F482557

General Info

Members Datasets Scaffolds Average Seq Length
828 436 758 436

Family's Representative Sequence

Representative Sequence 3300026067|Ga0207678_10044128|Ga0207678_100441284
Length 478
Sequence MRFPPLAGRLPCQAGLAYMKTGFCNETWLPPHVRKESSQVAVIVALETSDIRFPTSRELDGSDAMNPDPDYSAAYVVLRTDDPSGLSGHGFVFTIGRGNDVQTAALTALRHLVVGRDVAGVLDDLGAFARSLTNDSQLRWLGPEKGVMHMAIGAVINAAWDMAARRAGKPVWRLIAEMSPEQIVDLIDFRYISDALTPADALAILRASAPHKAERIATLLSRGYAAYTTSPGWLGYSDEKLARLAVEAVEQGFRTIKLKVGLTVEDDIRRLRIARQAIGPAIGLAIDANQRWDVGVACAWLQQLASFDVAWIEEPTSPDDVLGHAAIRRAVAPMPVSTGEHTQNRVIFKQLFQAGAVDLIQIDAARVGGVNENLAILLMAAKFGIRVYPHAGGVGLCELVQHLAMADYVAISGSMEDRAIEYVDHLHEHFVDPVRIRAGRYLAPLAPGFSAEMRPQSLAQYRFPDGPVWLTSPPGASR

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
3 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
4 2558860280 Kutzneria sp. 744 Isolate Unclassified
5 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
6 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
7 2643221578 Streptomyces sp. Root63 Isolate Unclassified
8 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
9 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
10 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
11 2643221714 Streptomyces sp. Root264 Isolate Unclassified
12 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
13 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
14 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
15 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
16 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
17 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
18 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
19 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
20 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
21 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
22 2818991457 Xanthomonas translucens 569 Isolate Unclassified
23 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
24 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
25 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
26 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
27 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
28 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
29 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
30 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
31 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
32 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
33 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
34 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
35 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
36 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
37 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
38 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
39 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
40 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
41 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
42 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
43 2928963466 Dyella japonica 1073 Isolate Unclassified
44 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
45 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
46 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
47 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
48 2941471342 Luteibacter sp. 621 Isolate Unclassified
49 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
50 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
51 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
52 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
53 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
54 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
55 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
56 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
57 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
58 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
59 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
60 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
61 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
62 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
63 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
64 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
65 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
66 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
67 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
68 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
69 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
70 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
71 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
72 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
73 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
74 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
75 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
76 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
77 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
78 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
79 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
80 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
81 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
82 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
83 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
84 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
85 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
86 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
87 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
88 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
89 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
90 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
91 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
92 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
93 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
94 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
95 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
96 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
97 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
98 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
99 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
100 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
101 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
102 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
103 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
104 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
105 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
106 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
107 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
108 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
109 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
110 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
111 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
112 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
113 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
114 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
115 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
116 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
117 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
118 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
119 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
120 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
121 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
122 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
123 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
124 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
125 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
126 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
127 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
128 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
129 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
130 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
131 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
132 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
133 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
134 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
135 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
136 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
137 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
138 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
139 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
140 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
141 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
142 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
143 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
144 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
145 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
146 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
147 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
148 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
149 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
150 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
151 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
152 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
153 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
154 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
155 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
156 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
157 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
158 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
159 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
160 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
161 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
162 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
163 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
164 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
165 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
166 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
167 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
168 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
169 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
170 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
171 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
172 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
173 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
174 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
175 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
176 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
177 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
178 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
179 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
180 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
181 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
182 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
183 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
184 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
185 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
186 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
187 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
188 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
189 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
190 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
191 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
192 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
193 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
194 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
195 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
196 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
197 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
198 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
199 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
200 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
201 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
246 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
248 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
249 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
253 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
254 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
255 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
256 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
257 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
258 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
259 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
260 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
261 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
262 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
263 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
264 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
265 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
266 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
267 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
268 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
269 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
270 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
271 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
272 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
273 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
274 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
275 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
276 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
277 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
278 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
279 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
280 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
281 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
282 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
283 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
284 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
285 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
286 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
287 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
288 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
289 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
290 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
291 3300044661 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COC2E Metagenome Unclassified
292 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
293 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
294 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
295 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
296 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
297 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
298 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
299 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
300 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
301 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
302 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
303 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
304 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
305 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
306 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
307 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
308 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
309 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
310 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
311 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
312 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
313 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
314 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
315 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
316 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
317 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
318 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
319 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
320 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
321 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
322 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
323 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
324 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
325 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
326 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
327 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
328 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
329 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
330 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
331 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
332 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
333 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
334 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
335 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
336 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
337 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
338 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
339 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
340 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
341 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
342 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
343 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
344 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
345 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
346 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
347 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
348 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
349 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
350 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
351 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
352 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
353 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
354 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
355 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
356 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
357 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
358 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
359 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
360 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
361 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
362 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
363 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
364 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
365 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
366 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
367 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
368 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
369 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
370 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
371 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
372 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
373 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
374 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
375 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
376 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
377 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
378 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
379 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
380 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
381 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
382 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
383 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
384 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
385 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
386 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
387 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
388 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
389 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
390 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
391 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
392 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
393 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
394 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
395 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
396 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
397 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
398 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
399 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
400 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
401 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
402 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
403 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
404 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
405 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
406 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
407 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
408 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
409 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
410 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
411 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
412 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
413 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
414 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
415 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
416 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
417 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
418 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
419 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
420 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
421 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
422 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
423 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
424 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
425 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
426 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
427 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
428 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
429 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
430 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
431 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
432 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
433 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
434 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere
435 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
436 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 91.3
Metatranscriptomes 0.36
Isolates 8.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.2
Nodule 0.36
Rhizoplane 2.66
Rhizosphere 68.12
Stem 0
Stem Tuber 0
Unclassified 16.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_764990 2162886007 Bacteria 3452
2 JGI24741J21665_1007211 3300001915 Bacteria 2169
3 JGI24739J22299_10001025 3300001989 Bacteria 10335
4 JGI24737J22298_10000523 3300001990 Bacteria 13484
5 JGI24735J21928_10001024 3300002067 Bacteria 9999
6 JGI25156J39149_1001399 3300002705 Bacteria 10286
7 JGI25156J39149_1004432 3300002705 Bacteria 4276
8 JGI25162J39368_1000066 3300002737 Bacteria 130612
9 JGI25162J39368_1000623 3300002737 Bacteria 25375
10 JGI25162J39368_1003666 3300002737 Bacteria 4206
11 JGI25157J39369_1000050 3300002741 Bacteria 114470
12 JGI25157J39369_1000688 3300002741 Bacteria 18357
13 JGI25157J39369_1001266 3300002741 Bacteria 10287
14 JGI25157J39369_1002251 3300002741 Bacteria 5181
15 JGI25163J39215_1000565 3300002771 Bacteria 10522
16 JGI25164J39214_1000056 3300002772 Bacteria 114468
17 JGI25164J39214_1000061 3300002772 Bacteria 110617
18 JGI25159J45721_1008856 3300002987 Bacteria 2718
19 JGI25151J46595_10000179 3300003187 Bacteria 80108
20 JGI25165J46597_1000009 3300003214 Bacteria 467965
21 JGI25165J46597_1000151 3300003214 Bacteria 114835
22 rootH1_10019244 3300003316 Bacteria 3077
23 JGI25160J50197_1001998 3300003354 Bacteria 9735
24 Ga0006562J51391_1045775 3300003578 Bacteria 4160
25 Ga0006562J51391_1045778 3300003578 Bacteria 9200
26 Ga0055538_1001312 3300003751 Bacteria 5021
27 Ga0055533_1001372 3300003756 Bacteria 6505
28 Ga0055525_1000261 3300003759 Bacteria 50483
29 Ga0055527_1000271 3300003760 Bacteria 31313
30 Ga0055527_1000273 3300003760 Bacteria 30913
31 Ga0055535_1000045 3300003761 Bacteria 140688
32 Ga0055535_1000466 3300003761 Bacteria 37034
33 Ga0055535_1000567 3300003761 Bacteria 31313
34 Ga0055535_1000574 3300003761 Bacteria 30913
35 Ga0055542_1000010 3300003762 Bacteria 414813
36 Ga0055542_1000079 3300003762 Bacteria 130623
37 Ga0055542_1000104 3300003762 Bacteria 113323
38 Ga0055542_1000591 3300003762 Bacteria 31313
39 Ga0055542_1000597 3300003762 Bacteria 30913
40 Ga0055542_1000689 3300003762 Bacteria 26733
41 Ga0055529_1000122 3300003763 Bacteria 114462
42 Ga0055529_1000140 3300003763 Bacteria 102393
43 Ga0055529_1000556 3300003763 Bacteria 31313
44 Ga0055529_1000815 3300003763 Bacteria 18794
45 Ga0055529_1003401 3300003763 Bacteria 2647
46 Ga0058692_1000054 3300003856 Bacteria 106871
47 Ga0065165_1000186 3300005262 Bacteria 108712
48 Ga0065165_1004668 3300005262 Bacteria 8280
49 Ga0065704_10074189 3300005289 Bacteria 6462
50 Ga0070670_100000709 3300005331 Bacteria 25835
51 Ga0070670_100021401 3300005331 Bacteria 5564
52 Ga0070666_10000005 3300005335 Bacteria 343092
53 Ga0070666_10000147 3300005335 Bacteria 48216
54 Ga0070666_10083483 3300005335 Bacteria 2185
55 Ga0070680_100001573 3300005336 Bacteria 16644
56 Ga0070660_100067459 3300005339 Bacteria 2787
57 Ga0070691_10000632 3300005341 Bacteria 13561
58 Ga0070687_100021419 3300005343 Bacteria 3038
59 Ga0070661_100009253 3300005344 Bacteria 6811
60 Ga0070692_10035014 3300005345 Bacteria 2540
61 Ga0070669_100042507 3300005353 Bacteria 3307
62 Ga0070671_100009724 3300005355 Bacteria 7724
63 Ga0070671_100032205 3300005355 Bacteria 4335
64 Ga0070674_100001468 3300005356 Bacteria 12579
65 Ga0070674_100057277 3300005356 Bacteria 2705
66 Ga0070673_100010330 3300005364 Bacteria 6315
67 Ga0070659_100127592 3300005366 Bacteria 2064
68 Ga0070667_100006541 3300005367 Bacteria 9687
69 Ga0070667_100079789 3300005367 Bacteria 2798
70 Ga0070667_100082098 3300005367 Bacteria 2759
71 Ga0070667_100126000 3300005367 Bacteria 2232
72 Ga0070667_100216073 3300005367 Bacteria 1705
73 Ga0070714_100027069 3300005435 Bacteria 4744
74 Ga0070713_100001768 3300005436 Bacteria 13947
75 Ga0070713_100003503 3300005436 Bacteria 10362
76 Ga0070710_10000323 3300005437 Bacteria 22852
77 Ga0070710_10063104 3300005437 Bacteria 2116
78 Ga0070711_100183443 3300005439 Bacteria 1603
79 Ga0070694_100085307 3300005444 Bacteria 2205
80 Ga0070708_100047508 3300005445 Bacteria 3792
81 Ga0070663_100021139 3300005455 Bacteria 4323
82 Ga0070678_100001774 3300005456 Bacteria 11622
83 Ga0070662_100014343 3300005457 Bacteria 5292
84 Ga0070662_100057419 3300005457 Bacteria 2828
85 Ga0070681_10000170 3300005458 Bacteria 49540
86 Ga0070681_10009451 3300005458 Bacteria 9595
87 Ga0070681_10081342 3300005458 Bacteria 3195
88 Ga0070681_10193030 3300005458 Bacteria 1956
89 Ga0068867_100108573 3300005459 Bacteria 2129
90 Ga0070707_100077171 3300005468 Bacteria 3214
91 Ga0070707_100170508 3300005468 Bacteria 2121
92 Ga0070698_100030003 3300005471 Bacteria 5642
93 Ga0070698_100184645 3300005471 Bacteria 2023
94 Ga0070699_100113580 3300005518 Bacteria 2379
95 Ga0070679_100000161 3300005530 Bacteria 53878
96 Ga0070679_100092018 3300005530 Bacteria 3020
97 Ga0070697_100000007 3300005536 Bacteria 197603
98 Ga0068853_100020326 3300005539 Bacteria 5521
99 Ga0070672_100034073 3300005543 Bacteria 3862
100 Ga0070696_100068800 3300005546 Bacteria 2486
101 Ga0070665_100003246 3300005548 Bacteria 17482
102 Ga0070665_100013154 3300005548 Bacteria 8334
103 Ga0070665_100021493 3300005548 Bacteria 6487
104 Ga0070665_100033725 3300005548 Bacteria 5150
105 Ga0070665_100290682 3300005548 Bacteria 1637
106 Ga0068855_100012081 3300005563 Bacteria 10436
107 Ga0068855_100146328 3300005563 Bacteria 2689
108 Ga0068857_100000189 3300005577 Bacteria 39655
109 Ga0068857_100131461 3300005577 Bacteria 2258
110 Ga0068854_100000400 3300005578 Bacteria 27305
111 Ga0068856_100001887 3300005614 Bacteria 21829
112 Ga0068856_100001910 3300005614 Bacteria 21723
113 Ga0068856_100086528 3300005614 Bacteria 3114
114 Ga0068856_100226350 3300005614 Bacteria 1886
115 Ga0070702_100003651 3300005615 Bacteria 6924
116 Ga0070702_100085281 3300005615 Bacteria 1902
117 Ga0068852_100036452 3300005616 Bacteria 4115
118 Ga0068852_100037179 3300005616 Bacteria 4080
119 Ga0068852_100241121 3300005616 Bacteria 1728
120 Ga0068859_100000211 3300005617 Bacteria 58042
121 Ga0068859_100078206 3300005617 Bacteria 3348
122 Ga0068861_100034981 3300005719 Bacteria 3718
123 Ga0068851_10026780 3300005834 Bacteria 2836
124 Ga0068851_10027552 3300005834 Bacteria 2801
125 Ga0068863_100000545 3300005841 Bacteria 38315
126 Ga0068863_100000714 3300005841 Bacteria 33402
127 Ga0068863_100003996 3300005841 Bacteria 14561
128 Ga0068863_100010821 3300005841 Bacteria 8846
129 Ga0068858_100000534 3300005842 Bacteria 39680
130 Ga0068858_100001471 3300005842 Bacteria 24254
131 Ga0068858_100005568 3300005842 Bacteria 12322
132 Ga0068858_100006060 3300005842 Bacteria 11787
133 Ga0068858_100023029 3300005842 Bacteria 5809
134 Ga0068858_100160059 3300005842 Bacteria 2120
135 Ga0068858_100245519 3300005842 Bacteria 1699
136 Ga0068860_100000185 3300005843 Bacteria 99579
137 Ga0068860_100000296 3300005843 Bacteria 69084
138 Ga0068860_100004169 3300005843 Bacteria 14821
139 Ga0068862_100022786 3300005844 Bacteria 5240
140 Ga0068862_100126546 3300005844 Bacteria 2256
141 Ga0068862_100135608 3300005844 Bacteria 2181
142 Ga0081455_10203969 3300005937 Bacteria 1478
143 Ga0081539_10001103 3300005985 Bacteria 49011
144 Ga0081539_10004763 3300005985 Bacteria 14649
145 Ga0070717_10026850 3300006028 Bacteria 4598
146 Ga0070712_100009921 3300006175 Bacteria 6002
147 Ga0070712_100044833 3300006175 Bacteria 3051
148 Ga0097621_100009537 3300006237 Bacteria 7051
149 Ga0075370_10021614 3300006353 Bacteria 3525
150 Ga0068871_100031726 3300006358 Bacteria 4169
151 Ga0068871_100170807 3300006358 Bacteria 1864
152 Ga0075428_100004781 3300006844 Bacteria 15003
153 Ga0075430_100003642 3300006846 Bacteria 12925
154 Ga0075430_100013534 3300006846 Bacteria 6955
155 Ga0075430_100030472 3300006846 Bacteria 4583
156 Ga0075431_100004593 3300006847 Bacteria 13549
157 Ga0075431_100035498 3300006847 Bacteria 5133
158 Ga0075433_10011817 3300006852 Bacteria 7032
159 Ga0075434_100113754 3300006871 Bacteria 2718
160 Ga0075434_100161682 3300006871 Bacteria 2259
161 Ga0075429_100044196 3300006880 Bacteria 3875
162 Ga0075436_100005578 3300006914 Bacteria 8638
163 Ga0075436_100015010 3300006914 Bacteria 5310
164 Ga0075436_100022323 3300006914 Bacteria 4346
165 Ga0075436_100125169 3300006914 Bacteria 1800
166 Ga0097620_100000211 3300006931 Bacteria 58042
167 Ga0097620_100078212 3300006931 Bacteria 3348
168 Ga0097620_100082292 3300006931 Bacteria 3262
169 Ga0075435_100070676 3300007076 Bacteria 2849
170 Ga0075435_100128319 3300007076 Bacteria 2121
171 Ga0099794_10045384 3300007265 Bacteria 2103
172 Ga0099795_10000019 3300007788 Bacteria 59295
173 Ga0099795_10001057 3300007788 Bacteria 5683
174 Ga0105251_10000362 3300009011 Bacteria 44619
175 Ga0105250_10003540 3300009092 Bacteria 7356
176 Ga0105240_10000002 3300009093 Bacteria 1924170
177 Ga0105240_10000628 3300009093 Bacteria 65065
178 Ga0105240_10005363 3300009093 Bacteria 19127
179 Ga0105240_10007085 3300009093 Bacteria 16344
180 Ga0111539_10026149 3300009094 Bacteria 7143
181 Ga0111539_10122454 3300009094 Bacteria 3048
182 Ga0111539_10415366 3300009094 Bacteria 1567
183 Ga0105247_10000260 3300009101 Bacteria 48812
184 Ga0105247_10026927 3300009101 Bacteria 3475
185 Ga0105247_10039195 3300009101 Bacteria 2894
186 Ga0114129_10001468 3300009147 Bacteria 31889
187 Ga0114129_10004447 3300009147 Bacteria 19780
188 Ga0114129_10189004 3300009147 Bacteria 2798
189 Ga0114129_10225027 3300009147 Bacteria 2529
190 Ga0114129_10445042 3300009147 Bacteria 1700
191 Ga0105241_10011751 3300009174 Bacteria 6429
192 Ga0105241_10047992 3300009174 Bacteria 3248
193 Ga0105242_10099665 3300009176 Bacteria 2459
194 Ga0105248_10001076 3300009177 Bacteria 30156
195 Ga0105248_10126373 3300009177 Bacteria 2884
196 Ga0105237_10000007 3300009545 Bacteria 367690
197 Ga0105237_10000136 3300009545 Bacteria 103269
198 Ga0105237_10136725 3300009545 Bacteria 2445
199 Ga0105237_10252660 3300009545 Bacteria 1765
200 Ga0105237_10273282 3300009545 Bacteria 1692
201 Ga0105237_10291835 3300009545 Bacteria 1634
202 Ga0105238_10009646 3300009551 Bacteria 9661
203 Ga0105238_10016211 3300009551 Bacteria 7541
204 Ga0105238_10025862 3300009551 Bacteria 5985
205 Ga0105238_10208765 3300009551 Bacteria 1929
206 Ga0105238_10211076 3300009551 Bacteria 1917
207 Ga0105249_10018582 3300009553 Bacteria 6188
208 Ga0105249_10020152 3300009553 Bacteria 5958
209 Ga0105249_10134771 3300009553 Bacteria 2362
210 Ga0099796_10000010 3300010159 Bacteria 61889
211 Ga0099796_10000232 3300010159 Bacteria 8698
212 Ga0105239_10000050 3300010375 Bacteria 173908
213 Ga0105239_10003222 3300010375 Bacteria 20174
214 Ga0105239_10017060 3300010375 Bacteria 8027
215 Ga0105239_10044423 3300010375 Bacteria 4871
216 Ga0105239_10072472 3300010375 Bacteria 3787
217 Ga0105239_10101527 3300010375 Bacteria 3182
218 Ga0157314_1000790 3300012500 Bacteria 2731
219 Ga0157373_10061996 3300013100 Bacteria 2648
220 Ga0157373_10089741 3300013100 Bacteria 2165
221 Ga0157370_10004257 3300013104 Bacteria 16520
222 Ga0157370_10236533 3300013104 Bacteria 1690
223 Ga0157369_10001939 3300013105 Bacteria 24913
224 Ga0157374_10109243 3300013296 Bacteria 2659
225 Ga0157378_10020941 3300013297 Bacteria 5754
226 Ga0163162_10000281 3300013306 Bacteria 46556
227 Ga0163162_10062930 3300013306 Bacteria 3752
228 Ga0163162_10244608 3300013306 Bacteria 1925
229 Ga0157372_10054209 3300013307 Bacteria 4472
230 Ga0157372_10276459 3300013307 Bacteria 1952
231 Ga0163163_10049693 3300014325 Bacteria 4127
232 Ga0163163_10145333 3300014325 Bacteria 2415
233 Ga0157380_10011558 3300014326 Bacteria 6380
234 Ga0157380_10031769 3300014326 Bacteria 4056
235 Ga0182008_10007892 3300014497 Bacteria 5843
236 Ga0157379_10014123 3300014968 Bacteria 7001
237 Ga0157379_10072490 3300014968 Bacteria 3081
238 Ga0157379_10146214 3300014968 Bacteria 2132
239 Ga0157379_10150902 3300014968 Bacteria 2096
240 Ga0157376_10063194 3300014969 Bacteria 3118
241 Ga0182006_1000427 3300015261 Bacteria 33649
242 Ga0182007_10038236 3300015262 Bacteria 1610
243 Ga0182005_1000686 3300015265 Bacteria 15828
244 Ga0182005_1003981 3300015265 Bacteria 4872
245 Ga0183368_1004 3300015687 Bacteria 1211761
246 Ga0209760_100572 3300025207 Bacteria 6575
247 Ga0209784_100013 3300025224 Bacteria 518664
248 Ga0209674_100053 3300025226 Bacteria 323159
249 Ga0209674_100063 3300025226 Bacteria 275507
250 Ga0209674_100898 3300025226 Bacteria 9646
251 Ga0209672_100009 3300025228 Bacteria 883623
252 Ga0209672_100024 3300025228 Bacteria 367869
253 Ga0209672_100107 3300025228 Bacteria 99267
254 Ga0209672_100253 3300025228 Bacteria 39760
255 Ga0209672_100742 3300025228 Bacteria 15916
256 Ga0209563_100127 3300025230 Bacteria 109913
257 Ga0207427_100021 3300025231 Bacteria 494115
258 Ga0207427_100030 3300025231 Bacteria 358045
259 Ga0207427_101510 3300025231 Bacteria 8255
260 Ga0209437_100012 3300025233 Bacteria 792625
261 Ga0209437_100150 3300025233 Bacteria 157430
262 Ga0209437_100416 3300025233 Bacteria 38751
263 Ga0209258_100011 3300025242 Bacteria 867542
264 Ga0209258_100019 3300025242 Bacteria 566728
265 Ga0209258_100045 3300025242 Bacteria 369941
266 Ga0209258_100047 3300025242 Bacteria 367869
267 Ga0209258_100299 3300025242 Bacteria 80970
268 Ga0209258_102767 3300025242 Bacteria 4239
269 Ga0209258_104796 3300025242 Bacteria 2459
270 Ga0209646_1000458 3300025246 Bacteria 21135
271 Ga0209646_1002167 3300025246 Bacteria 4555
272 Ga0209646_1005413 3300025246 Bacteria 2228
273 Ga0209026_1000010 3300025250 Bacteria 511986
274 Ga0209026_1000015 3300025250 Bacteria 395555
275 Ga0209026_1000163 3300025250 Bacteria 102814
276 Ga0209026_1000391 3300025250 Bacteria 39130
277 Ga0209026_1001325 3300025250 Bacteria 11132
278 Ga0209026_1003010 3300025250 Bacteria 5814
279 Ga0209677_102437 3300025253 Bacteria 7000
280 Ga0209148_1000001 3300025254 Bacteria 2545271
281 Ga0209148_1000005 3300025254 Bacteria 1806504
282 Ga0209148_1000013 3300025254 Bacteria 956684
283 Ga0209148_1000052 3300025254 Bacteria 399449
284 Ga0209148_1000054 3300025254 Bacteria 367869
285 Ga0209148_1000205 3300025254 Bacteria 104659
286 Ga0209759_1000023 3300025256 Bacteria 321695
287 Ga0209759_1000622 3300025256 Bacteria 33847
288 Ga0209759_1001819 3300025256 Bacteria 10741
289 Ga0209759_1002777 3300025256 Bacteria 7416
290 Ga0209759_1009864 3300025256 Bacteria 2850
291 Ga0209233_1000002 3300025261 Bacteria 2501366
292 Ga0209233_1000023 3300025261 Bacteria 738870
293 Ga0209233_1000754 3300025261 Bacteria 14657
294 Ga0209455_1000012 3300025272 Bacteria 867234
295 Ga0209455_1000027 3300025272 Bacteria 566710
296 Ga0209455_1000052 3300025272 Bacteria 367804
297 Ga0209455_1000081 3300025272 Bacteria 263674
298 Ga0209455_1000357 3300025272 Bacteria 42718
299 Ga0209455_1013884 3300025272 Bacteria 1849
300 Ga0209130_1000793 3300025284 Bacteria 27090
301 Ga0209025_1000251 3300025294 Bacteria 126418
302 Ga0209758_1001868 3300025297 Bacteria 23096
303 Ga0207426_1000179 3300025302 Bacteria 158635
304 Ga0209051_1012497 3300025303 Bacteria 4103
305 Ga0207713_1000429 3300025735 Bacteria 44408
306 Ga0207692_10000685 3300025898 Bacteria 11953
307 Ga0207710_10000322 3300025900 Bacteria 36632
308 Ga0207710_10022803 3300025900 Bacteria 2687
309 Ga0207710_10055512 3300025900 Bacteria 1786
310 Ga0207680_10000005 3300025903 Bacteria 660983
311 Ga0207680_10001024 3300025903 Bacteria 13188
312 Ga0207680_10043657 3300025903 Bacteria 2631
313 Ga0207647_10000055 3300025904 Bacteria 86547
314 Ga0207647_10005581 3300025904 Bacteria 9201
315 Ga0207647_10006694 3300025904 Bacteria 8372
316 Ga0207647_10010943 3300025904 Bacteria 6381
317 Ga0207647_10028042 3300025904 Bacteria 3664
318 Ga0207643_10003066 3300025908 Bacteria 8981
319 Ga0207705_10072553 3300025909 Bacteria 2497
320 Ga0207684_10027359 3300025910 Bacteria 4860
321 Ga0207654_10133733 3300025911 Bacteria 1573
322 Ga0207707_10000249 3300025912 Bacteria 59150
323 Ga0207707_10000958 3300025912 Bacteria 27828
324 Ga0207695_10000002 3300025913 Bacteria 2188391
325 Ga0207695_10000040 3300025913 Bacteria 452787
326 Ga0207695_10000198 3300025913 Bacteria 167880
327 Ga0207695_10001115 3300025913 Bacteria 46659
328 Ga0207695_10001214 3300025913 Bacteria 44135
329 Ga0207695_10006516 3300025913 Bacteria 15114
330 Ga0207695_10012993 3300025913 Bacteria 9947
331 Ga0207695_10062233 3300025913 Bacteria 3854
332 Ga0207695_10091476 3300025913 Bacteria 3056
333 Ga0207671_10000059 3300025914 Bacteria 179761
334 Ga0207671_10000074 3300025914 Bacteria 156482
335 Ga0207671_10037715 3300025914 Bacteria 3583
336 Ga0207671_10041429 3300025914 Bacteria 3409
337 Ga0207671_10053093 3300025914 Bacteria 3004
338 Ga0207671_10060394 3300025914 Bacteria 2812
339 Ga0207660_10001068 3300025917 Bacteria 18208
340 Ga0207660_10003060 3300025917 Bacteria 10933
341 Ga0207657_10027032 3300025919 Bacteria 5260
342 Ga0207652_10000134 3300025921 Bacteria 78533
343 Ga0207652_10000912 3300025921 Bacteria 27888
344 Ga0207646_10010941 3300025922 Bacteria 8811
345 Ga0207646_10022308 3300025922 Bacteria 5835
346 Ga0207646_10104611 3300025922 Bacteria 2539
347 Ga0207646_10143230 3300025922 Bacteria 2153
348 Ga0207681_10008729 3300025923 Bacteria 6192
349 Ga0207694_10001048 3300025924 Bacteria 24066
350 Ga0207694_10013173 3300025924 Bacteria 6226
351 Ga0207694_10075188 3300025924 Bacteria 2644
352 Ga0207650_10000841 3300025925 Bacteria 23285
353 Ga0207650_10014766 3300025925 Bacteria 5430
354 Ga0207700_10001549 3300025928 Bacteria 13039
355 Ga0207700_10076420 3300025928 Bacteria 2598
356 Ga0207644_10018202 3300025931 Bacteria 4750
357 Ga0207644_10043803 3300025931 Bacteria 3177
358 Ga0207690_10027106 3300025932 Bacteria 3617
359 Ga0207706_10025342 3300025933 Bacteria 5315
360 Ga0207706_10049685 3300025933 Bacteria 3706
361 Ga0207686_10107858 3300025934 Bacteria 1872
362 Ga0207709_10046937 3300025935 Bacteria 2624
363 Ga0207709_10065253 3300025935 Bacteria 2289
364 Ga0207669_10060660 3300025937 Bacteria 2320
365 Ga0207691_10005413 3300025940 Bacteria 12319
366 Ga0207711_10037845 3300025941 Bacteria 4101
367 Ga0207689_10042064 3300025942 Bacteria 3782
368 Ga0207667_10000031 3300025949 Bacteria 323587
369 Ga0207667_10000292 3300025949 Bacteria 69279
370 Ga0207667_10022774 3300025949 Bacteria 6910
371 Ga0207667_10023268 3300025949 Bacteria 6823
372 Ga0207712_10000120 3300025961 Bacteria 84214
373 Ga0207712_10039372 3300025961 Bacteria 3239
374 Ga0207668_10002000 3300025972 Bacteria 11912
375 Ga0207668_10110871 3300025972 Bacteria 2059
376 Ga0207640_10000061 3300025981 Bacteria 89141
377 Ga0207640_10018558 3300025981 Bacteria 4089
378 Ga0207640_10078923 3300025981 Bacteria 2242
379 Ga0207640_10091377 3300025981 Bacteria 2109
380 Ga0207658_10032772 3300025986 Bacteria 3701
381 Ga0207658_10044094 3300025986 Bacteria 3246
382 Ga0207703_10000422 3300026035 Bacteria 44878
383 Ga0207703_10000468 3300026035 Bacteria 42232
384 Ga0207703_10002171 3300026035 Bacteria 17238
385 Ga0207703_10003735 3300026035 Bacteria 12667
386 Ga0207703_10029673 3300026035 Bacteria 4317
387 Ga0207639_10010801 3300026041 Bacteria 6330
388 Ga0207639_10015933 3300026041 Bacteria 5308
389 Ga0207639_10034619 3300026041 Bacteria 3734
390 Ga0207678_10005681 3300026067 Bacteria 11149
391 Ga0207678_10044128 3300026067 Bacteria 3857
392 Ga0207678_10066153 3300026067 Bacteria 3104
393 Ga0207678_10116742 3300026067 Bacteria 2277
394 Ga0207678_10160860 3300026067 Bacteria 1918
395 Ga0207708_10042238 3300026075 Bacteria 3476
396 Ga0207702_10000185 3300026078 Bacteria 74602
397 Ga0207702_10007958 3300026078 Bacteria 8981
398 Ga0207702_10037495 3300026078 Bacteria 4058
399 Ga0207702_10054129 3300026078 Bacteria 3399
400 Ga0207702_10089993 3300026078 Bacteria 2685
401 Ga0207702_10144433 3300026078 Bacteria 2157
402 Ga0207641_10000177 3300026088 Bacteria 88140
403 Ga0207641_10000393 3300026088 Bacteria 51636
404 Ga0207641_10007137 3300026088 Bacteria 9329
405 Ga0207641_10065076 3300026088 Bacteria 3117
406 Ga0207648_10126998 3300026089 Bacteria 2244
407 Ga0207674_10000298 3300026116 Bacteria 62902
408 Ga0207674_10036889 3300026116 Bacteria 5088
409 Ga0207683_10000244 3300026121 Bacteria 48306
410 Ga0207683_10166592 3300026121 Bacteria 1994
411 Ga0207698_10025989 3300026142 Bacteria 4136
412 Ga0207698_10057077 3300026142 Bacteria 3018
413 Ga0207698_10172685 3300026142 Bacteria 1905
414 Ga0209371_1000116 3300027312 Bacteria 135524
415 Ga0209179_1000008 3300027512 Bacteria 92811
416 Ga0209179_1000665 3300027512 Bacteria 3669
417 Ga0207428_10034951 3300027907 Bacteria 4112
418 Ga0265356_1000505 3300028017 Bacteria 7040
419 Ga0268266_10000004 3300028379 Bacteria 1495817
420 Ga0268266_10000007 3300028379 Bacteria 1372921
421 Ga0268266_10006593 3300028379 Bacteria 10602
422 Ga0268266_10028873 3300028379 Bacteria 4714
423 Ga0268266_10035428 3300028379 Bacteria 4245
424 Ga0268266_10096734 3300028379 Bacteria 2596
425 Ga0268265_10026758 3300028380 Bacteria 4106
426 Ga0268265_10128854 3300028380 Bacteria 2099
427 Ga0268265_10189989 3300028380 Bacteria 1772
428 Ga0268264_10000088 3300028381 Bacteria 235344
429 Ga0268264_10059497 3300028381 Bacteria 3201
430 Ga0268264_10119972 3300028381 Bacteria 2316
431 Ga0307517_10018152 3300028786 Bacteria 9117
432 Ga0307517_10018496 3300028786 Bacteria 9006
433 Ga0307515_10010304 3300028794 Bacteria 17938
434 Ga0307515_10017668 3300028794 Bacteria 12973
435 Ga0307515_10074461 3300028794 Bacteria 4542
436 Ga0268256_1000099 3300030500 Bacteria 135508
437 Ga0307511_10000227 3300030521 Bacteria 57255
438 Ga0307511_10000672 3300030521 Bacteria 36429
439 Ga0307511_10010986 3300030521 Bacteria 8940
440 Ga0307511_10015900 3300030521 Bacteria 7271
441 Ga0307512_10008398 3300030522 Bacteria 10073
442 Ga0314311_1226575 3300030733 Bacteria 2045
443 Ga0265760_10008192 3300031090 Bacteria 2987
444 Ga0265320_10013217 3300031240 Bacteria 4758
445 Ga0307513_10015491 3300031456 Bacteria 9243
446 Ga0307513_10035596 3300031456 Bacteria 5567
447 Ga0307509_10006518 3300031507 Bacteria 15655
448 Ga0307509_10030391 3300031507 Bacteria 5977
449 Ga0307509_10138169 3300031507 Bacteria 2378
450 Ga0307408_100044022 3300031548 Bacteria 3179
451 Ga0307408_100068822 3300031548 Bacteria 2608
452 Ga0307408_100188838 3300031548 Bacteria 1658
453 Ga0307508_10014270 3300031616 Bacteria 7247
454 Ga0307508_10015242 3300031616 Bacteria 7003
455 Ga0307508_10034594 3300031616 Bacteria 4555
456 Ga0307508_10053927 3300031616 Bacteria 3565
457 Ga0307508_10091016 3300031616 Bacteria 2638
458 Ga0307405_10043405 3300031731 Bacteria 2743
459 Ga0307406_10057987 3300031901 Bacteria 2486
460 Ga0307412_10000203 3300031911 Bacteria 40488
461 Ga0307409_100050650 3300031995 Bacteria 3173
462 Ga0307416_100012602 3300032002 Bacteria 5706
463 Ga0307411_10028371 3300032005 Bacteria 3402
464 Ga0307507_10025927 3300033179 Bacteria 6337
465 Ga0307507_10030151 3300033179 Bacteria 5726
466 Ga0307507_10060126 3300033179 Bacteria 3550
467 Ga0307507_10121752 3300033179 Bacteria 2084
468 Ga0307507_10180361 3300033179 Bacteria 1511
469 Ga0307510_10000061 3300033180 Bacteria 82810
470 Ga0307510_10005829 3300033180 Bacteria 14690
471 Ga0307510_10006065 3300033180 Bacteria 14405
472 Ga0307510_10010353 3300033180 Bacteria 11075
473 Ga0307510_10018254 3300033180 Bacteria 8256
474 Ga0307510_10133917 3300033180 Bacteria 2142
475 Ga0373936_0042983 3300035113 Bacteria 1815
476 Ga0395899_0000076 3300037312 Bacteria 177673
477 Ga0395899_0002906 3300037312 Bacteria 13766
478 Ga0395899_0053722 3300037312 Bacteria 2982
479 Ga0395900_0000018 3300037418 Bacteria 363472
480 Ga0395900_0063004 3300037418 Bacteria 3811
481 Ga0395898_0000530 3300037466 Bacteria 72663
482 Ga0395898_0000612 3300037466 Bacteria 65763
483 Ga0395898_0001593 3300037466 Bacteria 30957
484 Ga0436364_0821552 3300037853 Bacteria 4804
485 Ga0436363_1440167 3300039450 Bacteria 4209
486 Ga0439436_0000006 3300041404 Bacteria 123245
487 Ga0439436_0005195 3300041404 Bacteria 3991
488 Ga0439465_0003000 3300041413 Bacteria 5516
489 Ga0439465_0003108 3300041413 Bacteria 5431
490 Ga0451853_2973491 3300041512 Bacteria 2442
491 Ga0439445_0003134 3300042004 Bacteria 3709
492 Ga0439448_0022462 3300042005 Bacteria 1961
493 Ga0439449_0000378 3300042007 Bacteria 16401
494 Ga0439449_0000733 3300042007 Bacteria 12592
495 Ga0439449_0004079 3300042007 Bacteria 5653
496 Ga0439457_000120 3300042014 Bacteria 19130
497 Ga0439457_000307 3300042014 Bacteria 13539
498 Ga0450894_000894 3300042131 Bacteria 4749
499 Ga0450908_000195 3300042184 Bacteria 12425
500 Ga0439464_0003883 3300042439 Bacteria 3801
501 Ga0439460_0018890 3300042461 Bacteria 1861
502 Ga0466969_0014302 3300044656 Bacteria 4172
503 Ga0466969_0024240 3300044656 Bacteria 3121
504 Ga0466972_0000377 3300044658 Bacteria 23938
505 Ga0466972_0001073 3300044658 Bacteria 13098
506 Ga0466972_0002839 3300044658 Bacteria 8574
507 Ga0466972_0014349 3300044658 Bacteria 3969
508 Ga0466972_0024639 3300044658 Bacteria 2986
509 Ga0466972_0044402 3300044658 Bacteria 2155
510 Ga0466975_0171288 3300044661 Bacteria 1495
511 Ga0466982_0000033 3300044672 Bacteria 46451
512 Ga0466982_0000044 3300044672 Bacteria 38923
513 Ga0466965_0001162 3300044683 Bacteria 10357
514 Ga0466965_0003803 3300044683 Bacteria 6656
515 Ga0466965_0025957 3300044683 Bacteria 2838
516 Ga0466966_0008164 3300044684 Bacteria 6939
517 Ga0466966_0016818 3300044684 Bacteria 4832
518 Ga0466966_0033225 3300044684 Bacteria 3340
519 Ga0466961_0002692 3300044693 Bacteria 11030
520 Ga0466961_0007789 3300044693 Bacteria 6816
521 Ga0466961_0008091 3300044693 Bacteria 6701
522 Ga0466961_0036482 3300044693 Bacteria 3155
523 Ga0466961_0052920 3300044693 Bacteria 2591
524 Ga0466961_0055317 3300044693 Bacteria 2530
525 Ga0466971_0013988 3300044719 Bacteria 3526
526 Ga0466971_0037351 3300044719 Bacteria 2176
527 Ga0466968_0031075 3300044735 Bacteria 2214
528 Ga0466970_0002648 3300044765 Bacteria 8636
529 Ga0466970_0012573 3300044765 Bacteria 4331
530 Ga0466957_0022896 3300044842 Bacteria 3688
531 Ga0466957_0041448 3300044842 Bacteria 2784
532 Ga0466959_0000043 3300045049 Bacteria 92533
533 Ga0466959_0011104 3300045049 Bacteria 6464
534 Ga0466959_0014526 3300045049 Bacteria 5727
535 Ga0451576_0325731 3300045051 Bacteria 1608
536 Ga0466967_0000795 3300045976 Bacteria 16495
537 Ga0466967_0051257 3300045976 Bacteria 3616
538 Ga0466967_0051578 3300045976 Bacteria 3606
539 Ga0495592_0012776 3300046454 Bacteria 6383
540 Ga0495603_0002686 3300046455 Bacteria 10487
541 Ga0495629_0015196 3300046459 Bacteria 5531
542 Ga0495629_0025807 3300046459 Bacteria 4175
543 Ga0495638_0000009 3300046460 Bacteria 525345
544 Ga0495638_0000052 3300046460 Bacteria 203695
545 Ga0495638_0099420 3300046460 Bacteria 1741
546 Ga0495651_0004042 3300046462 Bacteria 11214
547 Ga0495650_0000122 3300046471 Bacteria 182888
548 Ga0495650_0000247 3300046471 Bacteria 106616
549 Ga0495639_0063529 3300046475 Bacteria 1695
550 Ga0495662_0000534 3300046476 Bacteria 17425
551 Ga0495662_0019059 3300046476 Bacteria 3320
552 Ga0495664_0003610 3300046477 Bacteria 8435
553 Ga0495585_0000021 3300046492 Bacteria 155715
554 Ga0495585_0038264 3300046492 Bacteria 2700
555 Ga0495594_0005271 3300046499 Bacteria 6640
556 Ga0495594_0019414 3300046499 Bacteria 3611
557 Ga0495607_0023327 3300046501 Bacteria 3874
558 Ga0495606_0000056 3300046507 Bacteria 198575
559 Ga0495606_0050569 3300046507 Bacteria 2718
560 Ga0495610_0001176 3300046512 Bacteria 23703
561 Ga0495628_0022582 3300046516 Bacteria 5168
562 Ga0495628_0071763 3300046516 Bacteria 2698
563 Ga0495631_0000060 3300046518 Bacteria 68239
564 Ga0495631_0040157 3300046518 Bacteria 2074
565 Ga0495643_0006314 3300046522 Bacteria 7834
566 Ga0495643_0009173 3300046522 Bacteria 6175
567 Ga0495648_0000688 3300046524 Bacteria 36092
568 Ga0495663_0000222 3300046525 Bacteria 22657
569 Ga0495652_0031801 3300046529 Bacteria 4619
570 Ga0495587_0015851 3300046536 Bacteria 4697
571 Ga0495621_0008627 3300046539 Bacteria 3065
572 Ga0495597_0017251 3300046542 Bacteria 3401
573 Ga0495645_0005263 3300046543 Bacteria 8862
574 Ga0495645_0005674 3300046543 Bacteria 8591
575 Ga0495622_0017292 3300046557 Bacteria 3357
576 Ga0495668_0027794 3300046616 Bacteria 3204
577 Ga0495625_0006824 3300046660 Bacteria 10087
578 Ga0495625_0022762 3300046660 Bacteria 4796
579 Ga0495625_0054199 3300046660 Bacteria 2865
580 Ga0495635_0006399 3300046663 Bacteria 8207
581 Ga0495635_0047510 3300046663 Bacteria 2960
582 Ga0495661_0000353 3300046665 Bacteria 50121
583 Ga0495588_0005143 3300046674 Bacteria 5811
584 Ga0495588_0007950 3300046674 Bacteria 4848
585 Ga0495623_0047478 3300046679 Bacteria 2725
586 Ga0495646_0057201 3300046680 Bacteria 2335
587 Ga0495658_0044193 3300046683 Bacteria 2495
588 Ga0495613_0017227 3300046689 Bacteria 5382
589 Ga0495613_0039155 3300046689 Bacteria 3514
590 Ga0495624_0058895 3300046690 Bacteria 2411
591 Ga0495670_0001214 3300046691 Bacteria 12527
592 Ga0495670_0007579 3300046691 Bacteria 5335
593 Ga0495649_0008985 3300046694 Bacteria 5971
594 Ga0495589_0023474 3300046794 Bacteria 3143
595 Ga0495600_0017891 3300046809 Bacteria 4510
596 Ga0495600_0047615 3300046809 Unclassified 2797
597 Ga0495660_0025463 3300046810 Bacteria 3360
598 Ga0495581_0021486 3300047315 Bacteria 3740
599 Ga0495604_0051265 3300047317 Bacteria 3200
600 Ga0495636_0018692 3300047318 Bacteria 2781
601 Ga0495674_0216232 3300047319 Bacteria 1586
602 Ga0495676_0012001 3300047321 Bacteria 7815
603 Ga0495683_0002632 3300047323 Bacteria 10723
604 Ga0495687_001648 3300047443 Bacteria 20081
605 Ga0495687_002821 3300047443 Bacteria 13387
606 Ga0495687_010294 3300047443 Bacteria 5137
607 Ga0495685_000931 3300047447 Bacteria 8880
608 Ga0495685_005825 3300047447 Bacteria 4026
609 Ga0495685_014345 3300047447 Bacteria 2691
610 Ga0495681_0001693 3300047470 Bacteria 16334
611 Ga0495681_0003555 3300047470 Bacteria 10848
612 Ga0495593_0003639 3300047673 Bacteria 9204
613 Ga0495602_0048087 3300048088 Bacteria 3838
614 Ga0495602_0127005 3300048088 Unclassified 2041
615 Ga0495614_0042408 3300048089 Bacteria 1950
616 Ga0495614_0054420 3300048089 Bacteria 1716
617 Ga0496100_0063836 3300048903 Bacteria 2435
618 Ga0496102_0014442 3300048905 Bacteria 6862
619 Ga0496102_0030481 3300048905 Bacteria 4828
620 Ga0496102_0030962 3300048905 Bacteria 4793
621 Ga0496103_0026811 3300048906 Bacteria 3488
622 Ga0496104_0031919 3300048907 Bacteria 4900
623 Ga0496104_0048215 3300048907 Bacteria 4016
624 Ga0496105_0005844 3300048908 Bacteria 9383
625 Ga0496106_0198717 3300048909 Bacteria 1595
626 Ga0496107_0011636 3300048910 Bacteria 6131
627 Ga0496107_0040761 3300048910 Bacteria 3334
628 Ga0496110_0224731 3300048913 Bacteria 1707
629 Ga0496110_0326451 3300048913 Bacteria 1398
630 Ga0496113_0013707 3300048916 Bacteria 5504
631 Ga0496114_0016710 3300048917 Bacteria 5917
632 Ga0496114_0033041 3300048917 Bacteria 4262
633 Ga0496115_0000013 3300048918 Bacteria 213060
634 Ga0496115_0000044 3300048918 Bacteria 115745
635 Ga0496115_0012558 3300048918 Bacteria 6381
636 Ga0496115_0015634 3300048918 Bacteria 5761
637 Ga0496115_0033021 3300048918 Bacteria 4085
638 Ga0496115_0168551 3300048918 Bacteria 1811
639 Ga0496116_0017221 3300048919 Bacteria 5620
640 Ga0496117_0000024 3300048920 Bacteria 418750
641 Ga0496117_0004227 3300048920 Bacteria 16031
642 Ga0496117_0008001 3300048920 Bacteria 10142
643 Ga0496117_0034255 3300048920 Bacteria 3828
644 Ga0496117_0112324 3300048920 Bacteria 1694
645 Ga0496118_0000014 3300048921 Bacteria 561628
646 Ga0496118_0000636 3300048921 Bacteria 57474
647 Ga0496118_0000780 3300048921 Bacteria 51033
648 Ga0496118_0008276 3300048921 Bacteria 10780
649 Ga0496118_0011987 3300048921 Bacteria 8377
650 Ga0496119_0000109 3300048922 Bacteria 116054
651 Ga0496119_0002080 3300048922 Bacteria 22625
652 Ga0496120_0000115 3300048923 Bacteria 136364
653 Ga0496120_0000150 3300048923 Bacteria 116072
654 Ga0496120_0026274 3300048923 Bacteria 3597
655 Ga0496121_0000013 3300048924 Bacteria 614976
656 Ga0496121_0001215 3300048924 Bacteria 44880
657 Ga0496121_0002051 3300048924 Bacteria 31889
658 Ga0496121_0014570 3300048924 Bacteria 8330
659 Ga0496121_0110793 3300048924 Bacteria 2094
660 Ga0496122_0000049 3300048925 Bacteria 268493
661 Ga0496122_0009875 3300048925 Bacteria 9948
662 Ga0496122_0034775 3300048925 Bacteria 4115
663 Ga0496123_0000042 3300048926 Bacteria 254481
664 Ga0496123_0003900 3300048926 Bacteria 16219
665 Ga0496123_0021655 3300048926 Bacteria 4988
666 Ga0496124_0003222 3300048927 Bacteria 20166
667 Ga0496124_0004659 3300048927 Bacteria 15867
668 Ga0496124_0004848 3300048927 Bacteria 15474
669 Ga0496125_0000416 3300048928 Bacteria 79287
670 Ga0496125_0000453 3300048928 Bacteria 74032
671 Ga0496125_0000816 3300048928 Bacteria 50685
672 Ga0496125_0012791 3300048928 Bacteria 8296
673 Ga0496125_0020072 3300048928 Bacteria 6283
674 Ga0496126_0002266 3300048929 Bacteria 26518
675 Ga0496126_0002275 3300048929 Bacteria 26475
676 Ga0496126_0014270 3300048929 Bacteria 8039
677 Ga0496126_0045508 3300048929 Bacteria 4032
678 Ga0496126_0069812 3300048929 Bacteria 3132
679 Ga0496126_0097845 3300048929 Bacteria 2571
680 Ga0495682_0000253 3300049460 Bacteria 42266
681 Ga0501299_012684 3300049522 Bacteria 1442
682 Ga0501036_0264331 3300049572 Bacteria 1441
683 Ga0501040_0086342 3300049576 Bacteria 2179
684 Ga0501043_0270106 3300049579 Bacteria 1306
685 Ga0501046_0010033 3300049580 Bacteria 8158
686 Ga0501047_0006703 3300049581 Bacteria 10826
687 Ga0501048_0234485 3300049582 Bacteria 1302
688 Ga0501070_0017543 3300049586 Bacteria 6009
689 Ga0501071_0216682 3300049587 Bacteria 1440
690 Ga0501072_0231280 3300049588 Bacteria 1473
691 Ga0501225_0001420 3300049705 Bacteria 7480
692 Ga0501035_0001136 3300049822 Bacteria 27827
693 Ga0501035_0014043 3300049822 Bacteria 7389
694 Ga0501035_0025899 3300049822 Bacteria 5374
695 Ga0501035_0226821 3300049822 Bacteria 1593
696 Ga0501044_0005139 3300049823 Bacteria 14596
697 Ga0501044_0022778 3300049823 Bacteria 6671
698 Ga0501044_0080152 3300049823 Bacteria 3307
699 Ga0501044_0146631 3300049823 Bacteria 2345
700 nmdc:mga05p37_198665_c1 3300050507 Bacteria 2430
701 nmdc:mga05p37_36826_c1 3300050507 Bacteria 6001
702 nmdc:mga05p37_43286_c1 3300050507 Bacteria 5539
703 nmdc:mga05p37_444857_c1 3300050507 Bacteria 1502
704 nmdc:mga05p37_687_c1 3300050507 Bacteria 37482
705 nmdc:mga05p37_76118_c1 3300050507 Bacteria 4132
706 nmdc:mga09592_173251_c1 3300050508 Bacteria 1866
707 nmdc:mga09592_218383_c1 3300050508 Bacteria 1652
708 nmdc:mga09592_28175_c1 3300050508 Bacteria 4666
709 nmdc:mga0qj67_13438_c1 3300050509 Bacteria 6175
710 nmdc:mga0qj67_39959_c1 3300050509 Bacteria 3686
711 nmdc:mga0qj67_99068_c1 3300050509 Bacteria 2348
712 nmdc:mga06r32_25047_c1 3300050510 Bacteria 5545
713 nmdc:mga06r32_28058_c1 3300050510 Bacteria 5265
714 nmdc:mga06r32_38872_c1 3300050510 Bacteria 4511
715 nmdc:mga08y16_167316_c1 3300050511 Bacteria 2284
716 nmdc:mga08y16_90275_c1 3300050511 Bacteria 3194
717 nmdc:mga0n895_157210_c1 3300050512 Bacteria 2304
718 nmdc:mga0n895_346474_c1 3300050512 Bacteria 1505
719 nmdc:mga0n895_53175_c1 3300050512 Bacteria 3978
720 nmdc:mga0n895_68130_c1 3300050512 Bacteria 3525
721 nmdc:mga0rr50_152468_c1 3300050513 Bacteria 1869
722 nmdc:mga0rr50_206252_c1 3300050513 Bacteria 1618
723 nmdc:mga0rr50_225168_c1 3300050513 Bacteria 1550
724 nmdc:mga08x19_110497_c1 3300050514 Bacteria 1833
725 nmdc:mga0a205_107049_c1 3300050515 Bacteria 2694
726 nmdc:mga0a205_143150_c1 3300050515 Bacteria 2291
727 nmdc:mga0a205_43683_c1 3300050515 Bacteria 4320
728 nmdc:mga0a205_7532_c2 3300050515 Bacteria 7471
729 Ga0495655_0005297 3300053083 Bacteria 2270
730 Ga0500578_0017345 3300053086 Bacteria 4625
731 Ga0500646_0007900 3300053090 Bacteria 2720
732 Ga0500583_0005204 3300053092 Bacteria 4335
733 Ga0500566_0033762 3300053094 Bacteria 2979
734 Ga0500553_078950 3300053101 Bacteria 1488
735 Ga0500560_030452 3300053107 Bacteria 1626
736 Ga0500569_006115 3300053109 Bacteria 2625
737 Ga0500591_034784 3300053115 Bacteria 2420
738 Ga0500628_001577 3300053129 Bacteria 3875
739 Ga0500652_015340 3300053131 Bacteria 2763
740 Ga0500652_016579 3300053131 Bacteria 2684
741 Ga0500658_0014589 3300053134 Bacteria 2911
742 Ga0500561_0000979 3300053137 Bacteria 4578
743 Ga0500568_0009215 3300053139 Bacteria 4706
744 Ga0500573_0083491 3300053140 Bacteria 1813
745 Ga0500600_0006627 3300053149 Bacteria 6923
746 Ga0500616_0000053 3300053153 Bacteria 291841
747 Ga0500616_0005770 3300053153 Bacteria 8315
748 Ga0500633_0029430 3300053160 Bacteria 1757
749 Ga0500634_0011919 3300053161 Bacteria 4508
750 Ga0500637_0032299 3300053178 Bacteria 2919
751 Ga0500645_000125 3300053730 Bacteria 60408
752 Ga0501084_0055417 3300054114 Bacteria 3317
753 Ga0590071_001088 3300059421 Bacteria 7344
754 Ga0590074_000513 3300059423 Bacteria 5758
755 Ga0590075_000364 3300059424 Bacteria 12490
756 Ga0590077_000930 3300059426 Bacteria 7469
757 Ga0466962_0002288 3300061719 Bacteria 9079
758 Ga0530510_0149864 3300061734 Bacteria 1722

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049822 Ga0501035_0025899 Ga0501035_0025899_3771_5105 360
2 3300049823 Ga0501044_0005139 Ga0501044_0005139_1124_2458 360
3 3300053161 Ga0500634_0011919 Ga0500634_0011919_773_2140 377
4 3300005985 Ga0081539_10001103 Ga0081539_1000110338 380
5 3300049579 Ga0501043_0270106 Ga0501043_0270106_23_1216 383
6 3300049582 Ga0501048_0234485 Ga0501048_0234485_25_1218 383
7 3300044658 Ga0466972_0024639 Ga0466972_0024639_1687_2889 385
8 3300049823 Ga0501044_0146631 Ga0501044_0146631_964_2280 386
9 3300003763 Ga0055529_1003401 Ga0055529_10034013 387
10 3300005614 Ga0068856_100001887 Ga0068856_1000018873 387
11 3300025272 Ga0209455_1000357 Ga0209455_100035732 387
12 3300026078 Ga0207702_10000185 Ga0207702_1000018519 387
13 3300005578 Ga0068854_100000400 Ga0068854_10000040012 389
14 3300025949 Ga0207667_10000031 Ga0207667_1000003114 389
15 3300025981 Ga0207640_10000061 Ga0207640_1000006124 389
16 3300044658 Ga0466972_0044402 Ga0466972_0044402_222_1553 390
17 3300044672 Ga0466982_0000044 Ga0466982_0000044_24329_25660 390
18 3300044683 Ga0466965_0025957 Ga0466965_0025957_451_1782 390
19 3300044684 Ga0466966_0033225 Ga0466966_0033225_1708_3039 390
20 3300044765 Ga0466970_0012573 Ga0466970_0012573_2447_3778 390
21 3300009093 Ga0105240_10005363 Ga0105240_100053636 391
22 3300006846 Ga0075430_100013534 Ga0075430_1000135346 392
23 3300050509 nmdc:mga0qj67_13438_c1 nmdc:mga0qj67_13438_c1_1385_2752 392
24 3300003759 Ga0055525_1000261 Ga0055525_10002612 393
25 3300003760 Ga0055527_1000273 Ga0055527_100027311 393
26 3300003761 Ga0055535_1000574 Ga0055535_100057411 393
27 3300003762 Ga0055542_1000597 Ga0055542_100059714 393
28 3300003763 Ga0055529_1000815 Ga0055529_10008157 393
29 3300025228 Ga0209672_100024 Ga0209672_100024279 393
30 3300025230 Ga0209563_100127 Ga0209563_10012772 393
31 3300025242 Ga0209258_100047 Ga0209258_100047279 393
32 3300025254 Ga0209148_1000054 Ga0209148_1000054279 393
33 3300025272 Ga0209455_1000052 Ga0209455_1000052279 393
34 3300048088 Ga0495602_0127005 Ga0495602_0127005_806_2029 393
35 3300049587 Ga0501071_0216682 Ga0501071_0216682_10_1218 394
36 3300045976 Ga0466967_0000795 Ga0466967_0000795_5263_6498 395
37 3300006852 Ga0075433_10011817 Ga0075433_100118172 396
38 3300006914 Ga0075436_100015010 Ga0075436_1000150104 396
39 3300007076 Ga0075435_100070676 Ga0075435_1000706762 396
40 3300033180 Ga0307510_10018254 Ga0307510_100182546 396
41 3300046455 Ga0495603_0002686 Ga0495603_0002686_938_2206 396
42 3300046459 Ga0495629_0025807 Ga0495629_0025807_11_1264 396
43 3300046460 Ga0495638_0099420 Ga0495638_0099420_261_1529 396
44 3300046492 Ga0495585_0038264 Ga0495585_0038264_344_1612 396
45 3300046518 Ga0495631_0040157 Ga0495631_0040157_291_1559 396
46 3300047447 Ga0495685_014345 Ga0495685_014345_1079_2347 396
47 3300048088 Ga0495602_0048087 Ga0495602_0048087_10_1263 396
48 3300048905 Ga0496102_0030481 Ga0496102_0030481_2436_3671 396
49 3300048919 Ga0496116_0017221 Ga0496116_0017221_3530_4765 396
50 3300048920 Ga0496117_0000024 Ga0496117_0000024_83163_84398 396
51 3300048921 Ga0496118_0000014 Ga0496118_0000014_334664_335899 396
52 3300048923 Ga0496120_0026274 Ga0496120_0026274_601_1836 396
53 3300048929 Ga0496126_0045508 Ga0496126_0045508_2369_3604 396
54 3300053178 Ga0500637_0032299 Ga0500637_0032299_686_1918 396
55 3300044693 Ga0466961_0055317 Ga0466961_0055317_1269_2513 397
56 3300005539 Ga0068853_100020326 Ga0068853_1000203264 398
57 3300009545 Ga0105237_10291835 Ga0105237_102918351 398
58 3300026041 Ga0207639_10034619 Ga0207639_100346193 398
59 3300005615 Ga0070702_100085281 Ga0070702_1000852812 399
60 3300025931 Ga0207644_10043803 Ga0207644_100438033 399
61 3300025940 Ga0207691_10005413 Ga0207691_1000541310 399
62 3300028381 Ga0268264_10059497 Ga0268264_100594971 399
63 3300006871 Ga0075434_100113754 Ga0075434_1001137542 401
64 3300050515 nmdc:mga0a205_7532_c2 nmdc:mga0a205_7532_c2_3201_4517 401
65 3300005468 Ga0070707_100170508 Ga0070707_1001705081 402
66 3300005518 Ga0070699_100113580 Ga0070699_1001135802 402
67 3300025922 Ga0207646_10104611 Ga0207646_101046112 402
68 3300025981 Ga0207640_10078923 Ga0207640_100789232 402
69 3300048928 Ga0496125_0020072 Ga0496125_0020072_629_1882 402
70 3300009101 Ga0105247_10026927 Ga0105247_100269272 403
71 3300009553 Ga0105249_10134771 Ga0105249_101347712 403
72 3300013296 Ga0157374_10109243 Ga0157374_101092432 403
73 3300026121 Ga0207683_10166592 Ga0207683_101665922 403
74 3300048928 Ga0496125_0000416 Ga0496125_0000416_41582_42844 403
75 3300005262 Ga0065165_1004668 Ga0065165_10046682 405
76 3300028786 Ga0307517_10018496 Ga0307517_100184968 405
77 3300031507 Ga0307509_10030391 Ga0307509_100303911 405
78 3300031616 Ga0307508_10014270 Ga0307508_100142704 405
79 3300033180 Ga0307510_10133917 Ga0307510_101339172 405
80 3300046499 Ga0495594_0019414 Ga0495594_0019414_2241_3566 405
81 3300046501 Ga0495607_0023327 Ga0495607_0023327_1090_2415 405
82 3300046522 Ga0495643_0009173 Ga0495643_0009173_1840_3165 405
83 3300046683 Ga0495658_0044193 Ga0495658_0044193_1065_2390 405
84 3300046690 Ga0495624_0058895 Ga0495624_0058895_690_2015 405
85 3300046691 Ga0495670_0007579 Ga0495670_0007579_1927_3252 405
86 3300046794 Ga0495589_0023474 Ga0495589_0023474_1690_3015 405
87 3300046810 Ga0495660_0025463 Ga0495660_0025463_1457_2782 405
88 3300047443 Ga0495687_010294 Ga0495687_010294_374_1699 405
89 3300047447 Ga0495685_000931 Ga0495685_000931_4569_5894 405
90 3300053083 Ga0495655_0005297 Ga0495655_0005297_126_1451 405
91 3300053094 Ga0500566_0033762 Ga0500566_0033762_626_1951 405
92 3300053101 Ga0500553_078950 Ga0500553_078950_100_1425 405
93 3300053109 Ga0500569_006115 Ga0500569_006115_1008_2333 405
94 3300053129 Ga0500628_001577 Ga0500628_001577_2451_3776 405
95 3300053131 Ga0500652_015340 Ga0500652_015340_768_2093 405
96 3300053137 Ga0500561_0000979 Ga0500561_0000979_1008_2333 405
97 3300053140 Ga0500573_0083491 Ga0500573_0083491_258_1583 405
98 3300053149 Ga0500600_0006627 Ga0500600_0006627_1606_2931 405
99 3300053153 Ga0500616_0005770 Ga0500616_0005770_5098_6423 405
100 3300003316 rootH1_10019244 rootH1_100192442 406
101 3300005458 Ga0070681_10193030 Ga0070681_101930302 408
102 3300031616 Ga0307508_10034594 Ga0307508_100345944 409
103 3300047447 Ga0495685_005825 Ga0495685_005825_2662_3987 409
104 3300053086 Ga0500578_0017345 Ga0500578_0017345_94_1419 409
105 3300053131 Ga0500652_016579 Ga0500652_016579_1126_2451 409
106 3300053160 Ga0500633_0029430 Ga0500633_0029430_94_1419 409
107 3300005355 Ga0070671_100032205 Ga0070671_1000322054 410
108 3300005543 Ga0070672_100034073 Ga0070672_1000340733 410
109 3300005841 Ga0068863_100010821 Ga0068863_1000108212 410
110 3300005842 Ga0068858_100160059 Ga0068858_1001600592 410
111 3300009177 Ga0105248_10126373 Ga0105248_101263732 410
112 3300013306 Ga0163162_10062930 Ga0163162_100629303 410
113 3300014968 Ga0157379_10072490 Ga0157379_100724902 410
114 3300025908 Ga0207643_10003066 Ga0207643_100030668 410
115 3300025941 Ga0207711_10037845 Ga0207711_100378452 410
116 3300025942 Ga0207689_10042064 Ga0207689_100420643 410
117 3300025972 Ga0207668_10110871 Ga0207668_101108712 410
118 3300026088 Ga0207641_10065076 Ga0207641_100650762 410
119 3300048913 Ga0496110_0326451 Ga0496110_0326451_31_1347 410
120 3300030522 Ga0307512_10008398 Ga0307512_100083989 411
121 3300005937 Ga0081455_10203969 Ga0081455_102039691 412
122 iso_pu_bacteria 8001781756 8001789183 412
123 3300045049 Ga0466959_0014526 Ga0466959_0014526_517_1815 413
124 3300046525 Ga0495663_0000222 Ga0495663_0000222_14417_15763 413
125 3300048929 Ga0496126_0097845 Ga0496126_0097845_1198_2517 413
126 3300049822 Ga0501035_0226821 Ga0501035_0226821_108_1427 414
127 iso_pu_bacteria 2844533157 2844533196 414
128 3300031456 Ga0307513_10035596 Ga0307513_100355965 415
129 iso_pu_bacteria 2558860280 2559427465 415
130 iso_pu_bacteria 2585427649 2586059182 415
131 iso_pu_bacteria 2791354901 2791914299 415
132 iso_pu_bacteria 2808606522 2809592059 415
133 iso_pu_bacteria 2915768154 2915773238 415
134 iso_pu_bacteria 2917736166 2917738827 415
135 iso_pu_bacteria 8003314358 8003322634 415
136 iso_pu_bacteria 8047710418 8047714131 415
137 3300031240 Ga0265320_10013217 Ga0265320_100132173 417
138 3300048907 Ga0496104_0031919 Ga0496104_0031919_1466_2776 417
139 3300048918 Ga0496115_0015634 Ga0496115_0015634_920_2230 417
140 iso_pu_bacteria 2857740372 2857744857 417
141 iso_pu_bacteria 2904497146 2904499110 417
142 iso_pu_bacteria 2919538618 2919541325 417
143 iso_pu_bacteria 2932426870 2932430163 417
144 iso_pu_bacteria 2933418574 2933422149 417
145 iso_pu_bacteria 2939674588 2939678957 417
146 3300002987 JGI25159J45721_1008856 JGI25159J45721_10088562 418
147 3300003187 JGI25151J46595_10000179 JGI25151J46595_1000017912 418
148 3300003354 JGI25160J50197_1001998 JGI25160J50197_10019986 418
149 3300005353 Ga0070669_100042507 Ga0070669_1000425072 418
150 3300005356 Ga0070674_100001468 Ga0070674_1000014684 418
151 3300005366 Ga0070659_100127592 Ga0070659_1001275922 418
152 3300005436 Ga0070713_100003503 Ga0070713_1000035038 418
153 3300005445 Ga0070708_100047508 Ga0070708_1000475083 418
154 3300005458 Ga0070681_10081342 Ga0070681_100813422 418
155 3300005614 Ga0068856_100086528 Ga0068856_1000865282 418
156 3300005616 Ga0068852_100036452 Ga0068852_1000364524 418
157 3300005719 Ga0068861_100034981 Ga0068861_1000349812 418
158 3300005844 Ga0068862_100022786 Ga0068862_1000227862 418
159 3300005844 Ga0068862_100126546 Ga0068862_1001265462 418
160 3300005985 Ga0081539_10004763 Ga0081539_1000476312 418
161 3300006028 Ga0070717_10026850 Ga0070717_100268506 418
162 3300006175 Ga0070712_100009921 Ga0070712_1000099215 418
163 3300006844 Ga0075428_100004781 Ga0075428_10000478111 418
164 3300006846 Ga0075430_100003642 Ga0075430_10000364210 418
165 3300006847 Ga0075431_100004593 Ga0075431_1000045932 418
166 3300006880 Ga0075429_100044196 Ga0075429_1000441962 418
167 3300006914 Ga0075436_100022323 Ga0075436_1000223233 418
168 3300006931 Ga0097620_100082292 Ga0097620_1000822922 418
169 3300007076 Ga0075435_100128319 Ga0075435_1001283192 418
170 3300009093 Ga0105240_10000002 Ga0105240_100000021128 418
171 3300009094 Ga0111539_10026149 Ga0111539_100261494 418
172 3300009094 Ga0111539_10122454 Ga0111539_101224542 418
173 3300009147 Ga0114129_10004447 Ga0114129_1000444714 418
174 3300009147 Ga0114129_10189004 Ga0114129_101890042 418
175 3300009147 Ga0114129_10225027 Ga0114129_102250271 418
176 3300009147 Ga0114129_10445042 Ga0114129_104450421 418
177 3300009551 Ga0105238_10025862 Ga0105238_100258624 418
178 3300013100 Ga0157373_10089741 Ga0157373_100897412 418
179 3300013104 Ga0157370_10004257 Ga0157370_100042578 418
180 3300013104 Ga0157370_10236533 Ga0157370_102365332 418
181 3300013105 Ga0157369_10001939 Ga0157369_1000193912 418
182 3300014326 Ga0157380_10011558 Ga0157380_100115583 418
183 3300014326 Ga0157380_10031769 Ga0157380_100317694 418
184 3300025284 Ga0209130_1000793 Ga0209130_10007937 418
185 3300025294 Ga0209025_1000251 Ga0209025_100025112 418
186 3300025913 Ga0207695_10000002 Ga0207695_100000021133 418
187 3300025923 Ga0207681_10008729 Ga0207681_100087292 418
188 3300025928 Ga0207700_10076420 Ga0207700_100764202 418
189 3300025935 Ga0207709_10065253 Ga0207709_100652532 418
190 3300026075 Ga0207708_10042238 Ga0207708_100422384 418
191 3300026078 Ga0207702_10144433 Ga0207702_101444332 418
192 3300026142 Ga0207698_10025989 Ga0207698_100259893 418
193 3300027907 Ga0207428_10034951 Ga0207428_100349513 418
194 3300028380 Ga0268265_10026758 Ga0268265_100267582 418
195 3300028380 Ga0268265_10128854 Ga0268265_101288542 418
196 3300028380 Ga0268265_10189989 Ga0268265_101899892 418
197 3300031548 Ga0307408_100068822 Ga0307408_1000688222 418
198 3300031901 Ga0307406_10057987 Ga0307406_100579872 418
199 3300042439 Ga0439464_0003883 Ga0439464_0003883_822_2126 418
200 3300042461 Ga0439460_0018890 Ga0439460_0018890_430_1746 418
201 3300046516 Ga0495628_0022582 Ga0495628_0022582_2845_4149 418
202 3300046536 Ga0495587_0015851 Ga0495587_0015851_3227_4531 418
203 3300046543 Ga0495645_0005674 Ga0495645_0005674_6279_7583 418
204 3300046663 Ga0495635_0047510 Ga0495635_0047510_1353_2657 418
205 3300046679 Ga0495623_0047478 Ga0495623_0047478_30_1334 418
206 3300046809 Ga0495600_0047615 Ga0495600_0047615_1364_2668 418
207 3300047317 Ga0495604_0051265 Ga0495604_0051265_183_1487 418
208 3300047470 Ga0495681_0003555 Ga0495681_0003555_2797_4116 418
209 3300049572 Ga0501036_0264331 Ga0501036_0264331_25_1323 418
210 3300049576 Ga0501040_0086342 Ga0501040_0086342_106_1404 418
211 3300050507 nmdc:mga05p37_198665_c1 nmdc:mga05p37_198665_c1_584_1900 418
212 3300050507 nmdc:mga05p37_43286_c1 nmdc:mga05p37_43286_c1_190_1494 418
213 3300050507 nmdc:mga05p37_444857_c1 nmdc:mga05p37_444857_c1_154_1455 418
214 3300050507 nmdc:mga05p37_76118_c1 nmdc:mga05p37_76118_c1_1631_2935 418
215 3300050508 nmdc:mga09592_218383_c1 nmdc:mga09592_218383_c1_255_1571 418
216 3300050508 nmdc:mga09592_28175_c1 nmdc:mga09592_28175_c1_1049_2353 418
217 3300050509 nmdc:mga0qj67_39959_c1 nmdc:mga0qj67_39959_c1_715_2019 418
218 3300050509 nmdc:mga0qj67_99068_c1 nmdc:mga0qj67_99068_c1_598_1902 418
219 3300050510 nmdc:mga06r32_25047_c1 nmdc:mga06r32_25047_c1_1013_2317 418
220 3300050510 nmdc:mga06r32_38872_c1 nmdc:mga06r32_38872_c1_71_1375 418
221 3300050511 nmdc:mga08y16_167316_c1 nmdc:mga08y16_167316_c1_176_1492 418
222 3300050511 nmdc:mga08y16_90275_c1 nmdc:mga08y16_90275_c1_183_1487 418
223 3300050512 nmdc:mga0n895_346474_c1 nmdc:mga0n895_346474_c1_13_1305 418
224 3300050512 nmdc:mga0n895_53175_c1 nmdc:mga0n895_53175_c1_497_1789 418
225 3300050513 nmdc:mga0rr50_152468_c1 nmdc:mga0rr50_152468_c1_136_1428 418
226 3300050513 nmdc:mga0rr50_206252_c1 nmdc:mga0rr50_206252_c1_278_1570 418
227 3300050515 nmdc:mga0a205_143150_c1 nmdc:mga0a205_143150_c1_702_1994 418
228 3300050515 nmdc:mga0a205_43683_c1 nmdc:mga0a205_43683_c1_115_1419 418
229 3300053139 Ga0500568_0009215 Ga0500568_0009215_1231_2547 418
230 3300054114 Ga0501084_0055417 Ga0501084_0055417_413_1723 418
231 3300061734 Ga0530510_0149864 Ga0530510_0149864_116_1414 418
232 iso_pu_bacteria 2818991440 2819562544 418
233 iso_pu_bacteria 2842914999 2842915264 418
234 iso_pu_bacteria 2842918807 2842921607 418
235 iso_pu_bacteria 2868088558 2868091334 418
236 iso_pu_bacteria 2904463128 2904463146 418
237 iso_pu_bacteria 2928963466 2928963876 418
238 iso_pu_bacteria 2941471342 2941472437 418
239 iso_pu_bacteria 2953994433 2953997622 418
240 3300005437 Ga0070710_10000323 Ga0070710_100003233 419
241 3300005548 Ga0070665_100290682 Ga0070665_1002906822 419
242 3300006846 Ga0075430_100030472 Ga0075430_1000304723 419
243 3300009094 Ga0111539_10415366 Ga0111539_104153661 419
244 3300009147 Ga0114129_10001468 Ga0114129_1000146813 419
245 3300025302 Ga0207426_1000179 Ga0207426_100017985 419
246 3300025898 Ga0207692_10000685 Ga0207692_100006854 419
247 3300025972 Ga0207668_10002000 Ga0207668_100020007 419
248 3300026067 Ga0207678_10005681 Ga0207678_100056812 419
249 3300028794 Ga0307515_10074461 Ga0307515_100744613 419
250 3300030733 Ga0314311_1226575 Ga0314311_12265752 419
251 3300031548 Ga0307408_100044022 Ga0307408_1000440221 419
252 3300031548 Ga0307408_100188838 Ga0307408_1001888382 419
253 3300031731 Ga0307405_10043405 Ga0307405_100434052 419
254 3300031995 Ga0307409_100050650 Ga0307409_1000506501 419
255 3300032002 Ga0307416_100012602 Ga0307416_1000126021 419
256 3300032005 Ga0307411_10028371 Ga0307411_100283713 419
257 3300033179 Ga0307507_10025927 Ga0307507_100259274 419
258 3300033179 Ga0307507_10121752 Ga0307507_101217522 419
259 3300037853 Ga0436364_0821552 Ga0436364_0821552_2912_4258 419
260 3300039450 Ga0436363_1440167 Ga0436363_1440167_973_2298 419
261 3300044658 Ga0466972_0000377 Ga0466972_0000377_13392_14696 419
262 3300044658 Ga0466972_0014349 Ga0466972_0014349_2562_3869 419
263 3300044683 Ga0466965_0001162 Ga0466965_0001162_1166_2476 419
264 3300044683 Ga0466965_0003803 Ga0466965_0003803_968_2275 419
265 3300048905 Ga0496102_0014442 Ga0496102_0014442_4766_6064 419
266 3300048909 Ga0496106_0198717 Ga0496106_0198717_140_1438 419
267 3300048913 Ga0496110_0224731 Ga0496110_0224731_307_1605 419
268 3300049522 Ga0501299_012684 Ga0501299_012684_35_1339 419
269 3300050507 nmdc:mga05p37_687_c1 nmdc:mga05p37_687_c1_17090_18409 419
270 3300050512 nmdc:mga0n895_68130_c1 nmdc:mga0n895_68130_c1_2001_3320 419
271 3300059421 Ga0590071_001088 Ga0590071_001088_3743_5050 419
272 3300059423 Ga0590074_000513 Ga0590074_000513_1897_3204 419
273 3300059424 Ga0590075_000364 Ga0590075_000364_3819_5126 419
274 3300059426 Ga0590077_000930 Ga0590077_000930_2185_3492 419
275 iso_pu_bacteria 2643221578 2643904983 419
276 iso_pu_bacteria 2643221673 2644403042 419
277 iso_pu_bacteria 2643221677 2644433490 419
278 iso_pu_bacteria 2751185734 2753075869 419
279 iso_pu_bacteria 2821443989 2821445719 419
280 iso_pu_bacteria 2867507094 2867507474 419
281 iso_pu_bacteria 2918501144 2918501623 419
282 3300001989 JGI24739J22299_10001025 JGI24739J22299_1000102510 420
283 3300001990 JGI24737J22298_10000523 JGI24737J22298_100005236 420
284 3300003578 Ga0006562J51391_1045775 Ga0006562J51391_10457752 420
285 3300003578 Ga0006562J51391_1045778 Ga0006562J51391_10457788 420
286 3300005335 Ga0070666_10000005 Ga0070666_1000000549 420
287 3300005355 Ga0070671_100009724 Ga0070671_1000097247 420
288 3300005367 Ga0070667_100006541 Ga0070667_1000065413 420
289 3300005367 Ga0070667_100082098 Ga0070667_1000820982 420
290 3300005548 Ga0070665_100033725 Ga0070665_1000337252 420
291 3300005563 Ga0068855_100146328 Ga0068855_1001463283 420
292 3300005577 Ga0068857_100000189 Ga0068857_10000018914 420
293 3300005616 Ga0068852_100037179 Ga0068852_1000371793 420
294 3300005617 Ga0068859_100000211 Ga0068859_10000021130 420
295 3300005841 Ga0068863_100003996 Ga0068863_1000039969 420
296 3300005842 Ga0068858_100005568 Ga0068858_1000055682 420
297 3300005843 Ga0068860_100004169 Ga0068860_1000041699 420
298 3300006847 Ga0075431_100035498 Ga0075431_1000354982 420
299 3300006871 Ga0075434_100161682 Ga0075434_1001616821 420
300 3300006914 Ga0075436_100125169 Ga0075436_1001251691 420
301 3300006931 Ga0097620_100000211 Ga0097620_10000021130 420
302 3300007788 Ga0099795_10000019 Ga0099795_1000001929 420
303 3300009092 Ga0105250_10003540 Ga0105250_100035404 420
304 3300009093 Ga0105240_10007085 Ga0105240_100070854 420
305 3300009101 Ga0105247_10000260 Ga0105247_1000026012 420
306 3300009177 Ga0105248_10001076 Ga0105248_100010769 420
307 3300009545 Ga0105237_10000007 Ga0105237_10000007179 420
308 3300009545 Ga0105237_10000136 Ga0105237_1000013627 420
309 3300009551 Ga0105238_10016211 Ga0105238_100162113 420
310 3300009553 Ga0105249_10020152 Ga0105249_100201522 420
311 3300010159 Ga0099796_10000010 Ga0099796_1000001029 420
312 3300010375 Ga0105239_10003222 Ga0105239_1000322213 420
313 3300012500 Ga0157314_1000790 Ga0157314_10007902 420
314 3300013306 Ga0163162_10000281 Ga0163162_1000028121 420
315 3300013306 Ga0163162_10244608 Ga0163162_102446082 420
316 3300014325 Ga0163163_10049693 Ga0163163_100496934 420
317 3300014968 Ga0157379_10146214 Ga0157379_101462142 420
318 3300025246 Ga0209646_1005413 Ga0209646_10054132 420
319 3300025250 Ga0209026_1000391 Ga0209026_100039115 420
320 3300025256 Ga0209759_1001819 Ga0209759_10018194 420
321 3300025297 Ga0209758_1001868 Ga0209758_100186812 420
322 3300025900 Ga0207710_10000322 Ga0207710_1000032231 420
323 3300025903 Ga0207680_10000005 Ga0207680_10000005405 420
324 3300025904 Ga0207647_10010943 Ga0207647_100109434 420
325 3300025913 Ga0207695_10001214 Ga0207695_1000121410 420
326 3300025913 Ga0207695_10012993 Ga0207695_100129934 420
327 3300025914 Ga0207671_10000059 Ga0207671_1000005927 420
328 3300025914 Ga0207671_10000074 Ga0207671_1000007480 420
329 3300025924 Ga0207694_10001048 Ga0207694_1000104820 420
330 3300025931 Ga0207644_10018202 Ga0207644_100182022 420
331 3300025949 Ga0207667_10000292 Ga0207667_1000029215 420
332 3300025961 Ga0207712_10039372 Ga0207712_100393722 420
333 3300025981 Ga0207640_10018558 Ga0207640_100185583 420
334 3300025986 Ga0207658_10044094 Ga0207658_100440941 420
335 3300026035 Ga0207703_10002171 Ga0207703_1000217113 420
336 3300026088 Ga0207641_10007137 Ga0207641_100071374 420
337 3300026116 Ga0207674_10000298 Ga0207674_1000029827 420
338 3300026142 Ga0207698_10057077 Ga0207698_100570773 420
339 3300027512 Ga0209179_1000008 Ga0209179_100000835 420
340 3300028379 Ga0268266_10000004 Ga0268266_100000041125 420
341 3300028379 Ga0268266_10035428 Ga0268266_100354284 420
342 3300030521 Ga0307511_10000227 Ga0307511_1000022710 420
343 3300033180 Ga0307510_10010353 Ga0307510_100103537 420
344 3300046471 Ga0495650_0000247 Ga0495650_0000247_64213_65526 420
345 3300048905 Ga0496102_0030962 Ga0496102_0030962_2977_4287 420
346 3300048906 Ga0496103_0026811 Ga0496103_0026811_1409_2719 420
347 3300048924 Ga0496121_0002051 Ga0496121_0002051_30117_31427 420
348 3300048924 Ga0496121_0014570 Ga0496121_0014570_2985_4313 420
349 3300048928 Ga0496125_0000453 Ga0496125_0000453_45082_46410 420
350 3300048928 Ga0496125_0012791 Ga0496125_0012791_766_2076 420
351 3300048929 Ga0496126_0002266 Ga0496126_0002266_13615_14928 420
352 3300049581 Ga0501047_0006703 Ga0501047_0006703_4824_6182 420
353 3300049586 Ga0501070_0017543 Ga0501070_0017543_3052_4410 420
354 3300049822 Ga0501035_0014043 Ga0501035_0014043_1965_3323 420
355 3300049823 Ga0501044_0022778 Ga0501044_0022778_4936_6294 420
356 3300049823 Ga0501044_0080152 Ga0501044_0080152_1664_3010 420
357 3300050507 nmdc:mga05p37_36826_c1 nmdc:mga05p37_36826_c1_717_2075 420
358 3300050510 nmdc:mga06r32_28058_c1 nmdc:mga06r32_28058_c1_1652_3034 420
359 3300050512 nmdc:mga0n895_157210_c1 nmdc:mga0n895_157210_c1_705_2000 420
360 3300050513 nmdc:mga0rr50_225168_c1 nmdc:mga0rr50_225168_c1_39_1334 420
361 3300050514 nmdc:mga08x19_110497_c1 nmdc:mga08x19_110497_c1_404_1699 420
362 3300053090 Ga0500646_0007900 Ga0500646_0007900_137_1450 420
363 iso_pu_bacteria 2523231044 2523384872 420
364 iso_pu_bacteria 2551306166 2552112353 420
365 iso_pu_bacteria 2747842501 2748017761 420
366 iso_pu_bacteria 2818991457 2819661583 420
367 iso_pu_bacteria 2852684882 2852688172 420
368 iso_pu_bacteria 2894414249 2894415220 420
369 iso_pu_bacteria 2919130084 2919134494 420
370 iso_pu_bacteria 2929195423 2929199594 420
371 iso_pu_bacteria 8021622325 8021623424 420
372 iso_pu_bacteria 8021626552 8021627080 420
373 iso_pu_bacteria 8021648035 8021648716 420
374 3300001915 JGI24741J21665_1007211 JGI24741J21665_10072112 421
375 3300003760 Ga0055527_1000271 Ga0055527_100027114 421
376 3300003761 Ga0055535_1000567 Ga0055535_100056714 421
377 3300003762 Ga0055542_1000591 Ga0055542_100059111 421
378 3300003763 Ga0055529_1000556 Ga0055529_100055611 421
379 3300005331 Ga0070670_100021401 Ga0070670_1000214016 421
380 3300005335 Ga0070666_10000147 Ga0070666_1000014728 421
381 3300005335 Ga0070666_10083483 Ga0070666_100834832 421
382 3300005343 Ga0070687_100021419 Ga0070687_1000214191 421
383 3300005356 Ga0070674_100057277 Ga0070674_1000572772 421
384 3300005364 Ga0070673_100010330 Ga0070673_1000103305 421
385 3300005367 Ga0070667_100079789 Ga0070667_1000797892 421
386 3300005367 Ga0070667_100126000 Ga0070667_1001260001 421
387 3300005367 Ga0070667_100216073 Ga0070667_1002160732 421
388 3300005437 Ga0070710_10063104 Ga0070710_100631042 421
389 3300005444 Ga0070694_100085307 Ga0070694_1000853072 421
390 3300005456 Ga0070678_100001774 Ga0070678_1000017745 421
391 3300005457 Ga0070662_100014343 Ga0070662_1000143435 421
392 3300005457 Ga0070662_100057419 Ga0070662_1000574193 421
393 3300005458 Ga0070681_10009451 Ga0070681_100094519 421
394 3300005459 Ga0068867_100108573 Ga0068867_1001085732 421
395 3300005468 Ga0070707_100077171 Ga0070707_1000771712 421
396 3300005471 Ga0070698_100030003 Ga0070698_1000300032 421
397 3300005471 Ga0070698_100184645 Ga0070698_1001846452 421
398 3300005530 Ga0070679_100092018 Ga0070679_1000920181 421
399 3300005536 Ga0070697_100000007 Ga0070697_100000007108 421
400 3300005546 Ga0070696_100068800 Ga0070696_1000688002 421
401 3300005548 Ga0070665_100003246 Ga0070665_1000032468 421
402 3300005548 Ga0070665_100013154 Ga0070665_1000131544 421
403 3300005548 Ga0070665_100021493 Ga0070665_1000214933 421
404 3300005563 Ga0068855_100012081 Ga0068855_1000120818 421
405 3300005577 Ga0068857_100131461 Ga0068857_1001314612 421
406 3300005614 Ga0068856_100001910 Ga0068856_10000191014 421
407 3300005615 Ga0070702_100003651 Ga0070702_1000036516 421
408 3300005616 Ga0068852_100241121 Ga0068852_1002411212 421
409 3300005617 Ga0068859_100078206 Ga0068859_1000782062 421
410 3300005834 Ga0068851_10027552 Ga0068851_100275523 421
411 3300005841 Ga0068863_100000714 Ga0068863_10000071426 421
412 3300005842 Ga0068858_100001471 Ga0068858_1000014718 421
413 3300005842 Ga0068858_100006060 Ga0068858_10000606014 421
414 3300005842 Ga0068858_100023029 Ga0068858_1000230295 421
415 3300005842 Ga0068858_100245519 Ga0068858_1002455191 421
416 3300005843 Ga0068860_100000185 Ga0068860_10000018566 421
417 3300005844 Ga0068862_100135608 Ga0068862_1001356082 421
418 3300006237 Ga0097621_100009537 Ga0097621_1000095373 421
419 3300006353 Ga0075370_10021614 Ga0075370_100216142 421
420 3300006358 Ga0068871_100031726 Ga0068871_1000317262 421
421 3300006358 Ga0068871_100170807 Ga0068871_1001708072 421
422 3300006914 Ga0075436_100005578 Ga0075436_1000055788 421
423 3300006931 Ga0097620_100078212 Ga0097620_1000782122 421
424 3300007265 Ga0099794_10045384 Ga0099794_100453842 421
425 3300007788 Ga0099795_10001057 Ga0099795_100010572 421
426 3300009093 Ga0105240_10000628 Ga0105240_1000062862 421
427 3300009101 Ga0105247_10039195 Ga0105247_100391952 421
428 3300009174 Ga0105241_10011751 Ga0105241_100117512 421
429 3300009174 Ga0105241_10047992 Ga0105241_100479923 421
430 3300009176 Ga0105242_10099665 Ga0105242_100996652 421
431 3300009545 Ga0105237_10136725 Ga0105237_101367252 421
432 3300009545 Ga0105237_10252660 Ga0105237_102526602 421
433 3300009545 Ga0105237_10273282 Ga0105237_102732822 421
434 3300009551 Ga0105238_10208765 Ga0105238_102087652 421
435 3300009551 Ga0105238_10211076 Ga0105238_102110762 421
436 3300009553 Ga0105249_10018582 Ga0105249_100185822 421
437 3300010159 Ga0099796_10000232 Ga0099796_100002326 421
438 3300010375 Ga0105239_10044423 Ga0105239_100444232 421
439 3300013297 Ga0157378_10020941 Ga0157378_100209416 421
440 3300013307 Ga0157372_10276459 Ga0157372_102764592 421
441 3300014325 Ga0163163_10145333 Ga0163163_101453332 421
442 3300014968 Ga0157379_10014123 Ga0157379_100141236 421
443 3300014968 Ga0157379_10150902 Ga0157379_101509022 421
444 3300025226 Ga0209674_100053 Ga0209674_10005342 421
445 3300025228 Ga0209672_100009 Ga0209672_100009337 421
446 3300025242 Ga0209258_100011 Ga0209258_100011307 421
447 3300025253 Ga0209677_102437 Ga0209677_1024376 421
448 3300025254 Ga0209148_1000013 Ga0209148_1000013307 421
449 3300025261 Ga0209233_1000754 Ga0209233_10007547 421
450 3300025272 Ga0209455_1000012 Ga0209455_1000012307 421
451 3300025900 Ga0207710_10022803 Ga0207710_100228032 421
452 3300025900 Ga0207710_10055512 Ga0207710_100555122 421
453 3300025903 Ga0207680_10001024 Ga0207680_100010242 421
454 3300025903 Ga0207680_10043657 Ga0207680_100436571 421
455 3300025904 Ga0207647_10000055 Ga0207647_1000005540 421
456 3300025904 Ga0207647_10005581 Ga0207647_100055813 421
457 3300025910 Ga0207684_10027359 Ga0207684_100273592 421
458 3300025911 Ga0207654_10133733 Ga0207654_101337332 421
459 3300025912 Ga0207707_10000958 Ga0207707_100009582 421
460 3300025913 Ga0207695_10000040 Ga0207695_10000040325 421
461 3300025913 Ga0207695_10006516 Ga0207695_100065167 421
462 3300025913 Ga0207695_10062233 Ga0207695_100622333 421
463 3300025913 Ga0207695_10091476 Ga0207695_100914762 421
464 3300025914 Ga0207671_10037715 Ga0207671_100377152 421
465 3300025914 Ga0207671_10041429 Ga0207671_100414293 421
466 3300025914 Ga0207671_10053093 Ga0207671_100530932 421
467 3300025914 Ga0207671_10060394 Ga0207671_100603942 421
468 3300025917 Ga0207660_10003060 Ga0207660_100030601 421
469 3300025921 Ga0207652_10000912 Ga0207652_1000091218 421
470 3300025922 Ga0207646_10010941 Ga0207646_100109414 421
471 3300025922 Ga0207646_10022308 Ga0207646_100223086 421
472 3300025922 Ga0207646_10143230 Ga0207646_101432302 421
473 3300025924 Ga0207694_10075188 Ga0207694_100751882 421
474 3300025925 Ga0207650_10014766 Ga0207650_100147661 421
475 3300025933 Ga0207706_10025342 Ga0207706_100253422 421
476 3300025933 Ga0207706_10049685 Ga0207706_100496852 421
477 3300025934 Ga0207686_10107858 Ga0207686_101078581 421
478 3300025937 Ga0207669_10060660 Ga0207669_100606602 421
479 3300025949 Ga0207667_10023268 Ga0207667_100232684 421
480 3300025961 Ga0207712_10000120 Ga0207712_1000012013 421
481 3300025981 Ga0207640_10091377 Ga0207640_100913772 421
482 3300026035 Ga0207703_10000422 Ga0207703_1000042228 421
483 3300026035 Ga0207703_10003735 Ga0207703_100037352 421
484 3300026035 Ga0207703_10029673 Ga0207703_100296735 421
485 3300026041 Ga0207639_10010801 Ga0207639_100108012 421
486 3300026067 Ga0207678_10066153 Ga0207678_100661532 421
487 3300026078 Ga0207702_10007958 Ga0207702_100079587 421
488 3300026078 Ga0207702_10037495 Ga0207702_100374954 421
489 3300026078 Ga0207702_10089993 Ga0207702_100899932 421
490 3300026088 Ga0207641_10000393 Ga0207641_1000039327 421
491 3300026089 Ga0207648_10126998 Ga0207648_101269982 421
492 3300026116 Ga0207674_10036889 Ga0207674_100368892 421
493 3300026121 Ga0207683_10000244 Ga0207683_100002447 421
494 3300026142 Ga0207698_10172685 Ga0207698_101726852 421
495 3300027512 Ga0209179_1000665 Ga0209179_10006652 421
496 3300028379 Ga0268266_10000007 Ga0268266_10000007138 421
497 3300028379 Ga0268266_10006593 Ga0268266_100065939 421
498 3300028379 Ga0268266_10028873 Ga0268266_100288734 421
499 3300028381 Ga0268264_10000088 Ga0268264_10000088174 421
500 3300028786 Ga0307517_10018152 Ga0307517_100181523 421
501 3300028794 Ga0307515_10010304 Ga0307515_100103047 421
502 3300028794 Ga0307515_10017668 Ga0307515_100176684 421
503 3300030521 Ga0307511_10000672 Ga0307511_1000067227 421
504 3300030521 Ga0307511_10010986 Ga0307511_100109868 421
505 3300030521 Ga0307511_10015900 Ga0307511_100159002 421
506 3300031456 Ga0307513_10015491 Ga0307513_100154918 421
507 3300031507 Ga0307509_10006518 Ga0307509_100065184 421
508 3300031507 Ga0307509_10138169 Ga0307509_101381691 421
509 3300031616 Ga0307508_10015242 Ga0307508_100152426 421
510 3300031616 Ga0307508_10053927 Ga0307508_100539273 421
511 3300031616 Ga0307508_10091016 Ga0307508_100910162 421
512 3300033179 Ga0307507_10030151 Ga0307507_100301516 421
513 3300033179 Ga0307507_10060126 Ga0307507_100601262 421
514 3300033180 Ga0307510_10000061 Ga0307510_1000006153 421
515 3300033180 Ga0307510_10005829 Ga0307510_1000582914 421
516 3300033180 Ga0307510_10006065 Ga0307510_100060656 421
517 3300035113 Ga0373936_0042983 Ga0373936_0042983_293_1606 421
518 3300037312 Ga0395899_0002906 Ga0395899_0002906_1897_3237 421
519 3300037418 Ga0395900_0063004 Ga0395900_0063004_1026_2366 421
520 3300037466 Ga0395898_0001593 Ga0395898_0001593_11207_12523 421
521 3300041404 Ga0439436_0005195 Ga0439436_0005195_1061_2413 421
522 3300041512 Ga0451853_2973491 Ga0451853_2973491_828_2159 421
523 3300042005 Ga0439448_0022462 Ga0439448_0022462_17_1348 421
524 3300042007 Ga0439449_0000378 Ga0439449_0000378_8732_10084 421
525 3300042014 Ga0439457_000120 Ga0439457_000120_11263_12597 421
526 3300042014 Ga0439457_000307 Ga0439457_000307_10411_11763 421
527 3300042131 Ga0450894_000894 Ga0450894_000894_1170_2522 421
528 3300044656 Ga0466969_0014302 Ga0466969_0014302_1589_2887 421
529 3300044656 Ga0466969_0024240 Ga0466969_0024240_441_1766 421
530 3300044658 Ga0466972_0001073 Ga0466972_0001073_2640_3965 421
531 3300044658 Ga0466972_0002839 Ga0466972_0002839_981_2333 421
532 3300044693 Ga0466961_0007789 Ga0466961_0007789_1640_2992 421
533 3300044693 Ga0466961_0008091 Ga0466961_0008091_3126_4484 421
534 3300044693 Ga0466961_0036482 Ga0466961_0036482_1679_3004 421
535 3300044719 Ga0466971_0013988 Ga0466971_0013988_105_1463 421
536 3300044735 Ga0466968_0031075 Ga0466968_0031075_210_1535 421
537 3300045049 Ga0466959_0011104 Ga0466959_0011104_5037_6335 421
538 3300045051 Ga0451576_0325731 Ga0451576_0325731_148_1542 421
539 3300045976 Ga0466967_0051578 Ga0466967_0051578_2146_3471 421
540 3300046454 Ga0495592_0012776 Ga0495592_0012776_3224_4564 421
541 3300046459 Ga0495629_0015196 Ga0495629_0015196_3216_4565 421
542 3300046462 Ga0495651_0004042 Ga0495651_0004042_4921_6261 421
543 3300046475 Ga0495639_0063529 Ga0495639_0063529_264_1619 421
544 3300046476 Ga0495662_0000534 Ga0495662_0000534_5654_6994 421
545 3300046476 Ga0495662_0019059 Ga0495662_0019059_153_1517 421
546 3300046477 Ga0495664_0003610 Ga0495664_0003610_4831_6171 421
547 3300046499 Ga0495594_0005271 Ga0495594_0005271_5254_6609 421
548 3300046507 Ga0495606_0050569 Ga0495606_0050569_993_2318 421
549 3300046516 Ga0495628_0071763 Ga0495628_0071763_1305_2645 421
550 3300046522 Ga0495643_0006314 Ga0495643_0006314_410_1735 421
551 3300046529 Ga0495652_0031801 Ga0495652_0031801_233_1573 421
552 3300046539 Ga0495621_0008627 Ga0495621_0008627_1045_2391 421
553 3300046542 Ga0495597_0017251 Ga0495597_0017251_1917_3242 421
554 3300046543 Ga0495645_0005263 Ga0495645_0005263_2458_3798 421
555 3300046616 Ga0495668_0027794 Ga0495668_0027794_1393_2718 421
556 3300046660 Ga0495625_0022762 Ga0495625_0022762_387_1736 421
557 3300046660 Ga0495625_0054199 Ga0495625_0054199_1087_2412 421
558 3300046663 Ga0495635_0006399 Ga0495635_0006399_5810_7150 421
559 3300046674 Ga0495588_0005143 Ga0495588_0005143_1416_2771 421
560 3300046674 Ga0495588_0007950 Ga0495588_0007950_460_1809 421
561 3300046680 Ga0495646_0057201 Ga0495646_0057201_142_1482 421
562 3300046689 Ga0495613_0017227 Ga0495613_0017227_1047_2387 421
563 3300046689 Ga0495613_0039155 Ga0495613_0039155_1294_2658 421
564 3300046809 Ga0495600_0017891 Ga0495600_0017891_1047_2387 421
565 3300047315 Ga0495581_0021486 Ga0495581_0021486_2230_3570 421
566 3300047318 Ga0495636_0018692 Ga0495636_0018692_783_2138 421
567 3300047319 Ga0495674_0216232 Ga0495674_0216232_240_1574 421
568 3300047321 Ga0495676_0012001 Ga0495676_0012001_2309_3649 421
569 3300047443 Ga0495687_001648 Ga0495687_001648_8382_9731 421
570 3300047443 Ga0495687_002821 Ga0495687_002821_7656_8981 421
571 3300047470 Ga0495681_0001693 Ga0495681_0001693_5885_7234 421
572 3300047673 Ga0495593_0003639 Ga0495593_0003639_5454_6794 421
573 3300048089 Ga0495614_0042408 Ga0495614_0042408_460_1809 421
574 3300048089 Ga0495614_0054420 Ga0495614_0054420_142_1482 421
575 3300048907 Ga0496104_0048215 Ga0496104_0048215_2224_3555 421
576 3300048908 Ga0496105_0005844 Ga0496105_0005844_4396_5727 421
577 3300048910 Ga0496107_0011636 Ga0496107_0011636_628_1959 421
578 3300048917 Ga0496114_0016710 Ga0496114_0016710_4483_5814 421
579 3300048921 Ga0496118_0008276 Ga0496118_0008276_1218_2573 421
580 3300048924 Ga0496121_0110793 Ga0496121_0110793_140_1438 421
581 3300048928 Ga0496125_0000816 Ga0496125_0000816_25147_26445 421
582 3300048929 Ga0496126_0069812 Ga0496126_0069812_1452_2750 421
583 3300049588 Ga0501072_0231280 Ga0501072_0231280_29_1339 421
584 3300049822 Ga0501035_0001136 Ga0501035_0001136_25979_27325 421
585 3300050508 nmdc:mga09592_173251_c1 nmdc:mga09592_173251_c1_91_1389 421
586 3300050515 nmdc:mga0a205_107049_c1 nmdc:mga0a205_107049_c1_218_1531 421
587 3300053092 Ga0500583_0005204 Ga0500583_0005204_2396_3715 421
588 3300053107 Ga0500560_030452 Ga0500560_030452_19_1368 421
589 3300053115 Ga0500591_034784 Ga0500591_034784_416_1723 421
590 3300053134 Ga0500658_0014589 Ga0500658_0014589_1414_2715 421
591 3300053153 Ga0500616_0000053 Ga0500616_0000053_177629_178930 421
592 3300061719 Ga0466962_0002288 Ga0466962_0002288_4392_5750 421
593 iso_pu_bacteria 2582581314 2585313979 421
594 iso_pu_bacteria 2643221678 2644443347 421
595 iso_pu_bacteria 2643221714 2644627348 421
596 iso_pu_bacteria 2643221962 2645724067 421
597 iso_pu_bacteria 2784746763 2785346316 421
598 iso_pu_bacteria 2784746763 2785346825 421
599 iso_pu_bacteria 2784746768 2785373452 421
600 iso_pu_bacteria 2808606359 2808848703 421
601 iso_pu_bacteria 2808606375 2808916477 421
602 iso_pu_bacteria 2852635781 2852642596 421
603 iso_pu_bacteria 2862382967 2862389661 421
604 iso_pu_bacteria 2863404153 2863407846 421
605 iso_pu_bacteria 2867346516 2867348328 421
606 iso_pu_bacteria 2947224130 2947224255 421
607 iso_pu_bacteria 2954380949 2954390057 421
608 iso_pu_bacteria 2954711539 2954712274 421
609 iso_pu_bacteria 2954721474 2954722219 421
610 iso_pu_bacteria 2954731030 2954739630 421
611 iso_pu_bacteria 2954740390 2954741108 421
612 iso_pu_bacteria 2954749733 2954758456 421
613 iso_pu_bacteria 2954759201 2954760119 421
614 iso_pu_bacteria 2990059506 2990066966 421
615 iso_pu_bacteria 3006493962 3006497289 421
616 iso_pu_bacteria 8008558824 8008558981 421
617 iso_pu_bacteria 8008558824 8008560422 421
618 iso_pu_bacteria 8008574985 8008575720 421
619 iso_pu_bacteria 8048406513 8048407534 421
620 3300002067 JGI24735J21928_10001024 JGI24735J21928_100010247 422
621 3300002705 JGI25156J39149_1001399 JGI25156J39149_10013992 422
622 3300002705 JGI25156J39149_1004432 JGI25156J39149_10044324 422
623 3300002737 JGI25162J39368_1000066 JGI25162J39368_100006620 422
624 3300002737 JGI25162J39368_1000623 JGI25162J39368_100062311 422
625 3300002737 JGI25162J39368_1003666 JGI25162J39368_10036662 422
626 3300002741 JGI25157J39369_1000050 JGI25157J39369_100005020 422
627 3300002741 JGI25157J39369_1000688 JGI25157J39369_100068810 422
628 3300002741 JGI25157J39369_1001266 JGI25157J39369_10012669 422
629 3300002741 JGI25157J39369_1002251 JGI25157J39369_10022514 422
630 3300002771 JGI25163J39215_1000565 JGI25163J39215_10005659 422
631 3300002772 JGI25164J39214_1000056 JGI25164J39214_100005686 422
632 3300002772 JGI25164J39214_1000061 JGI25164J39214_100006120 422
633 3300003214 JGI25165J46597_1000009 JGI25165J46597_100000920 422
634 3300003214 JGI25165J46597_1000151 JGI25165J46597_100015173 422
635 3300003751 Ga0055538_1001312 Ga0055538_10013125 422
636 3300003756 Ga0055533_1001372 Ga0055533_10013726 422
637 3300003761 Ga0055535_1000045 Ga0055535_100004520 422
638 3300003761 Ga0055535_1000466 Ga0055535_100046615 422
639 3300003762 Ga0055542_1000010 Ga0055542_1000010262 422
640 3300003762 Ga0055542_1000079 Ga0055542_100007920 422
641 3300003762 Ga0055542_1000104 Ga0055542_100010418 422
642 3300003762 Ga0055542_1000689 Ga0055542_10006898 422
643 3300003763 Ga0055529_1000122 Ga0055529_100012286 422
644 3300003763 Ga0055529_1000140 Ga0055529_100014080 422
645 3300005262 Ga0065165_1000186 Ga0065165_100018650 422
646 3300005339 Ga0070660_100067459 Ga0070660_1000674592 422
647 3300005344 Ga0070661_100009253 Ga0070661_1000092534 422
648 3300005345 Ga0070692_10035014 Ga0070692_100350142 422
649 3300005435 Ga0070714_100027069 Ga0070714_1000270694 422
650 3300005436 Ga0070713_100001768 Ga0070713_1000017685 422
651 3300005455 Ga0070663_100021139 Ga0070663_1000211394 422
652 3300005614 Ga0068856_100226350 Ga0068856_1002263502 422
653 3300005834 Ga0068851_10026780 Ga0068851_100267803 422
654 3300005841 Ga0068863_100000545 Ga0068863_10000054523 422
655 3300005842 Ga0068858_100000534 Ga0068858_1000005349 422
656 3300005843 Ga0068860_100000296 Ga0068860_10000029627 422
657 3300006175 Ga0070712_100044833 Ga0070712_1000448333 422
658 3300009551 Ga0105238_10009646 Ga0105238_100096465 422
659 3300010375 Ga0105239_10000050 Ga0105239_1000005011 422
660 3300010375 Ga0105239_10017060 Ga0105239_100170602 422
661 3300010375 Ga0105239_10072472 Ga0105239_100724723 422
662 3300013100 Ga0157373_10061996 Ga0157373_100619962 422
663 3300013307 Ga0157372_10054209 Ga0157372_100542094 422
664 3300014497 Ga0182008_10007892 Ga0182008_100078924 422
665 3300014969 Ga0157376_10063194 Ga0157376_100631942 422
666 3300015261 Ga0182006_1000427 Ga0182006_100042725 422
667 3300015262 Ga0182007_10038236 Ga0182007_100382362 422
668 3300015265 Ga0182005_1000686 Ga0182005_10006867 422
669 3300015687 Ga0183368_1004 Ga0183368_1004698 422
670 3300025207 Ga0209760_100572 Ga0209760_1005724 422
671 3300025224 Ga0209784_100013 Ga0209784_100013473 422
672 3300025226 Ga0209674_100063 Ga0209674_100063151 422
673 3300025226 Ga0209674_100898 Ga0209674_1008984 422
674 3300025228 Ga0209672_100107 Ga0209672_10010774 422
675 3300025228 Ga0209672_100253 Ga0209672_10025319 422
676 3300025228 Ga0209672_100742 Ga0209672_1007424 422
677 3300025231 Ga0207427_100021 Ga0207427_100021325 422
678 3300025231 Ga0207427_100030 Ga0207427_100030274 422
679 3300025231 Ga0207427_101510 Ga0207427_1015107 422
680 3300025233 Ga0209437_100012 Ga0209437_100012724 422
681 3300025233 Ga0209437_100150 Ga0209437_10015057 422
682 3300025233 Ga0209437_100416 Ga0209437_10041613 422
683 3300025242 Ga0209258_100019 Ga0209258_10001965 422
684 3300025242 Ga0209258_100045 Ga0209258_100045200 422
685 3300025242 Ga0209258_100299 Ga0209258_10029959 422
686 3300025242 Ga0209258_102767 Ga0209258_1027673 422
687 3300025242 Ga0209258_104796 Ga0209258_1047962 422
688 3300025246 Ga0209646_1000458 Ga0209646_100045813 422
689 3300025246 Ga0209646_1002167 Ga0209646_10021675 422
690 3300025250 Ga0209026_1000010 Ga0209026_1000010107 422
691 3300025250 Ga0209026_1000015 Ga0209026_1000015368 422
692 3300025250 Ga0209026_1000163 Ga0209026_100016326 422
693 3300025250 Ga0209026_1001325 Ga0209026_10013256 422
694 3300025250 Ga0209026_1003010 Ga0209026_10030104 422
695 3300025254 Ga0209148_1000001 Ga0209148_10000012235 422
696 3300025254 Ga0209148_1000005 Ga0209148_100000586 422
697 3300025254 Ga0209148_1000052 Ga0209148_1000052200 422
698 3300025254 Ga0209148_1000205 Ga0209148_100020579 422
699 3300025256 Ga0209759_1000023 Ga0209759_1000023232 422
700 3300025256 Ga0209759_1000622 Ga0209759_100062226 422
701 3300025256 Ga0209759_1002777 Ga0209759_10027773 422
702 3300025256 Ga0209759_1009864 Ga0209759_10098642 422
703 3300025261 Ga0209233_1000002 Ga0209233_100000265 422
704 3300025261 Ga0209233_1000023 Ga0209233_1000023297 422
705 3300025272 Ga0209455_1000027 Ga0209455_1000027481 422
706 3300025272 Ga0209455_1000081 Ga0209455_100008131 422
707 3300025272 Ga0209455_1013884 Ga0209455_10138842 422
708 3300025303 Ga0209051_1012497 Ga0209051_10124973 422
709 3300025904 Ga0207647_10006694 Ga0207647_100066942 422
710 3300025904 Ga0207647_10028042 Ga0207647_100280422 422
711 3300025909 Ga0207705_10072553 Ga0207705_100725532 422
712 3300025913 Ga0207695_10000198 Ga0207695_100001985 422
713 3300025913 Ga0207695_10001115 Ga0207695_1000111531 422
714 3300025919 Ga0207657_10027032 Ga0207657_100270325 422
715 3300025924 Ga0207694_10013173 Ga0207694_100131734 422
716 3300025928 Ga0207700_10001549 Ga0207700_100015497 422
717 3300025932 Ga0207690_10027106 Ga0207690_100271063 422
718 3300025949 Ga0207667_10022774 Ga0207667_100227744 422
719 3300025986 Ga0207658_10032772 Ga0207658_100327723 422
720 3300026035 Ga0207703_10000468 Ga0207703_100004685 422
721 3300026041 Ga0207639_10015933 Ga0207639_100159334 422
722 3300026067 Ga0207678_10044128 Ga0207678_100441284 422
723 3300026067 Ga0207678_10116742 Ga0207678_101167422 422
724 3300026067 Ga0207678_10160860 Ga0207678_101608602 422
725 3300026078 Ga0207702_10054129 Ga0207702_100541294 422
726 3300026088 Ga0207641_10000177 Ga0207641_1000017772 422
727 3300028379 Ga0268266_10096734 Ga0268266_100967342 422
728 3300028381 Ga0268264_10000088 Ga0268264_1000008887 422
729 3300028381 Ga0268264_10119972 Ga0268264_101199722 422
730 3300031911 Ga0307412_10000203 Ga0307412_100002039 422
731 3300033179 Ga0307507_10180361 Ga0307507_101803611 422
732 3300037312 Ga0395899_0000076 Ga0395899_0000076_116228_117547 422
733 3300037312 Ga0395899_0053722 Ga0395899_0053722_434_1753 422
734 3300037418 Ga0395900_0000018 Ga0395900_0000018_295872_297191 422
735 3300037466 Ga0395898_0000530 Ga0395898_0000530_55819_57138 422
736 3300037466 Ga0395898_0000612 Ga0395898_0000612_62981_64300 422
737 3300041404 Ga0439436_0000006 Ga0439436_0000006_72710_74029 422
738 3300041413 Ga0439465_0003108 Ga0439465_0003108_761_2080 422
739 3300042184 Ga0450908_000195 Ga0450908_000195_9331_10650 422
740 3300044661 Ga0466975_0171288 Ga0466975_0171288_116_1435 422
741 3300044672 Ga0466982_0000033 Ga0466982_0000033_34603_35922 422
742 3300044684 Ga0466966_0008164 Ga0466966_0008164_2751_4070 422
743 3300044684 Ga0466966_0016818 Ga0466966_0016818_756_2075 422
744 3300044693 Ga0466961_0002692 Ga0466961_0002692_1586_2905 422
745 3300044693 Ga0466961_0052920 Ga0466961_0052920_1047_2366 422
746 3300044719 Ga0466971_0037351 Ga0466971_0037351_685_2004 422
747 3300044765 Ga0466970_0002648 Ga0466970_0002648_5738_7057 422
748 3300044842 Ga0466957_0022896 Ga0466957_0022896_1945_3369 422
749 3300044842 Ga0466957_0041448 Ga0466957_0041448_1095_2414 422
750 3300045049 Ga0466959_0000043 Ga0466959_0000043_21690_23009 422
751 3300045976 Ga0466967_0051257 Ga0466967_0051257_1180_2499 422
752 3300046460 Ga0495638_0000009 Ga0495638_0000009_259823_261142 422
753 3300046460 Ga0495638_0000052 Ga0495638_0000052_181570_182889 422
754 3300046471 Ga0495650_0000122 Ga0495650_0000122_41723_43042 422
755 3300046492 Ga0495585_0000021 Ga0495585_0000021_126668_127987 422
756 3300046507 Ga0495606_0000056 Ga0495606_0000056_81326_82645 422
757 3300046512 Ga0495610_0001176 Ga0495610_0001176_11741_13060 422
758 3300046518 Ga0495631_0000060 Ga0495631_0000060_40237_41556 422
759 3300046524 Ga0495648_0000688 Ga0495648_0000688_7022_8341 422
760 3300046557 Ga0495622_0017292 Ga0495622_0017292_1182_2501 422
761 3300046660 Ga0495625_0006824 Ga0495625_0006824_6262_7581 422
762 3300046665 Ga0495661_0000353 Ga0495661_0000353_21041_22360 422
763 3300046691 Ga0495670_0001214 Ga0495670_0001214_4780_6099 422
764 3300046694 Ga0495649_0008985 Ga0495649_0008985_1139_2458 422
765 3300048903 Ga0496100_0063836 Ga0496100_0063836_523_1842 422
766 3300048910 Ga0496107_0040761 Ga0496107_0040761_309_1628 422
767 3300048916 Ga0496113_0013707 Ga0496113_0013707_3840_5159 422
768 3300048918 Ga0496115_0000013 Ga0496115_0000013_111939_113258 422
769 3300048918 Ga0496115_0000044 Ga0496115_0000044_1262_2581 422
770 3300048918 Ga0496115_0012558 Ga0496115_0012558_1498_2817 422
771 3300048918 Ga0496115_0033021 Ga0496115_0033021_1727_3046 422
772 3300048920 Ga0496117_0004227 Ga0496117_0004227_1475_2794 422
773 3300048920 Ga0496117_0008001 Ga0496117_0008001_5867_7186 422
774 3300048920 Ga0496117_0112324 Ga0496117_0112324_23_1342 422
775 3300048921 Ga0496118_0000636 Ga0496118_0000636_27831_29150 422
776 3300048921 Ga0496118_0000780 Ga0496118_0000780_34255_35574 422
777 3300048921 Ga0496118_0011987 Ga0496118_0011987_3953_5272 422
778 3300048922 Ga0496119_0000109 Ga0496119_0000109_86804_88123 422
779 3300048922 Ga0496119_0002080 Ga0496119_0002080_3648_4967 422
780 3300048923 Ga0496120_0000115 Ga0496120_0000115_58851_60170 422
781 3300048923 Ga0496120_0000150 Ga0496120_0000150_86805_88124 422
782 3300048924 Ga0496121_0000013 Ga0496121_0000013_127578_128897 422
783 3300048924 Ga0496121_0001215 Ga0496121_0001215_19205_20524 422
784 3300048925 Ga0496122_0009875 Ga0496122_0009875_7256_8575 422
785 3300048925 Ga0496122_0034775 Ga0496122_0034775_2489_3808 422
786 3300048926 Ga0496123_0003900 Ga0496123_0003900_7557_8876 422
787 3300048926 Ga0496123_0021655 Ga0496123_0021655_876_2195 422
788 3300048927 Ga0496124_0004659 Ga0496124_0004659_8724_10043 422
789 3300048927 Ga0496124_0004848 Ga0496124_0004848_5776_7095 422
790 3300048929 Ga0496126_0002275 Ga0496126_0002275_3856_5175 422
791 3300048929 Ga0496126_0014270 Ga0496126_0014270_4903_6222 422
792 3300049460 Ga0495682_0000253 Ga0495682_0000253_19474_20793 422
793 3300049580 Ga0501046_0010033 Ga0501046_0010033_1390_2709 422
794 3300049705 Ga0501225_0001420 Ga0501225_0001420_2218_3531 422
795 3300053730 Ga0500645_000125 Ga0500645_000125_31418_32737 422
796 3300003856 Ga0058692_1000054 Ga0058692_100005441 423
797 3300005439 Ga0070711_100183443 Ga0070711_1001834432 423
798 3300015265 Ga0182005_1003981 Ga0182005_10039812 423
799 3300025935 Ga0207709_10046937 Ga0207709_100469373 423
800 3300027312 Ga0209371_1000116 Ga0209371_100011655 423
801 3300030500 Ga0268256_1000099 Ga0268256_100009969 423
802 2162886007 SwRhRL2b_contig_764990 SwRhRL2b_0381.00004250 424
803 3300005289 Ga0065704_10074189 Ga0065704_100741892 424
804 3300005331 Ga0070670_100000709 Ga0070670_1000007097 424
805 3300005336 Ga0070680_100001573 Ga0070680_10000157313 424
806 3300005341 Ga0070691_10000632 Ga0070691_100006329 424
807 3300005458 Ga0070681_10000170 Ga0070681_1000017014 424
808 3300005530 Ga0070679_100000161 Ga0070679_10000016121 424
809 3300009011 Ga0105251_10000362 Ga0105251_1000036246 424
810 3300010375 Ga0105239_10101527 Ga0105239_101015273 424
811 3300025735 Ga0207713_1000429 Ga0207713_100042945 424
812 3300025912 Ga0207707_10000249 Ga0207707_1000024922 424
813 3300025917 Ga0207660_10001068 Ga0207660_100010685 424
814 3300025921 Ga0207652_10000134 Ga0207652_1000013423 424
815 3300025925 Ga0207650_10000841 Ga0207650_1000084110 424
816 3300028017 Ga0265356_1000505 Ga0265356_10005053 424
817 3300031090 Ga0265760_10008192 Ga0265760_100081922 424
818 3300041413 Ga0439465_0003000 Ga0439465_0003000_2485_3831 424
819 3300042004 Ga0439445_0003134 Ga0439445_0003134_996_2330 424
820 3300042007 Ga0439449_0000733 Ga0439449_0000733_1707_3035 424
821 3300042007 Ga0439449_0004079 Ga0439449_0004079_806_2152 424
822 3300047323 Ga0495683_0002632 Ga0495683_0002632_5057_6397 424
823 3300048917 Ga0496114_0033041 Ga0496114_0033041_736_2088 424
824 3300048918 Ga0496115_0168551 Ga0496115_0168551_292_1644 424
825 3300048920 Ga0496117_0034255 Ga0496117_0034255_1052_2371 424
826 3300048925 Ga0496122_0000049 Ga0496122_0000049_41386_42705 424
827 3300048926 Ga0496123_0000042 Ga0496123_0000042_211777_213096 424
828 3300048927 Ga0496124_0003222 Ga0496124_0003222_6742_8061 424

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02746

MR_MLE_N

Mandelate racemase / muconate lactonizing enzyme, N-terminal domain

68

176

0.96

PF13378

MR_MLE_C

Enolase C-terminal domain-like

240

457

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2hne-assembly1.cif.gz_A crystal structure of l-fuconate dehydratase from xanthomonas campestris pv. campestris str. atcc 33913 0.9891 1 419
1yey-assembly3.cif.gz_C crystal structure of l-fuconate dehydratase from xanthomonas campestris pv. campestris str. atcc 33913 0.9867 1 419
1yey-assembly6.cif.gz_A crystal structure of l-fuconate dehydratase from xanthomonas campestris pv. campestris str. atcc 33913 0.9867 1 419
1yey-assembly4.cif.gz_D crystal structure of l-fuconate dehydratase from xanthomonas campestris pv. campestris str. atcc 33913 0.9862 1 419
2hxu-assembly1.cif.gz_A-2 crystal structure of k220a mutant of l-fuconate dehydratase from xanthomonas campestris liganded with mg++ and l-fuconate 0.9842 3 419
ID Description Score Start End Superfamily
1yeyB02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Enolase-like C-terminal domain 0.9962 185 419 3.20.20.120
1yeyA02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Enolase-like C-terminal domain 0.9913 133 419 3.20.20.120
1yeyD01 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain 0.9587 3 178 3.30.390.10
1yeyD01 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain 0.9425 3 178 3.30.390.10
1yeyB02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Enolase-like C-terminal domain 0.9392 185 419 3.20.20.120
ID Description Score Start End GO Terms
AF-A0A0K2RLQ8-F1-model_v4 L-fuconate dehydratase 0.9948 293 419 GO:0000287
GO:0016052
GO:0016836
AF-A0A2V9TKP6-F1-model_v4 Fuconate dehydratase 0.9936 121 419 GO:0000287
GO:0009063
GO:0016052
GO:0016836
AF-J3HA68-F1-model_v4 deleted 0.9934 130 424
AF-A0A182H0H6-F1-model_v4 deleted 0.993 174 419
AF-A0A6I2V3N6-F1-model_v4 Fuconate dehydratase 0.9924 228 419 GO:0000287
GO:0009063
GO:0016052
GO:0016836

Feature Viewer

pLDDT pTM Quality
94.42 0.94 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map