F482413
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 825 | 546 | 543 | 158 |
Family's Representative Sequence
| Representative Sequence | 3300003775|Ga0055524_1039276|Ga0055524_10392762 |
| Length | 192 |
| Sequence | LRPASLRQFDRIRNDIGSFAVFKEFAGRKGELLMNIRVAHGDITGRIRSIVDDLRSLEGPLLPILHQIQEQFGYVPQEALPVISEELNLSRAEVHGVVTFYHDYRDHPAGRHVLKLCRAEACQSMGGDALAERIKALLGIDFHQTTLDGSVTLEPVYCLGLCACAPAVVLDGEVHGRVDGELAAELVAGARR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 2 | 2509276021 | Rhizobium leguminosarum bv. trifolii WSM597 | Isolate | Nodule |
| 3 | 2509276033 | Rhizobium leguminosarum bv. trifolii WSM2012 | Isolate | Nodule |
| 4 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 5 | 2510461069 | Rhizobium sp. PDO1-076 | Isolate | Rhizosphere |
| 6 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 7 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
| 8 | 2510917026 | Rhizobium sp. CF80 | Isolate | Rhizosphere |
| 9 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 10 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 11 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 12 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 13 | 2513237088 | Rhizobium mesoamericanum STM6155 | Isolate | Nodule |
| 14 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 15 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 16 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 17 | 2513237144 | Rhizobium sullae WSM1592 | Isolate | Nodule |
| 18 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 19 | 2513237159 | Rhizobium giardinii bv. giardinii H152 | Isolate | Nodule |
| 20 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 21 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 22 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 23 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 24 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 25 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 26 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 27 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 28 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 29 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 30 | 2519899620 | Rhizobium sp. Pop5 | Isolate | Nodule |
| 31 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 32 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 33 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 34 | 2537561587 | Agrobacterium tumefaciens Cherry 2E-2-2 | Isolate | Rhizosphere |
| 35 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 36 | 2582581283 | Rhizobium sp. OK665 | Isolate | Rhizosphere |
| 37 | 2582581294 | Rhizobium sp. CF394 | Isolate | Rhizosphere |
| 38 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 39 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 40 | 2582581306 | Rhizobium sp. YR295 | Isolate | Rhizosphere |
| 41 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 42 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 43 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 44 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 45 | 2582581865 | Rhizobium sp. CF258 | Isolate | Rhizosphere |
| 46 | 2582581866 | Rhizobium sp. CF097 | Isolate | Rhizosphere |
| 47 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 48 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 49 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 50 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 51 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 52 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 53 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 54 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 55 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 56 | 2585427594 | Rhizobium sp. YR528 | Isolate | Rhizosphere |
| 57 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 58 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 59 | 2585427633 | Neorhizobium galegae bv. officinalis HAMBI 1141 | Isolate | Nodule |
| 60 | 2585427634 | Neorhizobium galegae bv. orientalis HAMBI 540 | Isolate | Nodule |
| 61 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 62 | 2599185156 | Rhizobium sp. NFR03 | Isolate | Rhizoplane |
| 63 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 64 | 2599185236 | Rhizobium sp. NFR07 | Isolate | Rhizoplane |
| 65 | 2600254933 | Rhizobium sp. NFR12 | Isolate | Rhizoplane |
| 66 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 67 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 68 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 69 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 70 | 2643221558 | Rhizobium sp. Root149 | Isolate | Unclassified |
| 71 | 2643221568 | Rhizobium sp. Root564 | Isolate | Unclassified |
| 72 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 73 | 2643221607 | Rhizobium sp. Root73 | Isolate | Unclassified |
| 74 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 75 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 76 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 77 | 2643221636 | Rhizobium sp. Root1204 | Isolate | Unclassified |
| 78 | 2643221637 | Rhizobium sp. Root1212 | Isolate | Unclassified |
| 79 | 2643221643 | Rhizobium sp. Root1220 | Isolate | Unclassified |
| 80 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 81 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 82 | 2643221668 | Ensifer sp. Root423 | Isolate | Unclassified |
| 83 | 2643221686 | Rhizobium sp. Root1334 | Isolate | Unclassified |
| 84 | 2643221688 | Rhizobium sp. Root482 | Isolate | Unclassified |
| 85 | 2643221689 | Rhizobium sp. Root483D2 | Isolate | Unclassified |
| 86 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 87 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 88 | 2643221718 | Rhizobium sp. Root268 | Isolate | Unclassified |
| 89 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 90 | 2718217882 | Rhizobium sp. N741 | Isolate | Nodule |
| 91 | 2718217927 | Rhizobium sp. N324 | Isolate | Nodule |
| 92 | 2718217997 | Rhizobium phaseoli sv. phaseoli R723 | Isolate | Nodule |
| 93 | 2718218009 | Rhizobium sp. N561 | Isolate | Nodule |
| 94 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 95 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 96 | 2718218233 | Rhizobium phaseoli sv. phaseoli R744 | Isolate | Nodule |
| 97 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 98 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 99 | 2718218363 | Rhizobium sp. N113 | Isolate | Nodule |
| 100 | 2718218365 | Rhizobium sp. N731 | Isolate | Nodule |
| 101 | 2718218366 | Rhizobium sp. N621 | Isolate | Nodule |
| 102 | 2718218423 | Rhizobium sp. N941 | Isolate | Nodule |
| 103 | 2721755514 | Rhizobium sp. N6212 | Isolate | Nodule |
| 104 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 105 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 106 | 2721755685 | Rhizobium phaseoli sv. phaseoli R611 | Isolate | Nodule |
| 107 | 2721755809 | Rhizobium sp. N541 | Isolate | Nodule |
| 108 | 2721755810 | Rhizobium sp. N871 | Isolate | Nodule |
| 109 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 110 | 2721755822 | Rhizobium phaseoli sv. phaseoli R650 | Isolate | Nodule |
| 111 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 112 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 113 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 114 | 2728369365 | Rhizobium sp. N1341 | Isolate | Nodule |
| 115 | 2728369397 | Rhizobium sp. N1314 | Isolate | Nodule |
| 116 | 2738541293 | Rhizobium sp. GV031 | Isolate | Unclassified |
| 117 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 118 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 119 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 120 | 2791355094 | Sinorhizobium sp. BJ1 | Isolate | Nodule |
| 121 | 2791355256 | Rhizobium sp. M10 | Isolate | Nodule |
| 122 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 123 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 124 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 125 | 2791355262 | Rhizobium sp. M1 | Isolate | Nodule |
| 126 | 2791355263 | Rhizobium chutanense C5 | Isolate | Nodule |
| 127 | 2791355264 | Rhizobium sp. S9 | Isolate | Nodule |
| 128 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 129 | 2791355266 | Rhizobium sp. L43 | Isolate | Nodule |
| 130 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 131 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 132 | 2802429606 | Rhizobium sophoriradicis JJW1 | Isolate | Nodule |
| 133 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 134 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 135 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 136 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 137 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 138 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 139 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 140 | 2838016132 | Rhizobium phaseoli SEMIA 4071 | Isolate | Nodule |
| 141 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 142 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 143 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 144 | 2838042994 | Rhizobium esperanzae SEMIA 4089 | Isolate | Nodule |
| 145 | 2838048938 | Rhizobium pisi 27/80 | Isolate | Nodule |
| 146 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 147 | 2838068647 | Rhizobium esperanzae VC28 | Isolate | Nodule |
| 148 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 149 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 150 | 2838680041 | Rhizobium leguminosarum SEMIA 415 | Isolate | Nodule |
| 151 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 152 | 2838694306 | Rhizobium leguminosarum SEMIA 421 | Isolate | Nodule |
| 153 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 154 | 2838707686 | Rhizobium leguminosarum SEMIA 430 | Isolate | Nodule |
| 155 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 156 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 157 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 158 | 2841864319 | Rhizobium leguminosarum SEMIA 4052 | Isolate | Nodule |
| 159 | 2842077413 | Rhizobium leguminosarum SEMIA 422 | Isolate | Nodule |
| 160 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 161 | 2842118031 | Rhizobium esperanzae SEMIA 420 | Isolate | Nodule |
| 162 | 2842146304 | Rhizobium sophoriradicis SEMIA 454 | Isolate | Nodule |
| 163 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 164 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 165 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 166 | 2842192696 | Rhizobium esperanzae SEMIA 468 | Isolate | Nodule |
| 167 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 168 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 169 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 170 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 171 | 2842237096 | Rhizobium leguminosarum SEMIA 482 | Isolate | Nodule |
| 172 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 173 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 174 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 175 | 2842264693 | Rhizobium phaseoli SEMIA 487 | Isolate | Nodule |
| 176 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 177 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 178 | 2842285085 | Rhizobium lentis SEMIA 490 | Isolate | Nodule |
| 179 | 2842291075 | Rhizobium leguminosarum SEMIA 491 | Isolate | Nodule |
| 180 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 181 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 182 | 2842311132 | Rhizobium phaseoli SEMIA 4002 | Isolate | Nodule |
| 183 | 2842317721 | Rhizobium etli SEMIA 4004 | Isolate | Nodule |
| 184 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 185 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 186 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 187 | 2842370503 | Rhizobium leguminosarum SEMIA 4022 | Isolate | Nodule |
| 188 | 2842377471 | Rhizobium leguminosarum SEMIA 4024 | Isolate | Nodule |
| 189 | 2842384541 | Rhizobium leguminosarum SEMIA 4025 | Isolate | Nodule |
| 190 | 2842395702 | Rhizobium ecuadorense SEMIA 4029 | Isolate | Nodule |
| 191 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 192 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 193 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 194 | 2842422224 | Rhizobium esperanzae SEMIA 4042 | Isolate | Nodule |
| 195 | 2842428310 | Rhizobium phaseoli SEMIA 4050 | Isolate | Nodule |
| 196 | 2842434925 | Rhizobium esperanzae SEMIA 4051 | Isolate | Nodule |
| 197 | 2842441272 | Rhizobium esperanzae SEMIA 4053 | Isolate | Nodule |
| 198 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 199 | 2842462802 | Rhizobium phaseoli SEMIA 4057 | Isolate | Nodule |
| 200 | 2842469257 | Rhizobium phaseoli SEMIA 4058 | Isolate | Nodule |
| 201 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 202 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 203 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 204 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 205 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 206 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 207 | 2842521101 | Rhizobium giardinii SEMIA 4084 | Isolate | Nodule |
| 208 | 2842922631 | Pararhizobium sp. R-72066 | Isolate | Unclassified |
| 209 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 210 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 211 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 212 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 213 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 214 | 2891373044 | Shinella sp. AETb1-6 | Isolate | Rhizosphere |
| 215 | 2899275550 | Paracoccus hibiscisoli CCTCC AB2016182 | Isolate | Rhizosphere |
| 216 | 2899803654 | Agrobacterium sp. a22-2 | Isolate | Unclassified |
| 217 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 218 | 2919166419 | Agrobacterium cavarae 2074 | Isolate | Unclassified |
| 219 | 2919171160 | Neorhizobium sp. 2083 | Isolate | Unclassified |
| 220 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 221 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 222 | 2933016740 | Rhizobium sp. SEMIA 4085 | Isolate | Nodule |
| 223 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 224 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 225 | 2933599457 | Rhizobium phaseoli M3 | Isolate | Nodule |
| 226 | 2935894831 | Rhizobium leguminosarum SEMIA 419 | Isolate | Nodule |
| 227 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 228 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 229 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 230 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 231 | 2978969890 | Agrobacterium sp. SORGH_AS 787 | Isolate | Unclassified |
| 232 | 2984587000 | Agrobacterium larrymoorei SORGH_AS974 | Isolate | Aerial Root |
| 233 | 2996310559 | Mesorhizobium zhangyense CGMCC 1.15528 | Isolate | Unclassified |
| 234 | 2996887358 | Rhizobium sp. R711 | Isolate | Nodule |
| 235 | 2996893221 | Rhizobium sp. R635 | Isolate | Nodule |
| 236 | 3003930520 | Sinorhizobium sp. BG8 | Isolate | Unclassified |
| 237 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 238 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 239 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 240 | 3005452660 | Rhizobium grahamii BG7 | Isolate | Unclassified |
| 241 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 242 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 243 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 244 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 245 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 246 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 247 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 248 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 249 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 250 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 251 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 252 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 253 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 254 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 255 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 256 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 257 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 258 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 259 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 260 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 261 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 262 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 263 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 264 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 265 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 266 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 267 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 268 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 269 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 270 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 271 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 272 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 273 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 274 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 275 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 276 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 277 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 278 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 279 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 280 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 281 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 282 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 283 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 284 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 285 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 286 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 287 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 288 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 289 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 290 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 291 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 292 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 293 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 294 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 295 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 296 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 297 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 298 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 299 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 300 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 301 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 302 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 303 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 304 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 305 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 306 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 307 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 308 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 309 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 310 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 311 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 312 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 313 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 314 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 315 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 316 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 317 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 318 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 319 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 320 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 321 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 322 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 323 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 324 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 325 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 326 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 327 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 328 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 329 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 330 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 331 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 332 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 333 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 334 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 335 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 336 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 337 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 338 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 339 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 340 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 341 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 342 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 343 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 344 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 345 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 346 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 347 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 348 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 349 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 350 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 351 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 352 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 353 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 354 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 355 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 356 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 357 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 358 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 359 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 360 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 361 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 362 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 363 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 364 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 365 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 366 | 3300041497 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT | Metatranscriptome | Unclassified |
| 367 | 3300041502 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT | Metatranscriptome | Unclassified |
| 368 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 369 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 370 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 371 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 372 | 3300041510 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaT | Metatranscriptome | Unclassified |
| 373 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 374 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 375 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 376 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 377 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 378 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 379 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 380 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 381 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 382 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 383 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 384 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 385 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 386 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 387 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 388 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 428 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 429 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 430 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 431 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 432 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 433 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 434 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 435 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 436 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 437 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 438 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 439 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 440 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 441 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 442 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 443 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 444 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 445 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 446 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 447 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 448 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 451 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 452 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 453 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 454 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 455 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 456 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 457 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 458 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 459 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 460 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 461 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 462 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 463 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 464 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 465 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 466 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 467 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 468 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 469 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 470 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 471 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 472 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 473 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 474 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 475 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 476 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 477 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 478 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 479 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 480 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 481 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 482 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 483 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 484 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 485 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 486 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 487 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 488 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 489 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 490 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 491 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 492 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 493 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 494 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 495 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 496 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 497 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 498 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 499 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 500 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 501 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 502 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 503 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 504 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 505 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 506 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 507 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 508 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 509 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 510 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 511 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 512 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 513 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 514 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 515 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 516 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 517 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 518 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 519 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 520 | 8005497431 | Rhizobium phaseoli CCGM8 | Isolate | Unclassified |
| 521 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 522 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 523 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 524 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 525 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 526 | 8005626139 | Rhizobium phaseoli Y18 | Isolate | Nodule |
| 527 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 528 | 8005658619 | Rhizobium terrae CC-HIH110 | Isolate | Unclassified |
| 529 | 8005668836 | Rhizobium phaseoli CCGM9 | Isolate | Unclassified |
| 530 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 531 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 532 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 533 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 534 | 8018150411 | Rhizobium straminoryzae SM12 | Isolate | Rhizosphere |
| 535 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 536 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
| 537 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 538 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 539 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 540 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 541 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 542 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
| 543 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
| 544 | 8056875544 | Rhizobium halophilum TRM95001 | Isolate | Rhizosphere |
| 545 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
| 546 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 65.09 |
| Metatranscriptomes | 0.73 |
| Isolates | 34.18 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.12 |
| Bulb | 0 |
| Endosphere | 21.09 |
| Nodule | 23.15 |
| Rhizoplane | 2.91 |
| Rhizosphere | 33.94 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 18.79 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10000066 | 3300001979 | Bacteria | 34178 |
| 2 | JGI24739J22299_10144511 | 3300001989 | Bacteria | 704 |
| 3 | JGI25155J39150_1000010 | 3300002704 | Bacteria | 207717 |
| 4 | JGI25156J39149_1000033 | 3300002705 | Bacteria | 114688 |
| 5 | JGI25162J39368_1002132 | 3300002737 | Bacteria | 8355 |
| 6 | JGI25154J39366_1000058 | 3300002738 | Bacteria | 107363 |
| 7 | JGI25158J39367_1000039 | 3300002739 | Bacteria | 29889 |
| 8 | JGI25157J39369_1000009 | 3300002741 | Bacteria | 207868 |
| 9 | JGI25152J39213_1003798 | 3300002773 | Bacteria | 5011 |
| 10 | JGI25152J39213_1025070 | 3300002773 | Bacteria | 993 |
| 11 | JGI25150J39212_1000028 | 3300002774 | Bacteria | 105831 |
| 12 | JGI25150J39212_1002370 | 3300002774 | Bacteria | 4724 |
| 13 | JGI25150J39212_1029801 | 3300002774 | Bacteria | 763 |
| 14 | JGI25159J45721_1000241 | 3300002987 | Bacteria | 25864 |
| 15 | JGI25159J45721_1002399 | 3300002987 | Bacteria | 7137 |
| 16 | JGI25151J46595_10000123 | 3300003187 | Bacteria | 105339 |
| 17 | JGI25151J46595_10003986 | 3300003187 | Bacteria | 7937 |
| 18 | JGI25151J46595_10004252 | 3300003187 | Bacteria | 7616 |
| 19 | JGI25151J46595_10016106 | 3300003187 | Bacteria | 3276 |
| 20 | JGI25165J46597_1000935 | 3300003214 | Bacteria | 20060 |
| 21 | JGI25165J46597_1000949 | 3300003214 | Bacteria | 19837 |
| 22 | JGI25153J46596_10001187 | 3300003215 | Bacteria | 15732 |
| 23 | JGI25153J46596_10004401 | 3300003215 | Bacteria | 7603 |
| 24 | JGI25153J46596_10007873 | 3300003215 | Bacteria | 5173 |
| 25 | JGI25153J46596_10020184 | 3300003215 | Bacteria | 2526 |
| 26 | rootH1_10044838 | 3300003316 | Bacteria | 3652 |
| 27 | rootH1_10052753 | 3300003316 | Bacteria | 1159 |
| 28 | rootL2_10057936 | 3300003322 | Bacteria | 2824 |
| 29 | rootL2_10158058 | 3300003322 | Bacteria | 1122 |
| 30 | rootH1_10096654 | 3300003323 | Bacteria | 1571 |
| 31 | rootH1_10130547 | 3300003323 | Bacteria | 4076 |
| 32 | rootH1_10203432 | 3300003323 | Bacteria | 1961 |
| 33 | rootH1_10228777 | 3300003323 | Bacteria | 1570 |
| 34 | rootH1_10228778 | 3300003323 | Bacteria | 1382 |
| 35 | JGI25160J50197_1000214 | 3300003354 | Bacteria | 47126 |
| 36 | JGI25160J50197_1007275 | 3300003354 | Bacteria | 4352 |
| 37 | JGI25160J50197_1009767 | 3300003354 | Bacteria | 3527 |
| 38 | JGI25161J50226_1000158 | 3300003374 | Bacteria | 47126 |
| 39 | JGI25161J50226_1000537 | 3300003374 | Bacteria | 16251 |
| 40 | JGI25161J50226_1006184 | 3300003374 | Bacteria | 2206 |
| 41 | Ga0055526_1002383 | 3300003771 | Bacteria | 12740 |
| 42 | Ga0055526_1013480 | 3300003771 | Bacteria | 3452 |
| 43 | Ga0055526_1016937 | 3300003771 | Bacteria | 2815 |
| 44 | Ga0055524_1000988 | 3300003775 | Bacteria | 17749 |
| 45 | Ga0055524_1008246 | 3300003775 | Bacteria | 4342 |
| 46 | Ga0055524_1020400 | 3300003775 | Bacteria | 2233 |
| 47 | Ga0055524_1039276 | 3300003775 | Bacteria | 1224 |
| 48 | Ga0055524_1045703 | 3300003775 | Bacteria | 1050 |
| 49 | Ga0055528_1000842 | 3300003790 | Bacteria | 20898 |
| 50 | Ga0055528_1004809 | 3300003790 | Bacteria | 6426 |
| 51 | Ga0055528_1006582 | 3300003790 | Bacteria | 5257 |
| 52 | Ga0055528_1008361 | 3300003790 | Bacteria | 4447 |
| 53 | Ga0055528_1012908 | 3300003790 | Bacteria | 3205 |
| 54 | Ga0055530_10024053 | 3300003791 | Bacteria | 1737 |
| 55 | Ga0055540_1000481 | 3300003792 | Bacteria | 30719 |
| 56 | Ga0055540_1012734 | 3300003792 | Bacteria | 2617 |
| 57 | Ga0055540_1054951 | 3300003792 | Bacteria | 810 |
| 58 | Ga0055531_10010151 | 3300003794 | Bacteria | 4720 |
| 59 | Ga0055543_1000099 | 3300004625 | Bacteria | 74883 |
| 60 | Ga0055543_1000639 | 3300004625 | Bacteria | 18724 |
| 61 | Ga0055543_1002383 | 3300004625 | Bacteria | 6258 |
| 62 | Ga0065165_1000575 | 3300005262 | Bacteria | 54383 |
| 63 | Ga0065165_1003905 | 3300005262 | Bacteria | 9848 |
| 64 | Ga0065165_1012374 | 3300005262 | Bacteria | 3479 |
| 65 | Ga0065165_1012576 | 3300005262 | Bacteria | 3434 |
| 66 | Ga0065165_1040894 | 3300005262 | Bacteria | 1379 |
| 67 | Ga0070669_100470113 | 3300005353 | Bacteria | 1039 |
| 68 | Ga0070667_100168895 | 3300005367 | Bacteria | 1930 |
| 69 | Ga0068853_100285895 | 3300005539 | Bacteria | 1521 |
| 70 | Ga0070665_100006251 | 3300005548 | Bacteria | 12182 |
| 71 | Ga0070665_100212438 | 3300005548 | Bacteria | 1935 |
| 72 | Ga0068857_100614481 | 3300005577 | Bacteria | 1028 |
| 73 | Ga0068856_100110337 | 3300005614 | Bacteria | 2748 |
| 74 | Ga0068856_100380891 | 3300005614 | Bacteria | 1430 |
| 75 | Ga0068852_100138863 | 3300005616 | Bacteria | 2247 |
| 76 | Ga0081540_1045243 | 3300005983 | Bacteria | 2238 |
| 77 | Ga0075365_10000978 | 3300006038 | Bacteria | 12183 |
| 78 | Ga0075365_10278760 | 3300006038 | Bacteria | 1176 |
| 79 | Ga0075363_100053454 | 3300006048 | Bacteria | 2158 |
| 80 | Ga0075363_100553835 | 3300006048 | Bacteria | 686 |
| 81 | Ga0075362_10024800 | 3300006177 | Bacteria | 2546 |
| 82 | Ga0075362_10230894 | 3300006177 | Bacteria | 906 |
| 83 | Ga0075362_10759680 | 3300006177 | Bacteria | 508 |
| 84 | Ga0075367_10016233 | 3300006178 | Bacteria | 4065 |
| 85 | Ga0075367_10337706 | 3300006178 | Bacteria | 950 |
| 86 | Ga0075369_10101503 | 3300006186 | Bacteria | 1291 |
| 87 | Ga0075369_10138022 | 3300006186 | Bacteria | 1110 |
| 88 | Ga0075369_10138357 | 3300006186 | Bacteria | 1109 |
| 89 | Ga0075369_10213038 | 3300006186 | Bacteria | 893 |
| 90 | Ga0075370_10000922 | 3300006353 | Bacteria | 12070 |
| 91 | Ga0075370_10020528 | 3300006353 | Bacteria | 3613 |
| 92 | Ga0075370_10410697 | 3300006353 | Bacteria | 813 |
| 93 | Ga0075370_10533563 | 3300006353 | Bacteria | 709 |
| 94 | Ga0075370_10942811 | 3300006353 | Bacteria | 528 |
| 95 | Ga0105240_10000013 | 3300009093 | Bacteria | 483458 |
| 96 | Ga0105240_10188595 | 3300009093 | Bacteria | 2426 |
| 97 | Ga0105240_10723746 | 3300009093 | Bacteria | 1084 |
| 98 | Ga0105247_10044821 | 3300009101 | Bacteria | 2713 |
| 99 | Ga0105237_10003586 | 3300009545 | Bacteria | 18364 |
| 100 | Ga0105237_10282511 | 3300009545 | Bacteria | 1662 |
| 101 | Ga0105237_10674156 | 3300009545 | Bacteria | 1041 |
| 102 | Ga0105238_10345965 | 3300009551 | Bacteria | 1475 |
| 103 | Ga0123341_1014142 | 3300009765 | Bacteria | 7168 |
| 104 | Ga0123342_1012798 | 3300009766 | Bacteria | 8618 |
| 105 | Ga0123342_1016598 | 3300009766 | Bacteria | 6364 |
| 106 | Ga0105239_10005948 | 3300010375 | Bacteria | 14196 |
| 107 | Ga0105239_10839219 | 3300010375 | Bacteria | 1053 |
| 108 | Ga0157326_1031162 | 3300012513 | Bacteria | 707 |
| 109 | Ga0157371_10022144 | 3300013102 | Bacteria | 4661 |
| 110 | Ga0157370_10000209 | 3300013104 | Bacteria | 74351 |
| 111 | Ga0157369_10202346 | 3300013105 | Bacteria | 2084 |
| 112 | Ga0157369_10228530 | 3300013105 | Bacteria | 1946 |
| 113 | Ga0157372_10697990 | 3300013307 | Bacteria | 1181 |
| 114 | Ga0157379_10145466 | 3300014968 | Bacteria | 2138 |
| 115 | Ga0182007_10003149 | 3300015262 | Bacteria | 7919 |
| 116 | Ga0182005_1003085 | 3300015265 | Bacteria | 5746 |
| 117 | Ga0163161_10522041 | 3300017792 | Bacteria | 970 |
| 118 | Ga0209435_100009 | 3300025206 | Bacteria | 476614 |
| 119 | Ga0209436_101288 | 3300025208 | Bacteria | 8944 |
| 120 | Ga0209672_105717 | 3300025228 | Bacteria | 2103 |
| 121 | Ga0209437_100057 | 3300025233 | Bacteria | 362922 |
| 122 | Ga0209437_100107 | 3300025233 | Bacteria | 218656 |
| 123 | Ga0209437_105749 | 3300025233 | Bacteria | 2099 |
| 124 | Ga0207425_1000077 | 3300025245 | Bacteria | 105391 |
| 125 | Ga0207425_1005700 | 3300025245 | Bacteria | 3512 |
| 126 | Ga0209646_1000018 | 3300025246 | Bacteria | 476716 |
| 127 | Ga0209646_1007130 | 3300025246 | Bacteria | 1842 |
| 128 | Ga0209026_1000068 | 3300025250 | Bacteria | 207601 |
| 129 | Ga0209677_100309 | 3300025253 | Bacteria | 31966 |
| 130 | Ga0209759_1000007 | 3300025256 | Bacteria | 476614 |
| 131 | Ga0209129_1000036 | 3300025258 | Bacteria | 328331 |
| 132 | Ga0209129_1000118 | 3300025258 | Bacteria | 139972 |
| 133 | Ga0209129_1002381 | 3300025258 | Bacteria | 9254 |
| 134 | Ga0209129_1004334 | 3300025258 | Bacteria | 5599 |
| 135 | Ga0209129_1010005 | 3300025258 | Bacteria | 2415 |
| 136 | Ga0209233_1000072 | 3300025261 | Bacteria | 363074 |
| 137 | Ga0209233_1000134 | 3300025261 | Bacteria | 202535 |
| 138 | Ga0209233_1000440 | 3300025261 | Bacteria | 28932 |
| 139 | Ga0209673_1000052 | 3300025273 | Bacteria | 279795 |
| 140 | Ga0209673_1000158 | 3300025273 | Bacteria | 143067 |
| 141 | Ga0209673_1000459 | 3300025273 | Bacteria | 68727 |
| 142 | Ga0209673_1000997 | 3300025273 | Bacteria | 34532 |
| 143 | Ga0209673_1007484 | 3300025273 | Bacteria | 5021 |
| 144 | Ga0209673_1009902 | 3300025273 | Bacteria | 4075 |
| 145 | Ga0209673_1032225 | 3300025273 | Bacteria | 1617 |
| 146 | Ga0209673_1038068 | 3300025273 | Bacteria | 1405 |
| 147 | Ga0209673_1063126 | 3300025273 | Bacteria | 915 |
| 148 | Ga0209130_1000009 | 3300025284 | Bacteria | 498952 |
| 149 | Ga0209130_1000132 | 3300025284 | Bacteria | 119765 |
| 150 | Ga0209130_1028390 | 3300025284 | Bacteria | 1176 |
| 151 | Ga0209675_1022813 | 3300025291 | Bacteria | 1636 |
| 152 | Ga0209676_1004018 | 3300025292 | Bacteria | 8470 |
| 153 | Ga0209676_1024673 | 3300025292 | Bacteria | 1941 |
| 154 | Ga0209025_1000245 | 3300025294 | Bacteria | 127801 |
| 155 | Ga0209025_1000329 | 3300025294 | Bacteria | 105391 |
| 156 | Ga0209025_1000617 | 3300025294 | Bacteria | 63860 |
| 157 | Ga0209025_1000871 | 3300025294 | Bacteria | 47697 |
| 158 | Ga0209025_1002194 | 3300025294 | Bacteria | 21614 |
| 159 | Ga0209564_1000569 | 3300025295 | Bacteria | 58592 |
| 160 | Ga0209564_1000675 | 3300025295 | Bacteria | 50429 |
| 161 | Ga0209564_1001411 | 3300025295 | Bacteria | 24774 |
| 162 | Ga0209564_1002048 | 3300025295 | Bacteria | 17370 |
| 163 | Ga0209758_1000259 | 3300025297 | Bacteria | 105391 |
| 164 | Ga0209758_1000323 | 3300025297 | Bacteria | 92123 |
| 165 | Ga0209758_1000948 | 3300025297 | Bacteria | 39099 |
| 166 | Ga0209758_1003501 | 3300025297 | Bacteria | 14180 |
| 167 | Ga0209758_1005770 | 3300025297 | Bacteria | 9291 |
| 168 | Ga0209758_1007164 | 3300025297 | Bacteria | 7693 |
| 169 | Ga0209758_1007169 | 3300025297 | Bacteria | 7690 |
| 170 | Ga0209050_1003683 | 3300025298 | Bacteria | 11051 |
| 171 | Ga0209050_1004202 | 3300025298 | Bacteria | 9958 |
| 172 | Ga0209256_1001406 | 3300025299 | Bacteria | 25009 |
| 173 | Ga0209256_1001526 | 3300025299 | Bacteria | 23315 |
| 174 | Ga0209256_1001728 | 3300025299 | Bacteria | 20930 |
| 175 | Ga0209256_1009743 | 3300025299 | Bacteria | 4149 |
| 176 | Ga0209256_1012230 | 3300025299 | Bacteria | 3318 |
| 177 | Ga0209256_1051104 | 3300025299 | Bacteria | 999 |
| 178 | Ga0207426_1000041 | 3300025302 | Bacteria | 433536 |
| 179 | Ga0207426_1000246 | 3300025302 | Bacteria | 119765 |
| 180 | Ga0207426_1000761 | 3300025302 | Bacteria | 35881 |
| 181 | Ga0209051_1000863 | 3300025303 | Bacteria | 30781 |
| 182 | Ga0209051_1000871 | 3300025303 | Bacteria | 30516 |
| 183 | Ga0209051_1018016 | 3300025303 | Bacteria | 3140 |
| 184 | Ga0209051_1074658 | 3300025303 | Bacteria | 1004 |
| 185 | Ga0209257_1002861 | 3300025304 | Bacteria | 16111 |
| 186 | Ga0209257_1006330 | 3300025304 | Bacteria | 7698 |
| 187 | Ga0209257_1026753 | 3300025304 | Bacteria | 1935 |
| 188 | Ga0209257_1086265 | 3300025304 | Bacteria | 794 |
| 189 | Ga0207654_10103960 | 3300025911 | Bacteria | 1755 |
| 190 | Ga0207695_10000044 | 3300025913 | Bacteria | 440819 |
| 191 | Ga0207695_10054872 | 3300025913 | Bacteria | 4157 |
| 192 | Ga0207695_10135283 | 3300025913 | Bacteria | 2418 |
| 193 | Ga0207695_10744198 | 3300025913 | Unclassified | 861 |
| 194 | Ga0207671_10000226 | 3300025914 | Bacteria | 84886 |
| 195 | Ga0207671_10339929 | 3300025914 | Bacteria | 1189 |
| 196 | Ga0207681_10087654 | 3300025923 | Bacteria | 2215 |
| 197 | Ga0207694_10366022 | 3300025924 | Bacteria | 1195 |
| 198 | Ga0207664_10990612 | 3300025929 | Bacteria | 753 |
| 199 | Ga0207709_10243111 | 3300025935 | Bacteria | 1310 |
| 200 | Ga0207667_10431503 | 3300025949 | Bacteria | 1340 |
| 201 | Ga0207668_10605294 | 3300025972 | Bacteria | 955 |
| 202 | Ga0207658_10086035 | 3300025986 | Bacteria | 2423 |
| 203 | Ga0207702_10087884 | 3300026078 | Bacteria | 2715 |
| 204 | Ga0207698_10082011 | 3300026142 | Bacteria | 2606 |
| 205 | Ga0207698_10586597 | 3300026142 | Bacteria | 1097 |
| 206 | Ga0209371_1031992 | 3300027312 | Bacteria | 1135 |
| 207 | Ga0268266_10116451 | 3300028379 | Bacteria | 2373 |
| 208 | Ga0268266_10189212 | 3300028379 | Bacteria | 1878 |
| 209 | Ga0268266_10776527 | 3300028379 | Bacteria | 925 |
| 210 | Ga0268266_11788887 | 3300028379 | Bacteria | 589 |
| 211 | Ga0307515_10000377 | 3300028794 | Bacteria | 109082 |
| 212 | Ga0307515_10001840 | 3300028794 | Bacteria | 47276 |
| 213 | Ga0307515_10013206 | 3300028794 | Bacteria | 15453 |
| 214 | Ga0268256_1036395 | 3300030500 | Bacteria | 1135 |
| 215 | Ga0307513_10002147 | 3300031456 | Bacteria | 27587 |
| 216 | Ga0307513_10023038 | 3300031456 | Bacteria | 7289 |
| 217 | Ga0307408_100035018 | 3300031548 | Bacteria | 3521 |
| 218 | Ga0307408_100287431 | 3300031548 | Bacteria | 1372 |
| 219 | Ga0307406_10003800 | 3300031901 | Bacteria | 8220 |
| 220 | Ga0307412_10001541 | 3300031911 | Bacteria | 12737 |
| 221 | Ga0307412_10175757 | 3300031911 | Bacteria | 1605 |
| 222 | Ga0307409_100144544 | 3300031995 | Bacteria | 2055 |
| 223 | Ga0307416_101605593 | 3300032002 | Bacteria | 755 |
| 224 | Ga0307414_10068133 | 3300032004 | Bacteria | 2552 |
| 225 | Ga0307411_10802872 | 3300032005 | Bacteria | 829 |
| 226 | Ga0316593_10223636 | 3300032168 | Bacteria | 700 |
| 227 | Ga0373935_0446794 | 3300035692 | Unclassified | 933 |
| 228 | Ga0373927_0000074 | 3300035695 | Bacteria | 72943 |
| 229 | Ga0316582_0119491 | 3300036647 | Bacteria | 1762 |
| 230 | Ga0316584_0336126 | 3300036712 | Bacteria | 1087 |
| 231 | Ga0373925_0001779 | 3300037068 | Bacteria | 17996 |
| 232 | Ga0395899_0000014 | 3300037312 | Bacteria | 488813 |
| 233 | Ga0395900_0000007 | 3300037418 | Bacteria | 488860 |
| 234 | Ga0395898_0000011 | 3300037466 | Bacteria | 488860 |
| 235 | Ga0395905_0000008 | 3300037471 | Bacteria | 488860 |
| 236 | Ga0395901_0000048 | 3300038443 | Bacteria | 174069 |
| 237 | Ga0436363_1518595 | 3300039450 | Bacteria | 996 |
| 238 | Ga0439436_0008125 | 3300041404 | Bacteria | 3225 |
| 239 | Ga0439436_0010490 | 3300041404 | Bacteria | 2824 |
| 240 | Ga0439439_0067584 | 3300041406 | Bacteria | 954 |
| 241 | Ga0439461_0075817 | 3300041410 | Bacteria | 786 |
| 242 | Ga0439466_0072559 | 3300041411 | Bacteria | 1094 |
| 243 | Ga0439466_0080227 | 3300041411 | Bacteria | 1030 |
| 244 | Ga0439465_0004431 | 3300041413 | Bacteria | 4545 |
| 245 | Ga0439465_0009619 | 3300041413 | Bacteria | 3044 |
| 246 | Ga0439465_0027912 | 3300041413 | Bacteria | 1789 |
| 247 | Ga0439465_0124697 | 3300041413 | Bacteria | 905 |
| 248 | Ga0451789_0976999 | 3300041443 | Bacteria | 537 |
| 249 | Ga0451795_0141812 | 3300041456 | Bacteria | 1134 |
| 250 | Ga0451833_0233035 | 3300041491 | Bacteria | 1245 |
| 251 | Ga0451837_0488831 | 3300041494 | Bacteria | 661 |
| 252 | Ga0451837_1525209 | 3300041494 | Bacteria | 1158 |
| 253 | Ga0451840_08834 | 3300041497 | Bacteria | 669 |
| 254 | Ga0451846_08075 | 3300041502 | Bacteria | 1032 |
| 255 | Ga0451847_0854739 | 3300041503 | Bacteria | 898 |
| 256 | Ga0451849_1020839 | 3300041505 | Bacteria | 651 |
| 257 | Ga0451849_1110510 | 3300041505 | Bacteria | 781 |
| 258 | Ga0451851_0128736 | 3300041507 | Bacteria | 982 |
| 259 | Ga0451843_0376551 | 3300041509 | Bacteria | 1252 |
| 260 | Ga0451854_35136 | 3300041510 | Bacteria | 956 |
| 261 | Ga0451855_0299216 | 3300041511 | Bacteria | 2641 |
| 262 | Ga0451855_1181368 | 3300041511 | Bacteria | 662 |
| 263 | Ga0439431_0190831 | 3300041997 | Bacteria | 594 |
| 264 | Ga0439433_0055096 | 3300041999 | Bacteria | 941 |
| 265 | Ga0439445_0008840 | 3300042004 | Bacteria | 2366 |
| 266 | Ga0439445_0170173 | 3300042004 | Bacteria | 638 |
| 267 | Ga0439432_081275 | 3300042006 | Bacteria | 981 |
| 268 | Ga0439449_0020678 | 3300042007 | Bacteria | 2466 |
| 269 | Ga0439449_0057537 | 3300042007 | Bacteria | 1435 |
| 270 | Ga0439449_0100535 | 3300042007 | Bacteria | 1069 |
| 271 | Ga0439449_0168354 | 3300042007 | Bacteria | 818 |
| 272 | Ga0439457_034662 | 3300042014 | Bacteria | 1122 |
| 273 | Ga0439457_069883 | 3300042014 | Bacteria | 800 |
| 274 | Ga0439462_0005625 | 3300042015 | Bacteria | 3095 |
| 275 | Ga0439462_0055602 | 3300042015 | Bacteria | 1068 |
| 276 | Ga0450906_004354 | 3300042145 | Bacteria | 2968 |
| 277 | Ga0450918_003289 | 3300042531 | Bacteria | 3016 |
| 278 | Ga0466963_0187220 | 3300044694 | Bacteria | 1446 |
| 279 | Ga0466968_0017396 | 3300044735 | Bacteria | 2873 |
| 280 | Ga0466970_0143154 | 3300044765 | Bacteria | 1318 |
| 281 | Ga0466957_0153228 | 3300044842 | Bacteria | 1492 |
| 282 | Ga0466967_0435537 | 3300045976 | Bacteria | 1279 |
| 283 | Ga0466967_0664129 | 3300045976 | Bacteria | 1031 |
| 284 | Ga0466967_0857643 | 3300045976 | Bacteria | 903 |
| 285 | Ga0495617_005988 | 3300046452 | Bacteria | 4290 |
| 286 | Ga0495590_0015070 | 3300046457 | Bacteria | 2813 |
| 287 | Ga0495590_0051291 | 3300046457 | Bacteria | 1441 |
| 288 | Ga0495638_0002531 | 3300046460 | Bacteria | 14872 |
| 289 | Ga0495638_0024159 | 3300046460 | Bacteria | 3966 |
| 290 | Ga0495638_0094981 | 3300046460 | Bacteria | 1791 |
| 291 | Ga0495650_0118103 | 3300046471 | Bacteria | 978 |
| 292 | Ga0495605_0000839 | 3300046474 | Bacteria | 21527 |
| 293 | Ga0495662_0161966 | 3300046476 | Bacteria | 1102 |
| 294 | Ga0495585_0014511 | 3300046492 | Bacteria | 4587 |
| 295 | Ga0495585_0016074 | 3300046492 | Bacteria | 4338 |
| 296 | Ga0495607_0202514 | 3300046501 | Bacteria | 981 |
| 297 | Ga0495607_0365179 | 3300046501 | Bacteria | 663 |
| 298 | Ga0495583_0090651 | 3300046506 | Bacteria | 1316 |
| 299 | Ga0495583_0160053 | 3300046506 | Bacteria | 929 |
| 300 | Ga0495606_0001947 | 3300046507 | Bacteria | 25522 |
| 301 | Ga0495606_0023345 | 3300046507 | Bacteria | 4483 |
| 302 | Ga0495606_0046527 | 3300046507 | Bacteria | 2867 |
| 303 | Ga0495606_0237906 | 3300046507 | Bacteria | 1017 |
| 304 | Ga0495610_0102043 | 3300046512 | Bacteria | 1283 |
| 305 | Ga0495616_0035921 | 3300046513 | Bacteria | 2560 |
| 306 | Ga0495616_0090409 | 3300046513 | Bacteria | 1450 |
| 307 | Ga0495620_0020443 | 3300046515 | Bacteria | 3233 |
| 308 | Ga0495620_0052602 | 3300046515 | Bacteria | 1729 |
| 309 | Ga0495620_0064385 | 3300046515 | Bacteria | 1516 |
| 310 | Ga0495631_0000375 | 3300046518 | Bacteria | 30704 |
| 311 | Ga0495632_0006798 | 3300046519 | Bacteria | 7299 |
| 312 | Ga0495643_0022175 | 3300046522 | Bacteria | 3627 |
| 313 | Ga0495643_0025967 | 3300046522 | Bacteria | 3310 |
| 314 | Ga0495643_0138843 | 3300046522 | Bacteria | 1214 |
| 315 | Ga0495648_0091482 | 3300046524 | Bacteria | 1702 |
| 316 | Ga0495648_0107718 | 3300046524 | Bacteria | 1523 |
| 317 | Ga0495648_0207077 | 3300046524 | Bacteria | 977 |
| 318 | Ga0495663_0040069 | 3300046525 | Bacteria | 1421 |
| 319 | Ga0495654_0301224 | 3300046530 | Bacteria | 654 |
| 320 | Ga0495609_0103373 | 3300046538 | Bacteria | 1233 |
| 321 | Ga0495597_0011753 | 3300046542 | Bacteria | 4239 |
| 322 | Ga0495633_0020507 | 3300046558 | Bacteria | 3323 |
| 323 | Ga0495668_0007895 | 3300046616 | Bacteria | 6721 |
| 324 | Ga0495668_0037619 | 3300046616 | Bacteria | 2707 |
| 325 | Ga0495668_0136847 | 3300046616 | Bacteria | 1341 |
| 326 | Ga0495611_0007176 | 3300046648 | Bacteria | 4736 |
| 327 | Ga0495611_0395127 | 3300046648 | Bacteria | 632 |
| 328 | Ga0495625_0033539 | 3300046660 | Bacteria | 3795 |
| 329 | Ga0495625_0060124 | 3300046660 | Bacteria | 2693 |
| 330 | Ga0495625_0253865 | 3300046660 | Bacteria | 1140 |
| 331 | Ga0495625_0428701 | 3300046660 | Bacteria | 821 |
| 332 | Ga0495625_0588212 | 3300046660 | Bacteria | 669 |
| 333 | Ga0495661_0273255 | 3300046665 | Bacteria | 854 |
| 334 | Ga0495588_0026546 | 3300046674 | Bacteria | 2893 |
| 335 | Ga0495588_0030853 | 3300046674 | Bacteria | 2696 |
| 336 | Ga0495657_0236328 | 3300046675 | Bacteria | 1104 |
| 337 | Ga0495670_0118856 | 3300046691 | Bacteria | 1372 |
| 338 | Ga0495670_0154437 | 3300046691 | Bacteria | 1204 |
| 339 | Ga0495649_0004881 | 3300046694 | Bacteria | 8658 |
| 340 | Ga0495649_0030379 | 3300046694 | Bacteria | 2984 |
| 341 | Ga0495660_0085457 | 3300046810 | Bacteria | 1648 |
| 342 | Ga0495660_0099765 | 3300046810 | Bacteria | 1496 |
| 343 | Ga0495604_0290825 | 3300047317 | Bacteria | 1100 |
| 344 | Ga0495636_0138244 | 3300047318 | Bacteria | 1087 |
| 345 | Ga0495636_0556328 | 3300047318 | Bacteria | 558 |
| 346 | Ga0495672_0022787 | 3300047320 | Bacteria | 4064 |
| 347 | Ga0495672_0084243 | 3300047320 | Bacteria | 1764 |
| 348 | Ga0495687_063388 | 3300047443 | Bacteria | 1513 |
| 349 | Ga0495679_053875 | 3300047446 | Bacteria | 1200 |
| 350 | Ga0495686_0003461 | 3300047472 | Bacteria | 13679 |
| 351 | Ga0495686_0028813 | 3300047472 | Bacteria | 3615 |
| 352 | Ga0495686_0030555 | 3300047472 | Bacteria | 3498 |
| 353 | Ga0495686_0036792 | 3300047472 | Bacteria | 3140 |
| 354 | Ga0495686_0293505 | 3300047472 | Bacteria | 900 |
| 355 | Ga0495686_0569409 | 3300047472 | Bacteria | 590 |
| 356 | Ga0495615_0048901 | 3300048090 | Bacteria | 1082 |
| 357 | Ga0495626_0068568 | 3300048091 | Bacteria | 1599 |
| 358 | Ga0496101_0011657 | 3300048904 | Bacteria | 5840 |
| 359 | Ga0496101_0155478 | 3300048904 | Bacteria | 1752 |
| 360 | Ga0496101_0696203 | 3300048904 | Bacteria | 802 |
| 361 | Ga0496102_0016755 | 3300048905 | Bacteria | 6408 |
| 362 | Ga0496102_1763904 | 3300048905 | Bacteria | 536 |
| 363 | Ga0496103_0145406 | 3300048906 | Bacteria | 1517 |
| 364 | Ga0496106_0003275 | 3300048909 | Bacteria | 12102 |
| 365 | Ga0496106_0339538 | 3300048909 | Bacteria | 1206 |
| 366 | Ga0496107_1069027 | 3300048910 | Bacteria | 584 |
| 367 | Ga0496110_0132425 | 3300048913 | Bacteria | 2252 |
| 368 | Ga0496110_0331341 | 3300048913 | Bacteria | 1387 |
| 369 | Ga0496111_0004639 | 3300048914 | Bacteria | 8698 |
| 370 | Ga0496112_0765764 | 3300048915 | Bacteria | 891 |
| 371 | Ga0496113_0172590 | 3300048916 | Bacteria | 1713 |
| 372 | Ga0496113_0214156 | 3300048916 | Bacteria | 1534 |
| 373 | Ga0496113_0993460 | 3300048916 | Bacteria | 661 |
| 374 | Ga0496114_0252577 | 3300048917 | Bacteria | 1552 |
| 375 | Ga0496114_1484558 | 3300048917 | Bacteria | 566 |
| 376 | Ga0496116_0000061 | 3300048919 | Bacteria | 271860 |
| 377 | Ga0496116_0004014 | 3300048919 | Bacteria | 14274 |
| 378 | Ga0496116_0029898 | 3300048919 | Bacteria | 3920 |
| 379 | Ga0496116_0235391 | 3300048919 | Bacteria | 925 |
| 380 | Ga0496117_0001675 | 3300048920 | Bacteria | 30978 |
| 381 | Ga0496117_0010155 | 3300048920 | Bacteria | 8640 |
| 382 | Ga0496117_0028469 | 3300048920 | Bacteria | 4326 |
| 383 | Ga0496117_0060488 | 3300048920 | Bacteria | 2609 |
| 384 | Ga0496117_0149729 | 3300048920 | Bacteria | 1383 |
| 385 | Ga0496117_0153903 | 3300048920 | Bacteria | 1357 |
| 386 | Ga0496117_0238795 | 3300048920 | Bacteria | 999 |
| 387 | Ga0496117_0353566 | 3300048920 | Bacteria | 758 |
| 388 | Ga0496118_0005907 | 3300048921 | Bacteria | 13698 |
| 389 | Ga0496118_0018004 | 3300048921 | Bacteria | 6399 |
| 390 | Ga0496118_0053917 | 3300048921 | Bacteria | 3051 |
| 391 | Ga0496118_0153714 | 3300048921 | Bacteria | 1435 |
| 392 | Ga0496118_0221868 | 3300048921 | Bacteria | 1099 |
| 393 | Ga0496119_0010381 | 3300048922 | Bacteria | 7844 |
| 394 | Ga0496119_0028043 | 3300048922 | Bacteria | 3854 |
| 395 | Ga0496119_0048643 | 3300048922 | Bacteria | 2628 |
| 396 | Ga0496119_0178669 | 3300048922 | Bacteria | 1115 |
| 397 | Ga0496120_0011761 | 3300048923 | Bacteria | 5994 |
| 398 | Ga0496121_0023159 | 3300048924 | Bacteria | 5994 |
| 399 | Ga0496121_0027344 | 3300048924 | Bacteria | 5339 |
| 400 | Ga0496121_0043849 | 3300048924 | Bacteria | 3867 |
| 401 | Ga0496121_0048646 | 3300048924 | Bacteria | 3605 |
| 402 | Ga0496121_0060980 | 3300048924 | Bacteria | 3098 |
| 403 | Ga0496121_0096979 | 3300048924 | Bacteria | 2286 |
| 404 | Ga0496121_0198212 | 3300048924 | Bacteria | 1433 |
| 405 | Ga0496121_0235141 | 3300048924 | Bacteria | 1281 |
| 406 | Ga0496121_0246688 | 3300048924 | Bacteria | 1241 |
| 407 | Ga0496121_0285232 | 3300048924 | Bacteria | 1127 |
| 408 | Ga0496121_0311039 | 3300048924 | Bacteria | 1065 |
| 409 | Ga0496122_0000777 | 3300048925 | Bacteria | 61385 |
| 410 | Ga0496122_0007570 | 3300048925 | Bacteria | 12015 |
| 411 | Ga0496122_0010344 | 3300048925 | Bacteria | 9644 |
| 412 | Ga0496122_0019424 | 3300048925 | Bacteria | 6208 |
| 413 | Ga0496122_0019830 | 3300048925 | Bacteria | 6120 |
| 414 | Ga0496122_0041920 | 3300048925 | Bacteria | 3609 |
| 415 | Ga0496122_0098191 | 3300048925 | Bacteria | 1967 |
| 416 | Ga0496122_0141589 | 3300048925 | Bacteria | 1503 |
| 417 | Ga0496122_0203257 | 3300048925 | Bacteria | 1156 |
| 418 | Ga0496123_0000519 | 3300048926 | Bacteria | 66923 |
| 419 | Ga0496123_0022279 | 3300048926 | Bacteria | 4889 |
| 420 | Ga0496123_0025267 | 3300048926 | Bacteria | 4483 |
| 421 | Ga0496123_0026543 | 3300048926 | Bacteria | 4334 |
| 422 | Ga0496123_0079855 | 3300048926 | Bacteria | 1997 |
| 423 | Ga0496123_0109166 | 3300048926 | Bacteria | 1586 |
| 424 | Ga0496123_0123005 | 3300048926 | Bacteria | 1454 |
| 425 | Ga0496124_0000574 | 3300048927 | Bacteria | 62330 |
| 426 | Ga0496124_0010139 | 3300048927 | Bacteria | 9590 |
| 427 | Ga0496124_0011802 | 3300048927 | Bacteria | 8704 |
| 428 | Ga0496124_0022544 | 3300048927 | Bacteria | 5768 |
| 429 | Ga0496124_0057395 | 3300048927 | Bacteria | 3280 |
| 430 | Ga0496124_0124182 | 3300048927 | Bacteria | 2059 |
| 431 | Ga0496124_0145769 | 3300048927 | Bacteria | 1863 |
| 432 | Ga0496124_0202375 | 3300048927 | Bacteria | 1509 |
| 433 | Ga0496124_0203316 | 3300048927 | Bacteria | 1504 |
| 434 | Ga0496124_0621851 | 3300048927 | Bacteria | 698 |
| 435 | Ga0496125_0000790 | 3300048928 | Bacteria | 51640 |
| 436 | Ga0496125_0070064 | 3300048928 | Bacteria | 2747 |
| 437 | Ga0496125_0074850 | 3300048928 | Bacteria | 2623 |
| 438 | Ga0496125_0132852 | 3300048928 | Bacteria | 1748 |
| 439 | Ga0496125_0145729 | 3300048928 | Bacteria | 1637 |
| 440 | Ga0496126_0000397 | 3300048929 | Bacteria | 89305 |
| 441 | Ga0496126_0000466 | 3300048929 | Bacteria | 80395 |
| 442 | Ga0496126_0060122 | 3300048929 | Bacteria | 3419 |
| 443 | Ga0496126_0205504 | 3300048929 | Bacteria | 1660 |
| 444 | Ga0495678_062308 | 3300049459 | Bacteria | 1396 |
| 445 | Ga0495678_090851 | 3300049459 | Bacteria | 1076 |
| 446 | Ga0495682_0018055 | 3300049460 | Bacteria | 2657 |
| 447 | Ga0501031_0019286 | 3300049568 | Bacteria | 4441 |
| 448 | Ga0501031_0111024 | 3300049568 | Bacteria | 1790 |
| 449 | Ga0501032_0043928 | 3300049569 | Bacteria | 3025 |
| 450 | Ga0501033_0082976 | 3300049570 | Bacteria | 2350 |
| 451 | Ga0501033_0194743 | 3300049570 | Bacteria | 1449 |
| 452 | Ga0501033_0522763 | 3300049570 | Bacteria | 819 |
| 453 | Ga0501034_0026144 | 3300049571 | Bacteria | 5943 |
| 454 | Ga0501034_0106309 | 3300049571 | Bacteria | 2799 |
| 455 | Ga0501034_0193634 | 3300049571 | Bacteria | 1994 |
| 456 | Ga0501034_0251041 | 3300049571 | Bacteria | 1713 |
| 457 | Ga0501034_0463822 | 3300049571 | Bacteria | 1183 |
| 458 | Ga0501034_0964367 | 3300049571 | Bacteria | 738 |
| 459 | Ga0501036_0219603 | 3300049572 | Bacteria | 1596 |
| 460 | Ga0501036_0232296 | 3300049572 | Bacteria | 1547 |
| 461 | Ga0501037_0116744 | 3300049573 | Bacteria | 1920 |
| 462 | Ga0501037_0168959 | 3300049573 | Bacteria | 1555 |
| 463 | Ga0501038_0026508 | 3300049574 | Bacteria | 5162 |
| 464 | Ga0501038_0091915 | 3300049574 | Bacteria | 2541 |
| 465 | Ga0501038_0963358 | 3300049574 | Bacteria | 628 |
| 466 | Ga0501039_0199577 | 3300049575 | Bacteria | 1573 |
| 467 | Ga0501039_0242833 | 3300049575 | Bacteria | 1416 |
| 468 | Ga0501039_0868789 | 3300049575 | Bacteria | 702 |
| 469 | Ga0501040_0289498 | 3300049576 | Bacteria | 1170 |
| 470 | Ga0501041_0074743 | 3300049577 | Bacteria | 2083 |
| 471 | Ga0501042_0020859 | 3300049578 | Bacteria | 4562 |
| 472 | Ga0501043_0067906 | 3300049579 | Bacteria | 2799 |
| 473 | Ga0501043_0154843 | 3300049579 | Bacteria | 1792 |
| 474 | Ga0501043_0556238 | 3300049579 | Bacteria | 852 |
| 475 | Ga0501046_0032362 | 3300049580 | Bacteria | 4234 |
| 476 | Ga0501046_0086897 | 3300049580 | Bacteria | 2410 |
| 477 | Ga0501047_0029183 | 3300049581 | Bacteria | 5320 |
| 478 | Ga0501047_0064904 | 3300049581 | Bacteria | 3520 |
| 479 | Ga0501047_0292116 | 3300049581 | Bacteria | 1474 |
| 480 | Ga0501048_0011044 | 3300049582 | Bacteria | 6736 |
| 481 | Ga0501067_0022697 | 3300049583 | Bacteria | 3473 |
| 482 | Ga0501068_0037470 | 3300049584 | Bacteria | 2903 |
| 483 | Ga0501068_0682675 | 3300049584 | Bacteria | 671 |
| 484 | Ga0501070_0044862 | 3300049586 | Bacteria | 3677 |
| 485 | Ga0501071_0053381 | 3300049587 | Bacteria | 2915 |
| 486 | Ga0501073_0032824 | 3300049589 | Bacteria | 3700 |
| 487 | Ga0501073_0053843 | 3300049589 | Bacteria | 2817 |
| 488 | Ga0501079_0281217 | 3300049741 | Bacteria | 1301 |
| 489 | Ga0501079_0876656 | 3300049741 | Bacteria | 707 |
| 490 | Ga0501083_0057375 | 3300049744 | Bacteria | 2606 |
| 491 | Ga0501083_0169980 | 3300049744 | Bacteria | 1425 |
| 492 | Ga0501035_0010541 | 3300049822 | Bacteria | 8564 |
| 493 | Ga0501035_0062185 | 3300049822 | Bacteria | 3322 |
| 494 | Ga0501044_0038105 | 3300049823 | Bacteria | 5020 |
| 495 | Ga0501044_0094855 | 3300049823 | Bacteria | 3007 |
| 496 | Ga0501044_0150577 | 3300049823 | Bacteria | 2309 |
| 497 | Ga0501044_0254180 | 3300049823 | Bacteria | 1697 |
| 498 | Ga0501045_0005925 | 3300049824 | Bacteria | 8453 |
| 499 | nmdc:mga03683_314547_c1 | 3300050489 | Bacteria | 736 |
| 500 | nmdc:mga00v17_508608_c1 | 3300050491 | Bacteria | 780 |
| 501 | nmdc:mga0yw44_41508_c1 | 3300050492 | Bacteria | 2739 |
| 502 | nmdc:mga0k408_22809_c1 | 3300050493 | Bacteria | 3527 |
| 503 | nmdc:mga06z11_7641_c1 | 3300050494 | Bacteria | 4463 |
| 504 | nmdc:mga07m45_40598_c1 | 3300050496 | Bacteria | 2604 |
| 505 | nmdc:mga0sz30_63587_c1 | 3300050516 | Bacteria | 1580 |
| 506 | nmdc:mga0sz30_75994_c1 | 3300050516 | Bacteria | 1450 |
| 507 | nmdc:mga0sz30_89954_c1 | 3300050516 | Bacteria | 1335 |
| 508 | Ga0500610_0099306 | 3300053079 | Bacteria | 1507 |
| 509 | Ga0500578_0051786 | 3300053086 | Bacteria | 2629 |
| 510 | Ga0500578_0541689 | 3300053086 | Bacteria | 648 |
| 511 | Ga0500643_049242 | 3300053087 | Bacteria | 1209 |
| 512 | Ga0500647_0146531 | 3300053091 | Bacteria | 1104 |
| 513 | Ga0500556_0071340 | 3300053104 | Bacteria | 1298 |
| 514 | Ga0500569_023739 | 3300053109 | Bacteria | 1651 |
| 515 | Ga0500569_093176 | 3300053109 | Bacteria | 978 |
| 516 | Ga0500594_0029192 | 3300053118 | Bacteria | 1440 |
| 517 | Ga0500594_0038369 | 3300053118 | Bacteria | 1298 |
| 518 | Ga0500597_160443 | 3300053120 | Bacteria | 962 |
| 519 | Ga0500618_003843 | 3300053125 | Bacteria | 5009 |
| 520 | Ga0500618_007517 | 3300053125 | Bacteria | 3103 |
| 521 | Ga0500658_0002072 | 3300053134 | Bacteria | 7799 |
| 522 | Ga0500658_0004778 | 3300053134 | Bacteria | 5049 |
| 523 | Ga0500568_0004625 | 3300053139 | Bacteria | 7327 |
| 524 | Ga0500568_0007583 | 3300053139 | Bacteria | 5309 |
| 525 | Ga0500568_0035878 | 3300053139 | Bacteria | 2021 |
| 526 | Ga0500568_0076787 | 3300053139 | Bacteria | 1272 |
| 527 | Ga0500573_0002052 | 3300053140 | Bacteria | 9894 |
| 528 | Ga0500577_0183323 | 3300053142 | Bacteria | 899 |
| 529 | Ga0500604_0103018 | 3300053151 | Bacteria | 942 |
| 530 | Ga0500616_0001463 | 3300053153 | Bacteria | 22545 |
| 531 | Ga0500616_0016759 | 3300053153 | Bacteria | 4165 |
| 532 | Ga0500616_0043989 | 3300053153 | Bacteria | 2384 |
| 533 | Ga0500622_0002296 | 3300053156 | Bacteria | 14006 |
| 534 | Ga0500627_0067150 | 3300053158 | Bacteria | 1584 |
| 535 | Ga0500627_0431995 | 3300053158 | Bacteria | 557 |
| 536 | Ga0500633_0034799 | 3300053160 | Bacteria | 1654 |
| 537 | Ga0500611_133181 | 3300053727 | Bacteria | 671 |
| 538 | Ga0587078_015009 | 3300059646 | Bacteria | 931 |
| 539 | Ga0587079_116598 | 3300059647 | Bacteria | 655 |
| 540 | Ga0501082_0328840 | 3300060353 | Bacteria | 1332 |
| 541 | Ga0501082_0716774 | 3300060353 | Bacteria | 875 |
| 542 | Ga0501082_0894435 | 3300060353 | Bacteria | 777 |
| 543 | Ga0466962_0184563 | 3300061719 | Bacteria | 1017 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300002739 | JGI25158J39367_1000039 | JGI25158J39367_100003916 | 144 |
| 2 | 3300002987 | JGI25159J45721_1002399 | JGI25159J45721_10023998 | 144 |
| 3 | 3300003323 | rootH1_10228777 | rootH1_102287772 | 144 |
| 4 | 3300003354 | JGI25160J50197_1007275 | JGI25160J50197_10072754 | 144 |
| 5 | 3300003374 | JGI25161J50226_1000537 | JGI25161J50226_10005373 | 144 |
| 6 | 3300004625 | Ga0055543_1000639 | Ga0055543_10006396 | 144 |
| 7 | 3300005262 | Ga0065165_1003905 | Ga0065165_10039056 | 144 |
| 8 | 3300025208 | Ga0209436_101288 | Ga0209436_1012886 | 144 |
| 9 | 3300025284 | Ga0209130_1000009 | Ga0209130_1000009369 | 144 |
| 10 | 3300025302 | Ga0207426_1000041 | Ga0207426_1000041307 | 144 |
| 11 | 3300039450 | Ga0436363_1518595 | Ga0436363_1518595_155_622 | 153 |
| 12 | 3300005548 | Ga0070665_100006251 | Ga0070665_1000062514 | 154 |
| 13 | 3300005548 | Ga0070665_100212438 | Ga0070665_1002124381 | 154 |
| 14 | 3300009093 | Ga0105240_10188595 | Ga0105240_101885952 | 154 |
| 15 | 3300009093 | Ga0105240_10723746 | Ga0105240_107237461 | 154 |
| 16 | 3300009545 | Ga0105237_10282511 | Ga0105237_102825111 | 154 |
| 17 | 3300009551 | Ga0105238_10345965 | Ga0105238_103459652 | 154 |
| 18 | 3300010375 | Ga0105239_10839219 | Ga0105239_108392192 | 154 |
| 19 | 3300014968 | Ga0157379_10145466 | Ga0157379_101454662 | 154 |
| 20 | 3300025913 | Ga0207695_10054872 | Ga0207695_100548724 | 154 |
| 21 | 3300025913 | Ga0207695_10135283 | Ga0207695_101352833 | 154 |
| 22 | 3300025913 | Ga0207695_10744198 | Ga0207695_107441981 | 154 |
| 23 | 3300025914 | Ga0207671_10339929 | Ga0207671_103399292 | 154 |
| 24 | 3300025924 | Ga0207694_10366022 | Ga0207694_103660221 | 154 |
| 25 | 3300025949 | Ga0207667_10431503 | Ga0207667_104315032 | 154 |
| 26 | 3300028379 | Ga0268266_10116451 | Ga0268266_101164512 | 154 |
| 27 | 3300028379 | Ga0268266_10189212 | Ga0268266_101892122 | 154 |
| 28 | 3300048910 | Ga0496107_1069027 | Ga0496107_1069027_80_547 | 154 |
| 29 | 3300048915 | Ga0496112_0765764 | Ga0496112_0765764_284_751 | 154 |
| 30 | 3300053091 | Ga0500647_0146531 | Ga0500647_0146531_538_1005 | 154 |
| 31 | iso_pu_bacteria | 2510461069 | 2510840406 | 154 |
| 32 | iso_pu_bacteria | 2537561587 | 2537874957 | 154 |
| 33 | iso_pu_bacteria | 2643221558 | 2643813667 | 154 |
| 34 | iso_pu_bacteria | 2643221568 | 2643854479 | 154 |
| 35 | iso_pu_bacteria | 2899803654 | 2899808134 | 154 |
| 36 | iso_pu_bacteria | 2919166419 | 2919168815 | 154 |
| 37 | iso_pu_bacteria | 2978969890 | 2978971502 | 154 |
| 38 | iso_pu_bacteria | 2984587000 | 2984588646 | 154 |
| 39 | iso_pu_bacteria | 8005658619 | 8005660721 | 154 |
| 40 | iso_pu_bacteria | 8018150411 | 8018155158 | 154 |
| 41 | 3300003323 | rootH1_10203432 | rootH1_102034322 | 155 |
| 42 | 3300006048 | Ga0075363_100553835 | Ga0075363_1005538351 | 155 |
| 43 | 3300006177 | Ga0075362_10230894 | Ga0075362_102308942 | 155 |
| 44 | 3300050489 | nmdc:mga03683_314547_c1 | nmdc:mga03683_314547_c1_247_717 | 155 |
| 45 | 3300060353 | Ga0501082_0894435 | Ga0501082_0894435_46_516 | 155 |
| 46 | iso_pu_bacteria | 2509276019 | 2509378261 | 155 |
| 47 | iso_pu_bacteria | 2509276021 | 2509389528 | 155 |
| 48 | iso_pu_bacteria | 2509276033 | 2509446060 | 155 |
| 49 | iso_pu_bacteria | 2510065019 | 2510135123 | 155 |
| 50 | iso_pu_bacteria | 2510461076 | 2510896547 | 155 |
| 51 | iso_pu_bacteria | 2510917022 | 2511132044 | 155 |
| 52 | iso_pu_bacteria | 2510917026 | 2511173906 | 155 |
| 53 | iso_pu_bacteria | 2510917028 | 2511184836 | 155 |
| 54 | iso_pu_bacteria | 2510917030 | 2511198193 | 155 |
| 55 | iso_pu_bacteria | 2513237084 | 2513571490 | 155 |
| 56 | iso_pu_bacteria | 2513237085 | 2513580665 | 155 |
| 57 | iso_pu_bacteria | 2513237088 | 2513598107 | 155 |
| 58 | iso_pu_bacteria | 2513237093 | 2513630308 | 155 |
| 59 | iso_pu_bacteria | 2513237103 | 2513713082 | 155 |
| 60 | iso_pu_bacteria | 2513237138 | 2513869213 | 155 |
| 61 | iso_pu_bacteria | 2513237144 | 2513912284 | 155 |
| 62 | iso_pu_bacteria | 2513237146 | 2513928536 | 155 |
| 63 | iso_pu_bacteria | 2513237159 | 2513998592 | 155 |
| 64 | iso_pu_bacteria | 2513237162 | 2514023902 | 155 |
| 65 | iso_pu_bacteria | 2515075009 | 2515114274 | 155 |
| 66 | iso_pu_bacteria | 2515154113 | 2515639291 | 155 |
| 67 | iso_pu_bacteria | 2515154114 | 2515643343 | 155 |
| 68 | iso_pu_bacteria | 2515154116 | 2515660742 | 155 |
| 69 | iso_pu_bacteria | 2515154134 | 2515741438 | 155 |
| 70 | iso_pu_bacteria | 2516653077 | 2517037893 | 155 |
| 71 | iso_pu_bacteria | 2516653085 | 2517078158 | 155 |
| 72 | iso_pu_bacteria | 2517093000 | 2517096928 | 155 |
| 73 | iso_pu_bacteria | 2517287029 | 2517408657 | 155 |
| 74 | iso_pu_bacteria | 2519899620 | 2520379644 | 155 |
| 75 | iso_pu_bacteria | 2524023209 | 2524458360 | 155 |
| 76 | iso_pu_bacteria | 2529292951 | 2530647453 | 155 |
| 77 | iso_pu_bacteria | 2534681796 | 2535518919 | 155 |
| 78 | iso_pu_bacteria | 2558860100 | 2558867255 | 155 |
| 79 | iso_pu_bacteria | 2582581283 | 2585166832 | 155 |
| 80 | iso_pu_bacteria | 2582581294 | 2585201837 | 155 |
| 81 | iso_pu_bacteria | 2582581298 | 2585223821 | 155 |
| 82 | iso_pu_bacteria | 2582581299 | 2585228836 | 155 |
| 83 | iso_pu_bacteria | 2582581306 | 2585266817 | 155 |
| 84 | iso_pu_bacteria | 2582581307 | 2585271556 | 155 |
| 85 | iso_pu_bacteria | 2582581308 | 2585280618 | 155 |
| 86 | iso_pu_bacteria | 2582581315 | 2585327991 | 155 |
| 87 | iso_pu_bacteria | 2582581316 | 2585334261 | 155 |
| 88 | iso_pu_bacteria | 2582581865 | 2585387859 | 155 |
| 89 | iso_pu_bacteria | 2582581866 | 2585395959 | 155 |
| 90 | iso_pu_bacteria | 2582581867 | 2585399651 | 155 |
| 91 | iso_pu_bacteria | 2585427526 | 2585526197 | 155 |
| 92 | iso_pu_bacteria | 2585427527 | 2585531553 | 155 |
| 93 | iso_pu_bacteria | 2585427528 | 2585540651 | 155 |
| 94 | iso_pu_bacteria | 2585427529 | 2585549044 | 155 |
| 95 | iso_pu_bacteria | 2585427530 | 2585551501 | 155 |
| 96 | iso_pu_bacteria | 2585427531 | 2585563204 | 155 |
| 97 | iso_pu_bacteria | 2585427590 | 2585820738 | 155 |
| 98 | iso_pu_bacteria | 2585427593 | 2585838920 | 155 |
| 99 | iso_pu_bacteria | 2585427594 | 2585842226 | 155 |
| 100 | iso_pu_bacteria | 2585427608 | 2585902746 | 155 |
| 101 | iso_pu_bacteria | 2585427609 | 2585907422 | 155 |
| 102 | iso_pu_bacteria | 2585427633 | 2585997684 | 155 |
| 103 | iso_pu_bacteria | 2585427634 | 2586002271 | 155 |
| 104 | iso_pu_bacteria | 2585428125 | 2587982584 | 155 |
| 105 | iso_pu_bacteria | 2599185156 | 2599335014 | 155 |
| 106 | iso_pu_bacteria | 2599185170 | 2599420248 | 155 |
| 107 | iso_pu_bacteria | 2599185236 | 2599720236 | 155 |
| 108 | iso_pu_bacteria | 2600254933 | 2600376906 | 155 |
| 109 | iso_pu_bacteria | 2615840624 | 2616296416 | 155 |
| 110 | iso_pu_bacteria | 2615840626 | 2616306838 | 155 |
| 111 | iso_pu_bacteria | 2615840698 | 2616557689 | 155 |
| 112 | iso_pu_bacteria | 2617270742 | 2617383353 | 155 |
| 113 | iso_pu_bacteria | 2643221599 | 2644002373 | 155 |
| 114 | iso_pu_bacteria | 2643221607 | 2644051932 | 155 |
| 115 | iso_pu_bacteria | 2643221618 | 2644110000 | 155 |
| 116 | iso_pu_bacteria | 2643221626 | 2644150276 | 155 |
| 117 | iso_pu_bacteria | 2643221634 | 2644194024 | 155 |
| 118 | iso_pu_bacteria | 2643221636 | 2644201512 | 155 |
| 119 | iso_pu_bacteria | 2643221637 | 2644209375 | 155 |
| 120 | iso_pu_bacteria | 2643221643 | 2644240596 | 155 |
| 121 | iso_pu_bacteria | 2643221655 | 2644312880 | 155 |
| 122 | iso_pu_bacteria | 2643221659 | 2644336426 | 155 |
| 123 | iso_pu_bacteria | 2643221668 | 2644379648 | 155 |
| 124 | iso_pu_bacteria | 2643221686 | 2644484384 | 155 |
| 125 | iso_pu_bacteria | 2643221688 | 2644492400 | 155 |
| 126 | iso_pu_bacteria | 2643221689 | 2644499887 | 155 |
| 127 | iso_pu_bacteria | 2643221698 | 2644546074 | 155 |
| 128 | iso_pu_bacteria | 2643221712 | 2644618610 | 155 |
| 129 | iso_pu_bacteria | 2643221718 | 2644652903 | 155 |
| 130 | iso_pu_bacteria | 2667528174 | 2671113583 | 155 |
| 131 | iso_pu_bacteria | 2718217882 | 2719182859 | 155 |
| 132 | iso_pu_bacteria | 2718217927 | 2719387553 | 155 |
| 133 | iso_pu_bacteria | 2718217997 | 2719667199 | 155 |
| 134 | iso_pu_bacteria | 2718218009 | 2719733576 | 155 |
| 135 | iso_pu_bacteria | 2718218199 | 2720493619 | 155 |
| 136 | iso_pu_bacteria | 2718218232 | 2720615074 | 155 |
| 137 | iso_pu_bacteria | 2718218233 | 2720621867 | 155 |
| 138 | iso_pu_bacteria | 2718218235 | 2720633217 | 155 |
| 139 | iso_pu_bacteria | 2718218269 | 2720776914 | 155 |
| 140 | iso_pu_bacteria | 2718218363 | 2721148971 | 155 |
| 141 | iso_pu_bacteria | 2718218366 | 2721165784 | 155 |
| 142 | iso_pu_bacteria | 2718218423 | 2721401187 | 155 |
| 143 | iso_pu_bacteria | 2721755514 | 2722841954 | 155 |
| 144 | iso_pu_bacteria | 2721755556 | 2723028514 | 155 |
| 145 | iso_pu_bacteria | 2721755684 | 2723562118 | 155 |
| 146 | iso_pu_bacteria | 2721755685 | 2723568820 | 155 |
| 147 | iso_pu_bacteria | 2721755809 | 2724040001 | 155 |
| 148 | iso_pu_bacteria | 2721755810 | 2724046332 | 155 |
| 149 | iso_pu_bacteria | 2721755819 | 2724091521 | 155 |
| 150 | iso_pu_bacteria | 2721755822 | 2724106085 | 155 |
| 151 | iso_pu_bacteria | 2721755823 | 2724111891 | 155 |
| 152 | iso_pu_bacteria | 2724679232 | 2725947377 | 155 |
| 153 | iso_pu_bacteria | 2728369352 | 2730109450 | 155 |
| 154 | iso_pu_bacteria | 2728369365 | 2730166094 | 155 |
| 155 | iso_pu_bacteria | 2738541293 | 2738803159 | 155 |
| 156 | iso_pu_bacteria | 2738541333 | 2739037139 | 155 |
| 157 | iso_pu_bacteria | 2765235942 | 2766064431 | 155 |
| 158 | iso_pu_bacteria | 2775507266 | 2778173648 | 155 |
| 159 | iso_pu_bacteria | 2791355094 | 2792641381 | 155 |
| 160 | iso_pu_bacteria | 2791355256 | 2793295737 | 155 |
| 161 | iso_pu_bacteria | 2791355259 | 2793313510 | 155 |
| 162 | iso_pu_bacteria | 2791355260 | 2793320607 | 155 |
| 163 | iso_pu_bacteria | 2791355261 | 2793331043 | 155 |
| 164 | iso_pu_bacteria | 2791355262 | 2793332126 | 155 |
| 165 | iso_pu_bacteria | 2791355263 | 2793338694 | 155 |
| 166 | iso_pu_bacteria | 2791355265 | 2793353979 | 155 |
| 167 | iso_pu_bacteria | 2791355266 | 2793359503 | 155 |
| 168 | iso_pu_bacteria | 2791355267 | 2793365784 | 155 |
| 169 | iso_pu_bacteria | 2802429605 | 2805926106 | 155 |
| 170 | iso_pu_bacteria | 2802429606 | 2805937133 | 155 |
| 171 | iso_pu_bacteria | 2802429633 | 2806047230 | 155 |
| 172 | iso_pu_bacteria | 2802429634 | 2806054094 | 155 |
| 173 | iso_pu_bacteria | 2802429635 | 2806060322 | 155 |
| 174 | iso_pu_bacteria | 2802429636 | 2806068942 | 155 |
| 175 | iso_pu_bacteria | 2802429637 | 2806077115 | 155 |
| 176 | iso_pu_bacteria | 2818991448 | 2819611138 | 155 |
| 177 | iso_pu_bacteria | 2818991453 | 2819638931 | 155 |
| 178 | iso_pu_bacteria | 2838016132 | 2838018445 | 155 |
| 179 | iso_pu_bacteria | 2838022645 | 2838024126 | 155 |
| 180 | iso_pu_bacteria | 2838029111 | 2838030827 | 155 |
| 181 | iso_pu_bacteria | 2838035591 | 2838040454 | 155 |
| 182 | iso_pu_bacteria | 2838042994 | 2838048360 | 155 |
| 183 | iso_pu_bacteria | 2838048938 | 2838053705 | 155 |
| 184 | iso_pu_bacteria | 2838061910 | 2838062460 | 155 |
| 185 | iso_pu_bacteria | 2838068647 | 2838072012 | 155 |
| 186 | iso_pu_bacteria | 2838661181 | 2838667869 | 155 |
| 187 | iso_pu_bacteria | 2838668709 | 2838672925 | 155 |
| 188 | iso_pu_bacteria | 2838680041 | 2838684002 | 155 |
| 189 | iso_pu_bacteria | 2838686498 | 2838690123 | 155 |
| 190 | iso_pu_bacteria | 2838694306 | 2838698531 | 155 |
| 191 | iso_pu_bacteria | 2838701080 | 2838705597 | 155 |
| 192 | iso_pu_bacteria | 2838707686 | 2838711646 | 155 |
| 193 | iso_pu_bacteria | 2838729681 | 2838731898 | 155 |
| 194 | iso_pu_bacteria | 2838742623 | 2838744794 | 155 |
| 195 | iso_pu_bacteria | 2841851746 | 2841857899 | 155 |
| 196 | iso_pu_bacteria | 2841864319 | 2841867879 | 155 |
| 197 | iso_pu_bacteria | 2842077413 | 2842081447 | 155 |
| 198 | iso_pu_bacteria | 2842110456 | 2842116302 | 155 |
| 199 | iso_pu_bacteria | 2842118031 | 2842121776 | 155 |
| 200 | iso_pu_bacteria | 2842146304 | 2842149927 | 155 |
| 201 | iso_pu_bacteria | 2842156927 | 2842161021 | 155 |
| 202 | iso_pu_bacteria | 2842163707 | 2842166540 | 155 |
| 203 | iso_pu_bacteria | 2842180545 | 2842184637 | 155 |
| 204 | iso_pu_bacteria | 2842192696 | 2842194994 | 155 |
| 205 | iso_pu_bacteria | 2842198810 | 2842201720 | 155 |
| 206 | iso_pu_bacteria | 2842205361 | 2842207299 | 155 |
| 207 | iso_pu_bacteria | 2842217011 | 2842223402 | 155 |
| 208 | iso_pu_bacteria | 2842229732 | 2842232220 | 155 |
| 209 | iso_pu_bacteria | 2842237096 | 2842240791 | 155 |
| 210 | iso_pu_bacteria | 2842243621 | 2842246635 | 155 |
| 211 | iso_pu_bacteria | 2842250916 | 2842255277 | 155 |
| 212 | iso_pu_bacteria | 2842257432 | 2842261263 | 155 |
| 213 | iso_pu_bacteria | 2842264693 | 2842269527 | 155 |
| 214 | iso_pu_bacteria | 2842271015 | 2842274143 | 155 |
| 215 | iso_pu_bacteria | 2842278818 | 2842280990 | 155 |
| 216 | iso_pu_bacteria | 2842291075 | 2842295104 | 155 |
| 217 | iso_pu_bacteria | 2842298080 | 2842300384 | 155 |
| 218 | iso_pu_bacteria | 2842304105 | 2842305997 | 155 |
| 219 | iso_pu_bacteria | 2842311132 | 2842311299 | 155 |
| 220 | iso_pu_bacteria | 2842317721 | 2842321000 | 155 |
| 221 | iso_pu_bacteria | 2842341865 | 2842346702 | 155 |
| 222 | iso_pu_bacteria | 2842357229 | 2842361099 | 155 |
| 223 | iso_pu_bacteria | 2842363717 | 2842366384 | 155 |
| 224 | iso_pu_bacteria | 2842370503 | 2842374878 | 155 |
| 225 | iso_pu_bacteria | 2842377471 | 2842381503 | 155 |
| 226 | iso_pu_bacteria | 2842384541 | 2842388573 | 155 |
| 227 | iso_pu_bacteria | 2842395702 | 2842396069 | 155 |
| 228 | iso_pu_bacteria | 2842422224 | 2842425644 | 155 |
| 229 | iso_pu_bacteria | 2842428310 | 2842433485 | 155 |
| 230 | iso_pu_bacteria | 2842434925 | 2842439813 | 155 |
| 231 | iso_pu_bacteria | 2842441272 | 2842446442 | 155 |
| 232 | iso_pu_bacteria | 2842447887 | 2842448892 | 155 |
| 233 | iso_pu_bacteria | 2842462802 | 2842467885 | 155 |
| 234 | iso_pu_bacteria | 2842469257 | 2842474422 | 155 |
| 235 | iso_pu_bacteria | 2842475841 | 2842477559 | 155 |
| 236 | iso_pu_bacteria | 2842482326 | 2842488001 | 155 |
| 237 | iso_pu_bacteria | 2842489311 | 2842491052 | 155 |
| 238 | iso_pu_bacteria | 2842495871 | 2842498390 | 155 |
| 239 | iso_pu_bacteria | 2842502639 | 2842504568 | 155 |
| 240 | iso_pu_bacteria | 2842509118 | 2842511814 | 155 |
| 241 | iso_pu_bacteria | 2842521101 | 2842524377 | 155 |
| 242 | iso_pu_bacteria | 2842922631 | 2842926203 | 155 |
| 243 | iso_pu_bacteria | 2844163670 | 2844164194 | 155 |
| 244 | iso_pu_bacteria | 2844454524 | 2844457179 | 155 |
| 245 | iso_pu_bacteria | 2850079185 | 2850082489 | 155 |
| 246 | iso_pu_bacteria | 2852387548 | 2852391580 | 155 |
| 247 | iso_pu_bacteria | 2857516855 | 2857521119 | 155 |
| 248 | iso_pu_bacteria | 2891373044 | 2891373717 | 155 |
| 249 | iso_pu_bacteria | 2919100787 | 2919105281 | 155 |
| 250 | iso_pu_bacteria | 2919171160 | 2919175885 | 155 |
| 251 | iso_pu_bacteria | 2919408235 | 2919410960 | 155 |
| 252 | iso_pu_bacteria | 2923556063 | 2923559591 | 155 |
| 253 | iso_pu_bacteria | 2933016740 | 2933017246 | 155 |
| 254 | iso_pu_bacteria | 2933570622 | 2933572501 | 155 |
| 255 | iso_pu_bacteria | 2933586486 | 2933592519 | 155 |
| 256 | iso_pu_bacteria | 2933599457 | 2933603134 | 155 |
| 257 | iso_pu_bacteria | 2935894831 | 2935897820 | 155 |
| 258 | iso_pu_bacteria | 2935901341 | 2935903788 | 155 |
| 259 | iso_pu_bacteria | 2936367885 | 2936369760 | 155 |
| 260 | iso_pu_bacteria | 2936375103 | 2936378948 | 155 |
| 261 | iso_pu_bacteria | 2936381700 | 2936385835 | 155 |
| 262 | iso_pu_bacteria | 2996310559 | 2996311981 | 155 |
| 263 | iso_pu_bacteria | 2996887358 | 2996890141 | 155 |
| 264 | iso_pu_bacteria | 2996893221 | 2996895175 | 155 |
| 265 | iso_pu_bacteria | 3003930520 | 3003930780 | 155 |
| 266 | iso_pu_bacteria | 3005409236 | 3005409537 | 155 |
| 267 | iso_pu_bacteria | 3005416602 | 3005421738 | 155 |
| 268 | iso_pu_bacteria | 3005445848 | 3005449553 | 155 |
| 269 | iso_pu_bacteria | 3005452660 | 3005455845 | 155 |
| 270 | iso_pu_bacteria | 639633055 | 639650276 | 155 |
| 271 | iso_pu_bacteria | 8005258706 | 8005262325 | 155 |
| 272 | iso_pu_bacteria | 8005275841 | 8005282306 | 155 |
| 273 | iso_pu_bacteria | 8005289223 | 8005294968 | 155 |
| 274 | iso_pu_bacteria | 8005301065 | 8005305856 | 155 |
| 275 | iso_pu_bacteria | 8005307578 | 8005313545 | 155 |
| 276 | iso_pu_bacteria | 8005314921 | 8005319562 | 155 |
| 277 | iso_pu_bacteria | 8005321885 | 8005324668 | 155 |
| 278 | iso_pu_bacteria | 8005376324 | 8005381696 | 155 |
| 279 | iso_pu_bacteria | 8005382845 | 8005387881 | 155 |
| 280 | iso_pu_bacteria | 8005395548 | 8005400917 | 155 |
| 281 | iso_pu_bacteria | 8005430974 | 8005433697 | 155 |
| 282 | iso_pu_bacteria | 8005460587 | 8005464966 | 155 |
| 283 | iso_pu_bacteria | 8005484373 | 8005490190 | 155 |
| 284 | iso_pu_bacteria | 8005497431 | 8005497561 | 155 |
| 285 | iso_pu_bacteria | 8005542996 | 8005546569 | 155 |
| 286 | iso_pu_bacteria | 8005556819 | 8005561008 | 155 |
| 287 | iso_pu_bacteria | 8005563573 | 8005565633 | 155 |
| 288 | iso_pu_bacteria | 8005570704 | 8005571090 | 155 |
| 289 | iso_pu_bacteria | 8005619151 | 8005623294 | 155 |
| 290 | iso_pu_bacteria | 8005626139 | 8005631126 | 155 |
| 291 | iso_pu_bacteria | 8005645114 | 8005646848 | 155 |
| 292 | iso_pu_bacteria | 8005668836 | 8005668966 | 155 |
| 293 | iso_pu_bacteria | 8005682033 | 8005687569 | 155 |
| 294 | iso_pu_bacteria | 8005688590 | 8005694447 | 155 |
| 295 | iso_pu_bacteria | 8005695170 | 8005695608 | 155 |
| 296 | iso_pu_bacteria | 8018127388 | 8018128805 | 155 |
| 297 | iso_pu_bacteria | 8018163183 | 8018165256 | 155 |
| 298 | iso_pu_bacteria | 8018176218 | 8018177035 | 155 |
| 299 | iso_pu_bacteria | 8023680758 | 8023686383 | 155 |
| 300 | iso_pu_bacteria | 8024479707 | 8024484239 | 155 |
| 301 | iso_pu_bacteria | 8024486573 | 8024490747 | 155 |
| 302 | iso_pu_bacteria | 8024501048 | 8024502436 | 155 |
| 303 | iso_pu_bacteria | 8046767195 | 8046768143 | 155 |
| 304 | iso_pu_bacteria | 8056375014 | 8056379747 | 155 |
| 305 | iso_pu_bacteria | 8056382006 | 8056383917 | 155 |
| 306 | iso_pu_bacteria | 8056875544 | 8056878153 | 155 |
| 307 | iso_pu_bacteria | 8057575449 | 8057581496 | 155 |
| 308 | iso_pu_bacteria | 8057874678 | 8057879130 | 155 |
| 309 | 3300025929 | Ga0207664_10990612 | Ga0207664_109906121 | 156 |
| 310 | 3300028379 | Ga0268266_11788887 | Ga0268266_117888871 | 156 |
| 311 | 3300048921 | Ga0496118_0221868 | Ga0496118_0221868_555_1043 | 156 |
| 312 | 3300048924 | Ga0496121_0311039 | Ga0496121_0311039_137_625 | 156 |
| 313 | 3300060353 | Ga0501082_0328840 | Ga0501082_0328840_399_872 | 156 |
| 314 | iso_pu_bacteria | 2899275550 | 2899278795 | 156 |
| 315 | 3300005983 | Ga0081540_1045243 | Ga0081540_10452432 | 157 |
| 316 | 3300032002 | Ga0307416_101605593 | Ga0307416_1016055931 | 157 |
| 317 | 3300048927 | Ga0496124_0202375 | Ga0496124_0202375_890_1366 | 157 |
| 318 | 3300049571 | Ga0501034_0193634 | Ga0501034_0193634_858_1331 | 157 |
| 319 | 3300049575 | Ga0501039_0199577 | Ga0501039_0199577_568_1041 | 157 |
| 320 | 3300049741 | Ga0501079_0876656 | Ga0501079_0876656_74_556 | 157 |
| 321 | 3300050491 | nmdc:mga00v17_508608_c1 | nmdc:mga00v17_508608_c1_25_498 | 157 |
| 322 | 3300053153 | Ga0500616_0016759 | Ga0500616_0016759_1275_1748 | 157 |
| 323 | 3300053158 | Ga0500627_0067150 | Ga0500627_0067150_978_1451 | 157 |
| 324 | 3300059647 | Ga0587079_116598 | Ga0587079_116598_103_576 | 157 |
| 325 | 3300006177 | Ga0075362_10759680 | Ga0075362_107596801 | 158 |
| 326 | 3300006186 | Ga0075369_10138022 | Ga0075369_101380222 | 158 |
| 327 | 3300013102 | Ga0157371_10022144 | Ga0157371_100221443 | 158 |
| 328 | 3300013105 | Ga0157369_10228530 | Ga0157369_102285302 | 158 |
| 329 | 3300013307 | Ga0157372_10697990 | Ga0157372_106979902 | 158 |
| 330 | 3300025284 | Ga0209130_1028390 | Ga0209130_10283901 | 158 |
| 331 | 3300028794 | Ga0307515_10001840 | Ga0307515_100018407 | 158 |
| 332 | 3300031548 | Ga0307408_100287431 | Ga0307408_1002874313 | 158 |
| 333 | 3300046460 | Ga0495638_0024159 | Ga0495638_0024159_1976_2452 | 158 |
| 334 | 3300048919 | Ga0496116_0000061 | Ga0496116_0000061_53174_53653 | 158 |
| 335 | 3300048920 | Ga0496117_0153903 | Ga0496117_0153903_456_935 | 158 |
| 336 | 3300048922 | Ga0496119_0178669 | Ga0496119_0178669_268_747 | 158 |
| 337 | 3300048926 | Ga0496123_0109166 | Ga0496123_0109166_72_551 | 158 |
| 338 | 3300048927 | Ga0496124_0124182 | Ga0496124_0124182_883_1362 | 158 |
| 339 | 3300048929 | Ga0496126_0000397 | Ga0496126_0000397_12920_13399 | 158 |
| 340 | 3300050516 | nmdc:mga0sz30_63587_c1 | nmdc:mga0sz30_63587_c1_287_766 | 158 |
| 341 | 3300053140 | Ga0500573_0002052 | Ga0500573_0002052_2595_3071 | 158 |
| 342 | 3300001979 | JGI24740J21852_10000066 | JGI24740J21852_1000006619 | 159 |
| 343 | 3300001989 | JGI24739J22299_10144511 | JGI24739J22299_101445111 | 159 |
| 344 | 3300002704 | JGI25155J39150_1000010 | JGI25155J39150_1000010104 | 159 |
| 345 | 3300002705 | JGI25156J39149_1000033 | JGI25156J39149_100003379 | 159 |
| 346 | 3300002737 | JGI25162J39368_1002132 | JGI25162J39368_10021329 | 159 |
| 347 | 3300002738 | JGI25154J39366_1000058 | JGI25154J39366_100005836 | 159 |
| 348 | 3300002741 | JGI25157J39369_1000009 | JGI25157J39369_1000009103 | 159 |
| 349 | 3300002773 | JGI25152J39213_1003798 | JGI25152J39213_10037984 | 159 |
| 350 | 3300002773 | JGI25152J39213_1025070 | JGI25152J39213_10250702 | 159 |
| 351 | 3300002774 | JGI25150J39212_1000028 | JGI25150J39212_100002865 | 159 |
| 352 | 3300002774 | JGI25150J39212_1002370 | JGI25150J39212_10023702 | 159 |
| 353 | 3300002774 | JGI25150J39212_1029801 | JGI25150J39212_10298011 | 159 |
| 354 | 3300002987 | JGI25159J45721_1000241 | JGI25159J45721_100024117 | 159 |
| 355 | 3300003187 | JGI25151J46595_10000123 | JGI25151J46595_1000012332 | 159 |
| 356 | 3300003187 | JGI25151J46595_10003986 | JGI25151J46595_100039866 | 159 |
| 357 | 3300003187 | JGI25151J46595_10004252 | JGI25151J46595_100042523 | 159 |
| 358 | 3300003187 | JGI25151J46595_10016106 | JGI25151J46595_100161064 | 159 |
| 359 | 3300003214 | JGI25165J46597_1000935 | JGI25165J46597_100093516 | 159 |
| 360 | 3300003214 | JGI25165J46597_1000949 | JGI25165J46597_100094915 | 159 |
| 361 | 3300003215 | JGI25153J46596_10001187 | JGI25153J46596_100011878 | 159 |
| 362 | 3300003215 | JGI25153J46596_10004401 | JGI25153J46596_100044018 | 159 |
| 363 | 3300003215 | JGI25153J46596_10007873 | JGI25153J46596_100078734 | 159 |
| 364 | 3300003215 | JGI25153J46596_10020184 | JGI25153J46596_100201844 | 159 |
| 365 | 3300003316 | rootH1_10044838 | rootH1_100448382 | 159 |
| 366 | 3300003316 | rootH1_10052753 | rootH1_100527532 | 159 |
| 367 | 3300003322 | rootL2_10057936 | rootL2_100579364 | 159 |
| 368 | 3300003322 | rootL2_10158058 | rootL2_101580582 | 159 |
| 369 | 3300003323 | rootH1_10096654 | rootH1_100966542 | 159 |
| 370 | 3300003323 | rootH1_10130547 | rootH1_101305473 | 159 |
| 371 | 3300003323 | rootH1_10228778 | rootH1_102287782 | 159 |
| 372 | 3300003354 | JGI25160J50197_1000214 | JGI25160J50197_100021417 | 159 |
| 373 | 3300003354 | JGI25160J50197_1009767 | JGI25160J50197_10097672 | 159 |
| 374 | 3300003374 | JGI25161J50226_1000158 | JGI25161J50226_100015830 | 159 |
| 375 | 3300003374 | JGI25161J50226_1006184 | JGI25161J50226_10061841 | 159 |
| 376 | 3300003771 | Ga0055526_1002383 | Ga0055526_10023834 | 159 |
| 377 | 3300003771 | Ga0055526_1013480 | Ga0055526_10134802 | 159 |
| 378 | 3300003771 | Ga0055526_1016937 | Ga0055526_10169372 | 159 |
| 379 | 3300003775 | Ga0055524_1000988 | Ga0055524_10009889 | 159 |
| 380 | 3300003775 | Ga0055524_1008246 | Ga0055524_10082466 | 159 |
| 381 | 3300003775 | Ga0055524_1020400 | Ga0055524_10204002 | 159 |
| 382 | 3300003775 | Ga0055524_1039276 | Ga0055524_10392762 | 159 |
| 383 | 3300003775 | Ga0055524_1045703 | Ga0055524_10457032 | 159 |
| 384 | 3300003790 | Ga0055528_1000842 | Ga0055528_10008427 | 159 |
| 385 | 3300003790 | Ga0055528_1004809 | Ga0055528_10048097 | 159 |
| 386 | 3300003790 | Ga0055528_1006582 | Ga0055528_10065822 | 159 |
| 387 | 3300003790 | Ga0055528_1008361 | Ga0055528_10083612 | 159 |
| 388 | 3300003790 | Ga0055528_1012908 | Ga0055528_10129081 | 159 |
| 389 | 3300003791 | Ga0055530_10024053 | Ga0055530_100240532 | 159 |
| 390 | 3300003792 | Ga0055540_1000481 | Ga0055540_100048110 | 159 |
| 391 | 3300003792 | Ga0055540_1012734 | Ga0055540_10127342 | 159 |
| 392 | 3300003792 | Ga0055540_1054951 | Ga0055540_10549511 | 159 |
| 393 | 3300003794 | Ga0055531_10010151 | Ga0055531_100101515 | 159 |
| 394 | 3300004625 | Ga0055543_1000099 | Ga0055543_100009917 | 159 |
| 395 | 3300004625 | Ga0055543_1002383 | Ga0055543_10023833 | 159 |
| 396 | 3300005262 | Ga0065165_1000575 | Ga0065165_100057537 | 159 |
| 397 | 3300005262 | Ga0065165_1012374 | Ga0065165_10123742 | 159 |
| 398 | 3300005262 | Ga0065165_1012576 | Ga0065165_10125764 | 159 |
| 399 | 3300005262 | Ga0065165_1040894 | Ga0065165_10408942 | 159 |
| 400 | 3300005353 | Ga0070669_100470113 | Ga0070669_1004701132 | 159 |
| 401 | 3300005367 | Ga0070667_100168895 | Ga0070667_1001688952 | 159 |
| 402 | 3300005539 | Ga0068853_100285895 | Ga0068853_1002858951 | 159 |
| 403 | 3300005577 | Ga0068857_100614481 | Ga0068857_1006144811 | 159 |
| 404 | 3300005614 | Ga0068856_100110337 | Ga0068856_1001103372 | 159 |
| 405 | 3300005614 | Ga0068856_100380891 | Ga0068856_1003808912 | 159 |
| 406 | 3300005616 | Ga0068852_100138863 | Ga0068852_1001388632 | 159 |
| 407 | 3300006038 | Ga0075365_10000978 | Ga0075365_100009787 | 159 |
| 408 | 3300006038 | Ga0075365_10278760 | Ga0075365_102787602 | 159 |
| 409 | 3300006048 | Ga0075363_100053454 | Ga0075363_1000534542 | 159 |
| 410 | 3300006177 | Ga0075362_10024800 | Ga0075362_100248002 | 159 |
| 411 | 3300006178 | Ga0075367_10016233 | Ga0075367_100162333 | 159 |
| 412 | 3300006178 | Ga0075367_10337706 | Ga0075367_103377062 | 159 |
| 413 | 3300006186 | Ga0075369_10101503 | Ga0075369_101015032 | 159 |
| 414 | 3300006186 | Ga0075369_10138357 | Ga0075369_101383572 | 159 |
| 415 | 3300006186 | Ga0075369_10213038 | Ga0075369_102130381 | 159 |
| 416 | 3300006353 | Ga0075370_10000922 | Ga0075370_100009226 | 159 |
| 417 | 3300006353 | Ga0075370_10020528 | Ga0075370_100205282 | 159 |
| 418 | 3300006353 | Ga0075370_10410697 | Ga0075370_104106972 | 159 |
| 419 | 3300006353 | Ga0075370_10533563 | Ga0075370_105335632 | 159 |
| 420 | 3300006353 | Ga0075370_10942811 | Ga0075370_109428111 | 159 |
| 421 | 3300009093 | Ga0105240_10000013 | Ga0105240_10000013110 | 159 |
| 422 | 3300009101 | Ga0105247_10044821 | Ga0105247_100448212 | 159 |
| 423 | 3300009545 | Ga0105237_10003586 | Ga0105237_100035869 | 159 |
| 424 | 3300009545 | Ga0105237_10674156 | Ga0105237_106741562 | 159 |
| 425 | 3300009765 | Ga0123341_1014142 | Ga0123341_10141424 | 159 |
| 426 | 3300009766 | Ga0123342_1012798 | Ga0123342_10127987 | 159 |
| 427 | 3300009766 | Ga0123342_1016598 | Ga0123342_10165984 | 159 |
| 428 | 3300010375 | Ga0105239_10005948 | Ga0105239_100059487 | 159 |
| 429 | 3300012513 | Ga0157326_1031162 | Ga0157326_10311621 | 159 |
| 430 | 3300013104 | Ga0157370_10000209 | Ga0157370_1000020960 | 159 |
| 431 | 3300013105 | Ga0157369_10202346 | Ga0157369_102023463 | 159 |
| 432 | 3300015262 | Ga0182007_10003149 | Ga0182007_100031497 | 159 |
| 433 | 3300015265 | Ga0182005_1003085 | Ga0182005_10030852 | 159 |
| 434 | 3300017792 | Ga0163161_10522041 | Ga0163161_105220411 | 159 |
| 435 | 3300025206 | Ga0209435_100009 | Ga0209435_100009361 | 159 |
| 436 | 3300025228 | Ga0209672_105717 | Ga0209672_1057172 | 159 |
| 437 | 3300025233 | Ga0209437_100057 | Ga0209437_100057107 | 159 |
| 438 | 3300025233 | Ga0209437_100107 | Ga0209437_10010770 | 159 |
| 439 | 3300025233 | Ga0209437_105749 | Ga0209437_1057493 | 159 |
| 440 | 3300025245 | Ga0207425_1000077 | Ga0207425_100007730 | 159 |
| 441 | 3300025245 | Ga0207425_1005700 | Ga0207425_10057003 | 159 |
| 442 | 3300025246 | Ga0209646_1000018 | Ga0209646_1000018361 | 159 |
| 443 | 3300025246 | Ga0209646_1007130 | Ga0209646_10071302 | 159 |
| 444 | 3300025250 | Ga0209026_1000068 | Ga0209026_1000068103 | 159 |
| 445 | 3300025253 | Ga0209677_100309 | Ga0209677_1003093 | 159 |
| 446 | 3300025256 | Ga0209759_1000007 | Ga0209759_1000007361 | 159 |
| 447 | 3300025258 | Ga0209129_1000036 | Ga0209129_1000036287 | 159 |
| 448 | 3300025258 | Ga0209129_1000118 | Ga0209129_1000118119 | 159 |
| 449 | 3300025258 | Ga0209129_1002381 | Ga0209129_10023813 | 159 |
| 450 | 3300025258 | Ga0209129_1004334 | Ga0209129_10043342 | 159 |
| 451 | 3300025258 | Ga0209129_1010005 | Ga0209129_10100052 | 159 |
| 452 | 3300025261 | Ga0209233_1000072 | Ga0209233_100007299 | 159 |
| 453 | 3300025261 | Ga0209233_1000134 | Ga0209233_1000134107 | 159 |
| 454 | 3300025261 | Ga0209233_1000440 | Ga0209233_100044025 | 159 |
| 455 | 3300025273 | Ga0209673_1000052 | Ga0209673_100005215 | 159 |
| 456 | 3300025273 | Ga0209673_1000158 | Ga0209673_100015819 | 159 |
| 457 | 3300025273 | Ga0209673_1000459 | Ga0209673_100045953 | 159 |
| 458 | 3300025273 | Ga0209673_1000997 | Ga0209673_100099715 | 159 |
| 459 | 3300025273 | Ga0209673_1007484 | Ga0209673_10074841 | 159 |
| 460 | 3300025273 | Ga0209673_1009902 | Ga0209673_10099026 | 159 |
| 461 | 3300025273 | Ga0209673_1032225 | Ga0209673_10322252 | 159 |
| 462 | 3300025273 | Ga0209673_1038068 | Ga0209673_10380682 | 159 |
| 463 | 3300025273 | Ga0209673_1063126 | Ga0209673_10631262 | 159 |
| 464 | 3300025284 | Ga0209130_1000132 | Ga0209130_1000132106 | 159 |
| 465 | 3300025291 | Ga0209675_1022813 | Ga0209675_10228132 | 159 |
| 466 | 3300025292 | Ga0209676_1004018 | Ga0209676_10040182 | 159 |
| 467 | 3300025292 | Ga0209676_1024673 | Ga0209676_10246732 | 159 |
| 468 | 3300025294 | Ga0209025_1000245 | Ga0209025_100024512 | 159 |
| 469 | 3300025294 | Ga0209025_1000329 | Ga0209025_100032930 | 159 |
| 470 | 3300025294 | Ga0209025_1000617 | Ga0209025_100061730 | 159 |
| 471 | 3300025294 | Ga0209025_1000871 | Ga0209025_10008713 | 159 |
| 472 | 3300025294 | Ga0209025_1002194 | Ga0209025_10021942 | 159 |
| 473 | 3300025295 | Ga0209564_1000569 | Ga0209564_10005697 | 159 |
| 474 | 3300025295 | Ga0209564_1000675 | Ga0209564_100067528 | 159 |
| 475 | 3300025295 | Ga0209564_1001411 | Ga0209564_100141117 | 159 |
| 476 | 3300025295 | Ga0209564_1002048 | Ga0209564_10020482 | 159 |
| 477 | 3300025297 | Ga0209758_1000259 | Ga0209758_100025962 | 159 |
| 478 | 3300025297 | Ga0209758_1000323 | Ga0209758_100032327 | 159 |
| 479 | 3300025297 | Ga0209758_1000948 | Ga0209758_100094815 | 159 |
| 480 | 3300025297 | Ga0209758_1003501 | Ga0209758_10035017 | 159 |
| 481 | 3300025297 | Ga0209758_1005770 | Ga0209758_10057703 | 159 |
| 482 | 3300025297 | Ga0209758_1007164 | Ga0209758_10071643 | 159 |
| 483 | 3300025297 | Ga0209758_1007169 | Ga0209758_10071693 | 159 |
| 484 | 3300025298 | Ga0209050_1003683 | Ga0209050_10036833 | 159 |
| 485 | 3300025298 | Ga0209050_1004202 | Ga0209050_100420211 | 159 |
| 486 | 3300025299 | Ga0209256_1001406 | Ga0209256_100140617 | 159 |
| 487 | 3300025299 | Ga0209256_1001526 | Ga0209256_100152615 | 159 |
| 488 | 3300025299 | Ga0209256_1001728 | Ga0209256_100172816 | 159 |
| 489 | 3300025299 | Ga0209256_1009743 | Ga0209256_10097432 | 159 |
| 490 | 3300025299 | Ga0209256_1012230 | Ga0209256_10122302 | 159 |
| 491 | 3300025299 | Ga0209256_1051104 | Ga0209256_10511042 | 159 |
| 492 | 3300025302 | Ga0207426_1000246 | Ga0207426_1000246106 | 159 |
| 493 | 3300025302 | Ga0207426_1000761 | Ga0207426_100076115 | 159 |
| 494 | 3300025303 | Ga0209051_1000863 | Ga0209051_100086311 | 159 |
| 495 | 3300025303 | Ga0209051_1000871 | Ga0209051_10008712 | 159 |
| 496 | 3300025303 | Ga0209051_1018016 | Ga0209051_10180162 | 159 |
| 497 | 3300025303 | Ga0209051_1074658 | Ga0209051_10746581 | 159 |
| 498 | 3300025304 | Ga0209257_1002861 | Ga0209257_10028613 | 159 |
| 499 | 3300025304 | Ga0209257_1006330 | Ga0209257_10063309 | 159 |
| 500 | 3300025304 | Ga0209257_1026753 | Ga0209257_10267533 | 159 |
| 501 | 3300025304 | Ga0209257_1086265 | Ga0209257_10862651 | 159 |
| 502 | 3300025911 | Ga0207654_10103960 | Ga0207654_101039602 | 159 |
| 503 | 3300025913 | Ga0207695_10000044 | Ga0207695_1000004467 | 159 |
| 504 | 3300025914 | Ga0207671_10000226 | Ga0207671_1000022668 | 159 |
| 505 | 3300025923 | Ga0207681_10087654 | Ga0207681_100876542 | 159 |
| 506 | 3300025935 | Ga0207709_10243111 | Ga0207709_102431111 | 159 |
| 507 | 3300025972 | Ga0207668_10605294 | Ga0207668_106052942 | 159 |
| 508 | 3300025986 | Ga0207658_10086035 | Ga0207658_100860352 | 159 |
| 509 | 3300026078 | Ga0207702_10087884 | Ga0207702_100878842 | 159 |
| 510 | 3300026142 | Ga0207698_10082011 | Ga0207698_100820113 | 159 |
| 511 | 3300026142 | Ga0207698_10586597 | Ga0207698_105865972 | 159 |
| 512 | 3300027312 | Ga0209371_1031992 | Ga0209371_10319922 | 159 |
| 513 | 3300028379 | Ga0268266_10776527 | Ga0268266_107765272 | 159 |
| 514 | 3300028794 | Ga0307515_10000377 | Ga0307515_1000037785 | 159 |
| 515 | 3300028794 | Ga0307515_10013206 | Ga0307515_100132067 | 159 |
| 516 | 3300030500 | Ga0268256_1036395 | Ga0268256_10363952 | 159 |
| 517 | 3300031456 | Ga0307513_10002147 | Ga0307513_100021474 | 159 |
| 518 | 3300031456 | Ga0307513_10023038 | Ga0307513_100230386 | 159 |
| 519 | 3300031548 | Ga0307408_100035018 | Ga0307408_1000350182 | 159 |
| 520 | 3300031901 | Ga0307406_10003800 | Ga0307406_100038006 | 159 |
| 521 | 3300031911 | Ga0307412_10001541 | Ga0307412_100015413 | 159 |
| 522 | 3300031911 | Ga0307412_10175757 | Ga0307412_101757572 | 159 |
| 523 | 3300031995 | Ga0307409_100144544 | Ga0307409_1001445442 | 159 |
| 524 | 3300032004 | Ga0307414_10068133 | Ga0307414_100681332 | 159 |
| 525 | 3300032005 | Ga0307411_10802872 | Ga0307411_108028722 | 159 |
| 526 | 3300032168 | Ga0316593_10223636 | Ga0316593_102236362 | 159 |
| 527 | 3300035692 | Ga0373935_0446794 | Ga0373935_0446794_222_701 | 159 |
| 528 | 3300035695 | Ga0373927_0000074 | Ga0373927_0000074_28961_29440 | 159 |
| 529 | 3300036647 | Ga0316582_0119491 | Ga0316582_0119491_1018_1497 | 159 |
| 530 | 3300036712 | Ga0316584_0336126 | Ga0316584_0336126_482_961 | 159 |
| 531 | 3300037068 | Ga0373925_0001779 | Ga0373925_0001779_10842_11321 | 159 |
| 532 | 3300037312 | Ga0395899_0000014 | Ga0395899_0000014_129320_129799 | 159 |
| 533 | 3300037418 | Ga0395900_0000007 | Ga0395900_0000007_129339_129818 | 159 |
| 534 | 3300037466 | Ga0395898_0000011 | Ga0395898_0000011_359043_359522 | 159 |
| 535 | 3300037471 | Ga0395905_0000008 | Ga0395905_0000008_129339_129818 | 159 |
| 536 | 3300038443 | Ga0395901_0000048 | Ga0395901_0000048_44252_44731 | 159 |
| 537 | 3300041404 | Ga0439436_0008125 | Ga0439436_0008125_2026_2505 | 159 |
| 538 | 3300041404 | Ga0439436_0010490 | Ga0439436_0010490_154_693 | 159 |
| 539 | 3300041406 | Ga0439439_0067584 | Ga0439439_0067584_183_662 | 159 |
| 540 | 3300041410 | Ga0439461_0075817 | Ga0439461_0075817_234_713 | 159 |
| 541 | 3300041411 | Ga0439466_0072559 | Ga0439466_0072559_567_1046 | 159 |
| 542 | 3300041411 | Ga0439466_0080227 | Ga0439466_0080227_64_543 | 159 |
| 543 | 3300041413 | Ga0439465_0004431 | Ga0439465_0004431_3599_4078 | 159 |
| 544 | 3300041413 | Ga0439465_0009619 | Ga0439465_0009619_1870_2349 | 159 |
| 545 | 3300041413 | Ga0439465_0027912 | Ga0439465_0027912_205_684 | 159 |
| 546 | 3300041413 | Ga0439465_0124697 | Ga0439465_0124697_404_883 | 159 |
| 547 | 3300041443 | Ga0451789_0976999 | Ga0451789_0976999_47_526 | 159 |
| 548 | 3300041456 | Ga0451795_0141812 | Ga0451795_0141812_261_740 | 159 |
| 549 | 3300041491 | Ga0451833_0233035 | Ga0451833_0233035_648_1127 | 159 |
| 550 | 3300041494 | Ga0451837_0488831 | Ga0451837_0488831_168_647 | 159 |
| 551 | 3300041494 | Ga0451837_1525209 | Ga0451837_1525209_530_1009 | 159 |
| 552 | 3300041497 | Ga0451840_08834 | Ga0451840_08834_129_608 | 159 |
| 553 | 3300041502 | Ga0451846_08075 | Ga0451846_08075_116_595 | 159 |
| 554 | 3300041503 | Ga0451847_0854739 | Ga0451847_0854739_301_780 | 159 |
| 555 | 3300041505 | Ga0451849_1020839 | Ga0451849_1020839_23_502 | 159 |
| 556 | 3300041505 | Ga0451849_1110510 | Ga0451849_1110510_288_767 | 159 |
| 557 | 3300041507 | Ga0451851_0128736 | Ga0451851_0128736_301_780 | 159 |
| 558 | 3300041509 | Ga0451843_0376551 | Ga0451843_0376551_103_582 | 159 |
| 559 | 3300041510 | Ga0451854_35136 | Ga0451854_35136_113_592 | 159 |
| 560 | 3300041511 | Ga0451855_0299216 | Ga0451855_0299216_150_629 | 159 |
| 561 | 3300041511 | Ga0451855_1181368 | Ga0451855_1181368_168_647 | 159 |
| 562 | 3300041997 | Ga0439431_0190831 | Ga0439431_0190831_17_496 | 159 |
| 563 | 3300041999 | Ga0439433_0055096 | Ga0439433_0055096_274_753 | 159 |
| 564 | 3300042004 | Ga0439445_0008840 | Ga0439445_0008840_445_924 | 159 |
| 565 | 3300042004 | Ga0439445_0170173 | Ga0439445_0170173_43_522 | 159 |
| 566 | 3300042006 | Ga0439432_081275 | Ga0439432_081275_64_543 | 159 |
| 567 | 3300042007 | Ga0439449_0020678 | Ga0439449_0020678_609_1088 | 159 |
| 568 | 3300042007 | Ga0439449_0057537 | Ga0439449_0057537_50_589 | 159 |
| 569 | 3300042007 | Ga0439449_0100535 | Ga0439449_0100535_334_813 | 159 |
| 570 | 3300042007 | Ga0439449_0168354 | Ga0439449_0168354_128_607 | 159 |
| 571 | 3300042014 | Ga0439457_034662 | Ga0439457_034662_343_822 | 159 |
| 572 | 3300042014 | Ga0439457_069883 | Ga0439457_069883_273_752 | 159 |
| 573 | 3300042015 | Ga0439462_0005625 | Ga0439462_0005625_402_881 | 159 |
| 574 | 3300042015 | Ga0439462_0055602 | Ga0439462_0055602_348_827 | 159 |
| 575 | 3300042145 | Ga0450906_004354 | Ga0450906_004354_473_952 | 159 |
| 576 | 3300042531 | Ga0450918_003289 | Ga0450918_003289_1188_1667 | 159 |
| 577 | 3300044694 | Ga0466963_0187220 | Ga0466963_0187220_472_951 | 159 |
| 578 | 3300044735 | Ga0466968_0017396 | Ga0466968_0017396_686_1165 | 159 |
| 579 | 3300044765 | Ga0466970_0143154 | Ga0466970_0143154_509_988 | 159 |
| 580 | 3300044842 | Ga0466957_0153228 | Ga0466957_0153228_297_776 | 159 |
| 581 | 3300045976 | Ga0466967_0435537 | Ga0466967_0435537_478_1047 | 159 |
| 582 | 3300045976 | Ga0466967_0664129 | Ga0466967_0664129_387_866 | 159 |
| 583 | 3300045976 | Ga0466967_0857643 | Ga0466967_0857643_315_794 | 159 |
| 584 | 3300046452 | Ga0495617_005988 | Ga0495617_005988_1981_2460 | 159 |
| 585 | 3300046457 | Ga0495590_0015070 | Ga0495590_0015070_236_715 | 159 |
| 586 | 3300046457 | Ga0495590_0051291 | Ga0495590_0051291_432_911 | 159 |
| 587 | 3300046460 | Ga0495638_0002531 | Ga0495638_0002531_8183_8662 | 159 |
| 588 | 3300046460 | Ga0495638_0094981 | Ga0495638_0094981_733_1212 | 159 |
| 589 | 3300046471 | Ga0495650_0118103 | Ga0495650_0118103_105_584 | 159 |
| 590 | 3300046474 | Ga0495605_0000839 | Ga0495605_0000839_12283_12762 | 159 |
| 591 | 3300046476 | Ga0495662_0161966 | Ga0495662_0161966_168_647 | 159 |
| 592 | 3300046492 | Ga0495585_0014511 | Ga0495585_0014511_1810_2289 | 159 |
| 593 | 3300046492 | Ga0495585_0016074 | Ga0495585_0016074_428_907 | 159 |
| 594 | 3300046501 | Ga0495607_0202514 | Ga0495607_0202514_213_737 | 159 |
| 595 | 3300046501 | Ga0495607_0365179 | Ga0495607_0365179_78_557 | 159 |
| 596 | 3300046506 | Ga0495583_0090651 | Ga0495583_0090651_437_916 | 159 |
| 597 | 3300046506 | Ga0495583_0160053 | Ga0495583_0160053_62_541 | 159 |
| 598 | 3300046507 | Ga0495606_0001947 | Ga0495606_0001947_19136_19636 | 159 |
| 599 | 3300046507 | Ga0495606_0023345 | Ga0495606_0023345_276_755 | 159 |
| 600 | 3300046507 | Ga0495606_0046527 | Ga0495606_0046527_1286_1789 | 159 |
| 601 | 3300046507 | Ga0495606_0237906 | Ga0495606_0237906_191_670 | 159 |
| 602 | 3300046512 | Ga0495610_0102043 | Ga0495610_0102043_747_1226 | 159 |
| 603 | 3300046513 | Ga0495616_0035921 | Ga0495616_0035921_811_1290 | 159 |
| 604 | 3300046513 | Ga0495616_0090409 | Ga0495616_0090409_580_1059 | 159 |
| 605 | 3300046515 | Ga0495620_0020443 | Ga0495620_0020443_680_1183 | 159 |
| 606 | 3300046515 | Ga0495620_0052602 | Ga0495620_0052602_792_1271 | 159 |
| 607 | 3300046515 | Ga0495620_0064385 | Ga0495620_0064385_445_924 | 159 |
| 608 | 3300046518 | Ga0495631_0000375 | Ga0495631_0000375_23842_24321 | 159 |
| 609 | 3300046519 | Ga0495632_0006798 | Ga0495632_0006798_4834_5313 | 159 |
| 610 | 3300046522 | Ga0495643_0022175 | Ga0495643_0022175_1175_1654 | 159 |
| 611 | 3300046522 | Ga0495643_0025967 | Ga0495643_0025967_2495_2974 | 159 |
| 612 | 3300046522 | Ga0495643_0138843 | Ga0495643_0138843_134_658 | 159 |
| 613 | 3300046524 | Ga0495648_0091482 | Ga0495648_0091482_287_790 | 159 |
| 614 | 3300046524 | Ga0495648_0107718 | Ga0495648_0107718_563_1042 | 159 |
| 615 | 3300046524 | Ga0495648_0207077 | Ga0495648_0207077_132_611 | 159 |
| 616 | 3300046525 | Ga0495663_0040069 | Ga0495663_0040069_716_1195 | 159 |
| 617 | 3300046530 | Ga0495654_0301224 | Ga0495654_0301224_76_555 | 159 |
| 618 | 3300046538 | Ga0495609_0103373 | Ga0495609_0103373_306_785 | 159 |
| 619 | 3300046542 | Ga0495597_0011753 | Ga0495597_0011753_2525_3004 | 159 |
| 620 | 3300046558 | Ga0495633_0020507 | Ga0495633_0020507_2102_2581 | 159 |
| 621 | 3300046616 | Ga0495668_0007895 | Ga0495668_0007895_1545_2024 | 159 |
| 622 | 3300046616 | Ga0495668_0037619 | Ga0495668_0037619_199_678 | 159 |
| 623 | 3300046616 | Ga0495668_0136847 | Ga0495668_0136847_639_1142 | 159 |
| 624 | 3300046648 | Ga0495611_0007176 | Ga0495611_0007176_807_1286 | 159 |
| 625 | 3300046648 | Ga0495611_0395127 | Ga0495611_0395127_57_536 | 159 |
| 626 | 3300046660 | Ga0495625_0033539 | Ga0495625_0033539_1181_1660 | 159 |
| 627 | 3300046660 | Ga0495625_0060124 | Ga0495625_0060124_492_971 | 159 |
| 628 | 3300046660 | Ga0495625_0253865 | Ga0495625_0253865_133_612 | 159 |
| 629 | 3300046660 | Ga0495625_0428701 | Ga0495625_0428701_15_494 | 159 |
| 630 | 3300046660 | Ga0495625_0588212 | Ga0495625_0588212_133_612 | 159 |
| 631 | 3300046665 | Ga0495661_0273255 | Ga0495661_0273255_239_718 | 159 |
| 632 | 3300046674 | Ga0495588_0026546 | Ga0495588_0026546_137_616 | 159 |
| 633 | 3300046674 | Ga0495588_0030853 | Ga0495588_0030853_1980_2459 | 159 |
| 634 | 3300046675 | Ga0495657_0236328 | Ga0495657_0236328_488_967 | 159 |
| 635 | 3300046691 | Ga0495670_0118856 | Ga0495670_0118856_594_1073 | 159 |
| 636 | 3300046691 | Ga0495670_0154437 | Ga0495670_0154437_674_1153 | 159 |
| 637 | 3300046694 | Ga0495649_0004881 | Ga0495649_0004881_885_1364 | 159 |
| 638 | 3300046694 | Ga0495649_0030379 | Ga0495649_0030379_1223_1702 | 159 |
| 639 | 3300046810 | Ga0495660_0085457 | Ga0495660_0085457_671_1150 | 159 |
| 640 | 3300046810 | Ga0495660_0099765 | Ga0495660_0099765_960_1439 | 159 |
| 641 | 3300047317 | Ga0495604_0290825 | Ga0495604_0290825_208_687 | 159 |
| 642 | 3300047318 | Ga0495636_0138244 | Ga0495636_0138244_235_714 | 159 |
| 643 | 3300047318 | Ga0495636_0556328 | Ga0495636_0556328_68_547 | 159 |
| 644 | 3300047320 | Ga0495672_0022787 | Ga0495672_0022787_212_691 | 159 |
| 645 | 3300047320 | Ga0495672_0084243 | Ga0495672_0084243_424_903 | 159 |
| 646 | 3300047443 | Ga0495687_063388 | Ga0495687_063388_590_1069 | 159 |
| 647 | 3300047446 | Ga0495679_053875 | Ga0495679_053875_123_602 | 159 |
| 648 | 3300047472 | Ga0495686_0003461 | Ga0495686_0003461_2366_2866 | 159 |
| 649 | 3300047472 | Ga0495686_0028813 | Ga0495686_0028813_1236_1736 | 159 |
| 650 | 3300047472 | Ga0495686_0030555 | Ga0495686_0030555_847_1404 | 159 |
| 651 | 3300047472 | Ga0495686_0036792 | Ga0495686_0036792_1105_1584 | 159 |
| 652 | 3300047472 | Ga0495686_0293505 | Ga0495686_0293505_243_722 | 159 |
| 653 | 3300047472 | Ga0495686_0569409 | Ga0495686_0569409_15_494 | 159 |
| 654 | 3300048090 | Ga0495615_0048901 | Ga0495615_0048901_38_517 | 159 |
| 655 | 3300048091 | Ga0495626_0068568 | Ga0495626_0068568_434_913 | 159 |
| 656 | 3300048904 | Ga0496101_0011657 | Ga0496101_0011657_814_1293 | 159 |
| 657 | 3300048904 | Ga0496101_0155478 | Ga0496101_0155478_1169_1648 | 159 |
| 658 | 3300048904 | Ga0496101_0696203 | Ga0496101_0696203_137_616 | 159 |
| 659 | 3300048905 | Ga0496102_0016755 | Ga0496102_0016755_482_961 | 159 |
| 660 | 3300048905 | Ga0496102_1763904 | Ga0496102_1763904_34_513 | 159 |
| 661 | 3300048906 | Ga0496103_0145406 | Ga0496103_0145406_504_983 | 159 |
| 662 | 3300048909 | Ga0496106_0003275 | Ga0496106_0003275_835_1314 | 159 |
| 663 | 3300048909 | Ga0496106_0339538 | Ga0496106_0339538_450_929 | 159 |
| 664 | 3300048913 | Ga0496110_0132425 | Ga0496110_0132425_1417_1896 | 159 |
| 665 | 3300048913 | Ga0496110_0331341 | Ga0496110_0331341_211_711 | 159 |
| 666 | 3300048914 | Ga0496111_0004639 | Ga0496111_0004639_7595_8074 | 159 |
| 667 | 3300048916 | Ga0496113_0172590 | Ga0496113_0172590_1209_1688 | 159 |
| 668 | 3300048916 | Ga0496113_0214156 | Ga0496113_0214156_730_1209 | 159 |
| 669 | 3300048916 | Ga0496113_0993460 | Ga0496113_0993460_20_499 | 159 |
| 670 | 3300048917 | Ga0496114_0252577 | Ga0496114_0252577_610_1110 | 159 |
| 671 | 3300048917 | Ga0496114_1484558 | Ga0496114_1484558_75_554 | 159 |
| 672 | 3300048919 | Ga0496116_0004014 | Ga0496116_0004014_11354_11833 | 159 |
| 673 | 3300048919 | Ga0496116_0029898 | Ga0496116_0029898_1456_1935 | 159 |
| 674 | 3300048919 | Ga0496116_0235391 | Ga0496116_0235391_196_675 | 159 |
| 675 | 3300048920 | Ga0496117_0001675 | Ga0496117_0001675_24993_25472 | 159 |
| 676 | 3300048920 | Ga0496117_0010155 | Ga0496117_0010155_2467_2946 | 159 |
| 677 | 3300048920 | Ga0496117_0028469 | Ga0496117_0028469_2611_3090 | 159 |
| 678 | 3300048920 | Ga0496117_0060488 | Ga0496117_0060488_847_1326 | 159 |
| 679 | 3300048920 | Ga0496117_0149729 | Ga0496117_0149729_366_845 | 159 |
| 680 | 3300048920 | Ga0496117_0238795 | Ga0496117_0238795_320_799 | 159 |
| 681 | 3300048920 | Ga0496117_0353566 | Ga0496117_0353566_127_606 | 159 |
| 682 | 3300048921 | Ga0496118_0005907 | Ga0496118_0005907_758_1237 | 159 |
| 683 | 3300048921 | Ga0496118_0018004 | Ga0496118_0018004_3462_3941 | 159 |
| 684 | 3300048921 | Ga0496118_0053917 | Ga0496118_0053917_1893_2372 | 159 |
| 685 | 3300048921 | Ga0496118_0153714 | Ga0496118_0153714_504_983 | 159 |
| 686 | 3300048922 | Ga0496119_0010381 | Ga0496119_0010381_1994_2473 | 159 |
| 687 | 3300048922 | Ga0496119_0028043 | Ga0496119_0028043_2862_3341 | 159 |
| 688 | 3300048922 | Ga0496119_0048643 | Ga0496119_0048643_1882_2361 | 159 |
| 689 | 3300048923 | Ga0496120_0011761 | Ga0496120_0011761_758_1237 | 159 |
| 690 | 3300048924 | Ga0496121_0023159 | Ga0496121_0023159_758_1237 | 159 |
| 691 | 3300048924 | Ga0496121_0027344 | Ga0496121_0027344_3069_3569 | 159 |
| 692 | 3300048924 | Ga0496121_0043849 | Ga0496121_0043849_2654_3133 | 159 |
| 693 | 3300048924 | Ga0496121_0048646 | Ga0496121_0048646_3026_3505 | 159 |
| 694 | 3300048924 | Ga0496121_0060980 | Ga0496121_0060980_58_537 | 159 |
| 695 | 3300048924 | Ga0496121_0096979 | Ga0496121_0096979_99_578 | 159 |
| 696 | 3300048924 | Ga0496121_0198212 | Ga0496121_0198212_630_1109 | 159 |
| 697 | 3300048924 | Ga0496121_0235141 | Ga0496121_0235141_343_822 | 159 |
| 698 | 3300048924 | Ga0496121_0246688 | Ga0496121_0246688_629_1108 | 159 |
| 699 | 3300048924 | Ga0496121_0285232 | Ga0496121_0285232_101_580 | 159 |
| 700 | 3300048925 | Ga0496122_0000777 | Ga0496122_0000777_55121_55600 | 159 |
| 701 | 3300048925 | Ga0496122_0007570 | Ga0496122_0007570_400_879 | 159 |
| 702 | 3300048925 | Ga0496122_0010344 | Ga0496122_0010344_1239_1718 | 159 |
| 703 | 3300048925 | Ga0496122_0019424 | Ga0496122_0019424_2711_3190 | 159 |
| 704 | 3300048925 | Ga0496122_0019830 | Ga0496122_0019830_3681_4160 | 159 |
| 705 | 3300048925 | Ga0496122_0041920 | Ga0496122_0041920_1029_1508 | 159 |
| 706 | 3300048925 | Ga0496122_0098191 | Ga0496122_0098191_710_1189 | 159 |
| 707 | 3300048925 | Ga0496122_0141589 | Ga0496122_0141589_843_1322 | 159 |
| 708 | 3300048925 | Ga0496122_0203257 | Ga0496122_0203257_51_530 | 159 |
| 709 | 3300048926 | Ga0496123_0000519 | Ga0496123_0000519_56130_56609 | 159 |
| 710 | 3300048926 | Ga0496123_0022279 | Ga0496123_0022279_2384_2863 | 159 |
| 711 | 3300048926 | Ga0496123_0025267 | Ga0496123_0025267_488_967 | 159 |
| 712 | 3300048926 | Ga0496123_0026543 | Ga0496123_0026543_2140_2619 | 159 |
| 713 | 3300048926 | Ga0496123_0079855 | Ga0496123_0079855_713_1192 | 159 |
| 714 | 3300048926 | Ga0496123_0123005 | Ga0496123_0123005_175_654 | 159 |
| 715 | 3300048927 | Ga0496124_0000574 | Ga0496124_0000574_44007_44486 | 159 |
| 716 | 3300048927 | Ga0496124_0010139 | Ga0496124_0010139_1919_2398 | 159 |
| 717 | 3300048927 | Ga0496124_0011802 | Ga0496124_0011802_2348_2827 | 159 |
| 718 | 3300048927 | Ga0496124_0022544 | Ga0496124_0022544_2574_3053 | 159 |
| 719 | 3300048927 | Ga0496124_0057395 | Ga0496124_0057395_513_992 | 159 |
| 720 | 3300048927 | Ga0496124_0145769 | Ga0496124_0145769_1223_1702 | 159 |
| 721 | 3300048927 | Ga0496124_0203316 | Ga0496124_0203316_607_1086 | 159 |
| 722 | 3300048927 | Ga0496124_0621851 | Ga0496124_0621851_54_557 | 159 |
| 723 | 3300048928 | Ga0496125_0000790 | Ga0496125_0000790_42149_42628 | 159 |
| 724 | 3300048928 | Ga0496125_0070064 | Ga0496125_0070064_793_1272 | 159 |
| 725 | 3300048928 | Ga0496125_0074850 | Ga0496125_0074850_817_1296 | 159 |
| 726 | 3300048928 | Ga0496125_0132852 | Ga0496125_0132852_875_1354 | 159 |
| 727 | 3300048928 | Ga0496125_0145729 | Ga0496125_0145729_528_1007 | 159 |
| 728 | 3300048929 | Ga0496126_0000466 | Ga0496126_0000466_70833_71312 | 159 |
| 729 | 3300048929 | Ga0496126_0060122 | Ga0496126_0060122_2232_2711 | 159 |
| 730 | 3300048929 | Ga0496126_0205504 | Ga0496126_0205504_1091_1570 | 159 |
| 731 | 3300049459 | Ga0495678_062308 | Ga0495678_062308_659_1138 | 159 |
| 732 | 3300049459 | Ga0495678_090851 | Ga0495678_090851_450_929 | 159 |
| 733 | 3300049460 | Ga0495682_0018055 | Ga0495682_0018055_306_785 | 159 |
| 734 | 3300049568 | Ga0501031_0019286 | Ga0501031_0019286_2165_2644 | 159 |
| 735 | 3300049568 | Ga0501031_0111024 | Ga0501031_0111024_399_878 | 159 |
| 736 | 3300049569 | Ga0501032_0043928 | Ga0501032_0043928_1575_2108 | 159 |
| 737 | 3300049570 | Ga0501033_0082976 | Ga0501033_0082976_1597_2076 | 159 |
| 738 | 3300049570 | Ga0501033_0194743 | Ga0501033_0194743_320_799 | 159 |
| 739 | 3300049570 | Ga0501033_0522763 | Ga0501033_0522763_177_710 | 159 |
| 740 | 3300049571 | Ga0501034_0026144 | Ga0501034_0026144_3026_3505 | 159 |
| 741 | 3300049571 | Ga0501034_0106309 | Ga0501034_0106309_142_621 | 159 |
| 742 | 3300049571 | Ga0501034_0251041 | Ga0501034_0251041_113_592 | 159 |
| 743 | 3300049571 | Ga0501034_0463822 | Ga0501034_0463822_325_804 | 159 |
| 744 | 3300049571 | Ga0501034_0964367 | Ga0501034_0964367_16_549 | 159 |
| 745 | 3300049572 | Ga0501036_0219603 | Ga0501036_0219603_247_726 | 159 |
| 746 | 3300049572 | Ga0501036_0232296 | Ga0501036_0232296_848_1327 | 159 |
| 747 | 3300049573 | Ga0501037_0116744 | Ga0501037_0116744_85_564 | 159 |
| 748 | 3300049573 | Ga0501037_0168959 | Ga0501037_0168959_209_688 | 159 |
| 749 | 3300049574 | Ga0501038_0026508 | Ga0501038_0026508_236_715 | 159 |
| 750 | 3300049574 | Ga0501038_0091915 | Ga0501038_0091915_1570_2049 | 159 |
| 751 | 3300049574 | Ga0501038_0963358 | Ga0501038_0963358_131_610 | 159 |
| 752 | 3300049575 | Ga0501039_0242833 | Ga0501039_0242833_518_997 | 159 |
| 753 | 3300049575 | Ga0501039_0868789 | Ga0501039_0868789_15_494 | 159 |
| 754 | 3300049576 | Ga0501040_0289498 | Ga0501040_0289498_246_725 | 159 |
| 755 | 3300049577 | Ga0501041_0074743 | Ga0501041_0074743_774_1253 | 159 |
| 756 | 3300049578 | Ga0501042_0020859 | Ga0501042_0020859_661_1140 | 159 |
| 757 | 3300049579 | Ga0501043_0067906 | Ga0501043_0067906_1793_2272 | 159 |
| 758 | 3300049579 | Ga0501043_0154843 | Ga0501043_0154843_1105_1584 | 159 |
| 759 | 3300049579 | Ga0501043_0556238 | Ga0501043_0556238_116_595 | 159 |
| 760 | 3300049580 | Ga0501046_0032362 | Ga0501046_0032362_422_901 | 159 |
| 761 | 3300049580 | Ga0501046_0086897 | Ga0501046_0086897_1030_1563 | 159 |
| 762 | 3300049581 | Ga0501047_0029183 | Ga0501047_0029183_896_1429 | 159 |
| 763 | 3300049581 | Ga0501047_0064904 | Ga0501047_0064904_3027_3506 | 159 |
| 764 | 3300049581 | Ga0501047_0292116 | Ga0501047_0292116_373_852 | 159 |
| 765 | 3300049582 | Ga0501048_0011044 | Ga0501048_0011044_4136_4615 | 159 |
| 766 | 3300049583 | Ga0501067_0022697 | Ga0501067_0022697_2379_2858 | 159 |
| 767 | 3300049584 | Ga0501068_0037470 | Ga0501068_0037470_2197_2676 | 159 |
| 768 | 3300049584 | Ga0501068_0682675 | Ga0501068_0682675_174_653 | 159 |
| 769 | 3300049586 | Ga0501070_0044862 | Ga0501070_0044862_2631_3110 | 159 |
| 770 | 3300049587 | Ga0501071_0053381 | Ga0501071_0053381_1232_1711 | 159 |
| 771 | 3300049589 | Ga0501073_0032824 | Ga0501073_0032824_889_1368 | 159 |
| 772 | 3300049589 | Ga0501073_0053843 | Ga0501073_0053843_734_1267 | 159 |
| 773 | 3300049741 | Ga0501079_0281217 | Ga0501079_0281217_236_715 | 159 |
| 774 | 3300049744 | Ga0501083_0057375 | Ga0501083_0057375_1875_2408 | 159 |
| 775 | 3300049744 | Ga0501083_0169980 | Ga0501083_0169980_658_1137 | 159 |
| 776 | 3300049822 | Ga0501035_0010541 | Ga0501035_0010541_3767_4246 | 159 |
| 777 | 3300049822 | Ga0501035_0062185 | Ga0501035_0062185_227_706 | 159 |
| 778 | 3300049823 | Ga0501044_0038105 | Ga0501044_0038105_4267_4746 | 159 |
| 779 | 3300049823 | Ga0501044_0094855 | Ga0501044_0094855_1941_2420 | 159 |
| 780 | 3300049823 | Ga0501044_0150577 | Ga0501044_0150577_598_1077 | 159 |
| 781 | 3300049823 | Ga0501044_0254180 | Ga0501044_0254180_825_1304 | 159 |
| 782 | 3300049824 | Ga0501045_0005925 | Ga0501045_0005925_4745_5224 | 159 |
| 783 | 3300050492 | nmdc:mga0yw44_41508_c1 | nmdc:mga0yw44_41508_c1_1977_2456 | 159 |
| 784 | 3300050493 | nmdc:mga0k408_22809_c1 | nmdc:mga0k408_22809_c1_968_1447 | 159 |
| 785 | 3300050494 | nmdc:mga06z11_7641_c1 | nmdc:mga06z11_7641_c1_1943_2422 | 159 |
| 786 | 3300050496 | nmdc:mga07m45_40598_c1 | nmdc:mga07m45_40598_c1_538_1017 | 159 |
| 787 | 3300050516 | nmdc:mga0sz30_75994_c1 | nmdc:mga0sz30_75994_c1_665_1144 | 159 |
| 788 | 3300050516 | nmdc:mga0sz30_89954_c1 | nmdc:mga0sz30_89954_c1_542_1021 | 159 |
| 789 | 3300053079 | Ga0500610_0099306 | Ga0500610_0099306_592_1071 | 159 |
| 790 | 3300053086 | Ga0500578_0051786 | Ga0500578_0051786_2074_2553 | 159 |
| 791 | 3300053086 | Ga0500578_0541689 | Ga0500578_0541689_18_497 | 159 |
| 792 | 3300053087 | Ga0500643_049242 | Ga0500643_049242_609_1088 | 159 |
| 793 | 3300053104 | Ga0500556_0071340 | Ga0500556_0071340_142_621 | 159 |
| 794 | 3300053109 | Ga0500569_023739 | Ga0500569_023739_698_1177 | 159 |
| 795 | 3300053109 | Ga0500569_093176 | Ga0500569_093176_364_843 | 159 |
| 796 | 3300053118 | Ga0500594_0029192 | Ga0500594_0029192_340_819 | 159 |
| 797 | 3300053118 | Ga0500594_0038369 | Ga0500594_0038369_263_742 | 159 |
| 798 | 3300053120 | Ga0500597_160443 | Ga0500597_160443_244_723 | 159 |
| 799 | 3300053125 | Ga0500618_003843 | Ga0500618_003843_2064_2588 | 159 |
| 800 | 3300053125 | Ga0500618_007517 | Ga0500618_007517_175_654 | 159 |
| 801 | 3300053134 | Ga0500658_0002072 | Ga0500658_0002072_2003_2482 | 159 |
| 802 | 3300053134 | Ga0500658_0004778 | Ga0500658_0004778_3740_4219 | 159 |
| 803 | 3300053139 | Ga0500568_0004625 | Ga0500568_0004625_5929_6408 | 159 |
| 804 | 3300053139 | Ga0500568_0007583 | Ga0500568_0007583_4204_4683 | 159 |
| 805 | 3300053139 | Ga0500568_0035878 | Ga0500568_0035878_193_735 | 159 |
| 806 | 3300053139 | Ga0500568_0076787 | Ga0500568_0076787_708_1187 | 159 |
| 807 | 3300053142 | Ga0500577_0183323 | Ga0500577_0183323_270_749 | 159 |
| 808 | 3300053151 | Ga0500604_0103018 | Ga0500604_0103018_414_893 | 159 |
| 809 | 3300053153 | Ga0500616_0001463 | Ga0500616_0001463_21541_22020 | 159 |
| 810 | 3300053153 | Ga0500616_0043989 | Ga0500616_0043989_149_628 | 159 |
| 811 | 3300053156 | Ga0500622_0002296 | Ga0500622_0002296_10801_11280 | 159 |
| 812 | 3300053158 | Ga0500627_0431995 | Ga0500627_0431995_11_490 | 159 |
| 813 | 3300053160 | Ga0500633_0034799 | Ga0500633_0034799_560_1039 | 159 |
| 814 | 3300053727 | Ga0500611_133181 | Ga0500611_133181_143_622 | 159 |
| 815 | 3300059646 | Ga0587078_015009 | Ga0587078_015009_114_593 | 159 |
| 816 | 3300060353 | Ga0501082_0716774 | Ga0501082_0716774_110_643 | 159 |
| 817 | 3300061719 | Ga0466962_0184563 | Ga0466962_0184563_17_496 | 159 |
| 818 | iso_pu_bacteria | 2718218365 | 2721160369 | 159 |
| 819 | iso_pu_bacteria | 2728369397 | 2730300001 | 159 |
| 820 | iso_pu_bacteria | 2791355264 | 2793346496 | 159 |
| 821 | iso_pu_bacteria | 2842285085 | 2842288395 | 159 |
| 822 | iso_pu_bacteria | 2842402390 | 2842406259 | 159 |
| 823 | iso_pu_bacteria | 2842409023 | 2842412844 | 159 |
| 824 | iso_pu_bacteria | 2842415677 | 2842419277 | 159 |
| 825 | iso_pu_bacteria | 8005282627 | 8005286861 | 159 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7t30-assembly1.cif.gz_H | structure of electron bifurcating ni-fe hydrogenase complex hydabcsl in fmn/nad(h) bound state | 0.9075 | 9 | 77 |
| 7t30-assembly1.cif.gz_H | structure of electron bifurcating ni-fe hydrogenase complex hydabcsl in fmn/nad(h) bound state | 0.8615 | 9 | 77 |
| 7p92-assembly1.cif.gz_B | tmhydabc- t. maritima bifurcating hydrogenase with bridge domain up | 0.8325 | 77 | 158 |
| 7p8n-assembly1.cif.gz_B | tmhydabc- t. maritima hydrogenase with bridge closed | 0.8276 | 79 | 155 |
| 7p5h-assembly1.cif.gz_b | tmhydabc- d2 map | 0.8155 | 77 | 158 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9D6J6_126_223_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9673 | 76 | 156 | 3.40.30.10 |
| af_P0AFD1_83_165_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9576 | 75 | 156 | 3.40.30.10 |
| 3iamB01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;NADH-quinone oxidoreductase subunit E | 0.9553 | 28 | 75 | 1.10.10.1590 |
| af_A4HX94_128_234_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9541 | 76 | 158 | 3.40.30.10 |
| af_P9WIV5_106_200_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9433 | 76 | 158 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W7Z118-F1-model_v4 | Formate dehydrogenase subunit gamma | 0.8283 | 12 | 159 |
GO:0016491
GO:0046872 GO:0051537 |
| AF-A0A6A7Y881-F1-model_v4 | Formate dehydrogenase subunit gamma | 0.8262 | 11 | 157 |
GO:0016491
GO:0046872 GO:0051537 |
| AF-A0A1M5MYF5-F1-model_v4 | Formate dehydrogenase gamma subunit | 0.8261 | 11 | 159 |
GO:0016491
GO:0046872 GO:0051537 |
| AF-A0A1M7SUZ6-F1-model_v4 | Formate dehydrogenase gamma subunit | 0.825 | 12 | 159 |
GO:0016491
GO:0046872 GO:0051537 |
| AF-A0A0A8K1J0-F1-model_v4 | NAD-dependent formate dehydrogenase gamma subunit | 0.8242 | 11 | 159 |
GO:0016491
GO:0046872 GO:0051537 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar