F482557
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 828 | 436 | 758 | 436 |
Family's Representative Sequence
| Representative Sequence | 3300026067|Ga0207678_10044128|Ga0207678_100441284 |
| Length | 478 |
| Sequence | MRFPPLAGRLPCQAGLAYMKTGFCNETWLPPHVRKESSQVAVIVALETSDIRFPTSRELDGSDAMNPDPDYSAAYVVLRTDDPSGLSGHGFVFTIGRGNDVQTAALTALRHLVVGRDVAGVLDDLGAFARSLTNDSQLRWLGPEKGVMHMAIGAVINAAWDMAARRAGKPVWRLIAEMSPEQIVDLIDFRYISDALTPADALAILRASAPHKAERIATLLSRGYAAYTTSPGWLGYSDEKLARLAVEAVEQGFRTIKLKVGLTVEDDIRRLRIARQAIGPAIGLAIDANQRWDVGVACAWLQQLASFDVAWIEEPTSPDDVLGHAAIRRAVAPMPVSTGEHTQNRVIFKQLFQAGAVDLIQIDAARVGGVNENLAILLMAAKFGIRVYPHAGGVGLCELVQHLAMADYVAISGSMEDRAIEYVDHLHEHFVDPVRIRAGRYLAPLAPGFSAEMRPQSLAQYRFPDGPVWLTSPPGASR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2523231044 | Gordonia rhizosphera NBRC 16068 | Isolate | Rhizosphere |
| 3 | 2551306166 | Nocardia tenerifensis NBRC 101015 | Isolate | Rhizosphere |
| 4 | 2558860280 | Kutzneria sp. 744 | Isolate | Unclassified |
| 5 | 2582581314 | Streptomyces mirabilis YR139 | Isolate | Rhizosphere |
| 6 | 2585427649 | Amycolatopsis japonica MG417-CF17, DSM 44213 | Isolate | Unclassified |
| 7 | 2643221578 | Streptomyces sp. Root63 | Isolate | Unclassified |
| 8 | 2643221673 | Streptomyces sp. Root1295 | Isolate | Unclassified |
| 9 | 2643221677 | Streptomyces sp. Root1304 | Isolate | Unclassified |
| 10 | 2643221678 | Streptomyces sp. Root1310 | Isolate | Unclassified |
| 11 | 2643221714 | Streptomyces sp. Root264 | Isolate | Unclassified |
| 12 | 2643221962 | Aeromicrobium sp. Root344 | Isolate | Unclassified |
| 13 | 2747842501 | Xanthomonas sp. WCS2014-23 | Isolate | Unclassified |
| 14 | 2751185734 | Saccharothrix sp. NRRL B-16314 | Isolate | Rhizosphere |
| 15 | 2784746763 | Streptomyces ossamyceticus SAI-001 | Isolate | Unclassified |
| 16 | 2784746768 | Streptomyces griseorubiginosus SAI-142 | Isolate | Unclassified |
| 17 | 2791354901 | Actinophytocola xanthii 11-183 | Isolate | Rhizosphere |
| 18 | 2808606359 | Streptomyces sp. RJA2910 | Isolate | Unclassified |
| 19 | 2808606375 | Streptomyces sp. SLBN-31 | Isolate | Unclassified |
| 20 | 2808606522 | Amycolatopsis sp. BJA-103 | Isolate | Unclassified |
| 21 | 2818991440 | Luteibacter yeojuensis 583 | Isolate | Unclassified |
| 22 | 2818991457 | Xanthomonas translucens 569 | Isolate | Unclassified |
| 23 | 2821443989 | Inquilinus ginsengisoli 584 | Isolate | Unclassified |
| 24 | 2842914999 | Luteibacter sp. R-72151 | Isolate | Unclassified |
| 25 | 2842918807 | Luteibacter sp. R-73110 | Isolate | Unclassified |
| 26 | 2844533157 | Inquilinus sp. R-72501 v. 2 | Isolate | Unclassified |
| 27 | 2852635781 | Streptomyces sp. AK010 | Isolate | Rhizosphere |
| 28 | 2852684882 | Xanthomonas sp. JAI131 | Isolate | Rhizosphere |
| 29 | 2857740372 | Paenarthrobacter sp. R-74611 | Isolate | Unclassified |
| 30 | 2862382967 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 31 | 2863404153 | Streptomyces scabiei SAI-025 (Annotation) (version 2) | Isolate | Unclassified |
| 32 | 2867346516 | Streptomyces radicis AZ1-7 | Isolate | Unclassified |
| 33 | 2867507094 | Micromonospora zingiberis PLAI 1-1 | Isolate | Unclassified |
| 34 | 2868088558 | Phytoactinopolyspora endophytica EGI 60009 | Isolate | Unclassified |
| 35 | 2894414249 | Luteimonas sp. LNNU 24178 | Isolate | Rhizosphere |
| 36 | 2904463128 | Luteibacter yeojuensis 3191 | Isolate | Unclassified |
| 37 | 2904497146 | Arthrobacter sp. 1276 | Isolate | Rhizosphere |
| 38 | 2915768154 | Amycolatopsis pittospori PIP199 | Isolate | Unclassified |
| 39 | 2917736166 | Amycolatopsis dendrobii DR6-1 | Isolate | Unclassified |
| 40 | 2918501144 | Streptomyces sp. PvR006 | Isolate | Rhizosphere |
| 41 | 2919130084 | Xanthomonas sp. 1678 | Isolate | Rhizosphere |
| 42 | 2919538618 | Paenarthrobacter nitroguajacolicus 3945 | Isolate | Unclassified |
| 43 | 2928963466 | Dyella japonica 1073 | Isolate | Unclassified |
| 44 | 2929195423 | Xanthomonas sp. R-73098 Hybrid assembly | Isolate | Unclassified |
| 45 | 2932426870 | Paenarthrobacter sp. 4246 | Isolate | Rhizosphere |
| 46 | 2933418574 | Jeotgalibacillus campisalis 4120 | Isolate | Rhizosphere |
| 47 | 2939674588 | Arthrobacter bambusae 3552 | Isolate | Rhizosphere |
| 48 | 2941471342 | Luteibacter sp. 621 | Isolate | Unclassified |
| 49 | 2947224130 | Streptomyces afghaniensis W1I20 | Isolate | Rhizosphere |
| 50 | 2953994433 | Luteibacter sp. W1I16 | Isolate | Rhizosphere |
| 51 | 2954380949 | Streptomyces ciscaucasicus W1I15 | Isolate | Rhizosphere |
| 52 | 2954711539 | Streptomyces sp. SAI-090 | Isolate | Rhizosphere |
| 53 | 2954721474 | Streptomyces sp. SAI-117 | Isolate | Rhizosphere |
| 54 | 2954731030 | Streptomyces sp. SAI-133 | Isolate | Rhizosphere |
| 55 | 2954740390 | Streptomyces sp. SAI-041 | Isolate | Rhizosphere |
| 56 | 2954749733 | Streptomyces sp. SAI-135 | Isolate | Rhizosphere |
| 57 | 2954759201 | Streptomyces sp. SAI-208 | Isolate | Rhizosphere |
| 58 | 2990059506 | Streptomyces sp. CAP261 | Isolate | Unclassified |
| 59 | 3006493962 | Streptomyces grisecoloratus TRM S81-3 | Isolate | Rhizosphere |
| 60 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 61 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 62 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 63 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 64 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 65 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 66 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 67 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 68 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 69 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 70 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 71 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 72 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 73 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 74 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 75 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 76 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 77 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 78 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 79 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 80 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 81 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 82 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 83 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 84 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 85 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 88 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 90 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 91 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 93 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 101 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 102 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 104 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 109 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 110 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 111 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 112 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 113 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 114 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 115 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 116 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 117 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 118 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 119 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 120 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 121 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 122 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 123 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 124 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 125 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 126 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 127 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 128 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 129 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 130 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 131 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 132 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 133 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 134 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 135 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 136 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 138 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 139 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 140 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 141 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 142 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 143 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 144 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 145 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 146 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 148 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 149 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 150 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 151 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 152 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 153 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 155 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 157 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 158 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 159 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 160 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 161 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 162 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 163 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 164 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 165 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 168 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 169 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 170 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 171 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 172 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 173 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 174 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 175 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 176 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 177 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 178 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 179 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 180 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 181 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 182 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 183 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 184 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 185 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 186 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 187 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 188 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 189 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 190 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 191 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 192 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 193 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 194 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 195 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 196 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 197 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 198 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 199 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 200 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 201 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 248 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 249 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 253 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 254 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 255 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 256 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 257 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 258 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 259 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 260 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 261 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 262 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 263 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 264 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 265 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 266 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 267 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 268 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 269 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 270 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 271 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 272 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 273 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 274 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 275 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 276 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 277 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 278 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 279 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 280 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 281 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 282 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 283 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 284 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 285 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 286 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 287 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 288 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 289 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 290 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 291 | 3300044661 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COC2E | Metagenome | Unclassified |
| 292 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 293 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 294 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 295 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 296 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 297 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 298 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 299 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 300 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 301 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 302 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 303 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 356 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 357 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 358 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 359 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 360 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 361 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 362 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 363 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 364 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 365 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 366 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 367 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 368 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 369 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 370 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 371 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 372 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 373 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 374 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 375 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 376 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 377 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 379 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 380 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 381 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 382 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 385 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 386 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 387 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 388 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 389 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 390 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 391 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 392 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 393 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 394 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 395 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 396 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 397 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 398 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 399 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 400 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 402 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 403 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 404 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 405 | 3300053101 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere | Metagenome | Endosphere |
| 406 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 407 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 408 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 409 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 410 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 411 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 412 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 413 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 414 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 415 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 416 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 417 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 418 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 419 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 420 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 421 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 422 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 423 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 424 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 425 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 426 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 427 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 428 | 8001781756 | Catellatospora tritici NEAU-YM18 | Isolate | Rhizosphere |
| 429 | 8003314358 | Amycolatopsis sp. MtRt-6 | Isolate | Unclassified |
| 430 | 8008558824 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 431 | 8008574985 | Streptomyces sp. Jing01 | Isolate | Rhizosphere |
| 432 | 8021622325 | Xanthomonas sp. LMG12462 | Isolate | Rhizosphere |
| 433 | 8021626552 | Xanthomonas sp. LMG12460 | Isolate | Rhizosphere |
| 434 | 8021648035 | Xanthomonas sp. LMG 12461 | Isolate | Rhizosphere |
| 435 | 8047710418 | Umezawaea endophytica DSM 103496 | Isolate | Unclassified |
| 436 | 8048406513 | Streptomyces heilongjiangensis NEAU-W2 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.3 |
| Metatranscriptomes | 0.36 |
| Isolates | 8.33 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.2 |
| Nodule | 0.36 |
| Rhizoplane | 2.66 |
| Rhizosphere | 68.12 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 16.67 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_764990 | 2162886007 | Bacteria | 3452 |
| 2 | JGI24741J21665_1007211 | 3300001915 | Bacteria | 2169 |
| 3 | JGI24739J22299_10001025 | 3300001989 | Bacteria | 10335 |
| 4 | JGI24737J22298_10000523 | 3300001990 | Bacteria | 13484 |
| 5 | JGI24735J21928_10001024 | 3300002067 | Bacteria | 9999 |
| 6 | JGI25156J39149_1001399 | 3300002705 | Bacteria | 10286 |
| 7 | JGI25156J39149_1004432 | 3300002705 | Bacteria | 4276 |
| 8 | JGI25162J39368_1000066 | 3300002737 | Bacteria | 130612 |
| 9 | JGI25162J39368_1000623 | 3300002737 | Bacteria | 25375 |
| 10 | JGI25162J39368_1003666 | 3300002737 | Bacteria | 4206 |
| 11 | JGI25157J39369_1000050 | 3300002741 | Bacteria | 114470 |
| 12 | JGI25157J39369_1000688 | 3300002741 | Bacteria | 18357 |
| 13 | JGI25157J39369_1001266 | 3300002741 | Bacteria | 10287 |
| 14 | JGI25157J39369_1002251 | 3300002741 | Bacteria | 5181 |
| 15 | JGI25163J39215_1000565 | 3300002771 | Bacteria | 10522 |
| 16 | JGI25164J39214_1000056 | 3300002772 | Bacteria | 114468 |
| 17 | JGI25164J39214_1000061 | 3300002772 | Bacteria | 110617 |
| 18 | JGI25159J45721_1008856 | 3300002987 | Bacteria | 2718 |
| 19 | JGI25151J46595_10000179 | 3300003187 | Bacteria | 80108 |
| 20 | JGI25165J46597_1000009 | 3300003214 | Bacteria | 467965 |
| 21 | JGI25165J46597_1000151 | 3300003214 | Bacteria | 114835 |
| 22 | rootH1_10019244 | 3300003316 | Bacteria | 3077 |
| 23 | JGI25160J50197_1001998 | 3300003354 | Bacteria | 9735 |
| 24 | Ga0006562J51391_1045775 | 3300003578 | Bacteria | 4160 |
| 25 | Ga0006562J51391_1045778 | 3300003578 | Bacteria | 9200 |
| 26 | Ga0055538_1001312 | 3300003751 | Bacteria | 5021 |
| 27 | Ga0055533_1001372 | 3300003756 | Bacteria | 6505 |
| 28 | Ga0055525_1000261 | 3300003759 | Bacteria | 50483 |
| 29 | Ga0055527_1000271 | 3300003760 | Bacteria | 31313 |
| 30 | Ga0055527_1000273 | 3300003760 | Bacteria | 30913 |
| 31 | Ga0055535_1000045 | 3300003761 | Bacteria | 140688 |
| 32 | Ga0055535_1000466 | 3300003761 | Bacteria | 37034 |
| 33 | Ga0055535_1000567 | 3300003761 | Bacteria | 31313 |
| 34 | Ga0055535_1000574 | 3300003761 | Bacteria | 30913 |
| 35 | Ga0055542_1000010 | 3300003762 | Bacteria | 414813 |
| 36 | Ga0055542_1000079 | 3300003762 | Bacteria | 130623 |
| 37 | Ga0055542_1000104 | 3300003762 | Bacteria | 113323 |
| 38 | Ga0055542_1000591 | 3300003762 | Bacteria | 31313 |
| 39 | Ga0055542_1000597 | 3300003762 | Bacteria | 30913 |
| 40 | Ga0055542_1000689 | 3300003762 | Bacteria | 26733 |
| 41 | Ga0055529_1000122 | 3300003763 | Bacteria | 114462 |
| 42 | Ga0055529_1000140 | 3300003763 | Bacteria | 102393 |
| 43 | Ga0055529_1000556 | 3300003763 | Bacteria | 31313 |
| 44 | Ga0055529_1000815 | 3300003763 | Bacteria | 18794 |
| 45 | Ga0055529_1003401 | 3300003763 | Bacteria | 2647 |
| 46 | Ga0058692_1000054 | 3300003856 | Bacteria | 106871 |
| 47 | Ga0065165_1000186 | 3300005262 | Bacteria | 108712 |
| 48 | Ga0065165_1004668 | 3300005262 | Bacteria | 8280 |
| 49 | Ga0065704_10074189 | 3300005289 | Bacteria | 6462 |
| 50 | Ga0070670_100000709 | 3300005331 | Bacteria | 25835 |
| 51 | Ga0070670_100021401 | 3300005331 | Bacteria | 5564 |
| 52 | Ga0070666_10000005 | 3300005335 | Bacteria | 343092 |
| 53 | Ga0070666_10000147 | 3300005335 | Bacteria | 48216 |
| 54 | Ga0070666_10083483 | 3300005335 | Bacteria | 2185 |
| 55 | Ga0070680_100001573 | 3300005336 | Bacteria | 16644 |
| 56 | Ga0070660_100067459 | 3300005339 | Bacteria | 2787 |
| 57 | Ga0070691_10000632 | 3300005341 | Bacteria | 13561 |
| 58 | Ga0070687_100021419 | 3300005343 | Bacteria | 3038 |
| 59 | Ga0070661_100009253 | 3300005344 | Bacteria | 6811 |
| 60 | Ga0070692_10035014 | 3300005345 | Bacteria | 2540 |
| 61 | Ga0070669_100042507 | 3300005353 | Bacteria | 3307 |
| 62 | Ga0070671_100009724 | 3300005355 | Bacteria | 7724 |
| 63 | Ga0070671_100032205 | 3300005355 | Bacteria | 4335 |
| 64 | Ga0070674_100001468 | 3300005356 | Bacteria | 12579 |
| 65 | Ga0070674_100057277 | 3300005356 | Bacteria | 2705 |
| 66 | Ga0070673_100010330 | 3300005364 | Bacteria | 6315 |
| 67 | Ga0070659_100127592 | 3300005366 | Bacteria | 2064 |
| 68 | Ga0070667_100006541 | 3300005367 | Bacteria | 9687 |
| 69 | Ga0070667_100079789 | 3300005367 | Bacteria | 2798 |
| 70 | Ga0070667_100082098 | 3300005367 | Bacteria | 2759 |
| 71 | Ga0070667_100126000 | 3300005367 | Bacteria | 2232 |
| 72 | Ga0070667_100216073 | 3300005367 | Bacteria | 1705 |
| 73 | Ga0070714_100027069 | 3300005435 | Bacteria | 4744 |
| 74 | Ga0070713_100001768 | 3300005436 | Bacteria | 13947 |
| 75 | Ga0070713_100003503 | 3300005436 | Bacteria | 10362 |
| 76 | Ga0070710_10000323 | 3300005437 | Bacteria | 22852 |
| 77 | Ga0070710_10063104 | 3300005437 | Bacteria | 2116 |
| 78 | Ga0070711_100183443 | 3300005439 | Bacteria | 1603 |
| 79 | Ga0070694_100085307 | 3300005444 | Bacteria | 2205 |
| 80 | Ga0070708_100047508 | 3300005445 | Bacteria | 3792 |
| 81 | Ga0070663_100021139 | 3300005455 | Bacteria | 4323 |
| 82 | Ga0070678_100001774 | 3300005456 | Bacteria | 11622 |
| 83 | Ga0070662_100014343 | 3300005457 | Bacteria | 5292 |
| 84 | Ga0070662_100057419 | 3300005457 | Bacteria | 2828 |
| 85 | Ga0070681_10000170 | 3300005458 | Bacteria | 49540 |
| 86 | Ga0070681_10009451 | 3300005458 | Bacteria | 9595 |
| 87 | Ga0070681_10081342 | 3300005458 | Bacteria | 3195 |
| 88 | Ga0070681_10193030 | 3300005458 | Bacteria | 1956 |
| 89 | Ga0068867_100108573 | 3300005459 | Bacteria | 2129 |
| 90 | Ga0070707_100077171 | 3300005468 | Bacteria | 3214 |
| 91 | Ga0070707_100170508 | 3300005468 | Bacteria | 2121 |
| 92 | Ga0070698_100030003 | 3300005471 | Bacteria | 5642 |
| 93 | Ga0070698_100184645 | 3300005471 | Bacteria | 2023 |
| 94 | Ga0070699_100113580 | 3300005518 | Bacteria | 2379 |
| 95 | Ga0070679_100000161 | 3300005530 | Bacteria | 53878 |
| 96 | Ga0070679_100092018 | 3300005530 | Bacteria | 3020 |
| 97 | Ga0070697_100000007 | 3300005536 | Bacteria | 197603 |
| 98 | Ga0068853_100020326 | 3300005539 | Bacteria | 5521 |
| 99 | Ga0070672_100034073 | 3300005543 | Bacteria | 3862 |
| 100 | Ga0070696_100068800 | 3300005546 | Bacteria | 2486 |
| 101 | Ga0070665_100003246 | 3300005548 | Bacteria | 17482 |
| 102 | Ga0070665_100013154 | 3300005548 | Bacteria | 8334 |
| 103 | Ga0070665_100021493 | 3300005548 | Bacteria | 6487 |
| 104 | Ga0070665_100033725 | 3300005548 | Bacteria | 5150 |
| 105 | Ga0070665_100290682 | 3300005548 | Bacteria | 1637 |
| 106 | Ga0068855_100012081 | 3300005563 | Bacteria | 10436 |
| 107 | Ga0068855_100146328 | 3300005563 | Bacteria | 2689 |
| 108 | Ga0068857_100000189 | 3300005577 | Bacteria | 39655 |
| 109 | Ga0068857_100131461 | 3300005577 | Bacteria | 2258 |
| 110 | Ga0068854_100000400 | 3300005578 | Bacteria | 27305 |
| 111 | Ga0068856_100001887 | 3300005614 | Bacteria | 21829 |
| 112 | Ga0068856_100001910 | 3300005614 | Bacteria | 21723 |
| 113 | Ga0068856_100086528 | 3300005614 | Bacteria | 3114 |
| 114 | Ga0068856_100226350 | 3300005614 | Bacteria | 1886 |
| 115 | Ga0070702_100003651 | 3300005615 | Bacteria | 6924 |
| 116 | Ga0070702_100085281 | 3300005615 | Bacteria | 1902 |
| 117 | Ga0068852_100036452 | 3300005616 | Bacteria | 4115 |
| 118 | Ga0068852_100037179 | 3300005616 | Bacteria | 4080 |
| 119 | Ga0068852_100241121 | 3300005616 | Bacteria | 1728 |
| 120 | Ga0068859_100000211 | 3300005617 | Bacteria | 58042 |
| 121 | Ga0068859_100078206 | 3300005617 | Bacteria | 3348 |
| 122 | Ga0068861_100034981 | 3300005719 | Bacteria | 3718 |
| 123 | Ga0068851_10026780 | 3300005834 | Bacteria | 2836 |
| 124 | Ga0068851_10027552 | 3300005834 | Bacteria | 2801 |
| 125 | Ga0068863_100000545 | 3300005841 | Bacteria | 38315 |
| 126 | Ga0068863_100000714 | 3300005841 | Bacteria | 33402 |
| 127 | Ga0068863_100003996 | 3300005841 | Bacteria | 14561 |
| 128 | Ga0068863_100010821 | 3300005841 | Bacteria | 8846 |
| 129 | Ga0068858_100000534 | 3300005842 | Bacteria | 39680 |
| 130 | Ga0068858_100001471 | 3300005842 | Bacteria | 24254 |
| 131 | Ga0068858_100005568 | 3300005842 | Bacteria | 12322 |
| 132 | Ga0068858_100006060 | 3300005842 | Bacteria | 11787 |
| 133 | Ga0068858_100023029 | 3300005842 | Bacteria | 5809 |
| 134 | Ga0068858_100160059 | 3300005842 | Bacteria | 2120 |
| 135 | Ga0068858_100245519 | 3300005842 | Bacteria | 1699 |
| 136 | Ga0068860_100000185 | 3300005843 | Bacteria | 99579 |
| 137 | Ga0068860_100000296 | 3300005843 | Bacteria | 69084 |
| 138 | Ga0068860_100004169 | 3300005843 | Bacteria | 14821 |
| 139 | Ga0068862_100022786 | 3300005844 | Bacteria | 5240 |
| 140 | Ga0068862_100126546 | 3300005844 | Bacteria | 2256 |
| 141 | Ga0068862_100135608 | 3300005844 | Bacteria | 2181 |
| 142 | Ga0081455_10203969 | 3300005937 | Bacteria | 1478 |
| 143 | Ga0081539_10001103 | 3300005985 | Bacteria | 49011 |
| 144 | Ga0081539_10004763 | 3300005985 | Bacteria | 14649 |
| 145 | Ga0070717_10026850 | 3300006028 | Bacteria | 4598 |
| 146 | Ga0070712_100009921 | 3300006175 | Bacteria | 6002 |
| 147 | Ga0070712_100044833 | 3300006175 | Bacteria | 3051 |
| 148 | Ga0097621_100009537 | 3300006237 | Bacteria | 7051 |
| 149 | Ga0075370_10021614 | 3300006353 | Bacteria | 3525 |
| 150 | Ga0068871_100031726 | 3300006358 | Bacteria | 4169 |
| 151 | Ga0068871_100170807 | 3300006358 | Bacteria | 1864 |
| 152 | Ga0075428_100004781 | 3300006844 | Bacteria | 15003 |
| 153 | Ga0075430_100003642 | 3300006846 | Bacteria | 12925 |
| 154 | Ga0075430_100013534 | 3300006846 | Bacteria | 6955 |
| 155 | Ga0075430_100030472 | 3300006846 | Bacteria | 4583 |
| 156 | Ga0075431_100004593 | 3300006847 | Bacteria | 13549 |
| 157 | Ga0075431_100035498 | 3300006847 | Bacteria | 5133 |
| 158 | Ga0075433_10011817 | 3300006852 | Bacteria | 7032 |
| 159 | Ga0075434_100113754 | 3300006871 | Bacteria | 2718 |
| 160 | Ga0075434_100161682 | 3300006871 | Bacteria | 2259 |
| 161 | Ga0075429_100044196 | 3300006880 | Bacteria | 3875 |
| 162 | Ga0075436_100005578 | 3300006914 | Bacteria | 8638 |
| 163 | Ga0075436_100015010 | 3300006914 | Bacteria | 5310 |
| 164 | Ga0075436_100022323 | 3300006914 | Bacteria | 4346 |
| 165 | Ga0075436_100125169 | 3300006914 | Bacteria | 1800 |
| 166 | Ga0097620_100000211 | 3300006931 | Bacteria | 58042 |
| 167 | Ga0097620_100078212 | 3300006931 | Bacteria | 3348 |
| 168 | Ga0097620_100082292 | 3300006931 | Bacteria | 3262 |
| 169 | Ga0075435_100070676 | 3300007076 | Bacteria | 2849 |
| 170 | Ga0075435_100128319 | 3300007076 | Bacteria | 2121 |
| 171 | Ga0099794_10045384 | 3300007265 | Bacteria | 2103 |
| 172 | Ga0099795_10000019 | 3300007788 | Bacteria | 59295 |
| 173 | Ga0099795_10001057 | 3300007788 | Bacteria | 5683 |
| 174 | Ga0105251_10000362 | 3300009011 | Bacteria | 44619 |
| 175 | Ga0105250_10003540 | 3300009092 | Bacteria | 7356 |
| 176 | Ga0105240_10000002 | 3300009093 | Bacteria | 1924170 |
| 177 | Ga0105240_10000628 | 3300009093 | Bacteria | 65065 |
| 178 | Ga0105240_10005363 | 3300009093 | Bacteria | 19127 |
| 179 | Ga0105240_10007085 | 3300009093 | Bacteria | 16344 |
| 180 | Ga0111539_10026149 | 3300009094 | Bacteria | 7143 |
| 181 | Ga0111539_10122454 | 3300009094 | Bacteria | 3048 |
| 182 | Ga0111539_10415366 | 3300009094 | Bacteria | 1567 |
| 183 | Ga0105247_10000260 | 3300009101 | Bacteria | 48812 |
| 184 | Ga0105247_10026927 | 3300009101 | Bacteria | 3475 |
| 185 | Ga0105247_10039195 | 3300009101 | Bacteria | 2894 |
| 186 | Ga0114129_10001468 | 3300009147 | Bacteria | 31889 |
| 187 | Ga0114129_10004447 | 3300009147 | Bacteria | 19780 |
| 188 | Ga0114129_10189004 | 3300009147 | Bacteria | 2798 |
| 189 | Ga0114129_10225027 | 3300009147 | Bacteria | 2529 |
| 190 | Ga0114129_10445042 | 3300009147 | Bacteria | 1700 |
| 191 | Ga0105241_10011751 | 3300009174 | Bacteria | 6429 |
| 192 | Ga0105241_10047992 | 3300009174 | Bacteria | 3248 |
| 193 | Ga0105242_10099665 | 3300009176 | Bacteria | 2459 |
| 194 | Ga0105248_10001076 | 3300009177 | Bacteria | 30156 |
| 195 | Ga0105248_10126373 | 3300009177 | Bacteria | 2884 |
| 196 | Ga0105237_10000007 | 3300009545 | Bacteria | 367690 |
| 197 | Ga0105237_10000136 | 3300009545 | Bacteria | 103269 |
| 198 | Ga0105237_10136725 | 3300009545 | Bacteria | 2445 |
| 199 | Ga0105237_10252660 | 3300009545 | Bacteria | 1765 |
| 200 | Ga0105237_10273282 | 3300009545 | Bacteria | 1692 |
| 201 | Ga0105237_10291835 | 3300009545 | Bacteria | 1634 |
| 202 | Ga0105238_10009646 | 3300009551 | Bacteria | 9661 |
| 203 | Ga0105238_10016211 | 3300009551 | Bacteria | 7541 |
| 204 | Ga0105238_10025862 | 3300009551 | Bacteria | 5985 |
| 205 | Ga0105238_10208765 | 3300009551 | Bacteria | 1929 |
| 206 | Ga0105238_10211076 | 3300009551 | Bacteria | 1917 |
| 207 | Ga0105249_10018582 | 3300009553 | Bacteria | 6188 |
| 208 | Ga0105249_10020152 | 3300009553 | Bacteria | 5958 |
| 209 | Ga0105249_10134771 | 3300009553 | Bacteria | 2362 |
| 210 | Ga0099796_10000010 | 3300010159 | Bacteria | 61889 |
| 211 | Ga0099796_10000232 | 3300010159 | Bacteria | 8698 |
| 212 | Ga0105239_10000050 | 3300010375 | Bacteria | 173908 |
| 213 | Ga0105239_10003222 | 3300010375 | Bacteria | 20174 |
| 214 | Ga0105239_10017060 | 3300010375 | Bacteria | 8027 |
| 215 | Ga0105239_10044423 | 3300010375 | Bacteria | 4871 |
| 216 | Ga0105239_10072472 | 3300010375 | Bacteria | 3787 |
| 217 | Ga0105239_10101527 | 3300010375 | Bacteria | 3182 |
| 218 | Ga0157314_1000790 | 3300012500 | Bacteria | 2731 |
| 219 | Ga0157373_10061996 | 3300013100 | Bacteria | 2648 |
| 220 | Ga0157373_10089741 | 3300013100 | Bacteria | 2165 |
| 221 | Ga0157370_10004257 | 3300013104 | Bacteria | 16520 |
| 222 | Ga0157370_10236533 | 3300013104 | Bacteria | 1690 |
| 223 | Ga0157369_10001939 | 3300013105 | Bacteria | 24913 |
| 224 | Ga0157374_10109243 | 3300013296 | Bacteria | 2659 |
| 225 | Ga0157378_10020941 | 3300013297 | Bacteria | 5754 |
| 226 | Ga0163162_10000281 | 3300013306 | Bacteria | 46556 |
| 227 | Ga0163162_10062930 | 3300013306 | Bacteria | 3752 |
| 228 | Ga0163162_10244608 | 3300013306 | Bacteria | 1925 |
| 229 | Ga0157372_10054209 | 3300013307 | Bacteria | 4472 |
| 230 | Ga0157372_10276459 | 3300013307 | Bacteria | 1952 |
| 231 | Ga0163163_10049693 | 3300014325 | Bacteria | 4127 |
| 232 | Ga0163163_10145333 | 3300014325 | Bacteria | 2415 |
| 233 | Ga0157380_10011558 | 3300014326 | Bacteria | 6380 |
| 234 | Ga0157380_10031769 | 3300014326 | Bacteria | 4056 |
| 235 | Ga0182008_10007892 | 3300014497 | Bacteria | 5843 |
| 236 | Ga0157379_10014123 | 3300014968 | Bacteria | 7001 |
| 237 | Ga0157379_10072490 | 3300014968 | Bacteria | 3081 |
| 238 | Ga0157379_10146214 | 3300014968 | Bacteria | 2132 |
| 239 | Ga0157379_10150902 | 3300014968 | Bacteria | 2096 |
| 240 | Ga0157376_10063194 | 3300014969 | Bacteria | 3118 |
| 241 | Ga0182006_1000427 | 3300015261 | Bacteria | 33649 |
| 242 | Ga0182007_10038236 | 3300015262 | Bacteria | 1610 |
| 243 | Ga0182005_1000686 | 3300015265 | Bacteria | 15828 |
| 244 | Ga0182005_1003981 | 3300015265 | Bacteria | 4872 |
| 245 | Ga0183368_1004 | 3300015687 | Bacteria | 1211761 |
| 246 | Ga0209760_100572 | 3300025207 | Bacteria | 6575 |
| 247 | Ga0209784_100013 | 3300025224 | Bacteria | 518664 |
| 248 | Ga0209674_100053 | 3300025226 | Bacteria | 323159 |
| 249 | Ga0209674_100063 | 3300025226 | Bacteria | 275507 |
| 250 | Ga0209674_100898 | 3300025226 | Bacteria | 9646 |
| 251 | Ga0209672_100009 | 3300025228 | Bacteria | 883623 |
| 252 | Ga0209672_100024 | 3300025228 | Bacteria | 367869 |
| 253 | Ga0209672_100107 | 3300025228 | Bacteria | 99267 |
| 254 | Ga0209672_100253 | 3300025228 | Bacteria | 39760 |
| 255 | Ga0209672_100742 | 3300025228 | Bacteria | 15916 |
| 256 | Ga0209563_100127 | 3300025230 | Bacteria | 109913 |
| 257 | Ga0207427_100021 | 3300025231 | Bacteria | 494115 |
| 258 | Ga0207427_100030 | 3300025231 | Bacteria | 358045 |
| 259 | Ga0207427_101510 | 3300025231 | Bacteria | 8255 |
| 260 | Ga0209437_100012 | 3300025233 | Bacteria | 792625 |
| 261 | Ga0209437_100150 | 3300025233 | Bacteria | 157430 |
| 262 | Ga0209437_100416 | 3300025233 | Bacteria | 38751 |
| 263 | Ga0209258_100011 | 3300025242 | Bacteria | 867542 |
| 264 | Ga0209258_100019 | 3300025242 | Bacteria | 566728 |
| 265 | Ga0209258_100045 | 3300025242 | Bacteria | 369941 |
| 266 | Ga0209258_100047 | 3300025242 | Bacteria | 367869 |
| 267 | Ga0209258_100299 | 3300025242 | Bacteria | 80970 |
| 268 | Ga0209258_102767 | 3300025242 | Bacteria | 4239 |
| 269 | Ga0209258_104796 | 3300025242 | Bacteria | 2459 |
| 270 | Ga0209646_1000458 | 3300025246 | Bacteria | 21135 |
| 271 | Ga0209646_1002167 | 3300025246 | Bacteria | 4555 |
| 272 | Ga0209646_1005413 | 3300025246 | Bacteria | 2228 |
| 273 | Ga0209026_1000010 | 3300025250 | Bacteria | 511986 |
| 274 | Ga0209026_1000015 | 3300025250 | Bacteria | 395555 |
| 275 | Ga0209026_1000163 | 3300025250 | Bacteria | 102814 |
| 276 | Ga0209026_1000391 | 3300025250 | Bacteria | 39130 |
| 277 | Ga0209026_1001325 | 3300025250 | Bacteria | 11132 |
| 278 | Ga0209026_1003010 | 3300025250 | Bacteria | 5814 |
| 279 | Ga0209677_102437 | 3300025253 | Bacteria | 7000 |
| 280 | Ga0209148_1000001 | 3300025254 | Bacteria | 2545271 |
| 281 | Ga0209148_1000005 | 3300025254 | Bacteria | 1806504 |
| 282 | Ga0209148_1000013 | 3300025254 | Bacteria | 956684 |
| 283 | Ga0209148_1000052 | 3300025254 | Bacteria | 399449 |
| 284 | Ga0209148_1000054 | 3300025254 | Bacteria | 367869 |
| 285 | Ga0209148_1000205 | 3300025254 | Bacteria | 104659 |
| 286 | Ga0209759_1000023 | 3300025256 | Bacteria | 321695 |
| 287 | Ga0209759_1000622 | 3300025256 | Bacteria | 33847 |
| 288 | Ga0209759_1001819 | 3300025256 | Bacteria | 10741 |
| 289 | Ga0209759_1002777 | 3300025256 | Bacteria | 7416 |
| 290 | Ga0209759_1009864 | 3300025256 | Bacteria | 2850 |
| 291 | Ga0209233_1000002 | 3300025261 | Bacteria | 2501366 |
| 292 | Ga0209233_1000023 | 3300025261 | Bacteria | 738870 |
| 293 | Ga0209233_1000754 | 3300025261 | Bacteria | 14657 |
| 294 | Ga0209455_1000012 | 3300025272 | Bacteria | 867234 |
| 295 | Ga0209455_1000027 | 3300025272 | Bacteria | 566710 |
| 296 | Ga0209455_1000052 | 3300025272 | Bacteria | 367804 |
| 297 | Ga0209455_1000081 | 3300025272 | Bacteria | 263674 |
| 298 | Ga0209455_1000357 | 3300025272 | Bacteria | 42718 |
| 299 | Ga0209455_1013884 | 3300025272 | Bacteria | 1849 |
| 300 | Ga0209130_1000793 | 3300025284 | Bacteria | 27090 |
| 301 | Ga0209025_1000251 | 3300025294 | Bacteria | 126418 |
| 302 | Ga0209758_1001868 | 3300025297 | Bacteria | 23096 |
| 303 | Ga0207426_1000179 | 3300025302 | Bacteria | 158635 |
| 304 | Ga0209051_1012497 | 3300025303 | Bacteria | 4103 |
| 305 | Ga0207713_1000429 | 3300025735 | Bacteria | 44408 |
| 306 | Ga0207692_10000685 | 3300025898 | Bacteria | 11953 |
| 307 | Ga0207710_10000322 | 3300025900 | Bacteria | 36632 |
| 308 | Ga0207710_10022803 | 3300025900 | Bacteria | 2687 |
| 309 | Ga0207710_10055512 | 3300025900 | Bacteria | 1786 |
| 310 | Ga0207680_10000005 | 3300025903 | Bacteria | 660983 |
| 311 | Ga0207680_10001024 | 3300025903 | Bacteria | 13188 |
| 312 | Ga0207680_10043657 | 3300025903 | Bacteria | 2631 |
| 313 | Ga0207647_10000055 | 3300025904 | Bacteria | 86547 |
| 314 | Ga0207647_10005581 | 3300025904 | Bacteria | 9201 |
| 315 | Ga0207647_10006694 | 3300025904 | Bacteria | 8372 |
| 316 | Ga0207647_10010943 | 3300025904 | Bacteria | 6381 |
| 317 | Ga0207647_10028042 | 3300025904 | Bacteria | 3664 |
| 318 | Ga0207643_10003066 | 3300025908 | Bacteria | 8981 |
| 319 | Ga0207705_10072553 | 3300025909 | Bacteria | 2497 |
| 320 | Ga0207684_10027359 | 3300025910 | Bacteria | 4860 |
| 321 | Ga0207654_10133733 | 3300025911 | Bacteria | 1573 |
| 322 | Ga0207707_10000249 | 3300025912 | Bacteria | 59150 |
| 323 | Ga0207707_10000958 | 3300025912 | Bacteria | 27828 |
| 324 | Ga0207695_10000002 | 3300025913 | Bacteria | 2188391 |
| 325 | Ga0207695_10000040 | 3300025913 | Bacteria | 452787 |
| 326 | Ga0207695_10000198 | 3300025913 | Bacteria | 167880 |
| 327 | Ga0207695_10001115 | 3300025913 | Bacteria | 46659 |
| 328 | Ga0207695_10001214 | 3300025913 | Bacteria | 44135 |
| 329 | Ga0207695_10006516 | 3300025913 | Bacteria | 15114 |
| 330 | Ga0207695_10012993 | 3300025913 | Bacteria | 9947 |
| 331 | Ga0207695_10062233 | 3300025913 | Bacteria | 3854 |
| 332 | Ga0207695_10091476 | 3300025913 | Bacteria | 3056 |
| 333 | Ga0207671_10000059 | 3300025914 | Bacteria | 179761 |
| 334 | Ga0207671_10000074 | 3300025914 | Bacteria | 156482 |
| 335 | Ga0207671_10037715 | 3300025914 | Bacteria | 3583 |
| 336 | Ga0207671_10041429 | 3300025914 | Bacteria | 3409 |
| 337 | Ga0207671_10053093 | 3300025914 | Bacteria | 3004 |
| 338 | Ga0207671_10060394 | 3300025914 | Bacteria | 2812 |
| 339 | Ga0207660_10001068 | 3300025917 | Bacteria | 18208 |
| 340 | Ga0207660_10003060 | 3300025917 | Bacteria | 10933 |
| 341 | Ga0207657_10027032 | 3300025919 | Bacteria | 5260 |
| 342 | Ga0207652_10000134 | 3300025921 | Bacteria | 78533 |
| 343 | Ga0207652_10000912 | 3300025921 | Bacteria | 27888 |
| 344 | Ga0207646_10010941 | 3300025922 | Bacteria | 8811 |
| 345 | Ga0207646_10022308 | 3300025922 | Bacteria | 5835 |
| 346 | Ga0207646_10104611 | 3300025922 | Bacteria | 2539 |
| 347 | Ga0207646_10143230 | 3300025922 | Bacteria | 2153 |
| 348 | Ga0207681_10008729 | 3300025923 | Bacteria | 6192 |
| 349 | Ga0207694_10001048 | 3300025924 | Bacteria | 24066 |
| 350 | Ga0207694_10013173 | 3300025924 | Bacteria | 6226 |
| 351 | Ga0207694_10075188 | 3300025924 | Bacteria | 2644 |
| 352 | Ga0207650_10000841 | 3300025925 | Bacteria | 23285 |
| 353 | Ga0207650_10014766 | 3300025925 | Bacteria | 5430 |
| 354 | Ga0207700_10001549 | 3300025928 | Bacteria | 13039 |
| 355 | Ga0207700_10076420 | 3300025928 | Bacteria | 2598 |
| 356 | Ga0207644_10018202 | 3300025931 | Bacteria | 4750 |
| 357 | Ga0207644_10043803 | 3300025931 | Bacteria | 3177 |
| 358 | Ga0207690_10027106 | 3300025932 | Bacteria | 3617 |
| 359 | Ga0207706_10025342 | 3300025933 | Bacteria | 5315 |
| 360 | Ga0207706_10049685 | 3300025933 | Bacteria | 3706 |
| 361 | Ga0207686_10107858 | 3300025934 | Bacteria | 1872 |
| 362 | Ga0207709_10046937 | 3300025935 | Bacteria | 2624 |
| 363 | Ga0207709_10065253 | 3300025935 | Bacteria | 2289 |
| 364 | Ga0207669_10060660 | 3300025937 | Bacteria | 2320 |
| 365 | Ga0207691_10005413 | 3300025940 | Bacteria | 12319 |
| 366 | Ga0207711_10037845 | 3300025941 | Bacteria | 4101 |
| 367 | Ga0207689_10042064 | 3300025942 | Bacteria | 3782 |
| 368 | Ga0207667_10000031 | 3300025949 | Bacteria | 323587 |
| 369 | Ga0207667_10000292 | 3300025949 | Bacteria | 69279 |
| 370 | Ga0207667_10022774 | 3300025949 | Bacteria | 6910 |
| 371 | Ga0207667_10023268 | 3300025949 | Bacteria | 6823 |
| 372 | Ga0207712_10000120 | 3300025961 | Bacteria | 84214 |
| 373 | Ga0207712_10039372 | 3300025961 | Bacteria | 3239 |
| 374 | Ga0207668_10002000 | 3300025972 | Bacteria | 11912 |
| 375 | Ga0207668_10110871 | 3300025972 | Bacteria | 2059 |
| 376 | Ga0207640_10000061 | 3300025981 | Bacteria | 89141 |
| 377 | Ga0207640_10018558 | 3300025981 | Bacteria | 4089 |
| 378 | Ga0207640_10078923 | 3300025981 | Bacteria | 2242 |
| 379 | Ga0207640_10091377 | 3300025981 | Bacteria | 2109 |
| 380 | Ga0207658_10032772 | 3300025986 | Bacteria | 3701 |
| 381 | Ga0207658_10044094 | 3300025986 | Bacteria | 3246 |
| 382 | Ga0207703_10000422 | 3300026035 | Bacteria | 44878 |
| 383 | Ga0207703_10000468 | 3300026035 | Bacteria | 42232 |
| 384 | Ga0207703_10002171 | 3300026035 | Bacteria | 17238 |
| 385 | Ga0207703_10003735 | 3300026035 | Bacteria | 12667 |
| 386 | Ga0207703_10029673 | 3300026035 | Bacteria | 4317 |
| 387 | Ga0207639_10010801 | 3300026041 | Bacteria | 6330 |
| 388 | Ga0207639_10015933 | 3300026041 | Bacteria | 5308 |
| 389 | Ga0207639_10034619 | 3300026041 | Bacteria | 3734 |
| 390 | Ga0207678_10005681 | 3300026067 | Bacteria | 11149 |
| 391 | Ga0207678_10044128 | 3300026067 | Bacteria | 3857 |
| 392 | Ga0207678_10066153 | 3300026067 | Bacteria | 3104 |
| 393 | Ga0207678_10116742 | 3300026067 | Bacteria | 2277 |
| 394 | Ga0207678_10160860 | 3300026067 | Bacteria | 1918 |
| 395 | Ga0207708_10042238 | 3300026075 | Bacteria | 3476 |
| 396 | Ga0207702_10000185 | 3300026078 | Bacteria | 74602 |
| 397 | Ga0207702_10007958 | 3300026078 | Bacteria | 8981 |
| 398 | Ga0207702_10037495 | 3300026078 | Bacteria | 4058 |
| 399 | Ga0207702_10054129 | 3300026078 | Bacteria | 3399 |
| 400 | Ga0207702_10089993 | 3300026078 | Bacteria | 2685 |
| 401 | Ga0207702_10144433 | 3300026078 | Bacteria | 2157 |
| 402 | Ga0207641_10000177 | 3300026088 | Bacteria | 88140 |
| 403 | Ga0207641_10000393 | 3300026088 | Bacteria | 51636 |
| 404 | Ga0207641_10007137 | 3300026088 | Bacteria | 9329 |
| 405 | Ga0207641_10065076 | 3300026088 | Bacteria | 3117 |
| 406 | Ga0207648_10126998 | 3300026089 | Bacteria | 2244 |
| 407 | Ga0207674_10000298 | 3300026116 | Bacteria | 62902 |
| 408 | Ga0207674_10036889 | 3300026116 | Bacteria | 5088 |
| 409 | Ga0207683_10000244 | 3300026121 | Bacteria | 48306 |
| 410 | Ga0207683_10166592 | 3300026121 | Bacteria | 1994 |
| 411 | Ga0207698_10025989 | 3300026142 | Bacteria | 4136 |
| 412 | Ga0207698_10057077 | 3300026142 | Bacteria | 3018 |
| 413 | Ga0207698_10172685 | 3300026142 | Bacteria | 1905 |
| 414 | Ga0209371_1000116 | 3300027312 | Bacteria | 135524 |
| 415 | Ga0209179_1000008 | 3300027512 | Bacteria | 92811 |
| 416 | Ga0209179_1000665 | 3300027512 | Bacteria | 3669 |
| 417 | Ga0207428_10034951 | 3300027907 | Bacteria | 4112 |
| 418 | Ga0265356_1000505 | 3300028017 | Bacteria | 7040 |
| 419 | Ga0268266_10000004 | 3300028379 | Bacteria | 1495817 |
| 420 | Ga0268266_10000007 | 3300028379 | Bacteria | 1372921 |
| 421 | Ga0268266_10006593 | 3300028379 | Bacteria | 10602 |
| 422 | Ga0268266_10028873 | 3300028379 | Bacteria | 4714 |
| 423 | Ga0268266_10035428 | 3300028379 | Bacteria | 4245 |
| 424 | Ga0268266_10096734 | 3300028379 | Bacteria | 2596 |
| 425 | Ga0268265_10026758 | 3300028380 | Bacteria | 4106 |
| 426 | Ga0268265_10128854 | 3300028380 | Bacteria | 2099 |
| 427 | Ga0268265_10189989 | 3300028380 | Bacteria | 1772 |
| 428 | Ga0268264_10000088 | 3300028381 | Bacteria | 235344 |
| 429 | Ga0268264_10059497 | 3300028381 | Bacteria | 3201 |
| 430 | Ga0268264_10119972 | 3300028381 | Bacteria | 2316 |
| 431 | Ga0307517_10018152 | 3300028786 | Bacteria | 9117 |
| 432 | Ga0307517_10018496 | 3300028786 | Bacteria | 9006 |
| 433 | Ga0307515_10010304 | 3300028794 | Bacteria | 17938 |
| 434 | Ga0307515_10017668 | 3300028794 | Bacteria | 12973 |
| 435 | Ga0307515_10074461 | 3300028794 | Bacteria | 4542 |
| 436 | Ga0268256_1000099 | 3300030500 | Bacteria | 135508 |
| 437 | Ga0307511_10000227 | 3300030521 | Bacteria | 57255 |
| 438 | Ga0307511_10000672 | 3300030521 | Bacteria | 36429 |
| 439 | Ga0307511_10010986 | 3300030521 | Bacteria | 8940 |
| 440 | Ga0307511_10015900 | 3300030521 | Bacteria | 7271 |
| 441 | Ga0307512_10008398 | 3300030522 | Bacteria | 10073 |
| 442 | Ga0314311_1226575 | 3300030733 | Bacteria | 2045 |
| 443 | Ga0265760_10008192 | 3300031090 | Bacteria | 2987 |
| 444 | Ga0265320_10013217 | 3300031240 | Bacteria | 4758 |
| 445 | Ga0307513_10015491 | 3300031456 | Bacteria | 9243 |
| 446 | Ga0307513_10035596 | 3300031456 | Bacteria | 5567 |
| 447 | Ga0307509_10006518 | 3300031507 | Bacteria | 15655 |
| 448 | Ga0307509_10030391 | 3300031507 | Bacteria | 5977 |
| 449 | Ga0307509_10138169 | 3300031507 | Bacteria | 2378 |
| 450 | Ga0307408_100044022 | 3300031548 | Bacteria | 3179 |
| 451 | Ga0307408_100068822 | 3300031548 | Bacteria | 2608 |
| 452 | Ga0307408_100188838 | 3300031548 | Bacteria | 1658 |
| 453 | Ga0307508_10014270 | 3300031616 | Bacteria | 7247 |
| 454 | Ga0307508_10015242 | 3300031616 | Bacteria | 7003 |
| 455 | Ga0307508_10034594 | 3300031616 | Bacteria | 4555 |
| 456 | Ga0307508_10053927 | 3300031616 | Bacteria | 3565 |
| 457 | Ga0307508_10091016 | 3300031616 | Bacteria | 2638 |
| 458 | Ga0307405_10043405 | 3300031731 | Bacteria | 2743 |
| 459 | Ga0307406_10057987 | 3300031901 | Bacteria | 2486 |
| 460 | Ga0307412_10000203 | 3300031911 | Bacteria | 40488 |
| 461 | Ga0307409_100050650 | 3300031995 | Bacteria | 3173 |
| 462 | Ga0307416_100012602 | 3300032002 | Bacteria | 5706 |
| 463 | Ga0307411_10028371 | 3300032005 | Bacteria | 3402 |
| 464 | Ga0307507_10025927 | 3300033179 | Bacteria | 6337 |
| 465 | Ga0307507_10030151 | 3300033179 | Bacteria | 5726 |
| 466 | Ga0307507_10060126 | 3300033179 | Bacteria | 3550 |
| 467 | Ga0307507_10121752 | 3300033179 | Bacteria | 2084 |
| 468 | Ga0307507_10180361 | 3300033179 | Bacteria | 1511 |
| 469 | Ga0307510_10000061 | 3300033180 | Bacteria | 82810 |
| 470 | Ga0307510_10005829 | 3300033180 | Bacteria | 14690 |
| 471 | Ga0307510_10006065 | 3300033180 | Bacteria | 14405 |
| 472 | Ga0307510_10010353 | 3300033180 | Bacteria | 11075 |
| 473 | Ga0307510_10018254 | 3300033180 | Bacteria | 8256 |
| 474 | Ga0307510_10133917 | 3300033180 | Bacteria | 2142 |
| 475 | Ga0373936_0042983 | 3300035113 | Bacteria | 1815 |
| 476 | Ga0395899_0000076 | 3300037312 | Bacteria | 177673 |
| 477 | Ga0395899_0002906 | 3300037312 | Bacteria | 13766 |
| 478 | Ga0395899_0053722 | 3300037312 | Bacteria | 2982 |
| 479 | Ga0395900_0000018 | 3300037418 | Bacteria | 363472 |
| 480 | Ga0395900_0063004 | 3300037418 | Bacteria | 3811 |
| 481 | Ga0395898_0000530 | 3300037466 | Bacteria | 72663 |
| 482 | Ga0395898_0000612 | 3300037466 | Bacteria | 65763 |
| 483 | Ga0395898_0001593 | 3300037466 | Bacteria | 30957 |
| 484 | Ga0436364_0821552 | 3300037853 | Bacteria | 4804 |
| 485 | Ga0436363_1440167 | 3300039450 | Bacteria | 4209 |
| 486 | Ga0439436_0000006 | 3300041404 | Bacteria | 123245 |
| 487 | Ga0439436_0005195 | 3300041404 | Bacteria | 3991 |
| 488 | Ga0439465_0003000 | 3300041413 | Bacteria | 5516 |
| 489 | Ga0439465_0003108 | 3300041413 | Bacteria | 5431 |
| 490 | Ga0451853_2973491 | 3300041512 | Bacteria | 2442 |
| 491 | Ga0439445_0003134 | 3300042004 | Bacteria | 3709 |
| 492 | Ga0439448_0022462 | 3300042005 | Bacteria | 1961 |
| 493 | Ga0439449_0000378 | 3300042007 | Bacteria | 16401 |
| 494 | Ga0439449_0000733 | 3300042007 | Bacteria | 12592 |
| 495 | Ga0439449_0004079 | 3300042007 | Bacteria | 5653 |
| 496 | Ga0439457_000120 | 3300042014 | Bacteria | 19130 |
| 497 | Ga0439457_000307 | 3300042014 | Bacteria | 13539 |
| 498 | Ga0450894_000894 | 3300042131 | Bacteria | 4749 |
| 499 | Ga0450908_000195 | 3300042184 | Bacteria | 12425 |
| 500 | Ga0439464_0003883 | 3300042439 | Bacteria | 3801 |
| 501 | Ga0439460_0018890 | 3300042461 | Bacteria | 1861 |
| 502 | Ga0466969_0014302 | 3300044656 | Bacteria | 4172 |
| 503 | Ga0466969_0024240 | 3300044656 | Bacteria | 3121 |
| 504 | Ga0466972_0000377 | 3300044658 | Bacteria | 23938 |
| 505 | Ga0466972_0001073 | 3300044658 | Bacteria | 13098 |
| 506 | Ga0466972_0002839 | 3300044658 | Bacteria | 8574 |
| 507 | Ga0466972_0014349 | 3300044658 | Bacteria | 3969 |
| 508 | Ga0466972_0024639 | 3300044658 | Bacteria | 2986 |
| 509 | Ga0466972_0044402 | 3300044658 | Bacteria | 2155 |
| 510 | Ga0466975_0171288 | 3300044661 | Bacteria | 1495 |
| 511 | Ga0466982_0000033 | 3300044672 | Bacteria | 46451 |
| 512 | Ga0466982_0000044 | 3300044672 | Bacteria | 38923 |
| 513 | Ga0466965_0001162 | 3300044683 | Bacteria | 10357 |
| 514 | Ga0466965_0003803 | 3300044683 | Bacteria | 6656 |
| 515 | Ga0466965_0025957 | 3300044683 | Bacteria | 2838 |
| 516 | Ga0466966_0008164 | 3300044684 | Bacteria | 6939 |
| 517 | Ga0466966_0016818 | 3300044684 | Bacteria | 4832 |
| 518 | Ga0466966_0033225 | 3300044684 | Bacteria | 3340 |
| 519 | Ga0466961_0002692 | 3300044693 | Bacteria | 11030 |
| 520 | Ga0466961_0007789 | 3300044693 | Bacteria | 6816 |
| 521 | Ga0466961_0008091 | 3300044693 | Bacteria | 6701 |
| 522 | Ga0466961_0036482 | 3300044693 | Bacteria | 3155 |
| 523 | Ga0466961_0052920 | 3300044693 | Bacteria | 2591 |
| 524 | Ga0466961_0055317 | 3300044693 | Bacteria | 2530 |
| 525 | Ga0466971_0013988 | 3300044719 | Bacteria | 3526 |
| 526 | Ga0466971_0037351 | 3300044719 | Bacteria | 2176 |
| 527 | Ga0466968_0031075 | 3300044735 | Bacteria | 2214 |
| 528 | Ga0466970_0002648 | 3300044765 | Bacteria | 8636 |
| 529 | Ga0466970_0012573 | 3300044765 | Bacteria | 4331 |
| 530 | Ga0466957_0022896 | 3300044842 | Bacteria | 3688 |
| 531 | Ga0466957_0041448 | 3300044842 | Bacteria | 2784 |
| 532 | Ga0466959_0000043 | 3300045049 | Bacteria | 92533 |
| 533 | Ga0466959_0011104 | 3300045049 | Bacteria | 6464 |
| 534 | Ga0466959_0014526 | 3300045049 | Bacteria | 5727 |
| 535 | Ga0451576_0325731 | 3300045051 | Bacteria | 1608 |
| 536 | Ga0466967_0000795 | 3300045976 | Bacteria | 16495 |
| 537 | Ga0466967_0051257 | 3300045976 | Bacteria | 3616 |
| 538 | Ga0466967_0051578 | 3300045976 | Bacteria | 3606 |
| 539 | Ga0495592_0012776 | 3300046454 | Bacteria | 6383 |
| 540 | Ga0495603_0002686 | 3300046455 | Bacteria | 10487 |
| 541 | Ga0495629_0015196 | 3300046459 | Bacteria | 5531 |
| 542 | Ga0495629_0025807 | 3300046459 | Bacteria | 4175 |
| 543 | Ga0495638_0000009 | 3300046460 | Bacteria | 525345 |
| 544 | Ga0495638_0000052 | 3300046460 | Bacteria | 203695 |
| 545 | Ga0495638_0099420 | 3300046460 | Bacteria | 1741 |
| 546 | Ga0495651_0004042 | 3300046462 | Bacteria | 11214 |
| 547 | Ga0495650_0000122 | 3300046471 | Bacteria | 182888 |
| 548 | Ga0495650_0000247 | 3300046471 | Bacteria | 106616 |
| 549 | Ga0495639_0063529 | 3300046475 | Bacteria | 1695 |
| 550 | Ga0495662_0000534 | 3300046476 | Bacteria | 17425 |
| 551 | Ga0495662_0019059 | 3300046476 | Bacteria | 3320 |
| 552 | Ga0495664_0003610 | 3300046477 | Bacteria | 8435 |
| 553 | Ga0495585_0000021 | 3300046492 | Bacteria | 155715 |
| 554 | Ga0495585_0038264 | 3300046492 | Bacteria | 2700 |
| 555 | Ga0495594_0005271 | 3300046499 | Bacteria | 6640 |
| 556 | Ga0495594_0019414 | 3300046499 | Bacteria | 3611 |
| 557 | Ga0495607_0023327 | 3300046501 | Bacteria | 3874 |
| 558 | Ga0495606_0000056 | 3300046507 | Bacteria | 198575 |
| 559 | Ga0495606_0050569 | 3300046507 | Bacteria | 2718 |
| 560 | Ga0495610_0001176 | 3300046512 | Bacteria | 23703 |
| 561 | Ga0495628_0022582 | 3300046516 | Bacteria | 5168 |
| 562 | Ga0495628_0071763 | 3300046516 | Bacteria | 2698 |
| 563 | Ga0495631_0000060 | 3300046518 | Bacteria | 68239 |
| 564 | Ga0495631_0040157 | 3300046518 | Bacteria | 2074 |
| 565 | Ga0495643_0006314 | 3300046522 | Bacteria | 7834 |
| 566 | Ga0495643_0009173 | 3300046522 | Bacteria | 6175 |
| 567 | Ga0495648_0000688 | 3300046524 | Bacteria | 36092 |
| 568 | Ga0495663_0000222 | 3300046525 | Bacteria | 22657 |
| 569 | Ga0495652_0031801 | 3300046529 | Bacteria | 4619 |
| 570 | Ga0495587_0015851 | 3300046536 | Bacteria | 4697 |
| 571 | Ga0495621_0008627 | 3300046539 | Bacteria | 3065 |
| 572 | Ga0495597_0017251 | 3300046542 | Bacteria | 3401 |
| 573 | Ga0495645_0005263 | 3300046543 | Bacteria | 8862 |
| 574 | Ga0495645_0005674 | 3300046543 | Bacteria | 8591 |
| 575 | Ga0495622_0017292 | 3300046557 | Bacteria | 3357 |
| 576 | Ga0495668_0027794 | 3300046616 | Bacteria | 3204 |
| 577 | Ga0495625_0006824 | 3300046660 | Bacteria | 10087 |
| 578 | Ga0495625_0022762 | 3300046660 | Bacteria | 4796 |
| 579 | Ga0495625_0054199 | 3300046660 | Bacteria | 2865 |
| 580 | Ga0495635_0006399 | 3300046663 | Bacteria | 8207 |
| 581 | Ga0495635_0047510 | 3300046663 | Bacteria | 2960 |
| 582 | Ga0495661_0000353 | 3300046665 | Bacteria | 50121 |
| 583 | Ga0495588_0005143 | 3300046674 | Bacteria | 5811 |
| 584 | Ga0495588_0007950 | 3300046674 | Bacteria | 4848 |
| 585 | Ga0495623_0047478 | 3300046679 | Bacteria | 2725 |
| 586 | Ga0495646_0057201 | 3300046680 | Bacteria | 2335 |
| 587 | Ga0495658_0044193 | 3300046683 | Bacteria | 2495 |
| 588 | Ga0495613_0017227 | 3300046689 | Bacteria | 5382 |
| 589 | Ga0495613_0039155 | 3300046689 | Bacteria | 3514 |
| 590 | Ga0495624_0058895 | 3300046690 | Bacteria | 2411 |
| 591 | Ga0495670_0001214 | 3300046691 | Bacteria | 12527 |
| 592 | Ga0495670_0007579 | 3300046691 | Bacteria | 5335 |
| 593 | Ga0495649_0008985 | 3300046694 | Bacteria | 5971 |
| 594 | Ga0495589_0023474 | 3300046794 | Bacteria | 3143 |
| 595 | Ga0495600_0017891 | 3300046809 | Bacteria | 4510 |
| 596 | Ga0495600_0047615 | 3300046809 | Unclassified | 2797 |
| 597 | Ga0495660_0025463 | 3300046810 | Bacteria | 3360 |
| 598 | Ga0495581_0021486 | 3300047315 | Bacteria | 3740 |
| 599 | Ga0495604_0051265 | 3300047317 | Bacteria | 3200 |
| 600 | Ga0495636_0018692 | 3300047318 | Bacteria | 2781 |
| 601 | Ga0495674_0216232 | 3300047319 | Bacteria | 1586 |
| 602 | Ga0495676_0012001 | 3300047321 | Bacteria | 7815 |
| 603 | Ga0495683_0002632 | 3300047323 | Bacteria | 10723 |
| 604 | Ga0495687_001648 | 3300047443 | Bacteria | 20081 |
| 605 | Ga0495687_002821 | 3300047443 | Bacteria | 13387 |
| 606 | Ga0495687_010294 | 3300047443 | Bacteria | 5137 |
| 607 | Ga0495685_000931 | 3300047447 | Bacteria | 8880 |
| 608 | Ga0495685_005825 | 3300047447 | Bacteria | 4026 |
| 609 | Ga0495685_014345 | 3300047447 | Bacteria | 2691 |
| 610 | Ga0495681_0001693 | 3300047470 | Bacteria | 16334 |
| 611 | Ga0495681_0003555 | 3300047470 | Bacteria | 10848 |
| 612 | Ga0495593_0003639 | 3300047673 | Bacteria | 9204 |
| 613 | Ga0495602_0048087 | 3300048088 | Bacteria | 3838 |
| 614 | Ga0495602_0127005 | 3300048088 | Unclassified | 2041 |
| 615 | Ga0495614_0042408 | 3300048089 | Bacteria | 1950 |
| 616 | Ga0495614_0054420 | 3300048089 | Bacteria | 1716 |
| 617 | Ga0496100_0063836 | 3300048903 | Bacteria | 2435 |
| 618 | Ga0496102_0014442 | 3300048905 | Bacteria | 6862 |
| 619 | Ga0496102_0030481 | 3300048905 | Bacteria | 4828 |
| 620 | Ga0496102_0030962 | 3300048905 | Bacteria | 4793 |
| 621 | Ga0496103_0026811 | 3300048906 | Bacteria | 3488 |
| 622 | Ga0496104_0031919 | 3300048907 | Bacteria | 4900 |
| 623 | Ga0496104_0048215 | 3300048907 | Bacteria | 4016 |
| 624 | Ga0496105_0005844 | 3300048908 | Bacteria | 9383 |
| 625 | Ga0496106_0198717 | 3300048909 | Bacteria | 1595 |
| 626 | Ga0496107_0011636 | 3300048910 | Bacteria | 6131 |
| 627 | Ga0496107_0040761 | 3300048910 | Bacteria | 3334 |
| 628 | Ga0496110_0224731 | 3300048913 | Bacteria | 1707 |
| 629 | Ga0496110_0326451 | 3300048913 | Bacteria | 1398 |
| 630 | Ga0496113_0013707 | 3300048916 | Bacteria | 5504 |
| 631 | Ga0496114_0016710 | 3300048917 | Bacteria | 5917 |
| 632 | Ga0496114_0033041 | 3300048917 | Bacteria | 4262 |
| 633 | Ga0496115_0000013 | 3300048918 | Bacteria | 213060 |
| 634 | Ga0496115_0000044 | 3300048918 | Bacteria | 115745 |
| 635 | Ga0496115_0012558 | 3300048918 | Bacteria | 6381 |
| 636 | Ga0496115_0015634 | 3300048918 | Bacteria | 5761 |
| 637 | Ga0496115_0033021 | 3300048918 | Bacteria | 4085 |
| 638 | Ga0496115_0168551 | 3300048918 | Bacteria | 1811 |
| 639 | Ga0496116_0017221 | 3300048919 | Bacteria | 5620 |
| 640 | Ga0496117_0000024 | 3300048920 | Bacteria | 418750 |
| 641 | Ga0496117_0004227 | 3300048920 | Bacteria | 16031 |
| 642 | Ga0496117_0008001 | 3300048920 | Bacteria | 10142 |
| 643 | Ga0496117_0034255 | 3300048920 | Bacteria | 3828 |
| 644 | Ga0496117_0112324 | 3300048920 | Bacteria | 1694 |
| 645 | Ga0496118_0000014 | 3300048921 | Bacteria | 561628 |
| 646 | Ga0496118_0000636 | 3300048921 | Bacteria | 57474 |
| 647 | Ga0496118_0000780 | 3300048921 | Bacteria | 51033 |
| 648 | Ga0496118_0008276 | 3300048921 | Bacteria | 10780 |
| 649 | Ga0496118_0011987 | 3300048921 | Bacteria | 8377 |
| 650 | Ga0496119_0000109 | 3300048922 | Bacteria | 116054 |
| 651 | Ga0496119_0002080 | 3300048922 | Bacteria | 22625 |
| 652 | Ga0496120_0000115 | 3300048923 | Bacteria | 136364 |
| 653 | Ga0496120_0000150 | 3300048923 | Bacteria | 116072 |
| 654 | Ga0496120_0026274 | 3300048923 | Bacteria | 3597 |
| 655 | Ga0496121_0000013 | 3300048924 | Bacteria | 614976 |
| 656 | Ga0496121_0001215 | 3300048924 | Bacteria | 44880 |
| 657 | Ga0496121_0002051 | 3300048924 | Bacteria | 31889 |
| 658 | Ga0496121_0014570 | 3300048924 | Bacteria | 8330 |
| 659 | Ga0496121_0110793 | 3300048924 | Bacteria | 2094 |
| 660 | Ga0496122_0000049 | 3300048925 | Bacteria | 268493 |
| 661 | Ga0496122_0009875 | 3300048925 | Bacteria | 9948 |
| 662 | Ga0496122_0034775 | 3300048925 | Bacteria | 4115 |
| 663 | Ga0496123_0000042 | 3300048926 | Bacteria | 254481 |
| 664 | Ga0496123_0003900 | 3300048926 | Bacteria | 16219 |
| 665 | Ga0496123_0021655 | 3300048926 | Bacteria | 4988 |
| 666 | Ga0496124_0003222 | 3300048927 | Bacteria | 20166 |
| 667 | Ga0496124_0004659 | 3300048927 | Bacteria | 15867 |
| 668 | Ga0496124_0004848 | 3300048927 | Bacteria | 15474 |
| 669 | Ga0496125_0000416 | 3300048928 | Bacteria | 79287 |
| 670 | Ga0496125_0000453 | 3300048928 | Bacteria | 74032 |
| 671 | Ga0496125_0000816 | 3300048928 | Bacteria | 50685 |
| 672 | Ga0496125_0012791 | 3300048928 | Bacteria | 8296 |
| 673 | Ga0496125_0020072 | 3300048928 | Bacteria | 6283 |
| 674 | Ga0496126_0002266 | 3300048929 | Bacteria | 26518 |
| 675 | Ga0496126_0002275 | 3300048929 | Bacteria | 26475 |
| 676 | Ga0496126_0014270 | 3300048929 | Bacteria | 8039 |
| 677 | Ga0496126_0045508 | 3300048929 | Bacteria | 4032 |
| 678 | Ga0496126_0069812 | 3300048929 | Bacteria | 3132 |
| 679 | Ga0496126_0097845 | 3300048929 | Bacteria | 2571 |
| 680 | Ga0495682_0000253 | 3300049460 | Bacteria | 42266 |
| 681 | Ga0501299_012684 | 3300049522 | Bacteria | 1442 |
| 682 | Ga0501036_0264331 | 3300049572 | Bacteria | 1441 |
| 683 | Ga0501040_0086342 | 3300049576 | Bacteria | 2179 |
| 684 | Ga0501043_0270106 | 3300049579 | Bacteria | 1306 |
| 685 | Ga0501046_0010033 | 3300049580 | Bacteria | 8158 |
| 686 | Ga0501047_0006703 | 3300049581 | Bacteria | 10826 |
| 687 | Ga0501048_0234485 | 3300049582 | Bacteria | 1302 |
| 688 | Ga0501070_0017543 | 3300049586 | Bacteria | 6009 |
| 689 | Ga0501071_0216682 | 3300049587 | Bacteria | 1440 |
| 690 | Ga0501072_0231280 | 3300049588 | Bacteria | 1473 |
| 691 | Ga0501225_0001420 | 3300049705 | Bacteria | 7480 |
| 692 | Ga0501035_0001136 | 3300049822 | Bacteria | 27827 |
| 693 | Ga0501035_0014043 | 3300049822 | Bacteria | 7389 |
| 694 | Ga0501035_0025899 | 3300049822 | Bacteria | 5374 |
| 695 | Ga0501035_0226821 | 3300049822 | Bacteria | 1593 |
| 696 | Ga0501044_0005139 | 3300049823 | Bacteria | 14596 |
| 697 | Ga0501044_0022778 | 3300049823 | Bacteria | 6671 |
| 698 | Ga0501044_0080152 | 3300049823 | Bacteria | 3307 |
| 699 | Ga0501044_0146631 | 3300049823 | Bacteria | 2345 |
| 700 | nmdc:mga05p37_198665_c1 | 3300050507 | Bacteria | 2430 |
| 701 | nmdc:mga05p37_36826_c1 | 3300050507 | Bacteria | 6001 |
| 702 | nmdc:mga05p37_43286_c1 | 3300050507 | Bacteria | 5539 |
| 703 | nmdc:mga05p37_444857_c1 | 3300050507 | Bacteria | 1502 |
| 704 | nmdc:mga05p37_687_c1 | 3300050507 | Bacteria | 37482 |
| 705 | nmdc:mga05p37_76118_c1 | 3300050507 | Bacteria | 4132 |
| 706 | nmdc:mga09592_173251_c1 | 3300050508 | Bacteria | 1866 |
| 707 | nmdc:mga09592_218383_c1 | 3300050508 | Bacteria | 1652 |
| 708 | nmdc:mga09592_28175_c1 | 3300050508 | Bacteria | 4666 |
| 709 | nmdc:mga0qj67_13438_c1 | 3300050509 | Bacteria | 6175 |
| 710 | nmdc:mga0qj67_39959_c1 | 3300050509 | Bacteria | 3686 |
| 711 | nmdc:mga0qj67_99068_c1 | 3300050509 | Bacteria | 2348 |
| 712 | nmdc:mga06r32_25047_c1 | 3300050510 | Bacteria | 5545 |
| 713 | nmdc:mga06r32_28058_c1 | 3300050510 | Bacteria | 5265 |
| 714 | nmdc:mga06r32_38872_c1 | 3300050510 | Bacteria | 4511 |
| 715 | nmdc:mga08y16_167316_c1 | 3300050511 | Bacteria | 2284 |
| 716 | nmdc:mga08y16_90275_c1 | 3300050511 | Bacteria | 3194 |
| 717 | nmdc:mga0n895_157210_c1 | 3300050512 | Bacteria | 2304 |
| 718 | nmdc:mga0n895_346474_c1 | 3300050512 | Bacteria | 1505 |
| 719 | nmdc:mga0n895_53175_c1 | 3300050512 | Bacteria | 3978 |
| 720 | nmdc:mga0n895_68130_c1 | 3300050512 | Bacteria | 3525 |
| 721 | nmdc:mga0rr50_152468_c1 | 3300050513 | Bacteria | 1869 |
| 722 | nmdc:mga0rr50_206252_c1 | 3300050513 | Bacteria | 1618 |
| 723 | nmdc:mga0rr50_225168_c1 | 3300050513 | Bacteria | 1550 |
| 724 | nmdc:mga08x19_110497_c1 | 3300050514 | Bacteria | 1833 |
| 725 | nmdc:mga0a205_107049_c1 | 3300050515 | Bacteria | 2694 |
| 726 | nmdc:mga0a205_143150_c1 | 3300050515 | Bacteria | 2291 |
| 727 | nmdc:mga0a205_43683_c1 | 3300050515 | Bacteria | 4320 |
| 728 | nmdc:mga0a205_7532_c2 | 3300050515 | Bacteria | 7471 |
| 729 | Ga0495655_0005297 | 3300053083 | Bacteria | 2270 |
| 730 | Ga0500578_0017345 | 3300053086 | Bacteria | 4625 |
| 731 | Ga0500646_0007900 | 3300053090 | Bacteria | 2720 |
| 732 | Ga0500583_0005204 | 3300053092 | Bacteria | 4335 |
| 733 | Ga0500566_0033762 | 3300053094 | Bacteria | 2979 |
| 734 | Ga0500553_078950 | 3300053101 | Bacteria | 1488 |
| 735 | Ga0500560_030452 | 3300053107 | Bacteria | 1626 |
| 736 | Ga0500569_006115 | 3300053109 | Bacteria | 2625 |
| 737 | Ga0500591_034784 | 3300053115 | Bacteria | 2420 |
| 738 | Ga0500628_001577 | 3300053129 | Bacteria | 3875 |
| 739 | Ga0500652_015340 | 3300053131 | Bacteria | 2763 |
| 740 | Ga0500652_016579 | 3300053131 | Bacteria | 2684 |
| 741 | Ga0500658_0014589 | 3300053134 | Bacteria | 2911 |
| 742 | Ga0500561_0000979 | 3300053137 | Bacteria | 4578 |
| 743 | Ga0500568_0009215 | 3300053139 | Bacteria | 4706 |
| 744 | Ga0500573_0083491 | 3300053140 | Bacteria | 1813 |
| 745 | Ga0500600_0006627 | 3300053149 | Bacteria | 6923 |
| 746 | Ga0500616_0000053 | 3300053153 | Bacteria | 291841 |
| 747 | Ga0500616_0005770 | 3300053153 | Bacteria | 8315 |
| 748 | Ga0500633_0029430 | 3300053160 | Bacteria | 1757 |
| 749 | Ga0500634_0011919 | 3300053161 | Bacteria | 4508 |
| 750 | Ga0500637_0032299 | 3300053178 | Bacteria | 2919 |
| 751 | Ga0500645_000125 | 3300053730 | Bacteria | 60408 |
| 752 | Ga0501084_0055417 | 3300054114 | Bacteria | 3317 |
| 753 | Ga0590071_001088 | 3300059421 | Bacteria | 7344 |
| 754 | Ga0590074_000513 | 3300059423 | Bacteria | 5758 |
| 755 | Ga0590075_000364 | 3300059424 | Bacteria | 12490 |
| 756 | Ga0590077_000930 | 3300059426 | Bacteria | 7469 |
| 757 | Ga0466962_0002288 | 3300061719 | Bacteria | 9079 |
| 758 | Ga0530510_0149864 | 3300061734 | Bacteria | 1722 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049822 | Ga0501035_0025899 | Ga0501035_0025899_3771_5105 | 360 |
| 2 | 3300049823 | Ga0501044_0005139 | Ga0501044_0005139_1124_2458 | 360 |
| 3 | 3300053161 | Ga0500634_0011919 | Ga0500634_0011919_773_2140 | 377 |
| 4 | 3300005985 | Ga0081539_10001103 | Ga0081539_1000110338 | 380 |
| 5 | 3300049579 | Ga0501043_0270106 | Ga0501043_0270106_23_1216 | 383 |
| 6 | 3300049582 | Ga0501048_0234485 | Ga0501048_0234485_25_1218 | 383 |
| 7 | 3300044658 | Ga0466972_0024639 | Ga0466972_0024639_1687_2889 | 385 |
| 8 | 3300049823 | Ga0501044_0146631 | Ga0501044_0146631_964_2280 | 386 |
| 9 | 3300003763 | Ga0055529_1003401 | Ga0055529_10034013 | 387 |
| 10 | 3300005614 | Ga0068856_100001887 | Ga0068856_1000018873 | 387 |
| 11 | 3300025272 | Ga0209455_1000357 | Ga0209455_100035732 | 387 |
| 12 | 3300026078 | Ga0207702_10000185 | Ga0207702_1000018519 | 387 |
| 13 | 3300005578 | Ga0068854_100000400 | Ga0068854_10000040012 | 389 |
| 14 | 3300025949 | Ga0207667_10000031 | Ga0207667_1000003114 | 389 |
| 15 | 3300025981 | Ga0207640_10000061 | Ga0207640_1000006124 | 389 |
| 16 | 3300044658 | Ga0466972_0044402 | Ga0466972_0044402_222_1553 | 390 |
| 17 | 3300044672 | Ga0466982_0000044 | Ga0466982_0000044_24329_25660 | 390 |
| 18 | 3300044683 | Ga0466965_0025957 | Ga0466965_0025957_451_1782 | 390 |
| 19 | 3300044684 | Ga0466966_0033225 | Ga0466966_0033225_1708_3039 | 390 |
| 20 | 3300044765 | Ga0466970_0012573 | Ga0466970_0012573_2447_3778 | 390 |
| 21 | 3300009093 | Ga0105240_10005363 | Ga0105240_100053636 | 391 |
| 22 | 3300006846 | Ga0075430_100013534 | Ga0075430_1000135346 | 392 |
| 23 | 3300050509 | nmdc:mga0qj67_13438_c1 | nmdc:mga0qj67_13438_c1_1385_2752 | 392 |
| 24 | 3300003759 | Ga0055525_1000261 | Ga0055525_10002612 | 393 |
| 25 | 3300003760 | Ga0055527_1000273 | Ga0055527_100027311 | 393 |
| 26 | 3300003761 | Ga0055535_1000574 | Ga0055535_100057411 | 393 |
| 27 | 3300003762 | Ga0055542_1000597 | Ga0055542_100059714 | 393 |
| 28 | 3300003763 | Ga0055529_1000815 | Ga0055529_10008157 | 393 |
| 29 | 3300025228 | Ga0209672_100024 | Ga0209672_100024279 | 393 |
| 30 | 3300025230 | Ga0209563_100127 | Ga0209563_10012772 | 393 |
| 31 | 3300025242 | Ga0209258_100047 | Ga0209258_100047279 | 393 |
| 32 | 3300025254 | Ga0209148_1000054 | Ga0209148_1000054279 | 393 |
| 33 | 3300025272 | Ga0209455_1000052 | Ga0209455_1000052279 | 393 |
| 34 | 3300048088 | Ga0495602_0127005 | Ga0495602_0127005_806_2029 | 393 |
| 35 | 3300049587 | Ga0501071_0216682 | Ga0501071_0216682_10_1218 | 394 |
| 36 | 3300045976 | Ga0466967_0000795 | Ga0466967_0000795_5263_6498 | 395 |
| 37 | 3300006852 | Ga0075433_10011817 | Ga0075433_100118172 | 396 |
| 38 | 3300006914 | Ga0075436_100015010 | Ga0075436_1000150104 | 396 |
| 39 | 3300007076 | Ga0075435_100070676 | Ga0075435_1000706762 | 396 |
| 40 | 3300033180 | Ga0307510_10018254 | Ga0307510_100182546 | 396 |
| 41 | 3300046455 | Ga0495603_0002686 | Ga0495603_0002686_938_2206 | 396 |
| 42 | 3300046459 | Ga0495629_0025807 | Ga0495629_0025807_11_1264 | 396 |
| 43 | 3300046460 | Ga0495638_0099420 | Ga0495638_0099420_261_1529 | 396 |
| 44 | 3300046492 | Ga0495585_0038264 | Ga0495585_0038264_344_1612 | 396 |
| 45 | 3300046518 | Ga0495631_0040157 | Ga0495631_0040157_291_1559 | 396 |
| 46 | 3300047447 | Ga0495685_014345 | Ga0495685_014345_1079_2347 | 396 |
| 47 | 3300048088 | Ga0495602_0048087 | Ga0495602_0048087_10_1263 | 396 |
| 48 | 3300048905 | Ga0496102_0030481 | Ga0496102_0030481_2436_3671 | 396 |
| 49 | 3300048919 | Ga0496116_0017221 | Ga0496116_0017221_3530_4765 | 396 |
| 50 | 3300048920 | Ga0496117_0000024 | Ga0496117_0000024_83163_84398 | 396 |
| 51 | 3300048921 | Ga0496118_0000014 | Ga0496118_0000014_334664_335899 | 396 |
| 52 | 3300048923 | Ga0496120_0026274 | Ga0496120_0026274_601_1836 | 396 |
| 53 | 3300048929 | Ga0496126_0045508 | Ga0496126_0045508_2369_3604 | 396 |
| 54 | 3300053178 | Ga0500637_0032299 | Ga0500637_0032299_686_1918 | 396 |
| 55 | 3300044693 | Ga0466961_0055317 | Ga0466961_0055317_1269_2513 | 397 |
| 56 | 3300005539 | Ga0068853_100020326 | Ga0068853_1000203264 | 398 |
| 57 | 3300009545 | Ga0105237_10291835 | Ga0105237_102918351 | 398 |
| 58 | 3300026041 | Ga0207639_10034619 | Ga0207639_100346193 | 398 |
| 59 | 3300005615 | Ga0070702_100085281 | Ga0070702_1000852812 | 399 |
| 60 | 3300025931 | Ga0207644_10043803 | Ga0207644_100438033 | 399 |
| 61 | 3300025940 | Ga0207691_10005413 | Ga0207691_1000541310 | 399 |
| 62 | 3300028381 | Ga0268264_10059497 | Ga0268264_100594971 | 399 |
| 63 | 3300006871 | Ga0075434_100113754 | Ga0075434_1001137542 | 401 |
| 64 | 3300050515 | nmdc:mga0a205_7532_c2 | nmdc:mga0a205_7532_c2_3201_4517 | 401 |
| 65 | 3300005468 | Ga0070707_100170508 | Ga0070707_1001705081 | 402 |
| 66 | 3300005518 | Ga0070699_100113580 | Ga0070699_1001135802 | 402 |
| 67 | 3300025922 | Ga0207646_10104611 | Ga0207646_101046112 | 402 |
| 68 | 3300025981 | Ga0207640_10078923 | Ga0207640_100789232 | 402 |
| 69 | 3300048928 | Ga0496125_0020072 | Ga0496125_0020072_629_1882 | 402 |
| 70 | 3300009101 | Ga0105247_10026927 | Ga0105247_100269272 | 403 |
| 71 | 3300009553 | Ga0105249_10134771 | Ga0105249_101347712 | 403 |
| 72 | 3300013296 | Ga0157374_10109243 | Ga0157374_101092432 | 403 |
| 73 | 3300026121 | Ga0207683_10166592 | Ga0207683_101665922 | 403 |
| 74 | 3300048928 | Ga0496125_0000416 | Ga0496125_0000416_41582_42844 | 403 |
| 75 | 3300005262 | Ga0065165_1004668 | Ga0065165_10046682 | 405 |
| 76 | 3300028786 | Ga0307517_10018496 | Ga0307517_100184968 | 405 |
| 77 | 3300031507 | Ga0307509_10030391 | Ga0307509_100303911 | 405 |
| 78 | 3300031616 | Ga0307508_10014270 | Ga0307508_100142704 | 405 |
| 79 | 3300033180 | Ga0307510_10133917 | Ga0307510_101339172 | 405 |
| 80 | 3300046499 | Ga0495594_0019414 | Ga0495594_0019414_2241_3566 | 405 |
| 81 | 3300046501 | Ga0495607_0023327 | Ga0495607_0023327_1090_2415 | 405 |
| 82 | 3300046522 | Ga0495643_0009173 | Ga0495643_0009173_1840_3165 | 405 |
| 83 | 3300046683 | Ga0495658_0044193 | Ga0495658_0044193_1065_2390 | 405 |
| 84 | 3300046690 | Ga0495624_0058895 | Ga0495624_0058895_690_2015 | 405 |
| 85 | 3300046691 | Ga0495670_0007579 | Ga0495670_0007579_1927_3252 | 405 |
| 86 | 3300046794 | Ga0495589_0023474 | Ga0495589_0023474_1690_3015 | 405 |
| 87 | 3300046810 | Ga0495660_0025463 | Ga0495660_0025463_1457_2782 | 405 |
| 88 | 3300047443 | Ga0495687_010294 | Ga0495687_010294_374_1699 | 405 |
| 89 | 3300047447 | Ga0495685_000931 | Ga0495685_000931_4569_5894 | 405 |
| 90 | 3300053083 | Ga0495655_0005297 | Ga0495655_0005297_126_1451 | 405 |
| 91 | 3300053094 | Ga0500566_0033762 | Ga0500566_0033762_626_1951 | 405 |
| 92 | 3300053101 | Ga0500553_078950 | Ga0500553_078950_100_1425 | 405 |
| 93 | 3300053109 | Ga0500569_006115 | Ga0500569_006115_1008_2333 | 405 |
| 94 | 3300053129 | Ga0500628_001577 | Ga0500628_001577_2451_3776 | 405 |
| 95 | 3300053131 | Ga0500652_015340 | Ga0500652_015340_768_2093 | 405 |
| 96 | 3300053137 | Ga0500561_0000979 | Ga0500561_0000979_1008_2333 | 405 |
| 97 | 3300053140 | Ga0500573_0083491 | Ga0500573_0083491_258_1583 | 405 |
| 98 | 3300053149 | Ga0500600_0006627 | Ga0500600_0006627_1606_2931 | 405 |
| 99 | 3300053153 | Ga0500616_0005770 | Ga0500616_0005770_5098_6423 | 405 |
| 100 | 3300003316 | rootH1_10019244 | rootH1_100192442 | 406 |
| 101 | 3300005458 | Ga0070681_10193030 | Ga0070681_101930302 | 408 |
| 102 | 3300031616 | Ga0307508_10034594 | Ga0307508_100345944 | 409 |
| 103 | 3300047447 | Ga0495685_005825 | Ga0495685_005825_2662_3987 | 409 |
| 104 | 3300053086 | Ga0500578_0017345 | Ga0500578_0017345_94_1419 | 409 |
| 105 | 3300053131 | Ga0500652_016579 | Ga0500652_016579_1126_2451 | 409 |
| 106 | 3300053160 | Ga0500633_0029430 | Ga0500633_0029430_94_1419 | 409 |
| 107 | 3300005355 | Ga0070671_100032205 | Ga0070671_1000322054 | 410 |
| 108 | 3300005543 | Ga0070672_100034073 | Ga0070672_1000340733 | 410 |
| 109 | 3300005841 | Ga0068863_100010821 | Ga0068863_1000108212 | 410 |
| 110 | 3300005842 | Ga0068858_100160059 | Ga0068858_1001600592 | 410 |
| 111 | 3300009177 | Ga0105248_10126373 | Ga0105248_101263732 | 410 |
| 112 | 3300013306 | Ga0163162_10062930 | Ga0163162_100629303 | 410 |
| 113 | 3300014968 | Ga0157379_10072490 | Ga0157379_100724902 | 410 |
| 114 | 3300025908 | Ga0207643_10003066 | Ga0207643_100030668 | 410 |
| 115 | 3300025941 | Ga0207711_10037845 | Ga0207711_100378452 | 410 |
| 116 | 3300025942 | Ga0207689_10042064 | Ga0207689_100420643 | 410 |
| 117 | 3300025972 | Ga0207668_10110871 | Ga0207668_101108712 | 410 |
| 118 | 3300026088 | Ga0207641_10065076 | Ga0207641_100650762 | 410 |
| 119 | 3300048913 | Ga0496110_0326451 | Ga0496110_0326451_31_1347 | 410 |
| 120 | 3300030522 | Ga0307512_10008398 | Ga0307512_100083989 | 411 |
| 121 | 3300005937 | Ga0081455_10203969 | Ga0081455_102039691 | 412 |
| 122 | iso_pu_bacteria | 8001781756 | 8001789183 | 412 |
| 123 | 3300045049 | Ga0466959_0014526 | Ga0466959_0014526_517_1815 | 413 |
| 124 | 3300046525 | Ga0495663_0000222 | Ga0495663_0000222_14417_15763 | 413 |
| 125 | 3300048929 | Ga0496126_0097845 | Ga0496126_0097845_1198_2517 | 413 |
| 126 | 3300049822 | Ga0501035_0226821 | Ga0501035_0226821_108_1427 | 414 |
| 127 | iso_pu_bacteria | 2844533157 | 2844533196 | 414 |
| 128 | 3300031456 | Ga0307513_10035596 | Ga0307513_100355965 | 415 |
| 129 | iso_pu_bacteria | 2558860280 | 2559427465 | 415 |
| 130 | iso_pu_bacteria | 2585427649 | 2586059182 | 415 |
| 131 | iso_pu_bacteria | 2791354901 | 2791914299 | 415 |
| 132 | iso_pu_bacteria | 2808606522 | 2809592059 | 415 |
| 133 | iso_pu_bacteria | 2915768154 | 2915773238 | 415 |
| 134 | iso_pu_bacteria | 2917736166 | 2917738827 | 415 |
| 135 | iso_pu_bacteria | 8003314358 | 8003322634 | 415 |
| 136 | iso_pu_bacteria | 8047710418 | 8047714131 | 415 |
| 137 | 3300031240 | Ga0265320_10013217 | Ga0265320_100132173 | 417 |
| 138 | 3300048907 | Ga0496104_0031919 | Ga0496104_0031919_1466_2776 | 417 |
| 139 | 3300048918 | Ga0496115_0015634 | Ga0496115_0015634_920_2230 | 417 |
| 140 | iso_pu_bacteria | 2857740372 | 2857744857 | 417 |
| 141 | iso_pu_bacteria | 2904497146 | 2904499110 | 417 |
| 142 | iso_pu_bacteria | 2919538618 | 2919541325 | 417 |
| 143 | iso_pu_bacteria | 2932426870 | 2932430163 | 417 |
| 144 | iso_pu_bacteria | 2933418574 | 2933422149 | 417 |
| 145 | iso_pu_bacteria | 2939674588 | 2939678957 | 417 |
| 146 | 3300002987 | JGI25159J45721_1008856 | JGI25159J45721_10088562 | 418 |
| 147 | 3300003187 | JGI25151J46595_10000179 | JGI25151J46595_1000017912 | 418 |
| 148 | 3300003354 | JGI25160J50197_1001998 | JGI25160J50197_10019986 | 418 |
| 149 | 3300005353 | Ga0070669_100042507 | Ga0070669_1000425072 | 418 |
| 150 | 3300005356 | Ga0070674_100001468 | Ga0070674_1000014684 | 418 |
| 151 | 3300005366 | Ga0070659_100127592 | Ga0070659_1001275922 | 418 |
| 152 | 3300005436 | Ga0070713_100003503 | Ga0070713_1000035038 | 418 |
| 153 | 3300005445 | Ga0070708_100047508 | Ga0070708_1000475083 | 418 |
| 154 | 3300005458 | Ga0070681_10081342 | Ga0070681_100813422 | 418 |
| 155 | 3300005614 | Ga0068856_100086528 | Ga0068856_1000865282 | 418 |
| 156 | 3300005616 | Ga0068852_100036452 | Ga0068852_1000364524 | 418 |
| 157 | 3300005719 | Ga0068861_100034981 | Ga0068861_1000349812 | 418 |
| 158 | 3300005844 | Ga0068862_100022786 | Ga0068862_1000227862 | 418 |
| 159 | 3300005844 | Ga0068862_100126546 | Ga0068862_1001265462 | 418 |
| 160 | 3300005985 | Ga0081539_10004763 | Ga0081539_1000476312 | 418 |
| 161 | 3300006028 | Ga0070717_10026850 | Ga0070717_100268506 | 418 |
| 162 | 3300006175 | Ga0070712_100009921 | Ga0070712_1000099215 | 418 |
| 163 | 3300006844 | Ga0075428_100004781 | Ga0075428_10000478111 | 418 |
| 164 | 3300006846 | Ga0075430_100003642 | Ga0075430_10000364210 | 418 |
| 165 | 3300006847 | Ga0075431_100004593 | Ga0075431_1000045932 | 418 |
| 166 | 3300006880 | Ga0075429_100044196 | Ga0075429_1000441962 | 418 |
| 167 | 3300006914 | Ga0075436_100022323 | Ga0075436_1000223233 | 418 |
| 168 | 3300006931 | Ga0097620_100082292 | Ga0097620_1000822922 | 418 |
| 169 | 3300007076 | Ga0075435_100128319 | Ga0075435_1001283192 | 418 |
| 170 | 3300009093 | Ga0105240_10000002 | Ga0105240_100000021128 | 418 |
| 171 | 3300009094 | Ga0111539_10026149 | Ga0111539_100261494 | 418 |
| 172 | 3300009094 | Ga0111539_10122454 | Ga0111539_101224542 | 418 |
| 173 | 3300009147 | Ga0114129_10004447 | Ga0114129_1000444714 | 418 |
| 174 | 3300009147 | Ga0114129_10189004 | Ga0114129_101890042 | 418 |
| 175 | 3300009147 | Ga0114129_10225027 | Ga0114129_102250271 | 418 |
| 176 | 3300009147 | Ga0114129_10445042 | Ga0114129_104450421 | 418 |
| 177 | 3300009551 | Ga0105238_10025862 | Ga0105238_100258624 | 418 |
| 178 | 3300013100 | Ga0157373_10089741 | Ga0157373_100897412 | 418 |
| 179 | 3300013104 | Ga0157370_10004257 | Ga0157370_100042578 | 418 |
| 180 | 3300013104 | Ga0157370_10236533 | Ga0157370_102365332 | 418 |
| 181 | 3300013105 | Ga0157369_10001939 | Ga0157369_1000193912 | 418 |
| 182 | 3300014326 | Ga0157380_10011558 | Ga0157380_100115583 | 418 |
| 183 | 3300014326 | Ga0157380_10031769 | Ga0157380_100317694 | 418 |
| 184 | 3300025284 | Ga0209130_1000793 | Ga0209130_10007937 | 418 |
| 185 | 3300025294 | Ga0209025_1000251 | Ga0209025_100025112 | 418 |
| 186 | 3300025913 | Ga0207695_10000002 | Ga0207695_100000021133 | 418 |
| 187 | 3300025923 | Ga0207681_10008729 | Ga0207681_100087292 | 418 |
| 188 | 3300025928 | Ga0207700_10076420 | Ga0207700_100764202 | 418 |
| 189 | 3300025935 | Ga0207709_10065253 | Ga0207709_100652532 | 418 |
| 190 | 3300026075 | Ga0207708_10042238 | Ga0207708_100422384 | 418 |
| 191 | 3300026078 | Ga0207702_10144433 | Ga0207702_101444332 | 418 |
| 192 | 3300026142 | Ga0207698_10025989 | Ga0207698_100259893 | 418 |
| 193 | 3300027907 | Ga0207428_10034951 | Ga0207428_100349513 | 418 |
| 194 | 3300028380 | Ga0268265_10026758 | Ga0268265_100267582 | 418 |
| 195 | 3300028380 | Ga0268265_10128854 | Ga0268265_101288542 | 418 |
| 196 | 3300028380 | Ga0268265_10189989 | Ga0268265_101899892 | 418 |
| 197 | 3300031548 | Ga0307408_100068822 | Ga0307408_1000688222 | 418 |
| 198 | 3300031901 | Ga0307406_10057987 | Ga0307406_100579872 | 418 |
| 199 | 3300042439 | Ga0439464_0003883 | Ga0439464_0003883_822_2126 | 418 |
| 200 | 3300042461 | Ga0439460_0018890 | Ga0439460_0018890_430_1746 | 418 |
| 201 | 3300046516 | Ga0495628_0022582 | Ga0495628_0022582_2845_4149 | 418 |
| 202 | 3300046536 | Ga0495587_0015851 | Ga0495587_0015851_3227_4531 | 418 |
| 203 | 3300046543 | Ga0495645_0005674 | Ga0495645_0005674_6279_7583 | 418 |
| 204 | 3300046663 | Ga0495635_0047510 | Ga0495635_0047510_1353_2657 | 418 |
| 205 | 3300046679 | Ga0495623_0047478 | Ga0495623_0047478_30_1334 | 418 |
| 206 | 3300046809 | Ga0495600_0047615 | Ga0495600_0047615_1364_2668 | 418 |
| 207 | 3300047317 | Ga0495604_0051265 | Ga0495604_0051265_183_1487 | 418 |
| 208 | 3300047470 | Ga0495681_0003555 | Ga0495681_0003555_2797_4116 | 418 |
| 209 | 3300049572 | Ga0501036_0264331 | Ga0501036_0264331_25_1323 | 418 |
| 210 | 3300049576 | Ga0501040_0086342 | Ga0501040_0086342_106_1404 | 418 |
| 211 | 3300050507 | nmdc:mga05p37_198665_c1 | nmdc:mga05p37_198665_c1_584_1900 | 418 |
| 212 | 3300050507 | nmdc:mga05p37_43286_c1 | nmdc:mga05p37_43286_c1_190_1494 | 418 |
| 213 | 3300050507 | nmdc:mga05p37_444857_c1 | nmdc:mga05p37_444857_c1_154_1455 | 418 |
| 214 | 3300050507 | nmdc:mga05p37_76118_c1 | nmdc:mga05p37_76118_c1_1631_2935 | 418 |
| 215 | 3300050508 | nmdc:mga09592_218383_c1 | nmdc:mga09592_218383_c1_255_1571 | 418 |
| 216 | 3300050508 | nmdc:mga09592_28175_c1 | nmdc:mga09592_28175_c1_1049_2353 | 418 |
| 217 | 3300050509 | nmdc:mga0qj67_39959_c1 | nmdc:mga0qj67_39959_c1_715_2019 | 418 |
| 218 | 3300050509 | nmdc:mga0qj67_99068_c1 | nmdc:mga0qj67_99068_c1_598_1902 | 418 |
| 219 | 3300050510 | nmdc:mga06r32_25047_c1 | nmdc:mga06r32_25047_c1_1013_2317 | 418 |
| 220 | 3300050510 | nmdc:mga06r32_38872_c1 | nmdc:mga06r32_38872_c1_71_1375 | 418 |
| 221 | 3300050511 | nmdc:mga08y16_167316_c1 | nmdc:mga08y16_167316_c1_176_1492 | 418 |
| 222 | 3300050511 | nmdc:mga08y16_90275_c1 | nmdc:mga08y16_90275_c1_183_1487 | 418 |
| 223 | 3300050512 | nmdc:mga0n895_346474_c1 | nmdc:mga0n895_346474_c1_13_1305 | 418 |
| 224 | 3300050512 | nmdc:mga0n895_53175_c1 | nmdc:mga0n895_53175_c1_497_1789 | 418 |
| 225 | 3300050513 | nmdc:mga0rr50_152468_c1 | nmdc:mga0rr50_152468_c1_136_1428 | 418 |
| 226 | 3300050513 | nmdc:mga0rr50_206252_c1 | nmdc:mga0rr50_206252_c1_278_1570 | 418 |
| 227 | 3300050515 | nmdc:mga0a205_143150_c1 | nmdc:mga0a205_143150_c1_702_1994 | 418 |
| 228 | 3300050515 | nmdc:mga0a205_43683_c1 | nmdc:mga0a205_43683_c1_115_1419 | 418 |
| 229 | 3300053139 | Ga0500568_0009215 | Ga0500568_0009215_1231_2547 | 418 |
| 230 | 3300054114 | Ga0501084_0055417 | Ga0501084_0055417_413_1723 | 418 |
| 231 | 3300061734 | Ga0530510_0149864 | Ga0530510_0149864_116_1414 | 418 |
| 232 | iso_pu_bacteria | 2818991440 | 2819562544 | 418 |
| 233 | iso_pu_bacteria | 2842914999 | 2842915264 | 418 |
| 234 | iso_pu_bacteria | 2842918807 | 2842921607 | 418 |
| 235 | iso_pu_bacteria | 2868088558 | 2868091334 | 418 |
| 236 | iso_pu_bacteria | 2904463128 | 2904463146 | 418 |
| 237 | iso_pu_bacteria | 2928963466 | 2928963876 | 418 |
| 238 | iso_pu_bacteria | 2941471342 | 2941472437 | 418 |
| 239 | iso_pu_bacteria | 2953994433 | 2953997622 | 418 |
| 240 | 3300005437 | Ga0070710_10000323 | Ga0070710_100003233 | 419 |
| 241 | 3300005548 | Ga0070665_100290682 | Ga0070665_1002906822 | 419 |
| 242 | 3300006846 | Ga0075430_100030472 | Ga0075430_1000304723 | 419 |
| 243 | 3300009094 | Ga0111539_10415366 | Ga0111539_104153661 | 419 |
| 244 | 3300009147 | Ga0114129_10001468 | Ga0114129_1000146813 | 419 |
| 245 | 3300025302 | Ga0207426_1000179 | Ga0207426_100017985 | 419 |
| 246 | 3300025898 | Ga0207692_10000685 | Ga0207692_100006854 | 419 |
| 247 | 3300025972 | Ga0207668_10002000 | Ga0207668_100020007 | 419 |
| 248 | 3300026067 | Ga0207678_10005681 | Ga0207678_100056812 | 419 |
| 249 | 3300028794 | Ga0307515_10074461 | Ga0307515_100744613 | 419 |
| 250 | 3300030733 | Ga0314311_1226575 | Ga0314311_12265752 | 419 |
| 251 | 3300031548 | Ga0307408_100044022 | Ga0307408_1000440221 | 419 |
| 252 | 3300031548 | Ga0307408_100188838 | Ga0307408_1001888382 | 419 |
| 253 | 3300031731 | Ga0307405_10043405 | Ga0307405_100434052 | 419 |
| 254 | 3300031995 | Ga0307409_100050650 | Ga0307409_1000506501 | 419 |
| 255 | 3300032002 | Ga0307416_100012602 | Ga0307416_1000126021 | 419 |
| 256 | 3300032005 | Ga0307411_10028371 | Ga0307411_100283713 | 419 |
| 257 | 3300033179 | Ga0307507_10025927 | Ga0307507_100259274 | 419 |
| 258 | 3300033179 | Ga0307507_10121752 | Ga0307507_101217522 | 419 |
| 259 | 3300037853 | Ga0436364_0821552 | Ga0436364_0821552_2912_4258 | 419 |
| 260 | 3300039450 | Ga0436363_1440167 | Ga0436363_1440167_973_2298 | 419 |
| 261 | 3300044658 | Ga0466972_0000377 | Ga0466972_0000377_13392_14696 | 419 |
| 262 | 3300044658 | Ga0466972_0014349 | Ga0466972_0014349_2562_3869 | 419 |
| 263 | 3300044683 | Ga0466965_0001162 | Ga0466965_0001162_1166_2476 | 419 |
| 264 | 3300044683 | Ga0466965_0003803 | Ga0466965_0003803_968_2275 | 419 |
| 265 | 3300048905 | Ga0496102_0014442 | Ga0496102_0014442_4766_6064 | 419 |
| 266 | 3300048909 | Ga0496106_0198717 | Ga0496106_0198717_140_1438 | 419 |
| 267 | 3300048913 | Ga0496110_0224731 | Ga0496110_0224731_307_1605 | 419 |
| 268 | 3300049522 | Ga0501299_012684 | Ga0501299_012684_35_1339 | 419 |
| 269 | 3300050507 | nmdc:mga05p37_687_c1 | nmdc:mga05p37_687_c1_17090_18409 | 419 |
| 270 | 3300050512 | nmdc:mga0n895_68130_c1 | nmdc:mga0n895_68130_c1_2001_3320 | 419 |
| 271 | 3300059421 | Ga0590071_001088 | Ga0590071_001088_3743_5050 | 419 |
| 272 | 3300059423 | Ga0590074_000513 | Ga0590074_000513_1897_3204 | 419 |
| 273 | 3300059424 | Ga0590075_000364 | Ga0590075_000364_3819_5126 | 419 |
| 274 | 3300059426 | Ga0590077_000930 | Ga0590077_000930_2185_3492 | 419 |
| 275 | iso_pu_bacteria | 2643221578 | 2643904983 | 419 |
| 276 | iso_pu_bacteria | 2643221673 | 2644403042 | 419 |
| 277 | iso_pu_bacteria | 2643221677 | 2644433490 | 419 |
| 278 | iso_pu_bacteria | 2751185734 | 2753075869 | 419 |
| 279 | iso_pu_bacteria | 2821443989 | 2821445719 | 419 |
| 280 | iso_pu_bacteria | 2867507094 | 2867507474 | 419 |
| 281 | iso_pu_bacteria | 2918501144 | 2918501623 | 419 |
| 282 | 3300001989 | JGI24739J22299_10001025 | JGI24739J22299_1000102510 | 420 |
| 283 | 3300001990 | JGI24737J22298_10000523 | JGI24737J22298_100005236 | 420 |
| 284 | 3300003578 | Ga0006562J51391_1045775 | Ga0006562J51391_10457752 | 420 |
| 285 | 3300003578 | Ga0006562J51391_1045778 | Ga0006562J51391_10457788 | 420 |
| 286 | 3300005335 | Ga0070666_10000005 | Ga0070666_1000000549 | 420 |
| 287 | 3300005355 | Ga0070671_100009724 | Ga0070671_1000097247 | 420 |
| 288 | 3300005367 | Ga0070667_100006541 | Ga0070667_1000065413 | 420 |
| 289 | 3300005367 | Ga0070667_100082098 | Ga0070667_1000820982 | 420 |
| 290 | 3300005548 | Ga0070665_100033725 | Ga0070665_1000337252 | 420 |
| 291 | 3300005563 | Ga0068855_100146328 | Ga0068855_1001463283 | 420 |
| 292 | 3300005577 | Ga0068857_100000189 | Ga0068857_10000018914 | 420 |
| 293 | 3300005616 | Ga0068852_100037179 | Ga0068852_1000371793 | 420 |
| 294 | 3300005617 | Ga0068859_100000211 | Ga0068859_10000021130 | 420 |
| 295 | 3300005841 | Ga0068863_100003996 | Ga0068863_1000039969 | 420 |
| 296 | 3300005842 | Ga0068858_100005568 | Ga0068858_1000055682 | 420 |
| 297 | 3300005843 | Ga0068860_100004169 | Ga0068860_1000041699 | 420 |
| 298 | 3300006847 | Ga0075431_100035498 | Ga0075431_1000354982 | 420 |
| 299 | 3300006871 | Ga0075434_100161682 | Ga0075434_1001616821 | 420 |
| 300 | 3300006914 | Ga0075436_100125169 | Ga0075436_1001251691 | 420 |
| 301 | 3300006931 | Ga0097620_100000211 | Ga0097620_10000021130 | 420 |
| 302 | 3300007788 | Ga0099795_10000019 | Ga0099795_1000001929 | 420 |
| 303 | 3300009092 | Ga0105250_10003540 | Ga0105250_100035404 | 420 |
| 304 | 3300009093 | Ga0105240_10007085 | Ga0105240_100070854 | 420 |
| 305 | 3300009101 | Ga0105247_10000260 | Ga0105247_1000026012 | 420 |
| 306 | 3300009177 | Ga0105248_10001076 | Ga0105248_100010769 | 420 |
| 307 | 3300009545 | Ga0105237_10000007 | Ga0105237_10000007179 | 420 |
| 308 | 3300009545 | Ga0105237_10000136 | Ga0105237_1000013627 | 420 |
| 309 | 3300009551 | Ga0105238_10016211 | Ga0105238_100162113 | 420 |
| 310 | 3300009553 | Ga0105249_10020152 | Ga0105249_100201522 | 420 |
| 311 | 3300010159 | Ga0099796_10000010 | Ga0099796_1000001029 | 420 |
| 312 | 3300010375 | Ga0105239_10003222 | Ga0105239_1000322213 | 420 |
| 313 | 3300012500 | Ga0157314_1000790 | Ga0157314_10007902 | 420 |
| 314 | 3300013306 | Ga0163162_10000281 | Ga0163162_1000028121 | 420 |
| 315 | 3300013306 | Ga0163162_10244608 | Ga0163162_102446082 | 420 |
| 316 | 3300014325 | Ga0163163_10049693 | Ga0163163_100496934 | 420 |
| 317 | 3300014968 | Ga0157379_10146214 | Ga0157379_101462142 | 420 |
| 318 | 3300025246 | Ga0209646_1005413 | Ga0209646_10054132 | 420 |
| 319 | 3300025250 | Ga0209026_1000391 | Ga0209026_100039115 | 420 |
| 320 | 3300025256 | Ga0209759_1001819 | Ga0209759_10018194 | 420 |
| 321 | 3300025297 | Ga0209758_1001868 | Ga0209758_100186812 | 420 |
| 322 | 3300025900 | Ga0207710_10000322 | Ga0207710_1000032231 | 420 |
| 323 | 3300025903 | Ga0207680_10000005 | Ga0207680_10000005405 | 420 |
| 324 | 3300025904 | Ga0207647_10010943 | Ga0207647_100109434 | 420 |
| 325 | 3300025913 | Ga0207695_10001214 | Ga0207695_1000121410 | 420 |
| 326 | 3300025913 | Ga0207695_10012993 | Ga0207695_100129934 | 420 |
| 327 | 3300025914 | Ga0207671_10000059 | Ga0207671_1000005927 | 420 |
| 328 | 3300025914 | Ga0207671_10000074 | Ga0207671_1000007480 | 420 |
| 329 | 3300025924 | Ga0207694_10001048 | Ga0207694_1000104820 | 420 |
| 330 | 3300025931 | Ga0207644_10018202 | Ga0207644_100182022 | 420 |
| 331 | 3300025949 | Ga0207667_10000292 | Ga0207667_1000029215 | 420 |
| 332 | 3300025961 | Ga0207712_10039372 | Ga0207712_100393722 | 420 |
| 333 | 3300025981 | Ga0207640_10018558 | Ga0207640_100185583 | 420 |
| 334 | 3300025986 | Ga0207658_10044094 | Ga0207658_100440941 | 420 |
| 335 | 3300026035 | Ga0207703_10002171 | Ga0207703_1000217113 | 420 |
| 336 | 3300026088 | Ga0207641_10007137 | Ga0207641_100071374 | 420 |
| 337 | 3300026116 | Ga0207674_10000298 | Ga0207674_1000029827 | 420 |
| 338 | 3300026142 | Ga0207698_10057077 | Ga0207698_100570773 | 420 |
| 339 | 3300027512 | Ga0209179_1000008 | Ga0209179_100000835 | 420 |
| 340 | 3300028379 | Ga0268266_10000004 | Ga0268266_100000041125 | 420 |
| 341 | 3300028379 | Ga0268266_10035428 | Ga0268266_100354284 | 420 |
| 342 | 3300030521 | Ga0307511_10000227 | Ga0307511_1000022710 | 420 |
| 343 | 3300033180 | Ga0307510_10010353 | Ga0307510_100103537 | 420 |
| 344 | 3300046471 | Ga0495650_0000247 | Ga0495650_0000247_64213_65526 | 420 |
| 345 | 3300048905 | Ga0496102_0030962 | Ga0496102_0030962_2977_4287 | 420 |
| 346 | 3300048906 | Ga0496103_0026811 | Ga0496103_0026811_1409_2719 | 420 |
| 347 | 3300048924 | Ga0496121_0002051 | Ga0496121_0002051_30117_31427 | 420 |
| 348 | 3300048924 | Ga0496121_0014570 | Ga0496121_0014570_2985_4313 | 420 |
| 349 | 3300048928 | Ga0496125_0000453 | Ga0496125_0000453_45082_46410 | 420 |
| 350 | 3300048928 | Ga0496125_0012791 | Ga0496125_0012791_766_2076 | 420 |
| 351 | 3300048929 | Ga0496126_0002266 | Ga0496126_0002266_13615_14928 | 420 |
| 352 | 3300049581 | Ga0501047_0006703 | Ga0501047_0006703_4824_6182 | 420 |
| 353 | 3300049586 | Ga0501070_0017543 | Ga0501070_0017543_3052_4410 | 420 |
| 354 | 3300049822 | Ga0501035_0014043 | Ga0501035_0014043_1965_3323 | 420 |
| 355 | 3300049823 | Ga0501044_0022778 | Ga0501044_0022778_4936_6294 | 420 |
| 356 | 3300049823 | Ga0501044_0080152 | Ga0501044_0080152_1664_3010 | 420 |
| 357 | 3300050507 | nmdc:mga05p37_36826_c1 | nmdc:mga05p37_36826_c1_717_2075 | 420 |
| 358 | 3300050510 | nmdc:mga06r32_28058_c1 | nmdc:mga06r32_28058_c1_1652_3034 | 420 |
| 359 | 3300050512 | nmdc:mga0n895_157210_c1 | nmdc:mga0n895_157210_c1_705_2000 | 420 |
| 360 | 3300050513 | nmdc:mga0rr50_225168_c1 | nmdc:mga0rr50_225168_c1_39_1334 | 420 |
| 361 | 3300050514 | nmdc:mga08x19_110497_c1 | nmdc:mga08x19_110497_c1_404_1699 | 420 |
| 362 | 3300053090 | Ga0500646_0007900 | Ga0500646_0007900_137_1450 | 420 |
| 363 | iso_pu_bacteria | 2523231044 | 2523384872 | 420 |
| 364 | iso_pu_bacteria | 2551306166 | 2552112353 | 420 |
| 365 | iso_pu_bacteria | 2747842501 | 2748017761 | 420 |
| 366 | iso_pu_bacteria | 2818991457 | 2819661583 | 420 |
| 367 | iso_pu_bacteria | 2852684882 | 2852688172 | 420 |
| 368 | iso_pu_bacteria | 2894414249 | 2894415220 | 420 |
| 369 | iso_pu_bacteria | 2919130084 | 2919134494 | 420 |
| 370 | iso_pu_bacteria | 2929195423 | 2929199594 | 420 |
| 371 | iso_pu_bacteria | 8021622325 | 8021623424 | 420 |
| 372 | iso_pu_bacteria | 8021626552 | 8021627080 | 420 |
| 373 | iso_pu_bacteria | 8021648035 | 8021648716 | 420 |
| 374 | 3300001915 | JGI24741J21665_1007211 | JGI24741J21665_10072112 | 421 |
| 375 | 3300003760 | Ga0055527_1000271 | Ga0055527_100027114 | 421 |
| 376 | 3300003761 | Ga0055535_1000567 | Ga0055535_100056714 | 421 |
| 377 | 3300003762 | Ga0055542_1000591 | Ga0055542_100059111 | 421 |
| 378 | 3300003763 | Ga0055529_1000556 | Ga0055529_100055611 | 421 |
| 379 | 3300005331 | Ga0070670_100021401 | Ga0070670_1000214016 | 421 |
| 380 | 3300005335 | Ga0070666_10000147 | Ga0070666_1000014728 | 421 |
| 381 | 3300005335 | Ga0070666_10083483 | Ga0070666_100834832 | 421 |
| 382 | 3300005343 | Ga0070687_100021419 | Ga0070687_1000214191 | 421 |
| 383 | 3300005356 | Ga0070674_100057277 | Ga0070674_1000572772 | 421 |
| 384 | 3300005364 | Ga0070673_100010330 | Ga0070673_1000103305 | 421 |
| 385 | 3300005367 | Ga0070667_100079789 | Ga0070667_1000797892 | 421 |
| 386 | 3300005367 | Ga0070667_100126000 | Ga0070667_1001260001 | 421 |
| 387 | 3300005367 | Ga0070667_100216073 | Ga0070667_1002160732 | 421 |
| 388 | 3300005437 | Ga0070710_10063104 | Ga0070710_100631042 | 421 |
| 389 | 3300005444 | Ga0070694_100085307 | Ga0070694_1000853072 | 421 |
| 390 | 3300005456 | Ga0070678_100001774 | Ga0070678_1000017745 | 421 |
| 391 | 3300005457 | Ga0070662_100014343 | Ga0070662_1000143435 | 421 |
| 392 | 3300005457 | Ga0070662_100057419 | Ga0070662_1000574193 | 421 |
| 393 | 3300005458 | Ga0070681_10009451 | Ga0070681_100094519 | 421 |
| 394 | 3300005459 | Ga0068867_100108573 | Ga0068867_1001085732 | 421 |
| 395 | 3300005468 | Ga0070707_100077171 | Ga0070707_1000771712 | 421 |
| 396 | 3300005471 | Ga0070698_100030003 | Ga0070698_1000300032 | 421 |
| 397 | 3300005471 | Ga0070698_100184645 | Ga0070698_1001846452 | 421 |
| 398 | 3300005530 | Ga0070679_100092018 | Ga0070679_1000920181 | 421 |
| 399 | 3300005536 | Ga0070697_100000007 | Ga0070697_100000007108 | 421 |
| 400 | 3300005546 | Ga0070696_100068800 | Ga0070696_1000688002 | 421 |
| 401 | 3300005548 | Ga0070665_100003246 | Ga0070665_1000032468 | 421 |
| 402 | 3300005548 | Ga0070665_100013154 | Ga0070665_1000131544 | 421 |
| 403 | 3300005548 | Ga0070665_100021493 | Ga0070665_1000214933 | 421 |
| 404 | 3300005563 | Ga0068855_100012081 | Ga0068855_1000120818 | 421 |
| 405 | 3300005577 | Ga0068857_100131461 | Ga0068857_1001314612 | 421 |
| 406 | 3300005614 | Ga0068856_100001910 | Ga0068856_10000191014 | 421 |
| 407 | 3300005615 | Ga0070702_100003651 | Ga0070702_1000036516 | 421 |
| 408 | 3300005616 | Ga0068852_100241121 | Ga0068852_1002411212 | 421 |
| 409 | 3300005617 | Ga0068859_100078206 | Ga0068859_1000782062 | 421 |
| 410 | 3300005834 | Ga0068851_10027552 | Ga0068851_100275523 | 421 |
| 411 | 3300005841 | Ga0068863_100000714 | Ga0068863_10000071426 | 421 |
| 412 | 3300005842 | Ga0068858_100001471 | Ga0068858_1000014718 | 421 |
| 413 | 3300005842 | Ga0068858_100006060 | Ga0068858_10000606014 | 421 |
| 414 | 3300005842 | Ga0068858_100023029 | Ga0068858_1000230295 | 421 |
| 415 | 3300005842 | Ga0068858_100245519 | Ga0068858_1002455191 | 421 |
| 416 | 3300005843 | Ga0068860_100000185 | Ga0068860_10000018566 | 421 |
| 417 | 3300005844 | Ga0068862_100135608 | Ga0068862_1001356082 | 421 |
| 418 | 3300006237 | Ga0097621_100009537 | Ga0097621_1000095373 | 421 |
| 419 | 3300006353 | Ga0075370_10021614 | Ga0075370_100216142 | 421 |
| 420 | 3300006358 | Ga0068871_100031726 | Ga0068871_1000317262 | 421 |
| 421 | 3300006358 | Ga0068871_100170807 | Ga0068871_1001708072 | 421 |
| 422 | 3300006914 | Ga0075436_100005578 | Ga0075436_1000055788 | 421 |
| 423 | 3300006931 | Ga0097620_100078212 | Ga0097620_1000782122 | 421 |
| 424 | 3300007265 | Ga0099794_10045384 | Ga0099794_100453842 | 421 |
| 425 | 3300007788 | Ga0099795_10001057 | Ga0099795_100010572 | 421 |
| 426 | 3300009093 | Ga0105240_10000628 | Ga0105240_1000062862 | 421 |
| 427 | 3300009101 | Ga0105247_10039195 | Ga0105247_100391952 | 421 |
| 428 | 3300009174 | Ga0105241_10011751 | Ga0105241_100117512 | 421 |
| 429 | 3300009174 | Ga0105241_10047992 | Ga0105241_100479923 | 421 |
| 430 | 3300009176 | Ga0105242_10099665 | Ga0105242_100996652 | 421 |
| 431 | 3300009545 | Ga0105237_10136725 | Ga0105237_101367252 | 421 |
| 432 | 3300009545 | Ga0105237_10252660 | Ga0105237_102526602 | 421 |
| 433 | 3300009545 | Ga0105237_10273282 | Ga0105237_102732822 | 421 |
| 434 | 3300009551 | Ga0105238_10208765 | Ga0105238_102087652 | 421 |
| 435 | 3300009551 | Ga0105238_10211076 | Ga0105238_102110762 | 421 |
| 436 | 3300009553 | Ga0105249_10018582 | Ga0105249_100185822 | 421 |
| 437 | 3300010159 | Ga0099796_10000232 | Ga0099796_100002326 | 421 |
| 438 | 3300010375 | Ga0105239_10044423 | Ga0105239_100444232 | 421 |
| 439 | 3300013297 | Ga0157378_10020941 | Ga0157378_100209416 | 421 |
| 440 | 3300013307 | Ga0157372_10276459 | Ga0157372_102764592 | 421 |
| 441 | 3300014325 | Ga0163163_10145333 | Ga0163163_101453332 | 421 |
| 442 | 3300014968 | Ga0157379_10014123 | Ga0157379_100141236 | 421 |
| 443 | 3300014968 | Ga0157379_10150902 | Ga0157379_101509022 | 421 |
| 444 | 3300025226 | Ga0209674_100053 | Ga0209674_10005342 | 421 |
| 445 | 3300025228 | Ga0209672_100009 | Ga0209672_100009337 | 421 |
| 446 | 3300025242 | Ga0209258_100011 | Ga0209258_100011307 | 421 |
| 447 | 3300025253 | Ga0209677_102437 | Ga0209677_1024376 | 421 |
| 448 | 3300025254 | Ga0209148_1000013 | Ga0209148_1000013307 | 421 |
| 449 | 3300025261 | Ga0209233_1000754 | Ga0209233_10007547 | 421 |
| 450 | 3300025272 | Ga0209455_1000012 | Ga0209455_1000012307 | 421 |
| 451 | 3300025900 | Ga0207710_10022803 | Ga0207710_100228032 | 421 |
| 452 | 3300025900 | Ga0207710_10055512 | Ga0207710_100555122 | 421 |
| 453 | 3300025903 | Ga0207680_10001024 | Ga0207680_100010242 | 421 |
| 454 | 3300025903 | Ga0207680_10043657 | Ga0207680_100436571 | 421 |
| 455 | 3300025904 | Ga0207647_10000055 | Ga0207647_1000005540 | 421 |
| 456 | 3300025904 | Ga0207647_10005581 | Ga0207647_100055813 | 421 |
| 457 | 3300025910 | Ga0207684_10027359 | Ga0207684_100273592 | 421 |
| 458 | 3300025911 | Ga0207654_10133733 | Ga0207654_101337332 | 421 |
| 459 | 3300025912 | Ga0207707_10000958 | Ga0207707_100009582 | 421 |
| 460 | 3300025913 | Ga0207695_10000040 | Ga0207695_10000040325 | 421 |
| 461 | 3300025913 | Ga0207695_10006516 | Ga0207695_100065167 | 421 |
| 462 | 3300025913 | Ga0207695_10062233 | Ga0207695_100622333 | 421 |
| 463 | 3300025913 | Ga0207695_10091476 | Ga0207695_100914762 | 421 |
| 464 | 3300025914 | Ga0207671_10037715 | Ga0207671_100377152 | 421 |
| 465 | 3300025914 | Ga0207671_10041429 | Ga0207671_100414293 | 421 |
| 466 | 3300025914 | Ga0207671_10053093 | Ga0207671_100530932 | 421 |
| 467 | 3300025914 | Ga0207671_10060394 | Ga0207671_100603942 | 421 |
| 468 | 3300025917 | Ga0207660_10003060 | Ga0207660_100030601 | 421 |
| 469 | 3300025921 | Ga0207652_10000912 | Ga0207652_1000091218 | 421 |
| 470 | 3300025922 | Ga0207646_10010941 | Ga0207646_100109414 | 421 |
| 471 | 3300025922 | Ga0207646_10022308 | Ga0207646_100223086 | 421 |
| 472 | 3300025922 | Ga0207646_10143230 | Ga0207646_101432302 | 421 |
| 473 | 3300025924 | Ga0207694_10075188 | Ga0207694_100751882 | 421 |
| 474 | 3300025925 | Ga0207650_10014766 | Ga0207650_100147661 | 421 |
| 475 | 3300025933 | Ga0207706_10025342 | Ga0207706_100253422 | 421 |
| 476 | 3300025933 | Ga0207706_10049685 | Ga0207706_100496852 | 421 |
| 477 | 3300025934 | Ga0207686_10107858 | Ga0207686_101078581 | 421 |
| 478 | 3300025937 | Ga0207669_10060660 | Ga0207669_100606602 | 421 |
| 479 | 3300025949 | Ga0207667_10023268 | Ga0207667_100232684 | 421 |
| 480 | 3300025961 | Ga0207712_10000120 | Ga0207712_1000012013 | 421 |
| 481 | 3300025981 | Ga0207640_10091377 | Ga0207640_100913772 | 421 |
| 482 | 3300026035 | Ga0207703_10000422 | Ga0207703_1000042228 | 421 |
| 483 | 3300026035 | Ga0207703_10003735 | Ga0207703_100037352 | 421 |
| 484 | 3300026035 | Ga0207703_10029673 | Ga0207703_100296735 | 421 |
| 485 | 3300026041 | Ga0207639_10010801 | Ga0207639_100108012 | 421 |
| 486 | 3300026067 | Ga0207678_10066153 | Ga0207678_100661532 | 421 |
| 487 | 3300026078 | Ga0207702_10007958 | Ga0207702_100079587 | 421 |
| 488 | 3300026078 | Ga0207702_10037495 | Ga0207702_100374954 | 421 |
| 489 | 3300026078 | Ga0207702_10089993 | Ga0207702_100899932 | 421 |
| 490 | 3300026088 | Ga0207641_10000393 | Ga0207641_1000039327 | 421 |
| 491 | 3300026089 | Ga0207648_10126998 | Ga0207648_101269982 | 421 |
| 492 | 3300026116 | Ga0207674_10036889 | Ga0207674_100368892 | 421 |
| 493 | 3300026121 | Ga0207683_10000244 | Ga0207683_100002447 | 421 |
| 494 | 3300026142 | Ga0207698_10172685 | Ga0207698_101726852 | 421 |
| 495 | 3300027512 | Ga0209179_1000665 | Ga0209179_10006652 | 421 |
| 496 | 3300028379 | Ga0268266_10000007 | Ga0268266_10000007138 | 421 |
| 497 | 3300028379 | Ga0268266_10006593 | Ga0268266_100065939 | 421 |
| 498 | 3300028379 | Ga0268266_10028873 | Ga0268266_100288734 | 421 |
| 499 | 3300028381 | Ga0268264_10000088 | Ga0268264_10000088174 | 421 |
| 500 | 3300028786 | Ga0307517_10018152 | Ga0307517_100181523 | 421 |
| 501 | 3300028794 | Ga0307515_10010304 | Ga0307515_100103047 | 421 |
| 502 | 3300028794 | Ga0307515_10017668 | Ga0307515_100176684 | 421 |
| 503 | 3300030521 | Ga0307511_10000672 | Ga0307511_1000067227 | 421 |
| 504 | 3300030521 | Ga0307511_10010986 | Ga0307511_100109868 | 421 |
| 505 | 3300030521 | Ga0307511_10015900 | Ga0307511_100159002 | 421 |
| 506 | 3300031456 | Ga0307513_10015491 | Ga0307513_100154918 | 421 |
| 507 | 3300031507 | Ga0307509_10006518 | Ga0307509_100065184 | 421 |
| 508 | 3300031507 | Ga0307509_10138169 | Ga0307509_101381691 | 421 |
| 509 | 3300031616 | Ga0307508_10015242 | Ga0307508_100152426 | 421 |
| 510 | 3300031616 | Ga0307508_10053927 | Ga0307508_100539273 | 421 |
| 511 | 3300031616 | Ga0307508_10091016 | Ga0307508_100910162 | 421 |
| 512 | 3300033179 | Ga0307507_10030151 | Ga0307507_100301516 | 421 |
| 513 | 3300033179 | Ga0307507_10060126 | Ga0307507_100601262 | 421 |
| 514 | 3300033180 | Ga0307510_10000061 | Ga0307510_1000006153 | 421 |
| 515 | 3300033180 | Ga0307510_10005829 | Ga0307510_1000582914 | 421 |
| 516 | 3300033180 | Ga0307510_10006065 | Ga0307510_100060656 | 421 |
| 517 | 3300035113 | Ga0373936_0042983 | Ga0373936_0042983_293_1606 | 421 |
| 518 | 3300037312 | Ga0395899_0002906 | Ga0395899_0002906_1897_3237 | 421 |
| 519 | 3300037418 | Ga0395900_0063004 | Ga0395900_0063004_1026_2366 | 421 |
| 520 | 3300037466 | Ga0395898_0001593 | Ga0395898_0001593_11207_12523 | 421 |
| 521 | 3300041404 | Ga0439436_0005195 | Ga0439436_0005195_1061_2413 | 421 |
| 522 | 3300041512 | Ga0451853_2973491 | Ga0451853_2973491_828_2159 | 421 |
| 523 | 3300042005 | Ga0439448_0022462 | Ga0439448_0022462_17_1348 | 421 |
| 524 | 3300042007 | Ga0439449_0000378 | Ga0439449_0000378_8732_10084 | 421 |
| 525 | 3300042014 | Ga0439457_000120 | Ga0439457_000120_11263_12597 | 421 |
| 526 | 3300042014 | Ga0439457_000307 | Ga0439457_000307_10411_11763 | 421 |
| 527 | 3300042131 | Ga0450894_000894 | Ga0450894_000894_1170_2522 | 421 |
| 528 | 3300044656 | Ga0466969_0014302 | Ga0466969_0014302_1589_2887 | 421 |
| 529 | 3300044656 | Ga0466969_0024240 | Ga0466969_0024240_441_1766 | 421 |
| 530 | 3300044658 | Ga0466972_0001073 | Ga0466972_0001073_2640_3965 | 421 |
| 531 | 3300044658 | Ga0466972_0002839 | Ga0466972_0002839_981_2333 | 421 |
| 532 | 3300044693 | Ga0466961_0007789 | Ga0466961_0007789_1640_2992 | 421 |
| 533 | 3300044693 | Ga0466961_0008091 | Ga0466961_0008091_3126_4484 | 421 |
| 534 | 3300044693 | Ga0466961_0036482 | Ga0466961_0036482_1679_3004 | 421 |
| 535 | 3300044719 | Ga0466971_0013988 | Ga0466971_0013988_105_1463 | 421 |
| 536 | 3300044735 | Ga0466968_0031075 | Ga0466968_0031075_210_1535 | 421 |
| 537 | 3300045049 | Ga0466959_0011104 | Ga0466959_0011104_5037_6335 | 421 |
| 538 | 3300045051 | Ga0451576_0325731 | Ga0451576_0325731_148_1542 | 421 |
| 539 | 3300045976 | Ga0466967_0051578 | Ga0466967_0051578_2146_3471 | 421 |
| 540 | 3300046454 | Ga0495592_0012776 | Ga0495592_0012776_3224_4564 | 421 |
| 541 | 3300046459 | Ga0495629_0015196 | Ga0495629_0015196_3216_4565 | 421 |
| 542 | 3300046462 | Ga0495651_0004042 | Ga0495651_0004042_4921_6261 | 421 |
| 543 | 3300046475 | Ga0495639_0063529 | Ga0495639_0063529_264_1619 | 421 |
| 544 | 3300046476 | Ga0495662_0000534 | Ga0495662_0000534_5654_6994 | 421 |
| 545 | 3300046476 | Ga0495662_0019059 | Ga0495662_0019059_153_1517 | 421 |
| 546 | 3300046477 | Ga0495664_0003610 | Ga0495664_0003610_4831_6171 | 421 |
| 547 | 3300046499 | Ga0495594_0005271 | Ga0495594_0005271_5254_6609 | 421 |
| 548 | 3300046507 | Ga0495606_0050569 | Ga0495606_0050569_993_2318 | 421 |
| 549 | 3300046516 | Ga0495628_0071763 | Ga0495628_0071763_1305_2645 | 421 |
| 550 | 3300046522 | Ga0495643_0006314 | Ga0495643_0006314_410_1735 | 421 |
| 551 | 3300046529 | Ga0495652_0031801 | Ga0495652_0031801_233_1573 | 421 |
| 552 | 3300046539 | Ga0495621_0008627 | Ga0495621_0008627_1045_2391 | 421 |
| 553 | 3300046542 | Ga0495597_0017251 | Ga0495597_0017251_1917_3242 | 421 |
| 554 | 3300046543 | Ga0495645_0005263 | Ga0495645_0005263_2458_3798 | 421 |
| 555 | 3300046616 | Ga0495668_0027794 | Ga0495668_0027794_1393_2718 | 421 |
| 556 | 3300046660 | Ga0495625_0022762 | Ga0495625_0022762_387_1736 | 421 |
| 557 | 3300046660 | Ga0495625_0054199 | Ga0495625_0054199_1087_2412 | 421 |
| 558 | 3300046663 | Ga0495635_0006399 | Ga0495635_0006399_5810_7150 | 421 |
| 559 | 3300046674 | Ga0495588_0005143 | Ga0495588_0005143_1416_2771 | 421 |
| 560 | 3300046674 | Ga0495588_0007950 | Ga0495588_0007950_460_1809 | 421 |
| 561 | 3300046680 | Ga0495646_0057201 | Ga0495646_0057201_142_1482 | 421 |
| 562 | 3300046689 | Ga0495613_0017227 | Ga0495613_0017227_1047_2387 | 421 |
| 563 | 3300046689 | Ga0495613_0039155 | Ga0495613_0039155_1294_2658 | 421 |
| 564 | 3300046809 | Ga0495600_0017891 | Ga0495600_0017891_1047_2387 | 421 |
| 565 | 3300047315 | Ga0495581_0021486 | Ga0495581_0021486_2230_3570 | 421 |
| 566 | 3300047318 | Ga0495636_0018692 | Ga0495636_0018692_783_2138 | 421 |
| 567 | 3300047319 | Ga0495674_0216232 | Ga0495674_0216232_240_1574 | 421 |
| 568 | 3300047321 | Ga0495676_0012001 | Ga0495676_0012001_2309_3649 | 421 |
| 569 | 3300047443 | Ga0495687_001648 | Ga0495687_001648_8382_9731 | 421 |
| 570 | 3300047443 | Ga0495687_002821 | Ga0495687_002821_7656_8981 | 421 |
| 571 | 3300047470 | Ga0495681_0001693 | Ga0495681_0001693_5885_7234 | 421 |
| 572 | 3300047673 | Ga0495593_0003639 | Ga0495593_0003639_5454_6794 | 421 |
| 573 | 3300048089 | Ga0495614_0042408 | Ga0495614_0042408_460_1809 | 421 |
| 574 | 3300048089 | Ga0495614_0054420 | Ga0495614_0054420_142_1482 | 421 |
| 575 | 3300048907 | Ga0496104_0048215 | Ga0496104_0048215_2224_3555 | 421 |
| 576 | 3300048908 | Ga0496105_0005844 | Ga0496105_0005844_4396_5727 | 421 |
| 577 | 3300048910 | Ga0496107_0011636 | Ga0496107_0011636_628_1959 | 421 |
| 578 | 3300048917 | Ga0496114_0016710 | Ga0496114_0016710_4483_5814 | 421 |
| 579 | 3300048921 | Ga0496118_0008276 | Ga0496118_0008276_1218_2573 | 421 |
| 580 | 3300048924 | Ga0496121_0110793 | Ga0496121_0110793_140_1438 | 421 |
| 581 | 3300048928 | Ga0496125_0000816 | Ga0496125_0000816_25147_26445 | 421 |
| 582 | 3300048929 | Ga0496126_0069812 | Ga0496126_0069812_1452_2750 | 421 |
| 583 | 3300049588 | Ga0501072_0231280 | Ga0501072_0231280_29_1339 | 421 |
| 584 | 3300049822 | Ga0501035_0001136 | Ga0501035_0001136_25979_27325 | 421 |
| 585 | 3300050508 | nmdc:mga09592_173251_c1 | nmdc:mga09592_173251_c1_91_1389 | 421 |
| 586 | 3300050515 | nmdc:mga0a205_107049_c1 | nmdc:mga0a205_107049_c1_218_1531 | 421 |
| 587 | 3300053092 | Ga0500583_0005204 | Ga0500583_0005204_2396_3715 | 421 |
| 588 | 3300053107 | Ga0500560_030452 | Ga0500560_030452_19_1368 | 421 |
| 589 | 3300053115 | Ga0500591_034784 | Ga0500591_034784_416_1723 | 421 |
| 590 | 3300053134 | Ga0500658_0014589 | Ga0500658_0014589_1414_2715 | 421 |
| 591 | 3300053153 | Ga0500616_0000053 | Ga0500616_0000053_177629_178930 | 421 |
| 592 | 3300061719 | Ga0466962_0002288 | Ga0466962_0002288_4392_5750 | 421 |
| 593 | iso_pu_bacteria | 2582581314 | 2585313979 | 421 |
| 594 | iso_pu_bacteria | 2643221678 | 2644443347 | 421 |
| 595 | iso_pu_bacteria | 2643221714 | 2644627348 | 421 |
| 596 | iso_pu_bacteria | 2643221962 | 2645724067 | 421 |
| 597 | iso_pu_bacteria | 2784746763 | 2785346316 | 421 |
| 598 | iso_pu_bacteria | 2784746763 | 2785346825 | 421 |
| 599 | iso_pu_bacteria | 2784746768 | 2785373452 | 421 |
| 600 | iso_pu_bacteria | 2808606359 | 2808848703 | 421 |
| 601 | iso_pu_bacteria | 2808606375 | 2808916477 | 421 |
| 602 | iso_pu_bacteria | 2852635781 | 2852642596 | 421 |
| 603 | iso_pu_bacteria | 2862382967 | 2862389661 | 421 |
| 604 | iso_pu_bacteria | 2863404153 | 2863407846 | 421 |
| 605 | iso_pu_bacteria | 2867346516 | 2867348328 | 421 |
| 606 | iso_pu_bacteria | 2947224130 | 2947224255 | 421 |
| 607 | iso_pu_bacteria | 2954380949 | 2954390057 | 421 |
| 608 | iso_pu_bacteria | 2954711539 | 2954712274 | 421 |
| 609 | iso_pu_bacteria | 2954721474 | 2954722219 | 421 |
| 610 | iso_pu_bacteria | 2954731030 | 2954739630 | 421 |
| 611 | iso_pu_bacteria | 2954740390 | 2954741108 | 421 |
| 612 | iso_pu_bacteria | 2954749733 | 2954758456 | 421 |
| 613 | iso_pu_bacteria | 2954759201 | 2954760119 | 421 |
| 614 | iso_pu_bacteria | 2990059506 | 2990066966 | 421 |
| 615 | iso_pu_bacteria | 3006493962 | 3006497289 | 421 |
| 616 | iso_pu_bacteria | 8008558824 | 8008558981 | 421 |
| 617 | iso_pu_bacteria | 8008558824 | 8008560422 | 421 |
| 618 | iso_pu_bacteria | 8008574985 | 8008575720 | 421 |
| 619 | iso_pu_bacteria | 8048406513 | 8048407534 | 421 |
| 620 | 3300002067 | JGI24735J21928_10001024 | JGI24735J21928_100010247 | 422 |
| 621 | 3300002705 | JGI25156J39149_1001399 | JGI25156J39149_10013992 | 422 |
| 622 | 3300002705 | JGI25156J39149_1004432 | JGI25156J39149_10044324 | 422 |
| 623 | 3300002737 | JGI25162J39368_1000066 | JGI25162J39368_100006620 | 422 |
| 624 | 3300002737 | JGI25162J39368_1000623 | JGI25162J39368_100062311 | 422 |
| 625 | 3300002737 | JGI25162J39368_1003666 | JGI25162J39368_10036662 | 422 |
| 626 | 3300002741 | JGI25157J39369_1000050 | JGI25157J39369_100005020 | 422 |
| 627 | 3300002741 | JGI25157J39369_1000688 | JGI25157J39369_100068810 | 422 |
| 628 | 3300002741 | JGI25157J39369_1001266 | JGI25157J39369_10012669 | 422 |
| 629 | 3300002741 | JGI25157J39369_1002251 | JGI25157J39369_10022514 | 422 |
| 630 | 3300002771 | JGI25163J39215_1000565 | JGI25163J39215_10005659 | 422 |
| 631 | 3300002772 | JGI25164J39214_1000056 | JGI25164J39214_100005686 | 422 |
| 632 | 3300002772 | JGI25164J39214_1000061 | JGI25164J39214_100006120 | 422 |
| 633 | 3300003214 | JGI25165J46597_1000009 | JGI25165J46597_100000920 | 422 |
| 634 | 3300003214 | JGI25165J46597_1000151 | JGI25165J46597_100015173 | 422 |
| 635 | 3300003751 | Ga0055538_1001312 | Ga0055538_10013125 | 422 |
| 636 | 3300003756 | Ga0055533_1001372 | Ga0055533_10013726 | 422 |
| 637 | 3300003761 | Ga0055535_1000045 | Ga0055535_100004520 | 422 |
| 638 | 3300003761 | Ga0055535_1000466 | Ga0055535_100046615 | 422 |
| 639 | 3300003762 | Ga0055542_1000010 | Ga0055542_1000010262 | 422 |
| 640 | 3300003762 | Ga0055542_1000079 | Ga0055542_100007920 | 422 |
| 641 | 3300003762 | Ga0055542_1000104 | Ga0055542_100010418 | 422 |
| 642 | 3300003762 | Ga0055542_1000689 | Ga0055542_10006898 | 422 |
| 643 | 3300003763 | Ga0055529_1000122 | Ga0055529_100012286 | 422 |
| 644 | 3300003763 | Ga0055529_1000140 | Ga0055529_100014080 | 422 |
| 645 | 3300005262 | Ga0065165_1000186 | Ga0065165_100018650 | 422 |
| 646 | 3300005339 | Ga0070660_100067459 | Ga0070660_1000674592 | 422 |
| 647 | 3300005344 | Ga0070661_100009253 | Ga0070661_1000092534 | 422 |
| 648 | 3300005345 | Ga0070692_10035014 | Ga0070692_100350142 | 422 |
| 649 | 3300005435 | Ga0070714_100027069 | Ga0070714_1000270694 | 422 |
| 650 | 3300005436 | Ga0070713_100001768 | Ga0070713_1000017685 | 422 |
| 651 | 3300005455 | Ga0070663_100021139 | Ga0070663_1000211394 | 422 |
| 652 | 3300005614 | Ga0068856_100226350 | Ga0068856_1002263502 | 422 |
| 653 | 3300005834 | Ga0068851_10026780 | Ga0068851_100267803 | 422 |
| 654 | 3300005841 | Ga0068863_100000545 | Ga0068863_10000054523 | 422 |
| 655 | 3300005842 | Ga0068858_100000534 | Ga0068858_1000005349 | 422 |
| 656 | 3300005843 | Ga0068860_100000296 | Ga0068860_10000029627 | 422 |
| 657 | 3300006175 | Ga0070712_100044833 | Ga0070712_1000448333 | 422 |
| 658 | 3300009551 | Ga0105238_10009646 | Ga0105238_100096465 | 422 |
| 659 | 3300010375 | Ga0105239_10000050 | Ga0105239_1000005011 | 422 |
| 660 | 3300010375 | Ga0105239_10017060 | Ga0105239_100170602 | 422 |
| 661 | 3300010375 | Ga0105239_10072472 | Ga0105239_100724723 | 422 |
| 662 | 3300013100 | Ga0157373_10061996 | Ga0157373_100619962 | 422 |
| 663 | 3300013307 | Ga0157372_10054209 | Ga0157372_100542094 | 422 |
| 664 | 3300014497 | Ga0182008_10007892 | Ga0182008_100078924 | 422 |
| 665 | 3300014969 | Ga0157376_10063194 | Ga0157376_100631942 | 422 |
| 666 | 3300015261 | Ga0182006_1000427 | Ga0182006_100042725 | 422 |
| 667 | 3300015262 | Ga0182007_10038236 | Ga0182007_100382362 | 422 |
| 668 | 3300015265 | Ga0182005_1000686 | Ga0182005_10006867 | 422 |
| 669 | 3300015687 | Ga0183368_1004 | Ga0183368_1004698 | 422 |
| 670 | 3300025207 | Ga0209760_100572 | Ga0209760_1005724 | 422 |
| 671 | 3300025224 | Ga0209784_100013 | Ga0209784_100013473 | 422 |
| 672 | 3300025226 | Ga0209674_100063 | Ga0209674_100063151 | 422 |
| 673 | 3300025226 | Ga0209674_100898 | Ga0209674_1008984 | 422 |
| 674 | 3300025228 | Ga0209672_100107 | Ga0209672_10010774 | 422 |
| 675 | 3300025228 | Ga0209672_100253 | Ga0209672_10025319 | 422 |
| 676 | 3300025228 | Ga0209672_100742 | Ga0209672_1007424 | 422 |
| 677 | 3300025231 | Ga0207427_100021 | Ga0207427_100021325 | 422 |
| 678 | 3300025231 | Ga0207427_100030 | Ga0207427_100030274 | 422 |
| 679 | 3300025231 | Ga0207427_101510 | Ga0207427_1015107 | 422 |
| 680 | 3300025233 | Ga0209437_100012 | Ga0209437_100012724 | 422 |
| 681 | 3300025233 | Ga0209437_100150 | Ga0209437_10015057 | 422 |
| 682 | 3300025233 | Ga0209437_100416 | Ga0209437_10041613 | 422 |
| 683 | 3300025242 | Ga0209258_100019 | Ga0209258_10001965 | 422 |
| 684 | 3300025242 | Ga0209258_100045 | Ga0209258_100045200 | 422 |
| 685 | 3300025242 | Ga0209258_100299 | Ga0209258_10029959 | 422 |
| 686 | 3300025242 | Ga0209258_102767 | Ga0209258_1027673 | 422 |
| 687 | 3300025242 | Ga0209258_104796 | Ga0209258_1047962 | 422 |
| 688 | 3300025246 | Ga0209646_1000458 | Ga0209646_100045813 | 422 |
| 689 | 3300025246 | Ga0209646_1002167 | Ga0209646_10021675 | 422 |
| 690 | 3300025250 | Ga0209026_1000010 | Ga0209026_1000010107 | 422 |
| 691 | 3300025250 | Ga0209026_1000015 | Ga0209026_1000015368 | 422 |
| 692 | 3300025250 | Ga0209026_1000163 | Ga0209026_100016326 | 422 |
| 693 | 3300025250 | Ga0209026_1001325 | Ga0209026_10013256 | 422 |
| 694 | 3300025250 | Ga0209026_1003010 | Ga0209026_10030104 | 422 |
| 695 | 3300025254 | Ga0209148_1000001 | Ga0209148_10000012235 | 422 |
| 696 | 3300025254 | Ga0209148_1000005 | Ga0209148_100000586 | 422 |
| 697 | 3300025254 | Ga0209148_1000052 | Ga0209148_1000052200 | 422 |
| 698 | 3300025254 | Ga0209148_1000205 | Ga0209148_100020579 | 422 |
| 699 | 3300025256 | Ga0209759_1000023 | Ga0209759_1000023232 | 422 |
| 700 | 3300025256 | Ga0209759_1000622 | Ga0209759_100062226 | 422 |
| 701 | 3300025256 | Ga0209759_1002777 | Ga0209759_10027773 | 422 |
| 702 | 3300025256 | Ga0209759_1009864 | Ga0209759_10098642 | 422 |
| 703 | 3300025261 | Ga0209233_1000002 | Ga0209233_100000265 | 422 |
| 704 | 3300025261 | Ga0209233_1000023 | Ga0209233_1000023297 | 422 |
| 705 | 3300025272 | Ga0209455_1000027 | Ga0209455_1000027481 | 422 |
| 706 | 3300025272 | Ga0209455_1000081 | Ga0209455_100008131 | 422 |
| 707 | 3300025272 | Ga0209455_1013884 | Ga0209455_10138842 | 422 |
| 708 | 3300025303 | Ga0209051_1012497 | Ga0209051_10124973 | 422 |
| 709 | 3300025904 | Ga0207647_10006694 | Ga0207647_100066942 | 422 |
| 710 | 3300025904 | Ga0207647_10028042 | Ga0207647_100280422 | 422 |
| 711 | 3300025909 | Ga0207705_10072553 | Ga0207705_100725532 | 422 |
| 712 | 3300025913 | Ga0207695_10000198 | Ga0207695_100001985 | 422 |
| 713 | 3300025913 | Ga0207695_10001115 | Ga0207695_1000111531 | 422 |
| 714 | 3300025919 | Ga0207657_10027032 | Ga0207657_100270325 | 422 |
| 715 | 3300025924 | Ga0207694_10013173 | Ga0207694_100131734 | 422 |
| 716 | 3300025928 | Ga0207700_10001549 | Ga0207700_100015497 | 422 |
| 717 | 3300025932 | Ga0207690_10027106 | Ga0207690_100271063 | 422 |
| 718 | 3300025949 | Ga0207667_10022774 | Ga0207667_100227744 | 422 |
| 719 | 3300025986 | Ga0207658_10032772 | Ga0207658_100327723 | 422 |
| 720 | 3300026035 | Ga0207703_10000468 | Ga0207703_100004685 | 422 |
| 721 | 3300026041 | Ga0207639_10015933 | Ga0207639_100159334 | 422 |
| 722 | 3300026067 | Ga0207678_10044128 | Ga0207678_100441284 | 422 |
| 723 | 3300026067 | Ga0207678_10116742 | Ga0207678_101167422 | 422 |
| 724 | 3300026067 | Ga0207678_10160860 | Ga0207678_101608602 | 422 |
| 725 | 3300026078 | Ga0207702_10054129 | Ga0207702_100541294 | 422 |
| 726 | 3300026088 | Ga0207641_10000177 | Ga0207641_1000017772 | 422 |
| 727 | 3300028379 | Ga0268266_10096734 | Ga0268266_100967342 | 422 |
| 728 | 3300028381 | Ga0268264_10000088 | Ga0268264_1000008887 | 422 |
| 729 | 3300028381 | Ga0268264_10119972 | Ga0268264_101199722 | 422 |
| 730 | 3300031911 | Ga0307412_10000203 | Ga0307412_100002039 | 422 |
| 731 | 3300033179 | Ga0307507_10180361 | Ga0307507_101803611 | 422 |
| 732 | 3300037312 | Ga0395899_0000076 | Ga0395899_0000076_116228_117547 | 422 |
| 733 | 3300037312 | Ga0395899_0053722 | Ga0395899_0053722_434_1753 | 422 |
| 734 | 3300037418 | Ga0395900_0000018 | Ga0395900_0000018_295872_297191 | 422 |
| 735 | 3300037466 | Ga0395898_0000530 | Ga0395898_0000530_55819_57138 | 422 |
| 736 | 3300037466 | Ga0395898_0000612 | Ga0395898_0000612_62981_64300 | 422 |
| 737 | 3300041404 | Ga0439436_0000006 | Ga0439436_0000006_72710_74029 | 422 |
| 738 | 3300041413 | Ga0439465_0003108 | Ga0439465_0003108_761_2080 | 422 |
| 739 | 3300042184 | Ga0450908_000195 | Ga0450908_000195_9331_10650 | 422 |
| 740 | 3300044661 | Ga0466975_0171288 | Ga0466975_0171288_116_1435 | 422 |
| 741 | 3300044672 | Ga0466982_0000033 | Ga0466982_0000033_34603_35922 | 422 |
| 742 | 3300044684 | Ga0466966_0008164 | Ga0466966_0008164_2751_4070 | 422 |
| 743 | 3300044684 | Ga0466966_0016818 | Ga0466966_0016818_756_2075 | 422 |
| 744 | 3300044693 | Ga0466961_0002692 | Ga0466961_0002692_1586_2905 | 422 |
| 745 | 3300044693 | Ga0466961_0052920 | Ga0466961_0052920_1047_2366 | 422 |
| 746 | 3300044719 | Ga0466971_0037351 | Ga0466971_0037351_685_2004 | 422 |
| 747 | 3300044765 | Ga0466970_0002648 | Ga0466970_0002648_5738_7057 | 422 |
| 748 | 3300044842 | Ga0466957_0022896 | Ga0466957_0022896_1945_3369 | 422 |
| 749 | 3300044842 | Ga0466957_0041448 | Ga0466957_0041448_1095_2414 | 422 |
| 750 | 3300045049 | Ga0466959_0000043 | Ga0466959_0000043_21690_23009 | 422 |
| 751 | 3300045976 | Ga0466967_0051257 | Ga0466967_0051257_1180_2499 | 422 |
| 752 | 3300046460 | Ga0495638_0000009 | Ga0495638_0000009_259823_261142 | 422 |
| 753 | 3300046460 | Ga0495638_0000052 | Ga0495638_0000052_181570_182889 | 422 |
| 754 | 3300046471 | Ga0495650_0000122 | Ga0495650_0000122_41723_43042 | 422 |
| 755 | 3300046492 | Ga0495585_0000021 | Ga0495585_0000021_126668_127987 | 422 |
| 756 | 3300046507 | Ga0495606_0000056 | Ga0495606_0000056_81326_82645 | 422 |
| 757 | 3300046512 | Ga0495610_0001176 | Ga0495610_0001176_11741_13060 | 422 |
| 758 | 3300046518 | Ga0495631_0000060 | Ga0495631_0000060_40237_41556 | 422 |
| 759 | 3300046524 | Ga0495648_0000688 | Ga0495648_0000688_7022_8341 | 422 |
| 760 | 3300046557 | Ga0495622_0017292 | Ga0495622_0017292_1182_2501 | 422 |
| 761 | 3300046660 | Ga0495625_0006824 | Ga0495625_0006824_6262_7581 | 422 |
| 762 | 3300046665 | Ga0495661_0000353 | Ga0495661_0000353_21041_22360 | 422 |
| 763 | 3300046691 | Ga0495670_0001214 | Ga0495670_0001214_4780_6099 | 422 |
| 764 | 3300046694 | Ga0495649_0008985 | Ga0495649_0008985_1139_2458 | 422 |
| 765 | 3300048903 | Ga0496100_0063836 | Ga0496100_0063836_523_1842 | 422 |
| 766 | 3300048910 | Ga0496107_0040761 | Ga0496107_0040761_309_1628 | 422 |
| 767 | 3300048916 | Ga0496113_0013707 | Ga0496113_0013707_3840_5159 | 422 |
| 768 | 3300048918 | Ga0496115_0000013 | Ga0496115_0000013_111939_113258 | 422 |
| 769 | 3300048918 | Ga0496115_0000044 | Ga0496115_0000044_1262_2581 | 422 |
| 770 | 3300048918 | Ga0496115_0012558 | Ga0496115_0012558_1498_2817 | 422 |
| 771 | 3300048918 | Ga0496115_0033021 | Ga0496115_0033021_1727_3046 | 422 |
| 772 | 3300048920 | Ga0496117_0004227 | Ga0496117_0004227_1475_2794 | 422 |
| 773 | 3300048920 | Ga0496117_0008001 | Ga0496117_0008001_5867_7186 | 422 |
| 774 | 3300048920 | Ga0496117_0112324 | Ga0496117_0112324_23_1342 | 422 |
| 775 | 3300048921 | Ga0496118_0000636 | Ga0496118_0000636_27831_29150 | 422 |
| 776 | 3300048921 | Ga0496118_0000780 | Ga0496118_0000780_34255_35574 | 422 |
| 777 | 3300048921 | Ga0496118_0011987 | Ga0496118_0011987_3953_5272 | 422 |
| 778 | 3300048922 | Ga0496119_0000109 | Ga0496119_0000109_86804_88123 | 422 |
| 779 | 3300048922 | Ga0496119_0002080 | Ga0496119_0002080_3648_4967 | 422 |
| 780 | 3300048923 | Ga0496120_0000115 | Ga0496120_0000115_58851_60170 | 422 |
| 781 | 3300048923 | Ga0496120_0000150 | Ga0496120_0000150_86805_88124 | 422 |
| 782 | 3300048924 | Ga0496121_0000013 | Ga0496121_0000013_127578_128897 | 422 |
| 783 | 3300048924 | Ga0496121_0001215 | Ga0496121_0001215_19205_20524 | 422 |
| 784 | 3300048925 | Ga0496122_0009875 | Ga0496122_0009875_7256_8575 | 422 |
| 785 | 3300048925 | Ga0496122_0034775 | Ga0496122_0034775_2489_3808 | 422 |
| 786 | 3300048926 | Ga0496123_0003900 | Ga0496123_0003900_7557_8876 | 422 |
| 787 | 3300048926 | Ga0496123_0021655 | Ga0496123_0021655_876_2195 | 422 |
| 788 | 3300048927 | Ga0496124_0004659 | Ga0496124_0004659_8724_10043 | 422 |
| 789 | 3300048927 | Ga0496124_0004848 | Ga0496124_0004848_5776_7095 | 422 |
| 790 | 3300048929 | Ga0496126_0002275 | Ga0496126_0002275_3856_5175 | 422 |
| 791 | 3300048929 | Ga0496126_0014270 | Ga0496126_0014270_4903_6222 | 422 |
| 792 | 3300049460 | Ga0495682_0000253 | Ga0495682_0000253_19474_20793 | 422 |
| 793 | 3300049580 | Ga0501046_0010033 | Ga0501046_0010033_1390_2709 | 422 |
| 794 | 3300049705 | Ga0501225_0001420 | Ga0501225_0001420_2218_3531 | 422 |
| 795 | 3300053730 | Ga0500645_000125 | Ga0500645_000125_31418_32737 | 422 |
| 796 | 3300003856 | Ga0058692_1000054 | Ga0058692_100005441 | 423 |
| 797 | 3300005439 | Ga0070711_100183443 | Ga0070711_1001834432 | 423 |
| 798 | 3300015265 | Ga0182005_1003981 | Ga0182005_10039812 | 423 |
| 799 | 3300025935 | Ga0207709_10046937 | Ga0207709_100469373 | 423 |
| 800 | 3300027312 | Ga0209371_1000116 | Ga0209371_100011655 | 423 |
| 801 | 3300030500 | Ga0268256_1000099 | Ga0268256_100009969 | 423 |
| 802 | 2162886007 | SwRhRL2b_contig_764990 | SwRhRL2b_0381.00004250 | 424 |
| 803 | 3300005289 | Ga0065704_10074189 | Ga0065704_100741892 | 424 |
| 804 | 3300005331 | Ga0070670_100000709 | Ga0070670_1000007097 | 424 |
| 805 | 3300005336 | Ga0070680_100001573 | Ga0070680_10000157313 | 424 |
| 806 | 3300005341 | Ga0070691_10000632 | Ga0070691_100006329 | 424 |
| 807 | 3300005458 | Ga0070681_10000170 | Ga0070681_1000017014 | 424 |
| 808 | 3300005530 | Ga0070679_100000161 | Ga0070679_10000016121 | 424 |
| 809 | 3300009011 | Ga0105251_10000362 | Ga0105251_1000036246 | 424 |
| 810 | 3300010375 | Ga0105239_10101527 | Ga0105239_101015273 | 424 |
| 811 | 3300025735 | Ga0207713_1000429 | Ga0207713_100042945 | 424 |
| 812 | 3300025912 | Ga0207707_10000249 | Ga0207707_1000024922 | 424 |
| 813 | 3300025917 | Ga0207660_10001068 | Ga0207660_100010685 | 424 |
| 814 | 3300025921 | Ga0207652_10000134 | Ga0207652_1000013423 | 424 |
| 815 | 3300025925 | Ga0207650_10000841 | Ga0207650_1000084110 | 424 |
| 816 | 3300028017 | Ga0265356_1000505 | Ga0265356_10005053 | 424 |
| 817 | 3300031090 | Ga0265760_10008192 | Ga0265760_100081922 | 424 |
| 818 | 3300041413 | Ga0439465_0003000 | Ga0439465_0003000_2485_3831 | 424 |
| 819 | 3300042004 | Ga0439445_0003134 | Ga0439445_0003134_996_2330 | 424 |
| 820 | 3300042007 | Ga0439449_0000733 | Ga0439449_0000733_1707_3035 | 424 |
| 821 | 3300042007 | Ga0439449_0004079 | Ga0439449_0004079_806_2152 | 424 |
| 822 | 3300047323 | Ga0495683_0002632 | Ga0495683_0002632_5057_6397 | 424 |
| 823 | 3300048917 | Ga0496114_0033041 | Ga0496114_0033041_736_2088 | 424 |
| 824 | 3300048918 | Ga0496115_0168551 | Ga0496115_0168551_292_1644 | 424 |
| 825 | 3300048920 | Ga0496117_0034255 | Ga0496117_0034255_1052_2371 | 424 |
| 826 | 3300048925 | Ga0496122_0000049 | Ga0496122_0000049_41386_42705 | 424 |
| 827 | 3300048926 | Ga0496123_0000042 | Ga0496123_0000042_211777_213096 | 424 |
| 828 | 3300048927 | Ga0496124_0003222 | Ga0496124_0003222_6742_8061 | 424 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2hne-assembly1.cif.gz_A | crystal structure of l-fuconate dehydratase from xanthomonas campestris pv. campestris str. atcc 33913 | 0.9891 | 1 | 419 |
| 1yey-assembly3.cif.gz_C | crystal structure of l-fuconate dehydratase from xanthomonas campestris pv. campestris str. atcc 33913 | 0.9867 | 1 | 419 |
| 1yey-assembly6.cif.gz_A | crystal structure of l-fuconate dehydratase from xanthomonas campestris pv. campestris str. atcc 33913 | 0.9867 | 1 | 419 |
| 1yey-assembly4.cif.gz_D | crystal structure of l-fuconate dehydratase from xanthomonas campestris pv. campestris str. atcc 33913 | 0.9862 | 1 | 419 |
| 2hxu-assembly1.cif.gz_A-2 | crystal structure of k220a mutant of l-fuconate dehydratase from xanthomonas campestris liganded with mg++ and l-fuconate | 0.9842 | 3 | 419 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1yeyB02 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Enolase-like C-terminal domain | 0.9962 | 185 | 419 | 3.20.20.120 |
| 1yeyA02 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Enolase-like C-terminal domain | 0.9913 | 133 | 419 | 3.20.20.120 |
| 1yeyD01 | Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain | 0.9587 | 3 | 178 | 3.30.390.10 |
| 1yeyD01 | Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain | 0.9425 | 3 | 178 | 3.30.390.10 |
| 1yeyB02 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Enolase-like C-terminal domain | 0.9392 | 185 | 419 | 3.20.20.120 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0K2RLQ8-F1-model_v4 | L-fuconate dehydratase | 0.9948 | 293 | 419 |
GO:0000287
GO:0016052 GO:0016836 |
| AF-A0A2V9TKP6-F1-model_v4 | Fuconate dehydratase | 0.9936 | 121 | 419 |
GO:0000287
GO:0009063 GO:0016052 GO:0016836 |
| AF-J3HA68-F1-model_v4 | deleted | 0.9934 | 130 | 424 |
|
| AF-A0A182H0H6-F1-model_v4 | deleted | 0.993 | 174 | 419 |
|
| AF-A0A6I2V3N6-F1-model_v4 | Fuconate dehydratase | 0.9924 | 228 | 419 |
GO:0000287
GO:0009063 GO:0016052 GO:0016836 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar