659_1000171412 | 317 |
| 175 | 3300025927 | Ga0207687_10133153 | Ga0207687_101331532 | 317 |
| 176 | 3300025932 | Ga0207690_10038315 | Ga0207690_100383152 | 317 |
| 177 | 3300025933 | Ga0207706_10071674 | Ga0207706_100716742 | 317 |
| 178 | 3300025940 | Ga0207691_10016579 | Ga0207691_100165796 | 317 |
| 179 | 3300025941 | Ga0207711_10025878 | Ga0207711_100258782 | 317 |
| 180 | 3300025942 | Ga0207689_10000578 | Ga0207689_100005782 | 317 |
| 181 | 3300025949 | Ga0207667_10039202 | Ga0207667_100392023 | 317 |
| 182 | 3300025981 | Ga0207640_10073024 | Ga0207640_100730242 | 317 |
| 183 | 3300026023 | Ga0207677_10008037 | Ga0207677_100080373 | 317 |
| 184 | 3300026035 | Ga0207703_10076591 | Ga0207703_100765912 | 317 |
| 185 | 3300026035 | Ga0207703_10122412 | Ga0207703_101224122 | 317 |
| 186 | 3300026041 | Ga0207639_10057989 | Ga0207639_100579892 | 317 |
| 187 | 3300026078 | Ga0207702_10114699 | Ga0207702_101146993 | 317 |
| 188 | 3300026095 | Ga0207676_10017649 | Ga0207676_100176492 | 317 |
| 189 | 3300026116 | Ga0207674_10024823 | Ga0207674_100248236 | 317 |
| 190 | 3300026118 | Ga0207675_100050157 | Ga0207675_1000501573 | 317 |
| 191 | 3300026121 | Ga0207683_10129945 | Ga0207683_101299453 | 317 |
| 192 | 3300026142 | Ga0207698_10046728 | Ga0207698_100467282 | 317 |
| 193 | 3300027671 | Ga0209588_1020355 | Ga0209588_10203553 | 317 |
| 194 | 3300028381 | Ga0268264_10009846 | Ga0268264_100098463 | 317 |
| 195 | 3300031548 | Ga0307408_100055346 | Ga0307408_1000553463 | 317 |
| 196 | 3300031901 | Ga0307406_10072021 | Ga0307406_100720212 | 317 |
| 197 | 3300035242 | Ga0373962_0047054 | Ga0373962_0047054_77_1096 | 317 |
| 198 | 3300037471 | Ga0395905_0066540 | Ga0395905_0066540_2213_3214 | 317 |
| 199 | 3300044673 | Ga0453683_0036542 | Ga0453683_0036542_571_1563 | 317 |
| 200 | 3300045051 | Ga0451576_0078540 | Ga0451576_0078540_711_1703 | 317 |
| 201 | 3300046528 | Ga0495642_0007566 | Ga0495642_0007566_2858_3874 | 317 |
| 202 | 3300048909 | Ga0496106_0080388 | Ga0496106_0080388_701_1720 | 317 |
| 203 | 3300048910 | Ga0496107_0013562 | Ga0496107_0013562_1789_2808 | 317 |
| 204 | 3300048912 | Ga0496109_0079993 | Ga0496109_0079993_1044_2063 | 317 |
| 205 | 3300048913 | Ga0496110_0044730 | Ga0496110_0044730_1288_2307 | 317 |
| 206 | 3300048914 | Ga0496111_0157686 | Ga0496111_0157686_610_1629 | 317 |
| 207 | 3300048915 | Ga0496112_0066380 | Ga0496112_0066380_2363_3382 | 317 |
| 208 | 3300048917 | Ga0496114_0051838 | Ga0496114_0051838_1186_2205 | 317 |
| 209 | 3300048918 | Ga0496115_0009096 | Ga0496115_0009096_5121_6140 | 317 |
| 210 | 3300049743 | Ga0501081_0228566 | Ga0501081_0228566_76_1053 | 317 |
| 211 | 3300050507 | nmdc:mga05p37_223804_c1 | nmdc:mga05p37_223804_c1_720_1697 | 317 |
| 212 | 3300050507 | nmdc:mga05p37_73969_c1 | nmdc:mga05p37_73969_c1_2230_3201 | 317 |
| 213 | 3300050508 | nmdc:mga09592_4960_c1 | nmdc:mga09592_4960_c1_978_1961 | 317 |
| 214 | 3300050509 | nmdc:mga0qj67_267612_c1 | nmdc:mga0qj67_267612_c1_352_1344 | 317 |
| 215 | 3300050509 | nmdc:mga0qj67_32441_c1 | nmdc:mga0qj67_32441_c1_2800_3825 | 317 |
| 216 | 3300050510 | nmdc:mga06r32_52039_c2 | nmdc:mga06r32_52039_c2_25_996 | 317 |
| 217 | 3300050511 | nmdc:mga08y16_319173_c1 | nmdc:mga08y16_319173_c1_87_1103 | 317 |
| 218 | 3300050515 | nmdc:mga0a205_11848_c2 | nmdc:mga0a205_11848_c2_3622_4599 | 317 |
| 219 | 3300053093 | Ga0500651_0000082 | Ga0500651_0000082_21318_22412 | 317 |
| 220 | 3300061734 | Ga0530510_0145371 | Ga0530510_0145371_283_1260 | 317 |
| 221 | 3300005330 | Ga0070690_100005700 | Ga0070690_1000057005 | 318 |
| 222 | 3300005333 | Ga0070677_10030192 | Ga0070677_100301922 | 318 |
| 223 | 3300005334 | Ga0068869_100049933 | Ga0068869_1000499331 | 318 |
| 224 | 3300005335 | Ga0070666_10010460 | Ga0070666_100104605 | 318 |
| 225 | 3300005338 | Ga0068868_100022037 | Ga0068868_1000220374 | 318 |
| 226 | 3300005347 | Ga0070668_100095077 | Ga0070668_1000950771 | 318 |
| 227 | 3300005354 | Ga0070675_100012318 | Ga0070675_1000123185 | 318 |
| 228 | 3300005355 | Ga0070671_100003747 | Ga0070671_10000374711 | 318 |
| 229 | 3300005364 | Ga0070673_100007204 | Ga0070673_1000072045 | 318 |
| 230 | 3300005364 | Ga0070673_100081600 | Ga0070673_1000816003 | 318 |
| 231 | 3300005367 | Ga0070667_100012330 | Ga0070667_1000123304 | 318 |
| 232 | 3300005456 | Ga0070678_100011332 | Ga0070678_1000113323 | 318 |
| 233 | 3300005457 | Ga0070662_100036296 | Ga0070662_1000362964 | 318 |
| 234 | 3300005459 | Ga0068867_100031859 | Ga0068867_1000318594 | 318 |
| 235 | 3300005543 | Ga0070672_100067175 | Ga0070672_1000671753 | 318 |
| 236 | 3300005548 | Ga0070665_100157616 | Ga0070665_1001576161 | 318 |
| 237 | 3300005616 | Ga0068852_100182214 | Ga0068852_1001822142 | 318 |
| 238 | 3300005617 | Ga0068859_100005136 | Ga0068859_1000051367 | 318 |
| 239 | 3300005618 | Ga0068864_100009415 | Ga0068864_1000094156 | 318 |
| 240 | 3300005719 | Ga0068861_100137979 | Ga0068861_1001379792 | 318 |
| 241 | 3300005841 | Ga0068863_100029312 | Ga0068863_1000293124 | 318 |
| 242 | 3300005842 | Ga0068858_100008304 | Ga0068858_1000083043 | 318 |
| 243 | 3300005844 | Ga0068862_100367943 | Ga0068862_1003679432 | 318 |
| 244 | 3300006237 | Ga0097621_100034178 | Ga0097621_1000341783 | 318 |
| 245 | 3300006358 | Ga0068871_100024771 | Ga0068871_1000247715 | 318 |
| 246 | 3300006931 | Ga0097620_100005136 | Ga0097620_1000051367 | 318 |
| 247 | 3300009147 | Ga0114129_10018918 | Ga0114129_100189188 | 318 |
| 248 | 3300009176 | Ga0105242_10298573 | Ga0105242_102985731 | 318 |
| 249 | 3300009177 | Ga0105248_10040261 | Ga0105248_100402614 | 318 |
| 250 | 3300009177 | Ga0105248_10150680 | Ga0105248_101506803 | 318 |
| 251 | 3300013296 | Ga0157374_10034097 | Ga0157374_100340974 | 318 |
| 252 | 3300013297 | Ga0157378_10118200 | Ga0157378_101182002 | 318 |
| 253 | 3300013306 | Ga0163162_10060920 | Ga0163162_100609204 | 318 |
| 254 | 3300013308 | Ga0157375_10037314 | Ga0157375_100373144 | 318 |
| 255 | 3300014325 | Ga0163163_10007322 | Ga0163163_100073225 | 318 |
| 256 | 3300014326 | Ga0157380_10071391 | Ga0157380_100713913 | 318 |
| 257 | 3300014968 | Ga0157379_10050042 | Ga0157379_100500423 | 318 |
| 258 | 3300017792 | Ga0163161_10037878 | Ga0163161_100378784 | 318 |
| 259 | 3300025893 | Ga0207682_10010960 | Ga0207682_100109602 | 318 |
| 260 | 3300025903 | Ga0207680_10013062 | Ga0207680_100130623 | 318 |
| 261 | 3300025905 | Ga0207685_10029541 | Ga0207685_100295411 | 318 |
| 262 | 3300025926 | Ga0207659_10003908 | Ga0207659_100039087 | 318 |
| 263 | 3300025931 | Ga0207644_10009027 | Ga0207644_100090273 | 318 |
| 264 | 3300025933 | Ga0207706_10058823 | Ga0207706_100588234 | 318 |
| 265 | 3300025934 | Ga0207686_10047398 | Ga0207686_100473983 | 318 |
| 266 | 3300025938 | Ga0207704_10053082 | Ga0207704_100530822 | 318 |
| 267 | 3300025941 | Ga0207711_10029877 | Ga0207711_100298774 | 318 |
| 268 | 3300025942 | Ga0207689_10058161 | Ga0207689_100581611 | 318 |
| 269 | 3300025960 | Ga0207651_10001572 | Ga0207651_100015724 | 318 |
| 270 | 3300025986 | Ga0207658_10008700 | Ga0207658_100087003 | 318 |
| 271 | 3300026023 | Ga0207677_10001764 | Ga0207677_100017648 | 318 |
| 272 | 3300026075 | Ga0207708_10111402 | Ga0207708_101114023 | 318 |
| 273 | 3300026088 | Ga0207641_10034332 | Ga0207641_100343324 | 318 |
| 274 | 3300026089 | Ga0207648_10077095 | Ga0207648_100770953 | 318 |
| 275 | 3300026095 | Ga0207676_10000860 | Ga0207676_1000086018 | 318 |
| 276 | 3300026118 | Ga0207675_100168002 | Ga0207675_1001680022 | 318 |
| 277 | 3300026121 | Ga0207683_10002475 | Ga0207683_1000247514 | 318 |
| 278 | 3300028379 | Ga0268266_10139377 | Ga0268266_101393771 | 318 |
| 279 | 3300028380 | Ga0268265_10387699 | Ga0268265_103876991 | 318 |
| 280 | 3300046518 | Ga0495631_0013301 | Ga0495631_0013301_1498_2601 | 318 |
| 281 | 3300046530 | Ga0495654_0005426 | Ga0495654_0005426_4885_5988 | 318 |
| 282 | 3300046616 | Ga0495668_0059634 | Ga0495668_0059634_887_1990 | 318 |
| 283 | 3300046674 | Ga0495588_0037453 | Ga0495588_0037453_858_1961 | 318 |
| 284 | 3300047673 | Ga0495593_0008983 | Ga0495593_0008983_3139_4242 | 318 |
| 285 | 3300048907 | Ga0496104_0027579 | Ga0496104_0027579_909_1928 | 318 |
| 286 | 3300048911 | Ga0496108_0015466 | Ga0496108_0015466_4181_5305 | 318 |
| 287 | 3300048922 | Ga0496119_0036909 | Ga0496119_0036909_505_1608 | 318 |
| 288 | 3300048925 | Ga0496122_0023376 | Ga0496122_0023376_1155_2258 | 318 |
| 289 | 3300050507 | nmdc:mga05p37_105529_c1 | nmdc:mga05p37_105529_c1_1896_2861 | 318 |
| 290 | 3300050507 | nmdc:mga05p37_64231_c1 | nmdc:mga05p37_64231_c1_720_1679 | 318 |
| 291 | 3300050510 | nmdc:mga06r32_404229_c1 | nmdc:mga06r32_404229_c1_329_1291 | 318 |
| 292 | 3300050512 | nmdc:mga0n895_90174_c1 | nmdc:mga0n895_90174_c1_137_1096 | 318 |
| 293 | 3300050515 | nmdc:mga0a205_7857_c1 | nmdc:mga0a205_7857_c1_313_1272 | 318 |
| 294 | 3300053110 | Ga0500571_000152 | Ga0500571_000152_21345_22448 | 318 |
| 295 | 3300053118 | Ga0500594_0002211 | Ga0500594_0002211_1750_2853 | 318 |
| 296 | 3300053133 | Ga0500655_000842 | Ga0500655_000842_4190_5293 | 318 |
| 297 | 3300053134 | Ga0500658_0000038 | Ga0500658_0000038_79851_80954 | 318 |
| 298 | 3300053138 | Ga0500564_004157 | Ga0500564_004157_4420_5523 | 318 |
| 299 | 3300053139 | Ga0500568_0000338 | Ga0500568_0000338_35147_36250 | 318 |
| 300 | 3300053141 | Ga0500574_000501 | Ga0500574_000501_3130_4233 | 318 |
| 301 | 3300053162 | Ga0500638_005113 | Ga0500638_005113_948_2051 | 318 |
| 302 | 3300053177 | Ga0500636_0060514 | Ga0500636_0060514_833_1936 | 318 |
| 303 | 3300061734 | Ga0530510_0002079 | Ga0530510_0002079_5120_6100 | 318 |
| 304 | iso_pu_bacteria | 2513020051 | 2513228096 | 318 |
| 305 | iso_pu_bacteria | 2643221672 | 2644399861 | 318 |
| 306 | iso_pu_bacteria | 2928084124 | 2928088400 | 318 |
| 307 | 3300005441 | Ga0070700_100093999 | Ga0070700_1000939992 | 319 |
| 308 | 3300006178 | Ga0075367_10020965 | Ga0075367_100209652 | 319 |
| 309 | 3300006195 | Ga0075366_10009924 | Ga0075366_100099244 | 319 |
| 310 | 3300009147 | Ga0114129_10015808 | Ga0114129_100158083 | 319 |
| 311 | 3300028794 | Ga0307515_10000179 | Ga0307515_1000017926 | 319 |
| 312 | 3300028794 | Ga0307515_10000586 | Ga0307515_1000058622 | 319 |
| 313 | 3300028794 | Ga0307515_10069999 | Ga0307515_100699994 | 319 |
| 314 | 3300030522 | Ga0307512_10142109 | Ga0307512_101421091 | 319 |
| 315 | 3300031456 | Ga0307513_10047767 | Ga0307513_100477672 | 319 |
| 316 | 3300031507 | Ga0307509_10128577 | Ga0307509_101285773 | 319 |
| 317 | 3300031548 | Ga0307408_100148525 | Ga0307408_1001485252 | 319 |
| 318 | 3300031616 | Ga0307508_10000649 | Ga0307508_1000064927 | 319 |
| 319 | 3300031730 | Ga0307516_10166651 | Ga0307516_101666512 | 319 |
| 320 | 3300031731 | Ga0307405_10013638 | Ga0307405_100136383 | 319 |
| 321 | 3300031852 | Ga0307410_10373502 | Ga0307410_103735021 | 319 |
| 322 | 3300031911 | Ga0307412_10012351 | Ga0307412_100123514 | 319 |
| 323 | 3300037471 | Ga0395905_0093729 | Ga0395905_0093729_1247_2254 | 319 |
| 324 | 3300041406 | Ga0439439_0002176 | Ga0439439_0002176_1578_2606 | 319 |
| 325 | 3300041507 | Ga0451851_1247133 | Ga0451851_1247133_192_1214 | 319 |
| 326 | 3300041511 | Ga0451855_1812600 | Ga0451855_1812600_267_1289 | 319 |
| 327 | 3300042006 | Ga0439432_005283 | Ga0439432_005283_1727_2755 | 319 |
| 328 | 3300042007 | Ga0439449_0001123 | Ga0439449_0001123_6681_7709 | 319 |
| 329 | 3300042010 | Ga0439452_001727 | Ga0439452_001727_1229_2356 | 319 |
| 330 | 3300042015 | Ga0439462_0006129 | Ga0439462_0006129_410_1438 | 319 |
| 331 | 3300042128 | Ga0450897_000666 | Ga0450897_000666_123_1151 | 319 |
| 332 | 3300042134 | Ga0450898_000063 | Ga0450898_000063_5611_6639 | 319 |
| 333 | 3300042145 | Ga0450906_002684 | Ga0450906_002684_1546_2574 | 319 |
| 334 | 3300042156 | Ga0439446_0011515 | Ga0439446_0011515_1186_2214 | 319 |
| 335 | 3300042435 | Ga0439434_0003855 | Ga0439434_0003855_1604_2632 | 319 |
| 336 | 3300046519 | Ga0495632_0096931 | Ga0495632_0096931_346_1368 | 319 |
| 337 | 3300046522 | Ga0495643_0058599 | Ga0495643_0058599_988_2010 | 319 |
| 338 | 3300046660 | Ga0495625_0001836 | Ga0495625_0001836_11431_12453 | 319 |
| 339 | 3300049576 | Ga0501040_0208558 | Ga0501040_0208558_201_1181 | 319 |
| 340 | 3300049576 | Ga0501040_0267172 | Ga0501040_0267172_96_1076 | 319 |
| 341 | 3300049577 | Ga0501041_0009461 | Ga0501041_0009461_396_1376 | 319 |
| 342 | 3300049588 | Ga0501072_0040001 | Ga0501072_0040001_1644_2642 | 319 |
| 343 | 3300049590 | Ga0501074_0116830 | Ga0501074_0116830_221_1219 | 319 |
| 344 | 3300049592 | Ga0501076_0017060 | Ga0501076_0017060_800_1798 | 319 |
| 345 | 3300049593 | Ga0501077_0051774 | Ga0501077_0051774_641_1639 | 319 |
| 346 | 3300049741 | Ga0501079_0027802 | Ga0501079_0027802_2872_3870 | 319 |
| 347 | 3300049741 | Ga0501079_0038707 | Ga0501079_0038707_1585_2565 | 319 |
| 348 | 3300049742 | Ga0501080_0349187 | Ga0501080_0349187_202_1200 | 319 |
| 349 | 3300049743 | Ga0501081_0016576 | Ga0501081_0016576_2265_3263 | 319 |
| 350 | 3300049743 | Ga0501081_0129624 | Ga0501081_0129624_160_1140 | 319 |
| 351 | 3300050489 | nmdc:mga03683_8366_c1 | nmdc:mga03683_8366_c1_1527_2651 | 319 |
| 352 | 3300050493 | nmdc:mga0k408_11190_c2 | nmdc:mga0k408_11190_c2_1592_2716 | 319 |
| 353 | 3300050493 | nmdc:mga0k408_96360_c1 | nmdc:mga0k408_96360_c1_199_1221 | 319 |
| 354 | 3300050507 | nmdc:mga05p37_241691_c1 | nmdc:mga05p37_241691_c1_24_983 | 319 |
| 355 | 3300050507 | nmdc:mga05p37_733_c1 | nmdc:mga05p37_733_c1_2837_3805 | 319 |
| 356 | 3300050507 | nmdc:mga05p37_787268_c1 | nmdc:mga05p37_787268_c1_24_983 | 319 |
| 357 | 3300050508 | nmdc:mga09592_22786_c2 | nmdc:mga09592_22786_c2_1260_2228 | 319 |
| 358 | 3300050510 | nmdc:mga06r32_301016_c1 | nmdc:mga06r32_301016_c1_17_976 | 319 |
| 359 | 3300050512 | nmdc:mga0n895_22204_c1 | nmdc:mga0n895_22204_c1_1190_2149 | 319 |
| 360 | 3300050512 | nmdc:mga0n895_776_c1 | nmdc:mga0n895_776_c1_6260_7219 | 319 |
| 361 | 3300050513 | nmdc:mga0rr50_143674_c1 | nmdc:mga0rr50_143674_c1_454_1413 | 319 |
| 362 | 3300050514 | nmdc:mga08x19_17815_c1 | nmdc:mga08x19_17815_c1_2692_3651 | 319 |
| 363 | 3300050515 | nmdc:mga0a205_881_c1 | nmdc:mga0a205_881_c1_4577_5536 | 319 |
| 364 | 3300054114 | Ga0501084_0003441 | Ga0501084_0003441_121_1101 | 319 |
| 365 | 3300054114 | Ga0501084_0005902 | Ga0501084_0005902_1060_2058 | 319 |
| 366 | iso_pu_bacteria | 2585428062 | 2587757740 | 319 |
| 367 | 3300005327 | Ga0070658_10100259 | Ga0070658_101002594 | 320 |
| 368 | 3300006844 | Ga0075428_100013199 | Ga0075428_1000131997 | 320 |
| 369 | 3300006844 | Ga0075428_100234543 | Ga0075428_1002345432 | 320 |
| 370 | 3300006847 | Ga0075431_100006738 | Ga0075431_1000067387 | 320 |
| 371 | 3300006847 | Ga0075431_100108770 | Ga0075431_1001087702 | 320 |
| 372 | 3300006871 | Ga0075434_100009161 | Ga0075434_1000091619 | 320 |
| 373 | 3300006880 | Ga0075429_100270905 | Ga0075429_1002709052 | 320 |
| 374 | 3300009147 | Ga0114129_10149663 | Ga0114129_101496632 | 320 |
| 375 | 3300017792 | Ga0163161_10000201 | Ga0163161_100002016 | 320 |
| 376 | 3300031649 | Ga0307514_10031436 | Ga0307514_100314361 | 320 |
| 377 | 3300049581 | Ga0501047_0037341 | Ga0501047_0037341_1447_2454 | 320 |
| 378 | 3300049823 | Ga0501044_0087640 | Ga0501044_0087640_986_1993 | 320 |
| 379 | 3300050507 | nmdc:mga05p37_87726_c1 | nmdc:mga05p37_87726_c1_1721_2719 | 320 |
| 380 | 3300050508 | nmdc:mga09592_22145_c1 | nmdc:mga09592_22145_c1_131_1129 | 320 |
| 381 | 3300050510 | nmdc:mga06r32_133201_c1 | nmdc:mga06r32_133201_c1_851_1849 | 320 |
| 382 | 3300050513 | nmdc:mga0rr50_85562_c1 | nmdc:mga0rr50_85562_c1_1347_2321 | 320 |
| 383 | 3300005333 | Ga0070677_10011261 | Ga0070677_100112613 | 321 |
| 384 | 3300005338 | Ga0068868_100202895 | Ga0068868_1002028952 | 321 |
| 385 | 3300005347 | Ga0070668_100029091 | Ga0070668_1000290912 | 321 |
| 386 | 3300005354 | Ga0070675_100143812 | Ga0070675_1001438123 | 321 |
| 387 | 3300005354 | Ga0070675_100431519 | Ga0070675_1004315191 | 321 |
| 388 | 3300005355 | Ga0070671_100178458 | Ga0070671_1001784581 | 321 |
| 389 | 3300005355 | Ga0070671_100222130 | Ga0070671_1002221302 | 321 |
| 390 | 3300005364 | Ga0070673_100029379 | Ga0070673_1000293794 | 321 |
| 391 | 3300005367 | Ga0070667_100088213 | Ga0070667_1000882132 | 321 |
| 392 | 3300005441 | Ga0070700_100030979 | Ga0070700_1000309793 | 321 |
| 393 | 3300005456 | Ga0070678_100040192 | Ga0070678_1000401923 | 321 |
| 394 | 3300005456 | Ga0070678_100155199 | Ga0070678_1001551991 | 321 |
| 395 | 3300005457 | Ga0070662_100026417 | Ga0070662_1000264173 | 321 |
| 396 | 3300005458 | Ga0070681_10060167 | Ga0070681_100601673 | 321 |
| 397 | 3300005467 | Ga0070706_100070565 | Ga0070706_1000705653 | 321 |
| 398 | 3300005530 | Ga0070679_100067827 | Ga0070679_1000678271 | 321 |
| 399 | 3300005543 | Ga0070672_100029468 | Ga0070672_1000294683 | 321 |
| 400 | 3300005543 | Ga0070672_100073109 | Ga0070672_1000731092 | 321 |
| 401 | 3300005544 | Ga0070686_100168705 | Ga0070686_1001687051 | 321 |
| 402 | 3300005578 | Ga0068854_100316254 | Ga0068854_1003162542 | 321 |
| 403 | 3300005617 | Ga0068859_100102845 | Ga0068859_1001028453 | 321 |
| 404 | 3300005618 | Ga0068864_100053353 | Ga0068864_1000533533 | 321 |
| 405 | 3300005841 | Ga0068863_100109776 | Ga0068863_1001097763 | 321 |
| 406 | 3300006237 | Ga0097621_100034948 | Ga0097621_1000349481 | 321 |
| 407 | 3300006358 | Ga0068871_100017804 | Ga0068871_1000178044 | 321 |
| 408 | 3300006358 | Ga0068871_100150122 | Ga0068871_1001501221 | 321 |
| 409 | 3300006844 | Ga0075428_100000436 | Ga0075428_1000004369 | 321 |
| 410 | 3300006844 | Ga0075428_100034150 | Ga0075428_1000341502 | 321 |
| 411 | 3300006846 | Ga0075430_100000002 | Ga0075430_100000002150 | 321 |
| 412 | 3300006846 | Ga0075430_100004567 | Ga0075430_1000045674 | 321 |
| 413 | 3300006846 | Ga0075430_100064840 | Ga0075430_1000648402 | 321 |
| 414 | 3300006847 | Ga0075431_100001143 | Ga0075431_1000011436 | 321 |
| 415 | 3300006847 | Ga0075431_100006431 | Ga0075431_1000064319 | 321 |
| 416 | 3300006847 | Ga0075431_100127404 | Ga0075431_1001274041 | 321 |
| 417 | 3300006880 | Ga0075429_100000460 | Ga0075429_10000046028 | 321 |
| 418 | 3300006880 | Ga0075429_100046370 | Ga0075429_1000463702 | 321 |
| 419 | 3300006931 | Ga0097620_100102842 | Ga0097620_1001028423 | 321 |
| 420 | 3300009147 | Ga0114129_10013913 | Ga0114129_100139139 | 321 |
| 421 | 3300009147 | Ga0114129_10027955 | Ga0114129_100279554 | 321 |
| 422 | 3300009147 | Ga0114129_10215283 | Ga0114129_102152832 | 321 |
| 423 | 3300009553 | Ga0105249_10004175 | Ga0105249_100041757 | 321 |
| 424 | 3300012485 | Ga0157325_1001329 | Ga0157325_10013291 | 321 |
| 425 | 3300014969 | Ga0157376_10004443 | Ga0157376_100044433 | 321 |
| 426 | 3300014969 | Ga0157376_10062886 | Ga0157376_100628863 | 321 |
| 427 | 3300025271 | Ga0207666_1002179 | Ga0207666_10021792 | 321 |
| 428 | 3300025893 | Ga0207682_10010199 | Ga0207682_100101993 | 321 |
| 429 | 3300025908 | Ga0207643_10104622 | Ga0207643_101046222 | 321 |
| 430 | 3300025912 | Ga0207707_10014037 | Ga0207707_100140373 | 321 |
| 431 | 3300025926 | Ga0207659_10126306 | Ga0207659_101263062 | 321 |
| 432 | 3300025931 | Ga0207644_10062435 | Ga0207644_100624353 | 321 |
| 433 | 3300025931 | Ga0207644_10180387 | Ga0207644_101803872 | 321 |
| 434 | 3300025931 | Ga0207644_10210719 | Ga0207644_102107192 | 321 |
| 435 | 3300025935 | Ga0207709_10118291 | Ga0207709_101182912 | 321 |
| 436 | 3300025940 | Ga0207691_10029124 | Ga0207691_100291243 | 321 |
| 437 | 3300025942 | Ga0207689_10008649 | Ga0207689_100086497 | 321 |
| 438 | 3300025960 | Ga0207651_10093360 | Ga0207651_100933603 | 321 |
| 439 | 3300025961 | Ga0207712_10008657 | Ga0207712_100086575 | 321 |
| 440 | 3300025972 | Ga0207668_10140461 | Ga0207668_101404612 | 321 |
| 441 | 3300025986 | Ga0207658_10002890 | Ga0207658_1000289011 | 321 |
| 442 | 3300025986 | Ga0207658_10105321 | Ga0207658_101053211 | 321 |
| 443 | 3300026067 | Ga0207678_10064226 | Ga0207678_100642262 | 321 |
| 444 | 3300026075 | Ga0207708_10078665 | Ga0207708_100786652 | 321 |
| 445 | 3300026088 | Ga0207641_10000594 | Ga0207641_1000059433 | 321 |
| 446 | 3300026088 | Ga0207641_10098334 | Ga0207641_100983342 | 321 |
| 447 | 3300026088 | Ga0207641_10272256 | Ga0207641_102722562 | 321 |
| 448 | 3300026118 | Ga0207675_100027354 | Ga0207675_1000273545 | 321 |
| 449 | 3300026142 | Ga0207698_10178288 | Ga0207698_101782882 | 321 |
| 450 | 3300028381 | Ga0268264_10003635 | Ga0268264_1000363512 | 321 |
| 451 | 3300037312 | Ga0395899_0011209 | Ga0395899_0011209_2344_3345 | 321 |
| 452 | 3300037418 | Ga0395900_0001747 | Ga0395900_0001747_15588_16589 | 321 |
| 453 | 3300037466 | Ga0395898_0003002 | Ga0395898_0003002_13671_14672 | 321 |
| 454 | 3300037471 | Ga0395905_0254105 | Ga0395905_0254105_628_1629 | 321 |
| 455 | 3300038443 | Ga0395901_0001149 | Ga0395901_0001149_23921_24922 | 321 |
| 456 | 3300038443 | Ga0395901_0014577 | Ga0395901_0014577_2725_3816 | 321 |
| 457 | 3300046537 | Ga0495598_0035848 | Ga0495598_0035848_223_1251 | 321 |
| 458 | 3300048910 | Ga0496107_0120010 | Ga0496107_0120010_500_1528 | 321 |
| 459 | 3300048911 | Ga0496108_0054499 | Ga0496108_0054499_2165_3193 | 321 |
| 460 | 3300049574 | Ga0501038_0255124 | Ga0501038_0255124_124_1116 | 321 |
| 461 | 3300049576 | Ga0501040_0092053 | Ga0501040_0092053_1072_2064 | 321 |
| 462 | 3300049577 | Ga0501041_0123727 | Ga0501041_0123727_197_1189 | 321 |
| 463 | 3300049590 | Ga0501074_0155644 | Ga0501074_0155644_238_1230 | 321 |
| 464 | 3300049743 | Ga0501081_0015410 | Ga0501081_0015410_1314_2306 | 321 |
| 465 | 3300050507 | nmdc:mga05p37_17921_c1 | nmdc:mga05p37_17921_c1_1488_2489 | 321 |
| 466 | 3300050508 | nmdc:mga09592_56_c1 | nmdc:mga09592_56_c1_24540_25541 | 321 |
| 467 | 3300050509 | nmdc:mga0qj67_6405_c1 | nmdc:mga0qj67_6405_c1_5224_6225 | 321 |
| 468 | 3300050510 | nmdc:mga06r32_5613_c1 | nmdc:mga06r32_5613_c1_8807_9808 | 321 |
| 469 | 3300054114 | Ga0501084_0016610 | Ga0501084_0016610_2551_3543 | 321 |
| 470 | 3300005328 | Ga0070676_10062625 | Ga0070676_100626251 | 322 |
| 471 | 3300005336 | Ga0070680_100017652 | Ga0070680_1000176525 | 322 |
| 472 | 3300005458 | Ga0070681_10324921 | Ga0070681_103249212 | 322 |
| 473 | 3300005459 | Ga0068867_100088054 | Ga0068867_1000880541 | 322 |
| 474 | 3300005467 | Ga0070706_100005491 | Ga0070706_1000054919 | 322 |
| 475 | 3300005468 | Ga0070707_100001162 | Ga0070707_10000116218 | 322 |
| 476 | 3300005518 | Ga0070699_100280401 | Ga0070699_1002804012 | 322 |
| 477 | 3300005840 | Ga0068870_10005096 | Ga0068870_100050963 | 322 |
| 478 | 3300005843 | Ga0068860_100030814 | Ga0068860_1000308145 | 322 |
| 479 | 3300006195 | Ga0075366_10113838 | Ga0075366_101138381 | 322 |
| 480 | 3300006846 | Ga0075430_100052664 | Ga0075430_1000526643 | 322 |
| 481 | 3300025908 | Ga0207643_10011086 | Ga0207643_100110863 | 322 |
| 482 | 3300025910 | Ga0207684_10002560 | Ga0207684_100025609 | 322 |
| 483 | 3300025922 | Ga0207646_10001059 | Ga0207646_100010594 | 322 |
| 484 | 3300025972 | Ga0207668_10383227 | Ga0207668_103832271 | 322 |
| 485 | 3300026089 | Ga0207648_10041353 | Ga0207648_100413532 | 322 |
| 486 | 3300028381 | Ga0268264_10047987 | Ga0268264_100479873 | 322 |
| 487 | 3300042015 | Ga0439462_0038644 | Ga0439462_0038644_52_1032 | 322 |
| 488 | 3300046681 | Ga0495647_0065083 | Ga0495647_0065083_36_1055 | 322 |
| 489 | 3300049572 | Ga0501036_0216976 | Ga0501036_0216976_94_1074 | 322 |
| 490 | 3300049577 | Ga0501041_0258169 | Ga0501041_0258169_61_1041 | 322 |
| 491 | 3300049592 | Ga0501076_0151372 | Ga0501076_0151372_677_1657 | 322 |
| 492 | 3300049742 | Ga0501080_0191030 | Ga0501080_0191030_536_1516 | 322 |
| 493 | 3300049824 | Ga0501045_0153852 | Ga0501045_0153852_71_1051 | 322 |
| 494 | 3300050493 | nmdc:mga0k408_25209_c1 | nmdc:mga0k408_25209_c1_1948_2970 | 322 |
| 495 | 3300005334 | Ga0068869_100032393 | Ga0068869_1000323933 | 323 |
| 496 | 3300005336 | Ga0070680_100312692 | Ga0070680_1003126921 | 323 |
| 497 | 3300005341 | Ga0070691_10011961 | Ga0070691_100119611 | 323 |
| 498 | 3300005345 | Ga0070692_10113560 | Ga0070692_101135601 | 323 |
| 499 | 3300005353 | Ga0070669_100111225 | Ga0070669_1001112251 | 323 |
| 500 | 3300005444 | Ga0070694_100087502 | Ga0070694_1000875022 | 323 |
| 501 | 3300005445 | Ga0070708_100357543 | Ga0070708_1003575431 | 323 |
| 502 | 3300005459 | Ga0068867_100236285 | Ga0068867_1002362851 | 323 |
| 503 | 3300005471 | Ga0070698_100039844 | Ga0070698_1000398442 | 323 |
| 504 | 3300005471 | Ga0070698_100344923 | Ga0070698_1003449232 | 323 |
| 505 | 3300005577 | Ga0068857_100033034 | Ga0068857_1000330343 | 323 |
| 506 | 3300005615 | Ga0070702_100030150 | Ga0070702_1000301503 | 323 |
| 507 | 3300005840 | Ga0068870_10016783 | Ga0068870_100167833 | 323 |
| 508 | 3300005843 | Ga0068860_100117085 | Ga0068860_1001170853 | 323 |
| 509 | 3300005844 | Ga0068862_100197452 | Ga0068862_1001974523 | 323 |
| 510 | 3300005983 | Ga0081540_1081992 | Ga0081540_10819921 | 323 |
| 511 | 3300006844 | Ga0075428_100012245 | Ga0075428_1000122452 | 323 |
| 512 | 3300006844 | Ga0075428_100091471 | Ga0075428_1000914712 | 323 |
| 513 | 3300006852 | Ga0075433_10006010 | Ga0075433_100060107 | 323 |
| 514 | 3300006852 | Ga0075433_10049089 | Ga0075433_100490892 | 323 |
| 515 | 3300006852 | Ga0075433_10110084 | Ga0075433_101100843 | 323 |
| 516 | 3300006852 | Ga0075433_10123164 | Ga0075433_101231642 | 323 |
| 517 | 3300006852 | Ga0075433_10141093 | Ga0075433_101410933 | 323 |
| 518 | 3300006871 | Ga0075434_100026125 | Ga0075434_1000261252 | 323 |
| 519 | 3300006871 | Ga0075434_100032201 | Ga0075434_1000322015 | 323 |
| 520 | 3300006871 | Ga0075434_100069050 | Ga0075434_1000690503 | 323 |
| 521 | 3300006871 | Ga0075434_100124067 | Ga0075434_1001240672 | 323 |
| 522 | 3300006880 | Ga0075429_100001854 | Ga0075429_1000018541 | 323 |
| 523 | 3300007076 | Ga0075435_100003478 | Ga0075435_1000034786 | 323 |
| 524 | 3300007076 | Ga0075435_100055170 | Ga0075435_1000551702 | 323 |
| 525 | 3300007076 | Ga0075435_100095060 | Ga0075435_1000950603 | 323 |
| 526 | 3300007076 | Ga0075435_100128226 | Ga0075435_1001282263 | 323 |
| 527 | 3300007265 | Ga0099794_10012766 | Ga0099794_100127662 | 323 |
| 528 | 3300009094 | Ga0111539_10007349 | Ga0111539_1000734912 | 323 |
| 529 | 3300009094 | Ga0111539_10407084 | Ga0111539_104070841 | 323 |
| 530 | 3300009147 | Ga0114129_10023727 | Ga0114129_100237277 | 323 |
| 531 | 3300009147 | Ga0114129_10031378 | Ga0114129_100313784 | 323 |
| 532 | 3300009147 | Ga0114129_10099597 | Ga0114129_100995972 | 323 |
| 533 | 3300009147 | Ga0114129_10272460 | Ga0114129_102724602 | 323 |
| 534 | 3300009147 | Ga0114129_10457427 | Ga0114129_104574272 | 323 |
| 535 | 3300009147 | Ga0114129_10461567 | Ga0114129_104615672 | 323 |
| 536 | 3300009176 | Ga0105242_10066025 | Ga0105242_100660254 | 323 |
| 537 | 3300025908 | Ga0207643_10011571 | Ga0207643_100115713 | 323 |
| 538 | 3300025910 | Ga0207684_10017290 | Ga0207684_100172902 | 323 |
| 539 | 3300025922 | Ga0207646_10019416 | Ga0207646_100194164 | 323 |
| 540 | 3300025935 | Ga0207709_10009580 | Ga0207709_100095802 | 323 |
| 541 | 3300025942 | Ga0207689_10037686 | Ga0207689_100376863 | 323 |
| 542 | 3300025961 | Ga0207712_10085590 | Ga0207712_100855903 | 323 |
| 543 | 3300026088 | Ga0207641_10344860 | Ga0207641_103448601 | 323 |
| 544 | 3300026089 | Ga0207648_10170905 | Ga0207648_101709052 | 323 |
| 545 | 3300026116 | Ga0207674_10027649 | Ga0207674_100276493 | 323 |
| 546 | 3300027671 | Ga0209588_1035179 | Ga0209588_10351792 | 323 |
| 547 | 3300027907 | Ga0207428_10000033 | Ga0207428_1000003356 | 323 |
| 548 | 3300035088 | Ga0373940_0031254 | Ga0373940_0031254_42_1034 | 323 |
| 549 | 3300035114 | Ga0373939_0022487 | Ga0373939_0022487_139_1122 | 323 |
| 550 | 3300035691 | Ga0373931_0012731 | Ga0373931_0012731_1368_2360 | 323 |
| 551 | 3300035691 | Ga0373931_0013727 | Ga0373931_0013727_1010_1993 | 323 |
| 552 | 3300044712 | Ga0453684_0174662 | Ga0453684_0174662_231_1229 | 323 |
| 553 | 3300045051 | Ga0451576_0082742 | Ga0451576_0082742_432_1415 | 323 |
| 554 | 3300046472 | Ga0495580_0001185 | Ga0495580_0001185_13021_14004 | 323 |
| 555 | 3300046664 | Ga0495659_0051169 | Ga0495659_0051169_361_1353 | 323 |
| 556 | 3300047318 | Ga0495636_0040401 | Ga0495636_0040401_817_1800 | 323 |
| 557 | 3300050507 | nmdc:mga05p37_120390_c1 | nmdc:mga05p37_120390_c1_1333_2328 | 323 |
| 558 | 3300050507 | nmdc:mga05p37_200155_c1 | nmdc:mga05p37_200155_c1_690_1682 | 323 |
| 559 | 3300050507 | nmdc:mga05p37_34529_c1 | nmdc:mga05p37_34529_c1_427_1410 | 323 |
| 560 | 3300050507 | nmdc:mga05p37_41200_c1 | nmdc:mga05p37_41200_c1_4450_5433 | 323 |
| 561 | 3300050507 | nmdc:mga05p37_74584_c1 | nmdc:mga05p37_74584_c1_2531_3523 | 323 |
| 562 | 3300050508 | nmdc:mga09592_1059_c1 | nmdc:mga09592_1059_c1_19957_20949 | 323 |
| 563 | 3300050508 | nmdc:mga09592_141560_c1 | nmdc:mga09592_141560_c1_139_1131 | 323 |
| 564 | 3300050508 | nmdc:mga09592_1584_c1 | nmdc:mga09592_1584_c1_43_1026 | 323 |
| 565 | 3300050509 | nmdc:mga0qj67_13933_c1 | nmdc:mga0qj67_13933_c1_4927_5919 | 323 |
| 566 | 3300050510 | nmdc:mga06r32_16486_c1 | nmdc:mga06r32_16486_c1_754_1746 | 323 |
| 567 | 3300050510 | nmdc:mga06r32_253514_c1 | nmdc:mga06r32_253514_c1_534_1517 | 323 |
| 568 | 3300050511 | nmdc:mga08y16_29845_c1 | nmdc:mga08y16_29845_c1_1206_2189 | 323 |
| 569 | 3300050511 | nmdc:mga08y16_800_c1 | nmdc:mga08y16_800_c1_17950_18933 | 323 |
| 570 | 3300050512 | nmdc:mga0n895_147472_c1 | nmdc:mga0n895_147472_c1_1217_2200 | 323 |
| 571 | 3300050512 | nmdc:mga0n895_36264_c1 | nmdc:mga0n895_36264_c1_1573_2565 | 323 |
| 572 | 3300050512 | nmdc:mga0n895_41376_c1 | nmdc:mga0n895_41376_c1_913_1905 | 323 |
| 573 | 3300050512 | nmdc:mga0n895_63207_c1 | nmdc:mga0n895_63207_c1_892_1887 | 323 |
| 574 | 3300050513 | nmdc:mga0rr50_108642_c1 | nmdc:mga0rr50_108642_c1_797_1789 | 323 |
| 575 | 3300050513 | nmdc:mga0rr50_112804_c1 | nmdc:mga0rr50_112804_c1_486_1469 | 323 |
| 576 | 3300050513 | nmdc:mga0rr50_19697_c1 | nmdc:mga0rr50_19697_c1_361_1344 | 323 |
| 577 | 3300050513 | nmdc:mga0rr50_81363_c1 | nmdc:mga0rr50_81363_c1_796_1788 | 323 |
| 578 | 3300050514 | nmdc:mga08x19_288166_c1 | nmdc:mga08x19_288166_c1_63_1046 | 323 |
| 579 | 3300050515 | nmdc:mga0a205_111152_c1 | nmdc:mga0a205_111152_c1_1013_2008 | 323 |
| 580 | 3300050515 | nmdc:mga0a205_134313_c1 | nmdc:mga0a205_134313_c1_446_1429 | 323 |
| 581 | 3300050515 | nmdc:mga0a205_177404_c1 | nmdc:mga0a205_177404_c1_686_1669 | 323 |
| 582 | 3300050515 | nmdc:mga0a205_236862_c1 | nmdc:mga0a205_236862_c1_378_1370 | 323 |
| 583 | 3300050515 | nmdc:mga0a205_55298_c1 | nmdc:mga0a205_55298_c1_867_1850 | 323 |
| 584 | 3300050515 | nmdc:mga0a205_69619_c1 | nmdc:mga0a205_69619_c1_903_1886 | 323 |
| 585 | 3300050515 | nmdc:mga0a205_9861_c1 | nmdc:mga0a205_9861_c1_818_1810 | 323 |
| 586 | 3300005445 | Ga0070708_100007577 | Ga0070708_1000075773 | 324 |
| 587 | 3300005467 | Ga0070706_100010557 | Ga0070706_1000105572 | 324 |
| 588 | 3300005468 | Ga0070707_100100816 | Ga0070707_1001008163 | 324 |
| 589 | 3300005468 | Ga0070707_100332738 | Ga0070707_1003327382 | 324 |
| 590 | 3300006038 | Ga0075365_10040606 | Ga0075365_100406063 | 324 |
| 591 | 3300006177 | Ga0075362_10010992 | Ga0075362_100109923 | 324 |
| 592 | 3300006195 | Ga0075366_10013053 | Ga0075366_100130531 | 324 |
| 593 | 3300006871 | Ga0075434_100177262 | Ga0075434_1001772622 | 324 |
| 594 | 3300007076 | Ga0075435_100203807 | Ga0075435_1002038072 | 324 |
| 595 | 3300025922 | Ga0207646_10032739 | Ga0207646_100327394 | 324 |
| 596 | 3300027866 | Ga0209813_10033417 | Ga0209813_100334171 | 324 |
| 597 | 3300041451 | Ga0451791_1836557 | Ga0451791_1836557_27_1049 | 324 |
| 598 | 3300049570 | Ga0501033_0109243 | Ga0501033_0109243_1010_1996 | 324 |
| 599 | 3300049572 | Ga0501036_0003619 | Ga0501036_0003619_3422_4408 | 324 |
| 600 | 3300049574 | Ga0501038_0137443 | Ga0501038_0137443_557_1543 | 324 |
| 601 | 3300049577 | Ga0501041_0034253 | Ga0501041_0034253_1278_2264 | 324 |
| 602 | 3300049578 | Ga0501042_0081432 | Ga0501042_0081432_608_1594 | 324 |
| 603 | 3300049580 | Ga0501046_0301024 | Ga0501046_0301024_119_1105 | 324 |
| 604 | 3300049582 | Ga0501048_0038735 | Ga0501048_0038735_1693_2679 | 324 |
| 605 | 3300049587 | Ga0501071_0002922 | Ga0501071_0002922_1429_2415 | 324 |
| 606 | 3300049588 | Ga0501072_0001954 | Ga0501072_0001954_913_1899 | 324 |
| 607 | 3300049590 | Ga0501074_0053896 | Ga0501074_0053896_1733_2719 | 324 |
| 608 | 3300049591 | Ga0501075_0000177 | Ga0501075_0000177_23043_24029 | 324 |
| 609 | 3300049592 | Ga0501076_0000014 | Ga0501076_0000014_79484_80470 | 324 |
| 610 | 3300049743 | Ga0501081_0062219 | Ga0501081_0062219_40_1026 | 324 |
| 611 | 3300049824 | Ga0501045_0135468 | Ga0501045_0135468_692_1678 | 324 |
| 612 | 3300050489 | nmdc:mga03683_17897_c1 | nmdc:mga03683_17897_c1_844_1869 | 324 |
| 613 | 3300050492 | nmdc:mga0yw44_21348_c1 | nmdc:mga0yw44_21348_c1_998_2023 | 324 |
| 614 | 3300050493 | nmdc:mga0k408_78623_c1 | nmdc:mga0k408_78623_c1_881_1906 | 324 |
| 615 | 3300050512 | nmdc:mga0n895_86333_c1 | nmdc:mga0n895_86333_c1_1771_2769 | 324 |
| 616 | 3300054114 | Ga0501084_0015490 | Ga0501084_0015490_202_1188 | 324 |
| 617 | 3300061734 | Ga0530510_0000045 | Ga0530510_0000045_9145_10131 | 324 |
| 618 | 3300005353 | Ga0070669_100064942 | Ga0070669_1000649422 | 325 |
| 619 | 3300005445 | Ga0070708_100062810 | Ga0070708_1000628103 | 325 |
| 620 | 3300005445 | Ga0070708_100251746 | Ga0070708_1002517462 | 325 |
| 621 | 3300005471 | Ga0070698_100040892 | Ga0070698_1000408924 | 325 |
| 622 | 3300005536 | Ga0070697_100079233 | Ga0070697_1000792332 | 325 |
| 623 | 3300006175 | Ga0070712_100062413 | Ga0070712_1000624133 | 325 |
| 624 | 3300006852 | Ga0075433_10019115 | Ga0075433_100191155 | 325 |
| 625 | 3300006871 | Ga0075434_100002356 | Ga0075434_10000235615 | 325 |
| 626 | 3300006871 | Ga0075434_100078710 | Ga0075434_1000787102 | 325 |
| 627 | 3300006880 | Ga0075429_100093929 | Ga0075429_1000939292 | 325 |
| 628 | 3300007076 | Ga0075435_100016217 | Ga0075435_1000162176 | 325 |
| 629 | 3300009094 | Ga0111539_10000557 | Ga0111539_1000055735 | 325 |
| 630 | 3300009094 | Ga0111539_10248176 | Ga0111539_102481762 | 325 |
| 631 | 3300009147 | Ga0114129_10061558 | Ga0114129_100615584 | 325 |
| 632 | 3300009147 | Ga0114129_10379746 | Ga0114129_103797462 | 325 |
| 633 | 3300009147 | Ga0114129_10479024 | Ga0114129_104790242 | 325 |
| 634 | 3300025910 | Ga0207684_10096540 | Ga0207684_100965403 | 325 |
| 635 | 3300025915 | Ga0207693_10010103 | Ga0207693_100101032 | 325 |
| 636 | 3300025922 | Ga0207646_10014377 | Ga0207646_100143777 | 325 |
| 637 | 3300025923 | Ga0207681_10043058 | Ga0207681_100430582 | 325 |
| 638 | 3300025941 | Ga0207711_10054531 | Ga0207711_100545312 | 325 |
| 639 | 3300026118 | Ga0207675_100034386 | Ga0207675_1000343864 | 325 |
| 640 | 3300027907 | Ga0207428_10000054 | Ga0207428_1000005489 | 325 |
| 641 | 3300027907 | Ga0207428_10163063 | Ga0207428_101630631 | 325 |
| 642 | 3300038996 | Ga0242420_023207 | Ga0242420_023207_66_1076 | 325 |
| 643 | 3300042876 | Ga0451577_0130714 | Ga0451577_0130714_57_1058 | 325 |
| 644 | 3300042876 | Ga0451577_0211712 | Ga0451577_0211712_223_1212 | 325 |
| 645 | 3300042876 | Ga0451577_0405919 | Ga0451577_0405919_73_1074 | 325 |
| 646 | 3300044673 | Ga0453683_0030684 | Ga0453683_0030684_2218_3228 | 325 |
| 647 | 3300044712 | Ga0453684_0009330 | Ga0453684_0009330_10524_11534 | 325 |
| 648 | 3300044712 | Ga0453684_0092140 | Ga0453684_0092140_65_1066 | 325 |
| 649 | 3300050507 | nmdc:mga05p37_172699_c1 | nmdc:mga05p37_172699_c1_597_1574 | 325 |
| 650 | 3300050508 | nmdc:mga09592_56420_c1 | nmdc:mga09592_56420_c1_1684_2682 | 325 |
| 651 | 3300050510 | nmdc:mga06r32_11821_c1 | nmdc:mga06r32_11821_c1_5273_6271 | 325 |
| 652 | 3300050511 | nmdc:mga08y16_254649_c1 | nmdc:mga08y16_254649_c1_623_1633 | 325 |
| 653 | 3300050511 | nmdc:mga08y16_5274_c1 | nmdc:mga08y16_5274_c1_2104_3114 | 325 |
| 654 | 3300050512 | nmdc:mga0n895_146568_c1 | nmdc:mga0n895_146568_c1_52_1041 | 325 |
| 655 | 3300050512 | nmdc:mga0n895_57551_c1 | nmdc:mga0n895_57551_c1_346_1332 | 325 |
| 656 | 3300050512 | nmdc:mga0n895_64237_c1 | nmdc:mga0n895_64237_c1_247_1257 | 325 |
| 657 | 3300050512 | nmdc:mga0n895_65148_c1 | nmdc:mga0n895_65148_c1_653_1663 | 325 |
| 658 | 3300050513 | nmdc:mga0rr50_193788_c1 | nmdc:mga0rr50_193788_c1_643_1629 | 325 |
| 659 | 3300050514 | nmdc:mga08x19_35045_c1 | nmdc:mga08x19_35045_c1_630_1616 | 325 |
| 660 | 3300050515 | nmdc:mga0a205_322849_c1 | nmdc:mga0a205_322849_c1_227_1240 | 325 |
| 661 | 3300005353 | Ga0070669_100130053 | Ga0070669_1001300532 | 326 |
| 662 | 3300005445 | Ga0070708_100010509 | Ga0070708_1000105094 | 326 |
| 663 | 3300005445 | Ga0070708_100032557 | Ga0070708_1000325573 | 326 |
| 664 | 3300005467 | Ga0070706_100077488 | Ga0070706_1000774882 | 326 |
| 665 | 3300005468 | Ga0070707_100458707 | Ga0070707_1004587072 | 326 |
| 666 | 3300005468 | Ga0070707_100550856 | Ga0070707_1005508561 | 326 |
| 667 | 3300006846 | Ga0075430_100053397 | Ga0075430_1000533971 | 326 |
| 668 | 3300006852 | Ga0075433_10245953 | Ga0075433_102459533 | 326 |
| 669 | 3300006871 | Ga0075434_100549203 | Ga0075434_1005492031 | 326 |
| 670 | 3300007076 | Ga0075435_100040978 | Ga0075435_1000409782 | 326 |
| 671 | 3300009147 | Ga0114129_10462710 | Ga0114129_104627102 | 326 |
| 672 | 3300009148 | Ga0105243_10175226 | Ga0105243_101752262 | 326 |
| 673 | 3300009174 | Ga0105241_10040435 | Ga0105241_100404352 | 326 |
| 674 | 3300009176 | Ga0105242_10228060 | Ga0105242_102280601 | 326 |
| 675 | 3300025911 | Ga0207654_10100827 | Ga0207654_101008272 | 326 |
| 676 | 3300025922 | Ga0207646_10021809 | Ga0207646_100218091 | 326 |
| 677 | 3300025923 | Ga0207681_10186358 | Ga0207681_101863581 | 326 |
| 678 | 3300025940 | Ga0207691_10040836 | Ga0207691_100408364 | 326 |
| 679 | 3300026089 | Ga0207648_10223741 | Ga0207648_102237412 | 326 |
| 680 | 3300044673 | Ga0453683_0190318 | Ga0453683_0190318_59_1051 | 326 |
| 681 | 3300046499 | Ga0495594_0047026 | Ga0495594_0047026_105_1097 | 326 |
| 682 | 3300048910 | Ga0496107_0259972 | Ga0496107_0259972_149_1141 | 326 |
| 683 | 3300050509 | nmdc:mga0qj67_255374_c1 | nmdc:mga0qj67_255374_c1_222_1205 | 326 |
| 684 | 3300050512 | nmdc:mga0n895_508716_c1 | nmdc:mga0n895_508716_c1_142_1140 | 326 |
| 685 | 3300050513 | nmdc:mga0rr50_93483_c1 | nmdc:mga0rr50_93483_c1_996_1994 | 326 |
| 686 | 3300050515 | nmdc:mga0a205_270298_c1 | nmdc:mga0a205_270298_c1_563_1561 | 326 |
| 687 | 3300005355 | Ga0070671_100150517 | Ga0070671_1001505173 | 327 |
| 688 | 3300005457 | Ga0070662_100112798 | Ga0070662_1001127982 | 327 |
| 689 | 3300005843 | Ga0068860_100525064 | Ga0068860_1005250642 | 327 |
| 690 | 3300006846 | Ga0075430_100000678 | Ga0075430_1000006782 | 327 |
| 691 | 3300006847 | Ga0075431_100000452 | Ga0075431_1000004522 | 327 |
| 692 | 3300006852 | Ga0075433_10003800 | Ga0075433_100038006 | 327 |
| 693 | 3300006852 | Ga0075433_10397558 | Ga0075433_103975581 | 327 |
| 694 | 3300006871 | Ga0075434_100005140 | Ga0075434_1000051402 | 327 |
| 695 | 3300006914 | Ga0075436_100015795 | Ga0075436_1000157955 | 327 |
| 696 | 3300007076 | Ga0075435_100056645 | Ga0075435_1000566453 | 327 |
| 697 | 3300025937 | Ga0207669_10267070 | Ga0207669_102670701 | 327 |
| 698 | 3300028381 | Ga0268264_10557296 | Ga0268264_105572962 | 327 |
| 699 | 3300031548 | Ga0307408_100007871 | Ga0307408_1000078718 | 327 |
| 700 | 3300031995 | Ga0307409_100011542 | Ga0307409_1000115424 | 327 |
| 701 | 3300037068 | Ga0373925_0290837 | Ga0373925_0290837_320_1303 | 327 |
| 702 | 3300046472 | Ga0495580_0003832 | Ga0495580_0003832_8583_9566 | 327 |
| 703 | 3300050509 | nmdc:mga0qj67_16942_c1 | nmdc:mga0qj67_16942_c1_2268_3263 | 327 |
| 704 | 3300050510 | nmdc:mga06r32_8830_c2 | nmdc:mga06r32_8830_c2_961_1956 | 327 |
| 705 | 3300006871 | Ga0075434_100582910 | Ga0075434_1005829101 | 328 |
| 706 | 3300007076 | Ga0075435_100240129 | Ga0075435_1002401292 | 328 |
| 707 | 3300009147 | Ga0114129_10028080 | Ga0114129_100280806 | 328 |
| 708 | 3300009147 | Ga0114129_10342592 | Ga0114129_103425922 | 328 |
| 709 | 3300025910 | Ga0207684_10331392 | Ga0207684_103313921 | 328 |
| 710 | 3300025922 | Ga0207646_10162679 | Ga0207646_101626793 | 328 |
| 711 | 3300035121 | Ga0373960_0035600 | Ga0373960_0035600_106_1092 | 328 |
| 712 | 3300049593 | Ga0501077_0010205 | Ga0501077_0010205_4000_4986 | 328 |
| 713 | 3300050507 | nmdc:mga05p37_22024_c1 | nmdc:mga05p37_22024_c1_5997_6983 | 328 |
| 714 | 3300050507 | nmdc:mga05p37_323142_c1 | nmdc:mga05p37_323142_c1_282_1268 | 328 |
| 715 | 3300050508 | nmdc:mga09592_53547_c1 | nmdc:mga09592_53547_c1_186_1172 | 328 |
| 716 | 3300050509 | nmdc:mga0qj67_84501_c1 | nmdc:mga0qj67_84501_c1_154_1140 | 328 |
| 717 | 3300050510 | nmdc:mga06r32_229563_c1 | nmdc:mga06r32_229563_c1_543_1529 | 328 |
| 718 | 3300050512 | nmdc:mga0n895_180354_c1 | nmdc:mga0n895_180354_c1_476_1462 | 328 |
| 719 | 3300050512 | nmdc:mga0n895_34414_c1 | nmdc:mga0n895_34414_c1_310_1296 | 328 |
| 720 | 3300050513 | nmdc:mga0rr50_20128_c1 | nmdc:mga0rr50_20128_c1_3443_4429 | 328 |
| 721 | 3300050513 | nmdc:mga0rr50_232183_c1 | nmdc:mga0rr50_232183_c1_229_1215 | 328 |
| 722 | 3300050515 | nmdc:mga0a205_12048_c1 | nmdc:mga0a205_12048_c1_1803_2789 | 328 |
| 723 | 3300050515 | nmdc:mga0a205_28565_c1 | nmdc:mga0a205_28565_c1_3777_4763 | 328 |
| 724 | 3300050515 | nmdc:mga0a205_39073_c1 | nmdc:mga0a205_39073_c1_3053_4039 | 328 |
| 725 | 3300061734 | Ga0530510_0043525 | Ga0530510_0043525_634_1620 | 328 |
| 726 | 3300005546 | Ga0070696_100120426 | Ga0070696_1001204262 | 330 |
| 727 | 3300005617 | Ga0068859_100715878 | Ga0068859_1007158781 | 330 |
| 728 | 3300006852 | Ga0075433_10008009 | Ga0075433_100080093 | 330 |
| 729 | 3300006871 | Ga0075434_100029969 | Ga0075434_1000299692 | 330 |
| 730 | 3300006871 | Ga0075434_100113841 | Ga0075434_1001138413 | 330 |
| 731 | 3300006871 | Ga0075434_100523460 | Ga0075434_1005234601 | 330 |
| 732 | 3300006931 | Ga0097620_100715770 | Ga0097620_1007157701 | 330 |
| 733 | 3300007076 | Ga0075435_100040318 | Ga0075435_1000403183 | 330 |
| 734 | 3300007076 | Ga0075435_100212135 | Ga0075435_1002121352 | 330 |
| 735 | 3300007076 | Ga0075435_100284504 | Ga0075435_1002845042 | 330 |
| 736 | 3300009094 | Ga0111539_10163932 | Ga0111539_101639323 | 330 |
| 737 | 3300027907 | Ga0207428_10087894 | Ga0207428_100878943 | 330 |
| 738 | 3300050511 | nmdc:mga08y16_131896_c1 | nmdc:mga08y16_131896_c1_993_1985 | 330 |
| 739 | 3300050512 | nmdc:mga0n895_11851_c1 | nmdc:mga0n895_11851_c1_3933_4925 | 330 |
| 740 | 3300050513 | nmdc:mga0rr50_6589_c1 | nmdc:mga0rr50_6589_c1_707_1699 | 330 |
| 741 | 3300050515 | nmdc:mga0a205_6839_c1 | nmdc:mga0a205_6839_c1_5182_6174 | 330 |
| 742 | 3300050515 | nmdc:mga0a205_75990_c1 | nmdc:mga0a205_75990_c1_381_1373 | 330 |
| 743 | 2209111006 | 2214922984 | 2213983589 | 331 |
| 744 | 3300005277 | Ga0065716_1003999 | Ga0065716_10039991 | 331 |
| 745 | 3300005290 | Ga0065712_10067794 | Ga0065712_1006779429 | 331 |
| 746 | 3300005290 | Ga0065712_10073744 | Ga0065712_100737444 | 331 |
| 747 | 3300005293 | Ga0065715_10000302 | Ga0065715_1000030223 | 331 |
| 748 | 3300005327 | Ga0070658_10193013 | Ga0070658_101930132 | 331 |
| 749 | 3300005328 | Ga0070676_10004177 | Ga0070676_100041771 | 331 |
| 750 | 3300005331 | Ga0070670_100005591 | Ga0070670_1000055918 | 331 |
| 751 | 3300005338 | Ga0068868_100050777 | Ga0068868_1000507773 | 331 |
| 752 | 3300005341 | Ga0070691_10051994 | Ga0070691_100519942 | 331 |
| 753 | 3300005347 | Ga0070668_100022166 | Ga0070668_1000221661 | 331 |
| 754 | 3300005355 | Ga0070671_100011289 | Ga0070671_1000112894 | 331 |
| 755 | 3300005364 | Ga0070673_100009277 | Ga0070673_1000092775 | 331 |
| 756 | 3300005366 | Ga0070659_100173101 | Ga0070659_1001731012 | 331 |
| 757 | 3300005439 | Ga0070711_100044173 | Ga0070711_1000441733 | 331 |
| 758 | 3300005445 | Ga0070708_100009904 | Ga0070708_1000099047 | 331 |
| 759 | 3300005455 | Ga0070663_100227957 | Ga0070663_1002279571 | 331 |
| 760 | 3300005457 | Ga0070662_100019928 | Ga0070662_1000199284 | 331 |
| 761 | 3300005457 | Ga0070662_100021528 | Ga0070662_1000215284 | 331 |
| 762 | 3300005458 | Ga0070681_10002879 | Ga0070681_100028798 | 331 |
| 763 | 3300005518 | Ga0070699_100225138 | Ga0070699_1002251382 | 331 |
| 764 | 3300005530 | Ga0070679_100047324 | Ga0070679_1000473245 | 331 |
| 765 | 3300005536 | Ga0070697_100035132 | Ga0070697_1000351323 | 331 |
| 766 | 3300005563 | Ga0068855_100031423 | Ga0068855_1000314236 | 331 |
| 767 | 3300005564 | Ga0070664_100002604 | Ga0070664_10000260412 | 331 |
| 768 | 3300005578 | Ga0068854_100092671 | Ga0068854_1000926713 | 331 |
| 769 | 3300006175 | Ga0070712_100093727 | Ga0070712_1000937273 | 331 |
| 770 | 3300006237 | Ga0097621_100065873 | Ga0097621_1000658731 | 331 |
| 771 | 3300006844 | Ga0075428_100137898 | Ga0075428_1001378982 | 331 |
| 772 | 3300006852 | Ga0075433_10170332 | Ga0075433_101703323 | 331 |
| 773 | 3300006871 | Ga0075434_100049867 | Ga0075434_1000498675 | 331 |
| 774 | 3300006881 | Ga0068865_100026816 | Ga0068865_1000268163 | 331 |
| 775 | 3300007076 | Ga0075435_100013001 | Ga0075435_1000130015 | 331 |
| 776 | 3300007265 | Ga0099794_10049142 | Ga0099794_100491423 | 331 |
| 777 | 3300009094 | Ga0111539_10327515 | Ga0111539_103275152 | 331 |
| 778 | 3300009094 | Ga0111539_10367544 | Ga0111539_103675441 | 331 |
| 779 | 3300009147 | Ga0114129_10309773 | Ga0114129_103097732 | 331 |
| 780 | 3300009147 | Ga0114129_10411631 | Ga0114129_104116312 | 331 |
| 781 | 3300009174 | Ga0105241_10068787 | Ga0105241_100687873 | 331 |
| 782 | 3300009176 | Ga0105242_10198533 | Ga0105242_101985331 | 331 |
| 783 | 3300009176 | Ga0105242_10272672 | Ga0105242_102726722 | 331 |
| 784 | 3300009553 | Ga0105249_10239632 | Ga0105249_102396322 | 331 |
| 785 | 3300010375 | Ga0105239_10357149 | Ga0105239_103571492 | 331 |
| 786 | 3300011119 | Ga0105246_10054413 | Ga0105246_100544133 | 331 |
| 787 | 3300013100 | Ga0157373_10112894 | Ga0157373_101128942 | 331 |
| 788 | 3300013296 | Ga0157374_10069604 | Ga0157374_100696043 | 331 |
| 789 | 3300013297 | Ga0157378_10020644 | Ga0157378_100206442 | 331 |
| 790 | 3300013306 | Ga0163162_10056936 | Ga0163162_100569361 | 331 |
| 791 | 3300013306 | Ga0163162_10245008 | Ga0163162_102450081 | 331 |
| 792 | 3300013307 | Ga0157372_10334191 | Ga0157372_103341912 | 331 |
| 793 | 3300014969 | Ga0157376_10282256 | Ga0157376_102822561 | 331 |
| 794 | 3300025315 | Ga0207697_10013998 | Ga0207697_100139983 | 331 |
| 795 | 3300025907 | Ga0207645_10003317 | Ga0207645_100033174 | 331 |
| 796 | 3300025909 | Ga0207705_10170128 | Ga0207705_101701281 | 331 |
| 797 | 3300025912 | Ga0207707_10061944 | Ga0207707_100619442 | 331 |
| 798 | 3300025915 | Ga0207693_10126656 | Ga0207693_101266561 | 331 |
| 799 | 3300025919 | Ga0207657_10053475 | Ga0207657_100534751 | 331 |
| 800 | 3300025920 | Ga0207649_10021044 | Ga0207649_100210441 | 331 |
| 801 | 3300025921 | Ga0207652_10008998 | Ga0207652_100089987 | 331 |
| 802 | 3300025923 | Ga0207681_10061243 | Ga0207681_100612433 | 331 |
| 803 | 3300025925 | Ga0207650_10007400 | Ga0207650_100074001 | 331 |
| 804 | 3300025925 | Ga0207650_10056804 | Ga0207650_100568042 | 331 |
| 805 | 3300025933 | Ga0207706_10005505 | Ga0207706_100055051 | 331 |
| 806 | 3300025933 | Ga0207706_10010676 | Ga0207706_100106766 | 331 |
| 807 | 3300025945 | Ga0207679_10180775 | Ga0207679_101807752 | 331 |
| 808 | 3300025960 | Ga0207651_10225090 | Ga0207651_102250902 | 331 |
| 809 | 3300025972 | Ga0207668_10245038 | Ga0207668_102450381 | 331 |
| 810 | 3300025981 | Ga0207640_10038096 | Ga0207640_100380962 | 331 |
| 811 | 3300025986 | Ga0207658_10247393 | Ga0207658_102473932 | 331 |
| 812 | 3300026067 | Ga0207678_10124647 | Ga0207678_101246472 | 331 |
| 813 | 3300026067 | Ga0207678_10203816 | Ga0207678_102038162 | 331 |
| 814 | 3300026075 | Ga0207708_10038044 | Ga0207708_100380441 | 331 |
| 815 | 3300026121 | Ga0207683_10000890 | Ga0207683_100008904 | 331 |
| 816 | 3300027671 | Ga0209588_1010717 | Ga0209588_10107173 | 331 |
| 817 | 3300027671 | Ga0209588_1016016 | Ga0209588_10160163 | 331 |
| 818 | 3300027907 | Ga0207428_10030997 | Ga0207428_100309973 | 331 |
| 819 | 3300035691 | Ga0373931_0009693 | Ga0373931_0009693_3272_4267 | 331 |
| 820 | 3300042876 | Ga0451577_0145074 | Ga0451577_0145074_277_1272 | 331 |
| 821 | 3300044712 | Ga0453684_0141440 | Ga0453684_0141440_237_1232 | 331 |
| 822 | 3300048913 | Ga0496110_0182036 | Ga0496110_0182036_638_1633 | 331 |
| 823 | 3300048915 | Ga0496112_0005186 | Ga0496112_0005186_2646_3641 | 331 |
| 824 | 3300048915 | Ga0496112_0006117 | Ga0496112_0006117_356_1351 | 331 |
| 825 | 3300050507 | nmdc:mga05p37_106287_c1 | nmdc:mga05p37_106287_c1_2230_3225 | 331 |
| 826 | 3300050511 | nmdc:mga08y16_113813_c1 | nmdc:mga08y16_113813_c1_545_1540 | 331 |
| 827 | 3300050512 | nmdc:mga0n895_34169_c1 | nmdc:mga0n895_34169_c1_96_1091 | 331 |
| 828 | 3300050513 | nmdc:mga0rr50_1138_c1 | nmdc:mga0rr50_1138_c1_5248_6243 | 331 |
| 829 | 3300050513 | nmdc:mga0rr50_183295_c1 | nmdc:mga0rr50_183295_c1_476_1486 | 331 |
| 830 | 3300050515 | nmdc:mga0a205_44053_c1 | nmdc:mga0a205_44053_c1_1406_2401 | 331 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5oku-assembly1.cif.gz_A | r. palustris rpa4515 with adipate | 0.9012 | 31 | 331 |
| 8hkb-assembly1.cif.gz_A | tpa bound-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis mutant k184d | 0.8964 | 34 | 331 |
| 5oku-assembly1.cif.gz_A | r. palustris rpa4515 with adipate | 0.8927 | 31 | 331 |
| 2dvz-assembly1.cif.gz_A | structure of a periplasmic transporter | 0.8897 | 31 | 329 |
| 2qpq-assembly2.cif.gz_B | structure of bug27 from bordetella pertussis | 0.8832 | 31 | 331 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4x9tA02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9522 | 129 | 256 | 3.40.190.10 |
| 4x9tA02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.937 | 129 | 256 | 3.40.190.10 |
| 2qpqC02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8839 | 129 | 256 | 3.40.190.10 |
| 2dvzA02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8764 | 129 | 253 | 3.40.190.10 |
| 2qpqC02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8709 | 129 | 256 | 3.40.190.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A536ZIM3-F1-model_v4 | 2Fe-2S iron-sulfur cluster binding domain-containing protein | 0.9432 | 67 | 328 |
GO:0051537
|
| AF-A0A258K2P3-F1-model_v4 | Tricarboxylate transporter | 0.9423 | 23 | 286 |
|
| AF-A0A2S5P4Q9-F1-model_v4 | Tripartite tricarboxylate transporter substrate binding protein | 0.9347 | 23 | 331 |
|
| AF-A0A519I8E8-F1-model_v4 | deleted | 0.9344 | 118 | 327 |
|
| AF-A0A4P5U297-F1-model_v4 | Tricarboxylate transporter | 0.9319 | 20 | 331 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar