F482413

General Info

Members Datasets Scaffolds Average Seq Length
825 546 543 158

Family's Representative Sequence

Representative Sequence 3300003775|Ga0055524_1039276|Ga0055524_10392762
Length 192
Sequence LRPASLRQFDRIRNDIGSFAVFKEFAGRKGELLMNIRVAHGDITGRIRSIVDDLRSLEGPLLPILHQIQEQFGYVPQEALPVISEELNLSRAEVHGVVTFYHDYRDHPAGRHVLKLCRAEACQSMGGDALAERIKALLGIDFHQTTLDGSVTLEPVYCLGLCACAPAVVLDGEVHGRVDGELAAELVAGARR

Samples

Sample ID Description Type Environment
1 2509276019 Ensifer aridi TW10 Isolate Nodule
2 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
3 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
4 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
5 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
6 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
7 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
8 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
9 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
10 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
11 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
12 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
13 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
14 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
15 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
16 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
17 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
18 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
19 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
20 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
21 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
22 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
23 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
24 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
25 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
26 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
27 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
28 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
29 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
30 2519899620 Rhizobium sp. Pop5 Isolate Nodule
31 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
32 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
33 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
34 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
35 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
36 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
37 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
38 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
39 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
40 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
41 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
42 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
43 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
44 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
45 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
46 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
47 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
48 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
49 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
50 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
51 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
52 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
53 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
54 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
55 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
56 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
57 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
58 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
59 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
60 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
61 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
62 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
63 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
64 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
65 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
66 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
67 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
68 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
69 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
70 2643221558 Rhizobium sp. Root149 Isolate Unclassified
71 2643221568 Rhizobium sp. Root564 Isolate Unclassified
72 2643221599 Rhizobium sp. Root708 Isolate Unclassified
73 2643221607 Rhizobium sp. Root73 Isolate Unclassified
74 2643221618 Ensifer sp. Root231 Isolate Unclassified
75 2643221626 Ensifer sp. Root31 Isolate Unclassified
76 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
77 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
78 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
79 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
80 2643221655 Ensifer sp. Root1252 Isolate Unclassified
81 2643221659 Ensifer sp. Root127 Isolate Unclassified
82 2643221668 Ensifer sp. Root423 Isolate Unclassified
83 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
84 2643221688 Rhizobium sp. Root482 Isolate Unclassified
85 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
86 2643221698 Ensifer sp. Root142 Isolate Unclassified
87 2643221712 Ensifer sp. Root258 Isolate Unclassified
88 2643221718 Rhizobium sp. Root268 Isolate Unclassified
89 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
90 2718217882 Rhizobium sp. N741 Isolate Nodule
91 2718217927 Rhizobium sp. N324 Isolate Nodule
92 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
93 2718218009 Rhizobium sp. N561 Isolate Nodule
94 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
95 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
96 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
97 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
98 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
99 2718218363 Rhizobium sp. N113 Isolate Nodule
100 2718218365 Rhizobium sp. N731 Isolate Nodule
101 2718218366 Rhizobium sp. N621 Isolate Nodule
102 2718218423 Rhizobium sp. N941 Isolate Nodule
103 2721755514 Rhizobium sp. N6212 Isolate Nodule
104 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
105 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
106 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
107 2721755809 Rhizobium sp. N541 Isolate Nodule
108 2721755810 Rhizobium sp. N871 Isolate Nodule
109 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
110 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
111 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
112 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
113 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
114 2728369365 Rhizobium sp. N1341 Isolate Nodule
115 2728369397 Rhizobium sp. N1314 Isolate Nodule
116 2738541293 Rhizobium sp. GV031 Isolate Unclassified
117 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
118 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
119 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
120 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
121 2791355256 Rhizobium sp. M10 Isolate Nodule
122 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
123 2791355260 Rhizobium sp. L9 Isolate Nodule
124 2791355261 Rhizobium sp. J15 Isolate Nodule
125 2791355262 Rhizobium sp. M1 Isolate Nodule
126 2791355263 Rhizobium chutanense C5 Isolate Nodule
127 2791355264 Rhizobium sp. S9 Isolate Nodule
128 2791355265 Rhizobium sp. H4 Isolate Nodule
129 2791355266 Rhizobium sp. L43 Isolate Nodule
130 2791355267 Rhizobium sp. L18 Isolate Nodule
131 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
132 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
133 2802429633 Rhizobium anhuiense J3 Isolate Nodule
134 2802429634 Rhizobium anhuiense S10 Isolate Nodule
135 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
136 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
137 2802429637 Rhizobium anhuiense C15 Isolate Nodule
138 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
139 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
140 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
141 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
142 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
143 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
144 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
145 2838048938 Rhizobium pisi 27/80 Isolate Nodule
146 2838061910 Rhizobium phaseoli L15 Isolate Nodule
147 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
148 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
149 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
150 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
151 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
152 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
153 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
154 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
155 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
156 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
157 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
158 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
159 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
160 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
161 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
162 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
163 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
164 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
165 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
166 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
167 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
168 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
169 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
170 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
171 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
172 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
173 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
174 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
175 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
176 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
177 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
178 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
179 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
180 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
181 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
182 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
183 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
184 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
185 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
186 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
187 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
188 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
189 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
190 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
191 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
192 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
193 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
194 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
195 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
196 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
197 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
198 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
199 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
200 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
201 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
202 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
203 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
204 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
205 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
206 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
207 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
208 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
209 2844163670 Ensifer sp. 1H6 Isolate Unclassified
210 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
211 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
212 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
213 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
214 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
215 2899275550 Paracoccus hibiscisoli CCTCC AB2016182 Isolate Rhizosphere
216 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
217 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
218 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
219 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
220 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
221 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
222 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
223 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
224 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
225 2933599457 Rhizobium phaseoli M3 Isolate Nodule
226 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
227 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
228 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
229 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
230 2936381700 Rhizobium chutanense C16 Isolate Unclassified
231 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
232 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
233 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
234 2996887358 Rhizobium sp. R711 Isolate Nodule
235 2996893221 Rhizobium sp. R635 Isolate Nodule
236 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
237 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
238 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
239 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
240 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
241 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
242 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
243 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
244 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
245 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
246 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
247 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
248 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
249 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
250 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
251 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
252 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
253 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
254 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
255 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
256 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
257 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
258 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
259 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
260 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
261 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
262 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
263 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
264 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
265 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
266 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
267 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
268 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
269 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
270 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
271 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
272 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
273 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
274 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
275 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
276 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
277 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
278 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
279 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
280 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
281 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
282 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
283 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
284 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
285 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
286 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
287 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
288 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
289 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
290 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
291 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
292 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
293 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
294 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
295 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
296 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
297 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
298 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
299 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
300 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
301 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
302 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
303 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
304 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
305 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
306 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
307 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
308 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
309 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
310 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
311 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
312 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
313 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
314 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
315 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
316 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
317 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
318 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
319 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
320 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
321 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
326 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
327 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
328 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
329 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
330 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
331 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
332 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
333 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
334 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
335 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
336 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
337 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
338 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
339 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
340 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
341 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
342 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
343 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
344 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
345 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
346 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
347 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
348 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
349 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
350 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
351 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
352 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
353 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
354 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
355 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
356 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
357 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
358 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
359 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
360 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
361 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
362 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
363 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
364 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
365 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
366 3300041497 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT Metatranscriptome Unclassified
367 3300041502 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT Metatranscriptome Unclassified
368 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
369 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
370 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
371 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
372 3300041510 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaT Metatranscriptome Unclassified
373 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
374 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
375 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
376 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
377 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
378 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
379 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
380 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
381 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
382 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
383 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
384 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
385 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
386 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
387 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
388 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
389 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
390 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
391 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
392 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
393 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
394 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
395 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
396 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
397 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
398 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
399 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
400 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
401 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
402 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
403 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
404 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
405 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
406 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
407 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
408 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
409 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
410 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
411 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
412 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
413 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
414 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
415 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
416 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
417 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
418 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
419 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
420 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
421 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
422 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
423 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
424 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
425 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
426 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
427 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
428 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
429 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
430 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
431 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
432 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
433 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
434 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
435 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
436 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
437 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
438 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
439 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
440 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
441 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
442 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
443 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
444 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
445 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
446 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
447 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
448 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
449 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
450 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
451 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
452 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
453 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
454 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
455 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
456 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
457 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
458 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
459 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
460 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
461 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
462 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
463 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
464 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
465 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
466 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
467 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
468 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
469 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
470 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
471 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
472 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
473 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
474 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
475 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
476 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
477 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
478 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
479 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
480 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
481 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
482 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
483 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
484 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
485 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
486 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
487 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
488 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
489 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
490 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
491 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
492 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
493 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
494 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
495 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
496 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
497 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
498 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
499 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
500 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
501 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
502 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
503 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
504 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
505 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
506 8005258706 Rhizobium sp. R693 Isolate Nodule
507 8005275841 Rhizobium sp. N4311 Isolate Nodule
508 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
509 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
510 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
511 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
512 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
513 8005321885 Rhizobium sp. R72 Isolate Nodule
514 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
515 8005382845 Rhizobium sp. R634 Isolate Nodule
516 8005395548 Rhizobium sp. R339 Isolate Nodule
517 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
518 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
519 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
520 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
521 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
522 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
523 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
524 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
525 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
526 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
527 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
528 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
529 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
530 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
531 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
532 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
533 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
534 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
535 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
536 8018176218 Rhizobium sp. N122 Isolate Nodule
537 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
538 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
539 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
540 8024501048 Rhizobium sp. H4 Isolate Nodule
541 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
542 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
543 8056382006 Rhizobium croatiense 13T Isolate Nodule
544 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
545 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
546 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 65.09
Metatranscriptomes 0.73
Isolates 34.18

Biome Distribution

Category Percentage (%)
Aerial Root 0.12
Bulb 0
Endosphere 21.09
Nodule 23.15
Rhizoplane 2.91
Rhizosphere 33.94
Stem 0
Stem Tuber 0
Unclassified 18.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000066 3300001979 Bacteria 34178
2 JGI24739J22299_10144511 3300001989 Bacteria 704
3 JGI25155J39150_1000010 3300002704 Bacteria 207717
4 JGI25156J39149_1000033 3300002705 Bacteria 114688
5 JGI25162J39368_1002132 3300002737 Bacteria 8355
6 JGI25154J39366_1000058 3300002738 Bacteria 107363
7 JGI25158J39367_1000039 3300002739 Bacteria 29889
8 JGI25157J39369_1000009 3300002741 Bacteria 207868
9 JGI25152J39213_1003798 3300002773 Bacteria 5011
10 JGI25152J39213_1025070 3300002773 Bacteria 993
11 JGI25150J39212_1000028 3300002774 Bacteria 105831
12 JGI25150J39212_1002370 3300002774 Bacteria 4724
13 JGI25150J39212_1029801 3300002774 Bacteria 763
14 JGI25159J45721_1000241 3300002987 Bacteria 25864
15 JGI25159J45721_1002399 3300002987 Bacteria 7137
16 JGI25151J46595_10000123 3300003187 Bacteria 105339
17 JGI25151J46595_10003986 3300003187 Bacteria 7937
18 JGI25151J46595_10004252 3300003187 Bacteria 7616
19 JGI25151J46595_10016106 3300003187 Bacteria 3276
20 JGI25165J46597_1000935 3300003214 Bacteria 20060
21 JGI25165J46597_1000949 3300003214 Bacteria 19837
22 JGI25153J46596_10001187 3300003215 Bacteria 15732
23 JGI25153J46596_10004401 3300003215 Bacteria 7603
24 JGI25153J46596_10007873 3300003215 Bacteria 5173
25 JGI25153J46596_10020184 3300003215 Bacteria 2526
26 rootH1_10044838 3300003316 Bacteria 3652
27 rootH1_10052753 3300003316 Bacteria 1159
28 rootL2_10057936 3300003322 Bacteria 2824
29 rootL2_10158058 3300003322 Bacteria 1122
30 rootH1_10096654 3300003323 Bacteria 1571
31 rootH1_10130547 3300003323 Bacteria 4076
32 rootH1_10203432 3300003323 Bacteria 1961
33 rootH1_10228777 3300003323 Bacteria 1570
34 rootH1_10228778 3300003323 Bacteria 1382
35 JGI25160J50197_1000214 3300003354 Bacteria 47126
36 JGI25160J50197_1007275 3300003354 Bacteria 4352
37 JGI25160J50197_1009767 3300003354 Bacteria 3527
38 JGI25161J50226_1000158 3300003374 Bacteria 47126
39 JGI25161J50226_1000537 3300003374 Bacteria 16251
40 JGI25161J50226_1006184 3300003374 Bacteria 2206
41 Ga0055526_1002383 3300003771 Bacteria 12740
42 Ga0055526_1013480 3300003771 Bacteria 3452
43 Ga0055526_1016937 3300003771 Bacteria 2815
44 Ga0055524_1000988 3300003775 Bacteria 17749
45 Ga0055524_1008246 3300003775 Bacteria 4342
46 Ga0055524_1020400 3300003775 Bacteria 2233
47 Ga0055524_1039276 3300003775 Bacteria 1224
48 Ga0055524_1045703 3300003775 Bacteria 1050
49 Ga0055528_1000842 3300003790 Bacteria 20898
50 Ga0055528_1004809 3300003790 Bacteria 6426
51 Ga0055528_1006582 3300003790 Bacteria 5257
52 Ga0055528_1008361 3300003790 Bacteria 4447
53 Ga0055528_1012908 3300003790 Bacteria 3205
54 Ga0055530_10024053 3300003791 Bacteria 1737
55 Ga0055540_1000481 3300003792 Bacteria 30719
56 Ga0055540_1012734 3300003792 Bacteria 2617
57 Ga0055540_1054951 3300003792 Bacteria 810
58 Ga0055531_10010151 3300003794 Bacteria 4720
59 Ga0055543_1000099 3300004625 Bacteria 74883
60 Ga0055543_1000639 3300004625 Bacteria 18724
61 Ga0055543_1002383 3300004625 Bacteria 6258
62 Ga0065165_1000575 3300005262 Bacteria 54383
63 Ga0065165_1003905 3300005262 Bacteria 9848
64 Ga0065165_1012374 3300005262 Bacteria 3479
65 Ga0065165_1012576 3300005262 Bacteria 3434
66 Ga0065165_1040894 3300005262 Bacteria 1379
67 Ga0070669_100470113 3300005353 Bacteria 1039
68 Ga0070667_100168895 3300005367 Bacteria 1930
69 Ga0068853_100285895 3300005539 Bacteria 1521
70 Ga0070665_100006251 3300005548 Bacteria 12182
71 Ga0070665_100212438 3300005548 Bacteria 1935
72 Ga0068857_100614481 3300005577 Bacteria 1028
73 Ga0068856_100110337 3300005614 Bacteria 2748
74 Ga0068856_100380891 3300005614 Bacteria 1430
75 Ga0068852_100138863 3300005616 Bacteria 2247
76 Ga0081540_1045243 3300005983 Bacteria 2238
77 Ga0075365_10000978 3300006038 Bacteria 12183
78 Ga0075365_10278760 3300006038 Bacteria 1176
79 Ga0075363_100053454 3300006048 Bacteria 2158
80 Ga0075363_100553835 3300006048 Bacteria 686
81 Ga0075362_10024800 3300006177 Bacteria 2546
82 Ga0075362_10230894 3300006177 Bacteria 906
83 Ga0075362_10759680 3300006177 Bacteria 508
84 Ga0075367_10016233 3300006178 Bacteria 4065
85 Ga0075367_10337706 3300006178 Bacteria 950
86 Ga0075369_10101503 3300006186 Bacteria 1291
87 Ga0075369_10138022 3300006186 Bacteria 1110
88 Ga0075369_10138357 3300006186 Bacteria 1109
89 Ga0075369_10213038 3300006186 Bacteria 893
90 Ga0075370_10000922 3300006353 Bacteria 12070
91 Ga0075370_10020528 3300006353 Bacteria 3613
92 Ga0075370_10410697 3300006353 Bacteria 813
93 Ga0075370_10533563 3300006353 Bacteria 709
94 Ga0075370_10942811 3300006353 Bacteria 528
95 Ga0105240_10000013 3300009093 Bacteria 483458
96 Ga0105240_10188595 3300009093 Bacteria 2426
97 Ga0105240_10723746 3300009093 Bacteria 1084
98 Ga0105247_10044821 3300009101 Bacteria 2713
99 Ga0105237_10003586 3300009545 Bacteria 18364
100 Ga0105237_10282511 3300009545 Bacteria 1662
101 Ga0105237_10674156 3300009545 Bacteria 1041
102 Ga0105238_10345965 3300009551 Bacteria 1475
103 Ga0123341_1014142 3300009765 Bacteria 7168
104 Ga0123342_1012798 3300009766 Bacteria 8618
105 Ga0123342_1016598 3300009766 Bacteria 6364
106 Ga0105239_10005948 3300010375 Bacteria 14196
107 Ga0105239_10839219 3300010375 Bacteria 1053
108 Ga0157326_1031162 3300012513 Bacteria 707
109 Ga0157371_10022144 3300013102 Bacteria 4661
110 Ga0157370_10000209 3300013104 Bacteria 74351
111 Ga0157369_10202346 3300013105 Bacteria 2084
112 Ga0157369_10228530 3300013105 Bacteria 1946
113 Ga0157372_10697990 3300013307 Bacteria 1181
114 Ga0157379_10145466 3300014968 Bacteria 2138
115 Ga0182007_10003149 3300015262 Bacteria 7919
116 Ga0182005_1003085 3300015265 Bacteria 5746
117 Ga0163161_10522041 3300017792 Bacteria 970
118 Ga0209435_100009 3300025206 Bacteria 476614
119 Ga0209436_101288 3300025208 Bacteria 8944
120 Ga0209672_105717 3300025228 Bacteria 2103
121 Ga0209437_100057 3300025233 Bacteria 362922
122 Ga0209437_100107 3300025233 Bacteria 218656
123 Ga0209437_105749 3300025233 Bacteria 2099
124 Ga0207425_1000077 3300025245 Bacteria 105391
125 Ga0207425_1005700 3300025245 Bacteria 3512
126 Ga0209646_1000018 3300025246 Bacteria 476716
127 Ga0209646_1007130 3300025246 Bacteria 1842
128 Ga0209026_1000068 3300025250 Bacteria 207601
129 Ga0209677_100309 3300025253 Bacteria 31966
130 Ga0209759_1000007 3300025256 Bacteria 476614
131 Ga0209129_1000036 3300025258 Bacteria 328331
132 Ga0209129_1000118 3300025258 Bacteria 139972
133 Ga0209129_1002381 3300025258 Bacteria 9254
134 Ga0209129_1004334 3300025258 Bacteria 5599
135 Ga0209129_1010005 3300025258 Bacteria 2415
136 Ga0209233_1000072 3300025261 Bacteria 363074
137 Ga0209233_1000134 3300025261 Bacteria 202535
138 Ga0209233_1000440 3300025261 Bacteria 28932
139 Ga0209673_1000052 3300025273 Bacteria 279795
140 Ga0209673_1000158 3300025273 Bacteria 143067
141 Ga0209673_1000459 3300025273 Bacteria 68727
142 Ga0209673_1000997 3300025273 Bacteria 34532
143 Ga0209673_1007484 3300025273 Bacteria 5021
144 Ga0209673_1009902 3300025273 Bacteria 4075
145 Ga0209673_1032225 3300025273 Bacteria 1617
146 Ga0209673_1038068 3300025273 Bacteria 1405
147 Ga0209673_1063126 3300025273 Bacteria 915
148 Ga0209130_1000009 3300025284 Bacteria 498952
149 Ga0209130_1000132 3300025284 Bacteria 119765
150 Ga0209130_1028390 3300025284 Bacteria 1176
151 Ga0209675_1022813 3300025291 Bacteria 1636
152 Ga0209676_1004018 3300025292 Bacteria 8470
153 Ga0209676_1024673 3300025292 Bacteria 1941
154 Ga0209025_1000245 3300025294 Bacteria 127801
155 Ga0209025_1000329 3300025294 Bacteria 105391
156 Ga0209025_1000617 3300025294 Bacteria 63860
157 Ga0209025_1000871 3300025294 Bacteria 47697
158 Ga0209025_1002194 3300025294 Bacteria 21614
159 Ga0209564_1000569 3300025295 Bacteria 58592
160 Ga0209564_1000675 3300025295 Bacteria 50429
161 Ga0209564_1001411 3300025295 Bacteria 24774
162 Ga0209564_1002048 3300025295 Bacteria 17370
163 Ga0209758_1000259 3300025297 Bacteria 105391
164 Ga0209758_1000323 3300025297 Bacteria 92123
165 Ga0209758_1000948 3300025297 Bacteria 39099
166 Ga0209758_1003501 3300025297 Bacteria 14180
167 Ga0209758_1005770 3300025297 Bacteria 9291
168 Ga0209758_1007164 3300025297 Bacteria 7693
169 Ga0209758_1007169 3300025297 Bacteria 7690
170 Ga0209050_1003683 3300025298 Bacteria 11051
171 Ga0209050_1004202 3300025298 Bacteria 9958
172 Ga0209256_1001406 3300025299 Bacteria 25009
173 Ga0209256_1001526 3300025299 Bacteria 23315
174 Ga0209256_1001728 3300025299 Bacteria 20930
175 Ga0209256_1009743 3300025299 Bacteria 4149
176 Ga0209256_1012230 3300025299 Bacteria 3318
177 Ga0209256_1051104 3300025299 Bacteria 999
178 Ga0207426_1000041 3300025302 Bacteria 433536
179 Ga0207426_1000246 3300025302 Bacteria 119765
180 Ga0207426_1000761 3300025302 Bacteria 35881
181 Ga0209051_1000863 3300025303 Bacteria 30781
182 Ga0209051_1000871 3300025303 Bacteria 30516
183 Ga0209051_1018016 3300025303 Bacteria 3140
184 Ga0209051_1074658 3300025303 Bacteria 1004
185 Ga0209257_1002861 3300025304 Bacteria 16111
186 Ga0209257_1006330 3300025304 Bacteria 7698
187 Ga0209257_1026753 3300025304 Bacteria 1935
188 Ga0209257_1086265 3300025304 Bacteria 794
189 Ga0207654_10103960 3300025911 Bacteria 1755
190 Ga0207695_10000044 3300025913 Bacteria 440819
191 Ga0207695_10054872 3300025913 Bacteria 4157
192 Ga0207695_10135283 3300025913 Bacteria 2418
193 Ga0207695_10744198 3300025913 Unclassified 861
194 Ga0207671_10000226 3300025914 Bacteria 84886
195 Ga0207671_10339929 3300025914 Bacteria 1189
196 Ga0207681_10087654 3300025923 Bacteria 2215
197 Ga0207694_10366022 3300025924 Bacteria 1195
198 Ga0207664_10990612 3300025929 Bacteria 753
199 Ga0207709_10243111 3300025935 Bacteria 1310
200 Ga0207667_10431503 3300025949 Bacteria 1340
201 Ga0207668_10605294 3300025972 Bacteria 955
202 Ga0207658_10086035 3300025986 Bacteria 2423
203 Ga0207702_10087884 3300026078 Bacteria 2715
204 Ga0207698_10082011 3300026142 Bacteria 2606
205 Ga0207698_10586597 3300026142 Bacteria 1097
206 Ga0209371_1031992 3300027312 Bacteria 1135
207 Ga0268266_10116451 3300028379 Bacteria 2373
208 Ga0268266_10189212 3300028379 Bacteria 1878
209 Ga0268266_10776527 3300028379 Bacteria 925
210 Ga0268266_11788887 3300028379 Bacteria 589
211 Ga0307515_10000377 3300028794 Bacteria 109082
212 Ga0307515_10001840 3300028794 Bacteria 47276
213 Ga0307515_10013206 3300028794 Bacteria 15453
214 Ga0268256_1036395 3300030500 Bacteria 1135
215 Ga0307513_10002147 3300031456 Bacteria 27587
216 Ga0307513_10023038 3300031456 Bacteria 7289
217 Ga0307408_100035018 3300031548 Bacteria 3521
218 Ga0307408_100287431 3300031548 Bacteria 1372
219 Ga0307406_10003800 3300031901 Bacteria 8220
220 Ga0307412_10001541 3300031911 Bacteria 12737
221 Ga0307412_10175757 3300031911 Bacteria 1605
222 Ga0307409_100144544 3300031995 Bacteria 2055
223 Ga0307416_101605593 3300032002 Bacteria 755
224 Ga0307414_10068133 3300032004 Bacteria 2552
225 Ga0307411_10802872 3300032005 Bacteria 829
226 Ga0316593_10223636 3300032168 Bacteria 700
227 Ga0373935_0446794 3300035692 Unclassified 933
228 Ga0373927_0000074 3300035695 Bacteria 72943
229 Ga0316582_0119491 3300036647 Bacteria 1762
230 Ga0316584_0336126 3300036712 Bacteria 1087
231 Ga0373925_0001779 3300037068 Bacteria 17996
232 Ga0395899_0000014 3300037312 Bacteria 488813
233 Ga0395900_0000007 3300037418 Bacteria 488860
234 Ga0395898_0000011 3300037466 Bacteria 488860
235 Ga0395905_0000008 3300037471 Bacteria 488860
236 Ga0395901_0000048 3300038443 Bacteria 174069
237 Ga0436363_1518595 3300039450 Bacteria 996
238 Ga0439436_0008125 3300041404 Bacteria 3225
239 Ga0439436_0010490 3300041404 Bacteria 2824
240 Ga0439439_0067584 3300041406 Bacteria 954
241 Ga0439461_0075817 3300041410 Bacteria 786
242 Ga0439466_0072559 3300041411 Bacteria 1094
243 Ga0439466_0080227 3300041411 Bacteria 1030
244 Ga0439465_0004431 3300041413 Bacteria 4545
245 Ga0439465_0009619 3300041413 Bacteria 3044
246 Ga0439465_0027912 3300041413 Bacteria 1789
247 Ga0439465_0124697 3300041413 Bacteria 905
248 Ga0451789_0976999 3300041443 Bacteria 537
249 Ga0451795_0141812 3300041456 Bacteria 1134
250 Ga0451833_0233035 3300041491 Bacteria 1245
251 Ga0451837_0488831 3300041494 Bacteria 661
252 Ga0451837_1525209 3300041494 Bacteria 1158
253 Ga0451840_08834 3300041497 Bacteria 669
254 Ga0451846_08075 3300041502 Bacteria 1032
255 Ga0451847_0854739 3300041503 Bacteria 898
256 Ga0451849_1020839 3300041505 Bacteria 651
257 Ga0451849_1110510 3300041505 Bacteria 781
258 Ga0451851_0128736 3300041507 Bacteria 982
259 Ga0451843_0376551 3300041509 Bacteria 1252
260 Ga0451854_35136 3300041510 Bacteria 956
261 Ga0451855_0299216 3300041511 Bacteria 2641
262 Ga0451855_1181368 3300041511 Bacteria 662
263 Ga0439431_0190831 3300041997 Bacteria 594
264 Ga0439433_0055096 3300041999 Bacteria 941
265 Ga0439445_0008840 3300042004 Bacteria 2366
266 Ga0439445_0170173 3300042004 Bacteria 638
267 Ga0439432_081275 3300042006 Bacteria 981
268 Ga0439449_0020678 3300042007 Bacteria 2466
269 Ga0439449_0057537 3300042007 Bacteria 1435
270 Ga0439449_0100535 3300042007 Bacteria 1069
271 Ga0439449_0168354 3300042007 Bacteria 818
272 Ga0439457_034662 3300042014 Bacteria 1122
273 Ga0439457_069883 3300042014 Bacteria 800
274 Ga0439462_0005625 3300042015 Bacteria 3095
275 Ga0439462_0055602 3300042015 Bacteria 1068
276 Ga0450906_004354 3300042145 Bacteria 2968
277 Ga0450918_003289 3300042531 Bacteria 3016
278 Ga0466963_0187220 3300044694 Bacteria 1446
279 Ga0466968_0017396 3300044735 Bacteria 2873
280 Ga0466970_0143154 3300044765 Bacteria 1318
281 Ga0466957_0153228 3300044842 Bacteria 1492
282 Ga0466967_0435537 3300045976 Bacteria 1279
283 Ga0466967_0664129 3300045976 Bacteria 1031
284 Ga0466967_0857643 3300045976 Bacteria 903
285 Ga0495617_005988 3300046452 Bacteria 4290
286 Ga0495590_0015070 3300046457 Bacteria 2813
287 Ga0495590_0051291 3300046457 Bacteria 1441
288 Ga0495638_0002531 3300046460 Bacteria 14872
289 Ga0495638_0024159 3300046460 Bacteria 3966
290 Ga0495638_0094981 3300046460 Bacteria 1791
291 Ga0495650_0118103 3300046471 Bacteria 978
292 Ga0495605_0000839 3300046474 Bacteria 21527
293 Ga0495662_0161966 3300046476 Bacteria 1102
294 Ga0495585_0014511 3300046492 Bacteria 4587
295 Ga0495585_0016074 3300046492 Bacteria 4338
296 Ga0495607_0202514 3300046501 Bacteria 981
297 Ga0495607_0365179 3300046501 Bacteria 663
298 Ga0495583_0090651 3300046506 Bacteria 1316
299 Ga0495583_0160053 3300046506 Bacteria 929
300 Ga0495606_0001947 3300046507 Bacteria 25522
301 Ga0495606_0023345 3300046507 Bacteria 4483
302 Ga0495606_0046527 3300046507 Bacteria 2867
303 Ga0495606_0237906 3300046507 Bacteria 1017
304 Ga0495610_0102043 3300046512 Bacteria 1283
305 Ga0495616_0035921 3300046513 Bacteria 2560
306 Ga0495616_0090409 3300046513 Bacteria 1450
307 Ga0495620_0020443 3300046515 Bacteria 3233
308 Ga0495620_0052602 3300046515 Bacteria 1729
309 Ga0495620_0064385 3300046515 Bacteria 1516
310 Ga0495631_0000375 3300046518 Bacteria 30704
311 Ga0495632_0006798 3300046519 Bacteria 7299
312 Ga0495643_0022175 3300046522 Bacteria 3627
313 Ga0495643_0025967 3300046522 Bacteria 3310
314 Ga0495643_0138843 3300046522 Bacteria 1214
315 Ga0495648_0091482 3300046524 Bacteria 1702
316 Ga0495648_0107718 3300046524 Bacteria 1523
317 Ga0495648_0207077 3300046524 Bacteria 977
318 Ga0495663_0040069 3300046525 Bacteria 1421
319 Ga0495654_0301224 3300046530 Bacteria 654
320 Ga0495609_0103373 3300046538 Bacteria 1233
321 Ga0495597_0011753 3300046542 Bacteria 4239
322 Ga0495633_0020507 3300046558 Bacteria 3323
323 Ga0495668_0007895 3300046616 Bacteria 6721
324 Ga0495668_0037619 3300046616 Bacteria 2707
325 Ga0495668_0136847 3300046616 Bacteria 1341
326 Ga0495611_0007176 3300046648 Bacteria 4736
327 Ga0495611_0395127 3300046648 Bacteria 632
328 Ga0495625_0033539 3300046660 Bacteria 3795
329 Ga0495625_0060124 3300046660 Bacteria 2693
330 Ga0495625_0253865 3300046660 Bacteria 1140
331 Ga0495625_0428701 3300046660 Bacteria 821
332 Ga0495625_0588212 3300046660 Bacteria 669
333 Ga0495661_0273255 3300046665 Bacteria 854
334 Ga0495588_0026546 3300046674 Bacteria 2893
335 Ga0495588_0030853 3300046674 Bacteria 2696
336 Ga0495657_0236328 3300046675 Bacteria 1104
337 Ga0495670_0118856 3300046691 Bacteria 1372
338 Ga0495670_0154437 3300046691 Bacteria 1204
339 Ga0495649_0004881 3300046694 Bacteria 8658
340 Ga0495649_0030379 3300046694 Bacteria 2984
341 Ga0495660_0085457 3300046810 Bacteria 1648
342 Ga0495660_0099765 3300046810 Bacteria 1496
343 Ga0495604_0290825 3300047317 Bacteria 1100
344 Ga0495636_0138244 3300047318 Bacteria 1087
345 Ga0495636_0556328 3300047318 Bacteria 558
346 Ga0495672_0022787 3300047320 Bacteria 4064
347 Ga0495672_0084243 3300047320 Bacteria 1764
348 Ga0495687_063388 3300047443 Bacteria 1513
349 Ga0495679_053875 3300047446 Bacteria 1200
350 Ga0495686_0003461 3300047472 Bacteria 13679
351 Ga0495686_0028813 3300047472 Bacteria 3615
352 Ga0495686_0030555 3300047472 Bacteria 3498
353 Ga0495686_0036792 3300047472 Bacteria 3140
354 Ga0495686_0293505 3300047472 Bacteria 900
355 Ga0495686_0569409 3300047472 Bacteria 590
356 Ga0495615_0048901 3300048090 Bacteria 1082
357 Ga0495626_0068568 3300048091 Bacteria 1599
358 Ga0496101_0011657 3300048904 Bacteria 5840
359 Ga0496101_0155478 3300048904 Bacteria 1752
360 Ga0496101_0696203 3300048904 Bacteria 802
361 Ga0496102_0016755 3300048905 Bacteria 6408
362 Ga0496102_1763904 3300048905 Bacteria 536
363 Ga0496103_0145406 3300048906 Bacteria 1517
364 Ga0496106_0003275 3300048909 Bacteria 12102
365 Ga0496106_0339538 3300048909 Bacteria 1206
366 Ga0496107_1069027 3300048910 Bacteria 584
367 Ga0496110_0132425 3300048913 Bacteria 2252
368 Ga0496110_0331341 3300048913 Bacteria 1387
369 Ga0496111_0004639 3300048914 Bacteria 8698
370 Ga0496112_0765764 3300048915 Bacteria 891
371 Ga0496113_0172590 3300048916 Bacteria 1713
372 Ga0496113_0214156 3300048916 Bacteria 1534
373 Ga0496113_0993460 3300048916 Bacteria 661
374 Ga0496114_0252577 3300048917 Bacteria 1552
375 Ga0496114_1484558 3300048917 Bacteria 566
376 Ga0496116_0000061 3300048919 Bacteria 271860
377 Ga0496116_0004014 3300048919 Bacteria 14274
378 Ga0496116_0029898 3300048919 Bacteria 3920
379 Ga0496116_0235391 3300048919 Bacteria 925
380 Ga0496117_0001675 3300048920 Bacteria 30978
381 Ga0496117_0010155 3300048920 Bacteria 8640
382 Ga0496117_0028469 3300048920 Bacteria 4326
383 Ga0496117_0060488 3300048920 Bacteria 2609
384 Ga0496117_0149729 3300048920 Bacteria 1383
385 Ga0496117_0153903 3300048920 Bacteria 1357
386 Ga0496117_0238795 3300048920 Bacteria 999
387 Ga0496117_0353566 3300048920 Bacteria 758
388 Ga0496118_0005907 3300048921 Bacteria 13698
389 Ga0496118_0018004 3300048921 Bacteria 6399
390 Ga0496118_0053917 3300048921 Bacteria 3051
391 Ga0496118_0153714 3300048921 Bacteria 1435
392 Ga0496118_0221868 3300048921 Bacteria 1099
393 Ga0496119_0010381 3300048922 Bacteria 7844
394 Ga0496119_0028043 3300048922 Bacteria 3854
395 Ga0496119_0048643 3300048922 Bacteria 2628
396 Ga0496119_0178669 3300048922 Bacteria 1115
397 Ga0496120_0011761 3300048923 Bacteria 5994
398 Ga0496121_0023159 3300048924 Bacteria 5994
399 Ga0496121_0027344 3300048924 Bacteria 5339
400 Ga0496121_0043849 3300048924 Bacteria 3867
401 Ga0496121_0048646 3300048924 Bacteria 3605
402 Ga0496121_0060980 3300048924 Bacteria 3098
403 Ga0496121_0096979 3300048924 Bacteria 2286
404 Ga0496121_0198212 3300048924 Bacteria 1433
405 Ga0496121_0235141 3300048924 Bacteria 1281
406 Ga0496121_0246688 3300048924 Bacteria 1241
407 Ga0496121_0285232 3300048924 Bacteria 1127
408 Ga0496121_0311039 3300048924 Bacteria 1065
409 Ga0496122_0000777 3300048925 Bacteria 61385
410 Ga0496122_0007570 3300048925 Bacteria 12015
411 Ga0496122_0010344 3300048925 Bacteria 9644
412 Ga0496122_0019424 3300048925 Bacteria 6208
413 Ga0496122_0019830 3300048925 Bacteria 6120
414 Ga0496122_0041920 3300048925 Bacteria 3609
415 Ga0496122_0098191 3300048925 Bacteria 1967
416 Ga0496122_0141589 3300048925 Bacteria 1503
417 Ga0496122_0203257 3300048925 Bacteria 1156
418 Ga0496123_0000519 3300048926 Bacteria 66923
419 Ga0496123_0022279 3300048926 Bacteria 4889
420 Ga0496123_0025267 3300048926 Bacteria 4483
421 Ga0496123_0026543 3300048926 Bacteria 4334
422 Ga0496123_0079855 3300048926 Bacteria 1997
423 Ga0496123_0109166 3300048926 Bacteria 1586
424 Ga0496123_0123005 3300048926 Bacteria 1454
425 Ga0496124_0000574 3300048927 Bacteria 62330
426 Ga0496124_0010139 3300048927 Bacteria 9590
427 Ga0496124_0011802 3300048927 Bacteria 8704
428 Ga0496124_0022544 3300048927 Bacteria 5768
429 Ga0496124_0057395 3300048927 Bacteria 3280
430 Ga0496124_0124182 3300048927 Bacteria 2059
431 Ga0496124_0145769 3300048927 Bacteria 1863
432 Ga0496124_0202375 3300048927 Bacteria 1509
433 Ga0496124_0203316 3300048927 Bacteria 1504
434 Ga0496124_0621851 3300048927 Bacteria 698
435 Ga0496125_0000790 3300048928 Bacteria 51640
436 Ga0496125_0070064 3300048928 Bacteria 2747
437 Ga0496125_0074850 3300048928 Bacteria 2623
438 Ga0496125_0132852 3300048928 Bacteria 1748
439 Ga0496125_0145729 3300048928 Bacteria 1637
440 Ga0496126_0000397 3300048929 Bacteria 89305
441 Ga0496126_0000466 3300048929 Bacteria 80395
442 Ga0496126_0060122 3300048929 Bacteria 3419
443 Ga0496126_0205504 3300048929 Bacteria 1660
444 Ga0495678_062308 3300049459 Bacteria 1396
445 Ga0495678_090851 3300049459 Bacteria 1076
446 Ga0495682_0018055 3300049460 Bacteria 2657
447 Ga0501031_0019286 3300049568 Bacteria 4441
448 Ga0501031_0111024 3300049568 Bacteria 1790
449 Ga0501032_0043928 3300049569 Bacteria 3025
450 Ga0501033_0082976 3300049570 Bacteria 2350
451 Ga0501033_0194743 3300049570 Bacteria 1449
452 Ga0501033_0522763 3300049570 Bacteria 819
453 Ga0501034_0026144 3300049571 Bacteria 5943
454 Ga0501034_0106309 3300049571 Bacteria 2799
455 Ga0501034_0193634 3300049571 Bacteria 1994
456 Ga0501034_0251041 3300049571 Bacteria 1713
457 Ga0501034_0463822 3300049571 Bacteria 1183
458 Ga0501034_0964367 3300049571 Bacteria 738
459 Ga0501036_0219603 3300049572 Bacteria 1596
460 Ga0501036_0232296 3300049572 Bacteria 1547
461 Ga0501037_0116744 3300049573 Bacteria 1920
462 Ga0501037_0168959 3300049573 Bacteria 1555
463 Ga0501038_0026508 3300049574 Bacteria 5162
464 Ga0501038_0091915 3300049574 Bacteria 2541
465 Ga0501038_0963358 3300049574 Bacteria 628
466 Ga0501039_0199577 3300049575 Bacteria 1573
467 Ga0501039_0242833 3300049575 Bacteria 1416
468 Ga0501039_0868789 3300049575 Bacteria 702
469 Ga0501040_0289498 3300049576 Bacteria 1170
470 Ga0501041_0074743 3300049577 Bacteria 2083
471 Ga0501042_0020859 3300049578 Bacteria 4562
472 Ga0501043_0067906 3300049579 Bacteria 2799
473 Ga0501043_0154843 3300049579 Bacteria 1792
474 Ga0501043_0556238 3300049579 Bacteria 852
475 Ga0501046_0032362 3300049580 Bacteria 4234
476 Ga0501046_0086897 3300049580 Bacteria 2410
477 Ga0501047_0029183 3300049581 Bacteria 5320
478 Ga0501047_0064904 3300049581 Bacteria 3520
479 Ga0501047_0292116 3300049581 Bacteria 1474
480 Ga0501048_0011044 3300049582 Bacteria 6736
481 Ga0501067_0022697 3300049583 Bacteria 3473
482 Ga0501068_0037470 3300049584 Bacteria 2903
483 Ga0501068_0682675 3300049584 Bacteria 671
484 Ga0501070_0044862 3300049586 Bacteria 3677
485 Ga0501071_0053381 3300049587 Bacteria 2915
486 Ga0501073_0032824 3300049589 Bacteria 3700
487 Ga0501073_0053843 3300049589 Bacteria 2817
488 Ga0501079_0281217 3300049741 Bacteria 1301
489 Ga0501079_0876656 3300049741 Bacteria 707
490 Ga0501083_0057375 3300049744 Bacteria 2606
491 Ga0501083_0169980 3300049744 Bacteria 1425
492 Ga0501035_0010541 3300049822 Bacteria 8564
493 Ga0501035_0062185 3300049822 Bacteria 3322
494 Ga0501044_0038105 3300049823 Bacteria 5020
495 Ga0501044_0094855 3300049823 Bacteria 3007
496 Ga0501044_0150577 3300049823 Bacteria 2309
497 Ga0501044_0254180 3300049823 Bacteria 1697
498 Ga0501045_0005925 3300049824 Bacteria 8453
499 nmdc:mga03683_314547_c1 3300050489 Bacteria 736
500 nmdc:mga00v17_508608_c1 3300050491 Bacteria 780
501 nmdc:mga0yw44_41508_c1 3300050492 Bacteria 2739
502 nmdc:mga0k408_22809_c1 3300050493 Bacteria 3527
503 nmdc:mga06z11_7641_c1 3300050494 Bacteria 4463
504 nmdc:mga07m45_40598_c1 3300050496 Bacteria 2604
505 nmdc:mga0sz30_63587_c1 3300050516 Bacteria 1580
506 nmdc:mga0sz30_75994_c1 3300050516 Bacteria 1450
507 nmdc:mga0sz30_89954_c1 3300050516 Bacteria 1335
508 Ga0500610_0099306 3300053079 Bacteria 1507
509 Ga0500578_0051786 3300053086 Bacteria 2629
510 Ga0500578_0541689 3300053086 Bacteria 648
511 Ga0500643_049242 3300053087 Bacteria 1209
512 Ga0500647_0146531 3300053091 Bacteria 1104
513 Ga0500556_0071340 3300053104 Bacteria 1298
514 Ga0500569_023739 3300053109 Bacteria 1651
515 Ga0500569_093176 3300053109 Bacteria 978
516 Ga0500594_0029192 3300053118 Bacteria 1440
517 Ga0500594_0038369 3300053118 Bacteria 1298
518 Ga0500597_160443 3300053120 Bacteria 962
519 Ga0500618_003843 3300053125 Bacteria 5009
520 Ga0500618_007517 3300053125 Bacteria 3103
521 Ga0500658_0002072 3300053134 Bacteria 7799
522 Ga0500658_0004778 3300053134 Bacteria 5049
523 Ga0500568_0004625 3300053139 Bacteria 7327
524 Ga0500568_0007583 3300053139 Bacteria 5309
525 Ga0500568_0035878 3300053139 Bacteria 2021
526 Ga0500568_0076787 3300053139 Bacteria 1272
527 Ga0500573_0002052 3300053140 Bacteria 9894
528 Ga0500577_0183323 3300053142 Bacteria 899
529 Ga0500604_0103018 3300053151 Bacteria 942
530 Ga0500616_0001463 3300053153 Bacteria 22545
531 Ga0500616_0016759 3300053153 Bacteria 4165
532 Ga0500616_0043989 3300053153 Bacteria 2384
533 Ga0500622_0002296 3300053156 Bacteria 14006
534 Ga0500627_0067150 3300053158 Bacteria 1584
535 Ga0500627_0431995 3300053158 Bacteria 557
536 Ga0500633_0034799 3300053160 Bacteria 1654
537 Ga0500611_133181 3300053727 Bacteria 671
538 Ga0587078_015009 3300059646 Bacteria 931
539 Ga0587079_116598 3300059647 Bacteria 655
540 Ga0501082_0328840 3300060353 Bacteria 1332
541 Ga0501082_0716774 3300060353 Bacteria 875
542 Ga0501082_0894435 3300060353 Bacteria 777
543 Ga0466962_0184563 3300061719 Bacteria 1017

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300002739 JGI25158J39367_1000039 JGI25158J39367_100003916 144
2 3300002987 JGI25159J45721_1002399 JGI25159J45721_10023998 144
3 3300003323 rootH1_10228777 rootH1_102287772 144
4 3300003354 JGI25160J50197_1007275 JGI25160J50197_10072754 144
5 3300003374 JGI25161J50226_1000537 JGI25161J50226_10005373 144
6 3300004625 Ga0055543_1000639 Ga0055543_10006396 144
7 3300005262 Ga0065165_1003905 Ga0065165_10039056 144
8 3300025208 Ga0209436_101288 Ga0209436_1012886 144
9 3300025284 Ga0209130_1000009 Ga0209130_1000009369 144
10 3300025302 Ga0207426_1000041 Ga0207426_1000041307 144
11 3300039450 Ga0436363_1518595 Ga0436363_1518595_155_622 153
12 3300005548 Ga0070665_100006251 Ga0070665_1000062514 154
13 3300005548 Ga0070665_100212438 Ga0070665_1002124381 154
14 3300009093 Ga0105240_10188595 Ga0105240_101885952 154
15 3300009093 Ga0105240_10723746 Ga0105240_107237461 154
16 3300009545 Ga0105237_10282511 Ga0105237_102825111 154
17 3300009551 Ga0105238_10345965 Ga0105238_103459652 154
18 3300010375 Ga0105239_10839219 Ga0105239_108392192 154
19 3300014968 Ga0157379_10145466 Ga0157379_101454662 154
20 3300025913 Ga0207695_10054872 Ga0207695_100548724 154
21 3300025913 Ga0207695_10135283 Ga0207695_101352833 154
22 3300025913 Ga0207695_10744198 Ga0207695_107441981 154
23 3300025914 Ga0207671_10339929 Ga0207671_103399292 154
24 3300025924 Ga0207694_10366022 Ga0207694_103660221 154
25 3300025949 Ga0207667_10431503 Ga0207667_104315032 154
26 3300028379 Ga0268266_10116451 Ga0268266_101164512 154
27 3300028379 Ga0268266_10189212 Ga0268266_101892122 154
28 3300048910 Ga0496107_1069027 Ga0496107_1069027_80_547 154
29 3300048915 Ga0496112_0765764 Ga0496112_0765764_284_751 154
30 3300053091 Ga0500647_0146531 Ga0500647_0146531_538_1005 154
31 iso_pu_bacteria 2510461069 2510840406 154
32 iso_pu_bacteria 2537561587 2537874957 154
33 iso_pu_bacteria 2643221558 2643813667 154
34 iso_pu_bacteria 2643221568 2643854479 154
35 iso_pu_bacteria 2899803654 2899808134 154
36 iso_pu_bacteria 2919166419 2919168815 154
37 iso_pu_bacteria 2978969890 2978971502 154
38 iso_pu_bacteria 2984587000 2984588646 154
39 iso_pu_bacteria 8005658619 8005660721 154
40 iso_pu_bacteria 8018150411 8018155158 154
41 3300003323 rootH1_10203432 rootH1_102034322 155
42 3300006048 Ga0075363_100553835 Ga0075363_1005538351 155
43 3300006177 Ga0075362_10230894 Ga0075362_102308942 155
44 3300050489 nmdc:mga03683_314547_c1 nmdc:mga03683_314547_c1_247_717 155
45 3300060353 Ga0501082_0894435 Ga0501082_0894435_46_516 155
46 iso_pu_bacteria 2509276019 2509378261 155
47 iso_pu_bacteria 2509276021 2509389528 155
48 iso_pu_bacteria 2509276033 2509446060 155
49 iso_pu_bacteria 2510065019 2510135123 155
50 iso_pu_bacteria 2510461076 2510896547 155
51 iso_pu_bacteria 2510917022 2511132044 155
52 iso_pu_bacteria 2510917026 2511173906 155
53 iso_pu_bacteria 2510917028 2511184836 155
54 iso_pu_bacteria 2510917030 2511198193 155
55 iso_pu_bacteria 2513237084 2513571490 155
56 iso_pu_bacteria 2513237085 2513580665 155
57 iso_pu_bacteria 2513237088 2513598107 155
58 iso_pu_bacteria 2513237093 2513630308 155
59 iso_pu_bacteria 2513237103 2513713082 155
60 iso_pu_bacteria 2513237138 2513869213 155
61 iso_pu_bacteria 2513237144 2513912284 155
62 iso_pu_bacteria 2513237146 2513928536 155
63 iso_pu_bacteria 2513237159 2513998592 155
64 iso_pu_bacteria 2513237162 2514023902 155
65 iso_pu_bacteria 2515075009 2515114274 155
66 iso_pu_bacteria 2515154113 2515639291 155
67 iso_pu_bacteria 2515154114 2515643343 155
68 iso_pu_bacteria 2515154116 2515660742 155
69 iso_pu_bacteria 2515154134 2515741438 155
70 iso_pu_bacteria 2516653077 2517037893 155
71 iso_pu_bacteria 2516653085 2517078158 155
72 iso_pu_bacteria 2517093000 2517096928 155
73 iso_pu_bacteria 2517287029 2517408657 155
74 iso_pu_bacteria 2519899620 2520379644 155
75 iso_pu_bacteria 2524023209 2524458360 155
76 iso_pu_bacteria 2529292951 2530647453 155
77 iso_pu_bacteria 2534681796 2535518919 155
78 iso_pu_bacteria 2558860100 2558867255 155
79 iso_pu_bacteria 2582581283 2585166832 155
80 iso_pu_bacteria 2582581294 2585201837 155
81 iso_pu_bacteria 2582581298 2585223821 155
82 iso_pu_bacteria 2582581299 2585228836 155
83 iso_pu_bacteria 2582581306 2585266817 155
84 iso_pu_bacteria 2582581307 2585271556 155
85 iso_pu_bacteria 2582581308 2585280618 155
86 iso_pu_bacteria 2582581315 2585327991 155
87 iso_pu_bacteria 2582581316 2585334261 155
88 iso_pu_bacteria 2582581865 2585387859 155
89 iso_pu_bacteria 2582581866 2585395959 155
90 iso_pu_bacteria 2582581867 2585399651 155
91 iso_pu_bacteria 2585427526 2585526197 155
92 iso_pu_bacteria 2585427527 2585531553 155
93 iso_pu_bacteria 2585427528 2585540651 155
94 iso_pu_bacteria 2585427529 2585549044 155
95 iso_pu_bacteria 2585427530 2585551501 155
96 iso_pu_bacteria 2585427531 2585563204 155
97 iso_pu_bacteria 2585427590 2585820738 155
98 iso_pu_bacteria 2585427593 2585838920 155
99 iso_pu_bacteria 2585427594 2585842226 155
100 iso_pu_bacteria 2585427608 2585902746 155
101 iso_pu_bacteria 2585427609 2585907422 155
102 iso_pu_bacteria 2585427633 2585997684 155
103 iso_pu_bacteria 2585427634 2586002271 155
104 iso_pu_bacteria 2585428125 2587982584 155
105 iso_pu_bacteria 2599185156 2599335014 155
106 iso_pu_bacteria 2599185170 2599420248 155
107 iso_pu_bacteria 2599185236 2599720236 155
108 iso_pu_bacteria 2600254933 2600376906 155
109 iso_pu_bacteria 2615840624 2616296416 155
110 iso_pu_bacteria 2615840626 2616306838 155
111 iso_pu_bacteria 2615840698 2616557689 155
112 iso_pu_bacteria 2617270742 2617383353 155
113 iso_pu_bacteria 2643221599 2644002373 155
114 iso_pu_bacteria 2643221607 2644051932 155
115 iso_pu_bacteria 2643221618 2644110000 155
116 iso_pu_bacteria 2643221626 2644150276 155
117 iso_pu_bacteria 2643221634 2644194024 155
118 iso_pu_bacteria 2643221636 2644201512 155
119 iso_pu_bacteria 2643221637 2644209375 155
120 iso_pu_bacteria 2643221643 2644240596 155
121 iso_pu_bacteria 2643221655 2644312880 155
122 iso_pu_bacteria 2643221659 2644336426 155
123 iso_pu_bacteria 2643221668 2644379648 155
124 iso_pu_bacteria 2643221686 2644484384 155
125 iso_pu_bacteria 2643221688 2644492400 155
126 iso_pu_bacteria 2643221689 2644499887 155
127 iso_pu_bacteria 2643221698 2644546074 155
128 iso_pu_bacteria 2643221712 2644618610 155
129 iso_pu_bacteria 2643221718 2644652903 155
130 iso_pu_bacteria 2667528174 2671113583 155
131 iso_pu_bacteria 2718217882 2719182859 155
132 iso_pu_bacteria 2718217927 2719387553 155
133 iso_pu_bacteria 2718217997 2719667199 155
134 iso_pu_bacteria 2718218009 2719733576 155
135 iso_pu_bacteria 2718218199 2720493619 155
136 iso_pu_bacteria 2718218232 2720615074 155
137 iso_pu_bacteria 2718218233 2720621867 155
138 iso_pu_bacteria 2718218235 2720633217 155
139 iso_pu_bacteria 2718218269 2720776914 155
140 iso_pu_bacteria 2718218363 2721148971 155
141 iso_pu_bacteria 2718218366 2721165784 155
142 iso_pu_bacteria 2718218423 2721401187 155
143 iso_pu_bacteria 2721755514 2722841954 155
144 iso_pu_bacteria 2721755556 2723028514 155
145 iso_pu_bacteria 2721755684 2723562118 155
146 iso_pu_bacteria 2721755685 2723568820 155
147 iso_pu_bacteria 2721755809 2724040001 155
148 iso_pu_bacteria 2721755810 2724046332 155
149 iso_pu_bacteria 2721755819 2724091521 155
150 iso_pu_bacteria 2721755822 2724106085 155
151 iso_pu_bacteria 2721755823 2724111891 155
152 iso_pu_bacteria 2724679232 2725947377 155
153 iso_pu_bacteria 2728369352 2730109450 155
154 iso_pu_bacteria 2728369365 2730166094 155
155 iso_pu_bacteria 2738541293 2738803159 155
156 iso_pu_bacteria 2738541333 2739037139 155
157 iso_pu_bacteria 2765235942 2766064431 155
158 iso_pu_bacteria 2775507266 2778173648 155
159 iso_pu_bacteria 2791355094 2792641381 155
160 iso_pu_bacteria 2791355256 2793295737 155
161 iso_pu_bacteria 2791355259 2793313510 155
162 iso_pu_bacteria 2791355260 2793320607 155
163 iso_pu_bacteria 2791355261 2793331043 155
164 iso_pu_bacteria 2791355262 2793332126 155
165 iso_pu_bacteria 2791355263 2793338694 155
166 iso_pu_bacteria 2791355265 2793353979 155
167 iso_pu_bacteria 2791355266 2793359503 155
168 iso_pu_bacteria 2791355267 2793365784 155
169 iso_pu_bacteria 2802429605 2805926106 155
170 iso_pu_bacteria 2802429606 2805937133 155
171 iso_pu_bacteria 2802429633 2806047230 155
172 iso_pu_bacteria 2802429634 2806054094 155
173 iso_pu_bacteria 2802429635 2806060322 155
174 iso_pu_bacteria 2802429636 2806068942 155
175 iso_pu_bacteria 2802429637 2806077115 155
176 iso_pu_bacteria 2818991448 2819611138 155
177 iso_pu_bacteria 2818991453 2819638931 155
178 iso_pu_bacteria 2838016132 2838018445 155
179 iso_pu_bacteria 2838022645 2838024126 155
180 iso_pu_bacteria 2838029111 2838030827 155
181 iso_pu_bacteria 2838035591 2838040454 155
182 iso_pu_bacteria 2838042994 2838048360 155
183 iso_pu_bacteria 2838048938 2838053705 155
184 iso_pu_bacteria 2838061910 2838062460 155
185 iso_pu_bacteria 2838068647 2838072012 155
186 iso_pu_bacteria 2838661181 2838667869 155
187 iso_pu_bacteria 2838668709 2838672925 155
188 iso_pu_bacteria 2838680041 2838684002 155
189 iso_pu_bacteria 2838686498 2838690123 155
190 iso_pu_bacteria 2838694306 2838698531 155
191 iso_pu_bacteria 2838701080 2838705597 155
192 iso_pu_bacteria 2838707686 2838711646 155
193 iso_pu_bacteria 2838729681 2838731898 155
194 iso_pu_bacteria 2838742623 2838744794 155
195 iso_pu_bacteria 2841851746 2841857899 155
196 iso_pu_bacteria 2841864319 2841867879 155
197 iso_pu_bacteria 2842077413 2842081447 155
198 iso_pu_bacteria 2842110456 2842116302 155
199 iso_pu_bacteria 2842118031 2842121776 155
200 iso_pu_bacteria 2842146304 2842149927 155
201 iso_pu_bacteria 2842156927 2842161021 155
202 iso_pu_bacteria 2842163707 2842166540 155
203 iso_pu_bacteria 2842180545 2842184637 155
204 iso_pu_bacteria 2842192696 2842194994 155
205 iso_pu_bacteria 2842198810 2842201720 155
206 iso_pu_bacteria 2842205361 2842207299 155
207 iso_pu_bacteria 2842217011 2842223402 155
208 iso_pu_bacteria 2842229732 2842232220 155
209 iso_pu_bacteria 2842237096 2842240791 155
210 iso_pu_bacteria 2842243621 2842246635 155
211 iso_pu_bacteria 2842250916 2842255277 155
212 iso_pu_bacteria 2842257432 2842261263 155
213 iso_pu_bacteria 2842264693 2842269527 155
214 iso_pu_bacteria 2842271015 2842274143 155
215 iso_pu_bacteria 2842278818 2842280990 155
216 iso_pu_bacteria 2842291075 2842295104 155
217 iso_pu_bacteria 2842298080 2842300384 155
218 iso_pu_bacteria 2842304105 2842305997 155
219 iso_pu_bacteria 2842311132 2842311299 155
220 iso_pu_bacteria 2842317721 2842321000 155
221 iso_pu_bacteria 2842341865 2842346702 155
222 iso_pu_bacteria 2842357229 2842361099 155
223 iso_pu_bacteria 2842363717 2842366384 155
224 iso_pu_bacteria 2842370503 2842374878 155
225 iso_pu_bacteria 2842377471 2842381503 155
226 iso_pu_bacteria 2842384541 2842388573 155
227 iso_pu_bacteria 2842395702 2842396069 155
228 iso_pu_bacteria 2842422224 2842425644 155
229 iso_pu_bacteria 2842428310 2842433485 155
230 iso_pu_bacteria 2842434925 2842439813 155
231 iso_pu_bacteria 2842441272 2842446442 155
232 iso_pu_bacteria 2842447887 2842448892 155
233 iso_pu_bacteria 2842462802 2842467885 155
234 iso_pu_bacteria 2842469257 2842474422 155
235 iso_pu_bacteria 2842475841 2842477559 155
236 iso_pu_bacteria 2842482326 2842488001 155
237 iso_pu_bacteria 2842489311 2842491052 155
238 iso_pu_bacteria 2842495871 2842498390 155
239 iso_pu_bacteria 2842502639 2842504568 155
240 iso_pu_bacteria 2842509118 2842511814 155
241 iso_pu_bacteria 2842521101 2842524377 155
242 iso_pu_bacteria 2842922631 2842926203 155
243 iso_pu_bacteria 2844163670 2844164194 155
244 iso_pu_bacteria 2844454524 2844457179 155
245 iso_pu_bacteria 2850079185 2850082489 155
246 iso_pu_bacteria 2852387548 2852391580 155
247 iso_pu_bacteria 2857516855 2857521119 155
248 iso_pu_bacteria 2891373044 2891373717 155
249 iso_pu_bacteria 2919100787 2919105281 155
250 iso_pu_bacteria 2919171160 2919175885 155
251 iso_pu_bacteria 2919408235 2919410960 155
252 iso_pu_bacteria 2923556063 2923559591 155
253 iso_pu_bacteria 2933016740 2933017246 155
254 iso_pu_bacteria 2933570622 2933572501 155
255 iso_pu_bacteria 2933586486 2933592519 155
256 iso_pu_bacteria 2933599457 2933603134 155
257 iso_pu_bacteria 2935894831 2935897820 155
258 iso_pu_bacteria 2935901341 2935903788 155
259 iso_pu_bacteria 2936367885 2936369760 155
260 iso_pu_bacteria 2936375103 2936378948 155
261 iso_pu_bacteria 2936381700 2936385835 155
262 iso_pu_bacteria 2996310559 2996311981 155
263 iso_pu_bacteria 2996887358 2996890141 155
264 iso_pu_bacteria 2996893221 2996895175 155
265 iso_pu_bacteria 3003930520 3003930780 155
266 iso_pu_bacteria 3005409236 3005409537 155
267 iso_pu_bacteria 3005416602 3005421738 155
268 iso_pu_bacteria 3005445848 3005449553 155
269 iso_pu_bacteria 3005452660 3005455845 155
270 iso_pu_bacteria 639633055 639650276 155
271 iso_pu_bacteria 8005258706 8005262325 155
272 iso_pu_bacteria 8005275841 8005282306 155
273 iso_pu_bacteria 8005289223 8005294968 155
274 iso_pu_bacteria 8005301065 8005305856 155
275 iso_pu_bacteria 8005307578 8005313545 155
276 iso_pu_bacteria 8005314921 8005319562 155
277 iso_pu_bacteria 8005321885 8005324668 155
278 iso_pu_bacteria 8005376324 8005381696 155
279 iso_pu_bacteria 8005382845 8005387881 155
280 iso_pu_bacteria 8005395548 8005400917 155
281 iso_pu_bacteria 8005430974 8005433697 155
282 iso_pu_bacteria 8005460587 8005464966 155
283 iso_pu_bacteria 8005484373 8005490190 155
284 iso_pu_bacteria 8005497431 8005497561 155
285 iso_pu_bacteria 8005542996 8005546569 155
286 iso_pu_bacteria 8005556819 8005561008 155
287 iso_pu_bacteria 8005563573 8005565633 155
288 iso_pu_bacteria 8005570704 8005571090 155
289 iso_pu_bacteria 8005619151 8005623294 155
290 iso_pu_bacteria 8005626139 8005631126 155
291 iso_pu_bacteria 8005645114 8005646848 155
292 iso_pu_bacteria 8005668836 8005668966 155
293 iso_pu_bacteria 8005682033 8005687569 155
294 iso_pu_bacteria 8005688590 8005694447 155
295 iso_pu_bacteria 8005695170 8005695608 155
296 iso_pu_bacteria 8018127388 8018128805 155
297 iso_pu_bacteria 8018163183 8018165256 155
298 iso_pu_bacteria 8018176218 8018177035 155
299 iso_pu_bacteria 8023680758 8023686383 155
300 iso_pu_bacteria 8024479707 8024484239 155
301 iso_pu_bacteria 8024486573 8024490747 155
302 iso_pu_bacteria 8024501048 8024502436 155
303 iso_pu_bacteria 8046767195 8046768143 155
304 iso_pu_bacteria 8056375014 8056379747 155
305 iso_pu_bacteria 8056382006 8056383917 155
306 iso_pu_bacteria 8056875544 8056878153 155
307 iso_pu_bacteria 8057575449 8057581496 155
308 iso_pu_bacteria 8057874678 8057879130 155
309 3300025929 Ga0207664_10990612 Ga0207664_109906121 156
310 3300028379 Ga0268266_11788887 Ga0268266_117888871 156
311 3300048921 Ga0496118_0221868 Ga0496118_0221868_555_1043 156
312 3300048924 Ga0496121_0311039 Ga0496121_0311039_137_625 156
313 3300060353 Ga0501082_0328840 Ga0501082_0328840_399_872 156
314 iso_pu_bacteria 2899275550 2899278795 156
315 3300005983 Ga0081540_1045243 Ga0081540_10452432 157
316 3300032002 Ga0307416_101605593 Ga0307416_1016055931 157
317 3300048927 Ga0496124_0202375 Ga0496124_0202375_890_1366 157
318 3300049571 Ga0501034_0193634 Ga0501034_0193634_858_1331 157
319 3300049575 Ga0501039_0199577 Ga0501039_0199577_568_1041 157
320 3300049741 Ga0501079_0876656 Ga0501079_0876656_74_556 157
321 3300050491 nmdc:mga00v17_508608_c1 nmdc:mga00v17_508608_c1_25_498 157
322 3300053153 Ga0500616_0016759 Ga0500616_0016759_1275_1748 157
323 3300053158 Ga0500627_0067150 Ga0500627_0067150_978_1451 157
324 3300059647 Ga0587079_116598 Ga0587079_116598_103_576 157
325 3300006177 Ga0075362_10759680 Ga0075362_107596801 158
326 3300006186 Ga0075369_10138022 Ga0075369_101380222 158
327 3300013102 Ga0157371_10022144 Ga0157371_100221443 158
328 3300013105 Ga0157369_10228530 Ga0157369_102285302 158
329 3300013307 Ga0157372_10697990 Ga0157372_106979902 158
330 3300025284 Ga0209130_1028390 Ga0209130_10283901 158
331 3300028794 Ga0307515_10001840 Ga0307515_100018407 158
332 3300031548 Ga0307408_100287431 Ga0307408_1002874313 158
333 3300046460 Ga0495638_0024159 Ga0495638_0024159_1976_2452 158
334 3300048919 Ga0496116_0000061 Ga0496116_0000061_53174_53653 158
335 3300048920 Ga0496117_0153903 Ga0496117_0153903_456_935 158
336 3300048922 Ga0496119_0178669 Ga0496119_0178669_268_747 158
337 3300048926 Ga0496123_0109166 Ga0496123_0109166_72_551 158
338 3300048927 Ga0496124_0124182 Ga0496124_0124182_883_1362 158
339 3300048929 Ga0496126_0000397 Ga0496126_0000397_12920_13399 158
340 3300050516 nmdc:mga0sz30_63587_c1 nmdc:mga0sz30_63587_c1_287_766 158
341 3300053140 Ga0500573_0002052 Ga0500573_0002052_2595_3071 158
342 3300001979 JGI24740J21852_10000066 JGI24740J21852_1000006619 159
343 3300001989 JGI24739J22299_10144511 JGI24739J22299_101445111 159
344 3300002704 JGI25155J39150_1000010 JGI25155J39150_1000010104 159
345 3300002705 JGI25156J39149_1000033 JGI25156J39149_100003379 159
346 3300002737 JGI25162J39368_1002132 JGI25162J39368_10021329 159
347 3300002738 JGI25154J39366_1000058 JGI25154J39366_100005836 159
348 3300002741 JGI25157J39369_1000009 JGI25157J39369_1000009103 159
349 3300002773 JGI25152J39213_1003798 JGI25152J39213_10037984 159
350 3300002773 JGI25152J39213_1025070 JGI25152J39213_10250702 159
351 3300002774 JGI25150J39212_1000028 JGI25150J39212_100002865 159
352 3300002774 JGI25150J39212_1002370 JGI25150J39212_10023702 159
353 3300002774 JGI25150J39212_1029801 JGI25150J39212_10298011 159
354 3300002987 JGI25159J45721_1000241 JGI25159J45721_100024117 159
355 3300003187 JGI25151J46595_10000123 JGI25151J46595_1000012332 159
356 3300003187 JGI25151J46595_10003986 JGI25151J46595_100039866 159
357 3300003187 JGI25151J46595_10004252 JGI25151J46595_100042523 159
358 3300003187 JGI25151J46595_10016106 JGI25151J46595_100161064 159
359 3300003214 JGI25165J46597_1000935 JGI25165J46597_100093516 159
360 3300003214 JGI25165J46597_1000949 JGI25165J46597_100094915 159
361 3300003215 JGI25153J46596_10001187 JGI25153J46596_100011878 159
362 3300003215 JGI25153J46596_10004401 JGI25153J46596_100044018 159
363 3300003215 JGI25153J46596_10007873 JGI25153J46596_100078734 159
364 3300003215 JGI25153J46596_10020184 JGI25153J46596_100201844 159
365 3300003316 rootH1_10044838 rootH1_100448382 159
366 3300003316 rootH1_10052753 rootH1_100527532 159
367 3300003322 rootL2_10057936 rootL2_100579364 159
368 3300003322 rootL2_10158058 rootL2_101580582 159
369 3300003323 rootH1_10096654 rootH1_100966542 159
370 3300003323 rootH1_10130547 rootH1_101305473 159
371 3300003323 rootH1_10228778 rootH1_102287782 159
372 3300003354 JGI25160J50197_1000214 JGI25160J50197_100021417 159
373 3300003354 JGI25160J50197_1009767 JGI25160J50197_10097672 159
374 3300003374 JGI25161J50226_1000158 JGI25161J50226_100015830 159
375 3300003374 JGI25161J50226_1006184 JGI25161J50226_10061841 159
376 3300003771 Ga0055526_1002383 Ga0055526_10023834 159
377 3300003771 Ga0055526_1013480 Ga0055526_10134802 159
378 3300003771 Ga0055526_1016937 Ga0055526_10169372 159
379 3300003775 Ga0055524_1000988 Ga0055524_10009889 159
380 3300003775 Ga0055524_1008246 Ga0055524_10082466 159
381 3300003775 Ga0055524_1020400 Ga0055524_10204002 159
382 3300003775 Ga0055524_1039276 Ga0055524_10392762 159
383 3300003775 Ga0055524_1045703 Ga0055524_10457032 159
384 3300003790 Ga0055528_1000842 Ga0055528_10008427 159
385 3300003790 Ga0055528_1004809 Ga0055528_10048097 159
386 3300003790 Ga0055528_1006582 Ga0055528_10065822 159
387 3300003790 Ga0055528_1008361 Ga0055528_10083612 159
388 3300003790 Ga0055528_1012908 Ga0055528_10129081 159
389 3300003791 Ga0055530_10024053 Ga0055530_100240532 159
390 3300003792 Ga0055540_1000481 Ga0055540_100048110 159
391 3300003792 Ga0055540_1012734 Ga0055540_10127342 159
392 3300003792 Ga0055540_1054951 Ga0055540_10549511 159
393 3300003794 Ga0055531_10010151 Ga0055531_100101515 159
394 3300004625 Ga0055543_1000099 Ga0055543_100009917 159
395 3300004625 Ga0055543_1002383 Ga0055543_10023833 159
396 3300005262 Ga0065165_1000575 Ga0065165_100057537 159
397 3300005262 Ga0065165_1012374 Ga0065165_10123742 159
398 3300005262 Ga0065165_1012576 Ga0065165_10125764 159
399 3300005262 Ga0065165_1040894 Ga0065165_10408942 159
400 3300005353 Ga0070669_100470113 Ga0070669_1004701132 159
401 3300005367 Ga0070667_100168895 Ga0070667_1001688952 159
402 3300005539 Ga0068853_100285895 Ga0068853_1002858951 159
403 3300005577 Ga0068857_100614481 Ga0068857_1006144811 159
404 3300005614 Ga0068856_100110337 Ga0068856_1001103372 159
405 3300005614 Ga0068856_100380891 Ga0068856_1003808912 159
406 3300005616 Ga0068852_100138863 Ga0068852_1001388632 159
407 3300006038 Ga0075365_10000978 Ga0075365_100009787 159
408 3300006038 Ga0075365_10278760 Ga0075365_102787602 159
409 3300006048 Ga0075363_100053454 Ga0075363_1000534542 159
410 3300006177 Ga0075362_10024800 Ga0075362_100248002 159
411 3300006178 Ga0075367_10016233 Ga0075367_100162333 159
412 3300006178 Ga0075367_10337706 Ga0075367_103377062 159
413 3300006186 Ga0075369_10101503 Ga0075369_101015032 159
414 3300006186 Ga0075369_10138357 Ga0075369_101383572 159
415 3300006186 Ga0075369_10213038 Ga0075369_102130381 159
416 3300006353 Ga0075370_10000922 Ga0075370_100009226 159
417 3300006353 Ga0075370_10020528 Ga0075370_100205282 159
418 3300006353 Ga0075370_10410697 Ga0075370_104106972 159
419 3300006353 Ga0075370_10533563 Ga0075370_105335632 159
420 3300006353 Ga0075370_10942811 Ga0075370_109428111 159
421 3300009093 Ga0105240_10000013 Ga0105240_10000013110 159
422 3300009101 Ga0105247_10044821 Ga0105247_100448212 159
423 3300009545 Ga0105237_10003586 Ga0105237_100035869 159
424 3300009545 Ga0105237_10674156 Ga0105237_106741562 159
425 3300009765 Ga0123341_1014142 Ga0123341_10141424 159
426 3300009766 Ga0123342_1012798 Ga0123342_10127987 159
427 3300009766 Ga0123342_1016598 Ga0123342_10165984 159
428 3300010375 Ga0105239_10005948 Ga0105239_100059487 159
429 3300012513 Ga0157326_1031162 Ga0157326_10311621 159
430 3300013104 Ga0157370_10000209 Ga0157370_1000020960 159
431 3300013105 Ga0157369_10202346 Ga0157369_102023463 159
432 3300015262 Ga0182007_10003149 Ga0182007_100031497 159
433 3300015265 Ga0182005_1003085 Ga0182005_10030852 159
434 3300017792 Ga0163161_10522041 Ga0163161_105220411 159
435 3300025206 Ga0209435_100009 Ga0209435_100009361 159
436 3300025228 Ga0209672_105717 Ga0209672_1057172 159
437 3300025233 Ga0209437_100057 Ga0209437_100057107 159
438 3300025233 Ga0209437_100107 Ga0209437_10010770 159
439 3300025233 Ga0209437_105749 Ga0209437_1057493 159
440 3300025245 Ga0207425_1000077 Ga0207425_100007730 159
441 3300025245 Ga0207425_1005700 Ga0207425_10057003 159
442 3300025246 Ga0209646_1000018 Ga0209646_1000018361 159
443 3300025246 Ga0209646_1007130 Ga0209646_10071302 159
444 3300025250 Ga0209026_1000068 Ga0209026_1000068103 159
445 3300025253 Ga0209677_100309 Ga0209677_1003093 159
446 3300025256 Ga0209759_1000007 Ga0209759_1000007361 159
447 3300025258 Ga0209129_1000036 Ga0209129_1000036287 159
448 3300025258 Ga0209129_1000118 Ga0209129_1000118119 159
449 3300025258 Ga0209129_1002381 Ga0209129_10023813 159
450 3300025258 Ga0209129_1004334 Ga0209129_10043342 159
451 3300025258 Ga0209129_1010005 Ga0209129_10100052 159
452 3300025261 Ga0209233_1000072 Ga0209233_100007299 159
453 3300025261 Ga0209233_1000134 Ga0209233_1000134107 159
454 3300025261 Ga0209233_1000440 Ga0209233_100044025 159
455 3300025273 Ga0209673_1000052 Ga0209673_100005215 159
456 3300025273 Ga0209673_1000158 Ga0209673_100015819 159
457 3300025273 Ga0209673_1000459 Ga0209673_100045953 159
458 3300025273 Ga0209673_1000997 Ga0209673_100099715 159
459 3300025273 Ga0209673_1007484 Ga0209673_10074841 159
460 3300025273 Ga0209673_1009902 Ga0209673_10099026 159
461 3300025273 Ga0209673_1032225 Ga0209673_10322252 159
462 3300025273 Ga0209673_1038068 Ga0209673_10380682 159
463 3300025273 Ga0209673_1063126 Ga0209673_10631262 159
464 3300025284 Ga0209130_1000132 Ga0209130_1000132106 159
465 3300025291 Ga0209675_1022813 Ga0209675_10228132 159
466 3300025292 Ga0209676_1004018 Ga0209676_10040182 159
467 3300025292 Ga0209676_1024673 Ga0209676_10246732 159
468 3300025294 Ga0209025_1000245 Ga0209025_100024512 159
469 3300025294 Ga0209025_1000329 Ga0209025_100032930 159
470 3300025294 Ga0209025_1000617 Ga0209025_100061730 159
471 3300025294 Ga0209025_1000871 Ga0209025_10008713 159
472 3300025294 Ga0209025_1002194 Ga0209025_10021942 159
473 3300025295 Ga0209564_1000569 Ga0209564_10005697 159
474 3300025295 Ga0209564_1000675 Ga0209564_100067528 159
475 3300025295 Ga0209564_1001411 Ga0209564_100141117 159
476 3300025295 Ga0209564_1002048 Ga0209564_10020482 159
477 3300025297 Ga0209758_1000259 Ga0209758_100025962 159
478 3300025297 Ga0209758_1000323 Ga0209758_100032327 159
479 3300025297 Ga0209758_1000948 Ga0209758_100094815 159
480 3300025297 Ga0209758_1003501 Ga0209758_10035017 159
481 3300025297 Ga0209758_1005770 Ga0209758_10057703 159
482 3300025297 Ga0209758_1007164 Ga0209758_10071643 159
483 3300025297 Ga0209758_1007169 Ga0209758_10071693 159
484 3300025298 Ga0209050_1003683 Ga0209050_10036833 159
485 3300025298 Ga0209050_1004202 Ga0209050_100420211 159
486 3300025299 Ga0209256_1001406 Ga0209256_100140617 159
487 3300025299 Ga0209256_1001526 Ga0209256_100152615 159
488 3300025299 Ga0209256_1001728 Ga0209256_100172816 159
489 3300025299 Ga0209256_1009743 Ga0209256_10097432 159
490 3300025299 Ga0209256_1012230 Ga0209256_10122302 159
491 3300025299 Ga0209256_1051104 Ga0209256_10511042 159
492 3300025302 Ga0207426_1000246 Ga0207426_1000246106 159
493 3300025302 Ga0207426_1000761 Ga0207426_100076115 159
494 3300025303 Ga0209051_1000863 Ga0209051_100086311 159
495 3300025303 Ga0209051_1000871 Ga0209051_10008712 159
496 3300025303 Ga0209051_1018016 Ga0209051_10180162 159
497 3300025303 Ga0209051_1074658 Ga0209051_10746581 159
498 3300025304 Ga0209257_1002861 Ga0209257_10028613 159
499 3300025304 Ga0209257_1006330 Ga0209257_10063309 159
500 3300025304 Ga0209257_1026753 Ga0209257_10267533 159
501 3300025304 Ga0209257_1086265 Ga0209257_10862651 159
502 3300025911 Ga0207654_10103960 Ga0207654_101039602 159
503 3300025913 Ga0207695_10000044 Ga0207695_1000004467 159
504 3300025914 Ga0207671_10000226 Ga0207671_1000022668 159
505 3300025923 Ga0207681_10087654 Ga0207681_100876542 159
506 3300025935 Ga0207709_10243111 Ga0207709_102431111 159
507 3300025972 Ga0207668_10605294 Ga0207668_106052942 159
508 3300025986 Ga0207658_10086035 Ga0207658_100860352 159
509 3300026078 Ga0207702_10087884 Ga0207702_100878842 159
510 3300026142 Ga0207698_10082011 Ga0207698_100820113 159
511 3300026142 Ga0207698_10586597 Ga0207698_105865972 159
512 3300027312 Ga0209371_1031992 Ga0209371_10319922 159
513 3300028379 Ga0268266_10776527 Ga0268266_107765272 159
514 3300028794 Ga0307515_10000377 Ga0307515_1000037785 159
515 3300028794 Ga0307515_10013206 Ga0307515_100132067 159
516 3300030500 Ga0268256_1036395 Ga0268256_10363952 159
517 3300031456 Ga0307513_10002147 Ga0307513_100021474 159
518 3300031456 Ga0307513_10023038 Ga0307513_100230386 159
519 3300031548 Ga0307408_100035018 Ga0307408_1000350182 159
520 3300031901 Ga0307406_10003800 Ga0307406_100038006 159
521 3300031911 Ga0307412_10001541 Ga0307412_100015413 159
522 3300031911 Ga0307412_10175757 Ga0307412_101757572 159
523 3300031995 Ga0307409_100144544 Ga0307409_1001445442 159
524 3300032004 Ga0307414_10068133 Ga0307414_100681332 159
525 3300032005 Ga0307411_10802872 Ga0307411_108028722 159
526 3300032168 Ga0316593_10223636 Ga0316593_102236362 159
527 3300035692 Ga0373935_0446794 Ga0373935_0446794_222_701 159
528 3300035695 Ga0373927_0000074 Ga0373927_0000074_28961_29440 159
529 3300036647 Ga0316582_0119491 Ga0316582_0119491_1018_1497 159
530 3300036712 Ga0316584_0336126 Ga0316584_0336126_482_961 159
531 3300037068 Ga0373925_0001779 Ga0373925_0001779_10842_11321 159
532 3300037312 Ga0395899_0000014 Ga0395899_0000014_129320_129799 159
533 3300037418 Ga0395900_0000007 Ga0395900_0000007_129339_129818 159
534 3300037466 Ga0395898_0000011 Ga0395898_0000011_359043_359522 159
535 3300037471 Ga0395905_0000008 Ga0395905_0000008_129339_129818 159
536 3300038443 Ga0395901_0000048 Ga0395901_0000048_44252_44731 159
537 3300041404 Ga0439436_0008125 Ga0439436_0008125_2026_2505 159
538 3300041404 Ga0439436_0010490 Ga0439436_0010490_154_693 159
539 3300041406 Ga0439439_0067584 Ga0439439_0067584_183_662 159
540 3300041410 Ga0439461_0075817 Ga0439461_0075817_234_713 159
541 3300041411 Ga0439466_0072559 Ga0439466_0072559_567_1046 159
542 3300041411 Ga0439466_0080227 Ga0439466_0080227_64_543 159
543 3300041413 Ga0439465_0004431 Ga0439465_0004431_3599_4078 159
544 3300041413 Ga0439465_0009619 Ga0439465_0009619_1870_2349 159
545 3300041413 Ga0439465_0027912 Ga0439465_0027912_205_684 159
546 3300041413 Ga0439465_0124697 Ga0439465_0124697_404_883 159
547 3300041443 Ga0451789_0976999 Ga0451789_0976999_47_526 159
548 3300041456 Ga0451795_0141812 Ga0451795_0141812_261_740 159
549 3300041491 Ga0451833_0233035 Ga0451833_0233035_648_1127 159
550 3300041494 Ga0451837_0488831 Ga0451837_0488831_168_647 159
551 3300041494 Ga0451837_1525209 Ga0451837_1525209_530_1009 159
552 3300041497 Ga0451840_08834 Ga0451840_08834_129_608 159
553 3300041502 Ga0451846_08075 Ga0451846_08075_116_595 159
554 3300041503 Ga0451847_0854739 Ga0451847_0854739_301_780 159
555 3300041505 Ga0451849_1020839 Ga0451849_1020839_23_502 159
556 3300041505 Ga0451849_1110510 Ga0451849_1110510_288_767 159
557 3300041507 Ga0451851_0128736 Ga0451851_0128736_301_780 159
558 3300041509 Ga0451843_0376551 Ga0451843_0376551_103_582 159
559 3300041510 Ga0451854_35136 Ga0451854_35136_113_592 159
560 3300041511 Ga0451855_0299216 Ga0451855_0299216_150_629 159
561 3300041511 Ga0451855_1181368 Ga0451855_1181368_168_647 159
562 3300041997 Ga0439431_0190831 Ga0439431_0190831_17_496 159
563 3300041999 Ga0439433_0055096 Ga0439433_0055096_274_753 159
564 3300042004 Ga0439445_0008840 Ga0439445_0008840_445_924 159
565 3300042004 Ga0439445_0170173 Ga0439445_0170173_43_522 159
566 3300042006 Ga0439432_081275 Ga0439432_081275_64_543 159
567 3300042007 Ga0439449_0020678 Ga0439449_0020678_609_1088 159
568 3300042007 Ga0439449_0057537 Ga0439449_0057537_50_589 159
569 3300042007 Ga0439449_0100535 Ga0439449_0100535_334_813 159
570 3300042007 Ga0439449_0168354 Ga0439449_0168354_128_607 159
571 3300042014 Ga0439457_034662 Ga0439457_034662_343_822 159
572 3300042014 Ga0439457_069883 Ga0439457_069883_273_752 159
573 3300042015 Ga0439462_0005625 Ga0439462_0005625_402_881 159
574 3300042015 Ga0439462_0055602 Ga0439462_0055602_348_827 159
575 3300042145 Ga0450906_004354 Ga0450906_004354_473_952 159
576 3300042531 Ga0450918_003289 Ga0450918_003289_1188_1667 159
577 3300044694 Ga0466963_0187220 Ga0466963_0187220_472_951 159
578 3300044735 Ga0466968_0017396 Ga0466968_0017396_686_1165 159
579 3300044765 Ga0466970_0143154 Ga0466970_0143154_509_988 159
580 3300044842 Ga0466957_0153228 Ga0466957_0153228_297_776 159
581 3300045976 Ga0466967_0435537 Ga0466967_0435537_478_1047 159
582 3300045976 Ga0466967_0664129 Ga0466967_0664129_387_866 159
583 3300045976 Ga0466967_0857643 Ga0466967_0857643_315_794 159
584 3300046452 Ga0495617_005988 Ga0495617_005988_1981_2460 159
585 3300046457 Ga0495590_0015070 Ga0495590_0015070_236_715 159
586 3300046457 Ga0495590_0051291 Ga0495590_0051291_432_911 159
587 3300046460 Ga0495638_0002531 Ga0495638_0002531_8183_8662 159
588 3300046460 Ga0495638_0094981 Ga0495638_0094981_733_1212 159
589 3300046471 Ga0495650_0118103 Ga0495650_0118103_105_584 159
590 3300046474 Ga0495605_0000839 Ga0495605_0000839_12283_12762 159
591 3300046476 Ga0495662_0161966 Ga0495662_0161966_168_647 159
592 3300046492 Ga0495585_0014511 Ga0495585_0014511_1810_2289 159
593 3300046492 Ga0495585_0016074 Ga0495585_0016074_428_907 159
594 3300046501 Ga0495607_0202514 Ga0495607_0202514_213_737 159
595 3300046501 Ga0495607_0365179 Ga0495607_0365179_78_557 159
596 3300046506 Ga0495583_0090651 Ga0495583_0090651_437_916 159
597 3300046506 Ga0495583_0160053 Ga0495583_0160053_62_541 159
598 3300046507 Ga0495606_0001947 Ga0495606_0001947_19136_19636 159
599 3300046507 Ga0495606_0023345 Ga0495606_0023345_276_755 159
600 3300046507 Ga0495606_0046527 Ga0495606_0046527_1286_1789 159
601 3300046507 Ga0495606_0237906 Ga0495606_0237906_191_670 159
602 3300046512 Ga0495610_0102043 Ga0495610_0102043_747_1226 159
603 3300046513 Ga0495616_0035921 Ga0495616_0035921_811_1290 159
604 3300046513 Ga0495616_0090409 Ga0495616_0090409_580_1059 159
605 3300046515 Ga0495620_0020443 Ga0495620_0020443_680_1183 159
606 3300046515 Ga0495620_0052602 Ga0495620_0052602_792_1271 159
607 3300046515 Ga0495620_0064385 Ga0495620_0064385_445_924 159
608 3300046518 Ga0495631_0000375 Ga0495631_0000375_23842_24321 159
609 3300046519 Ga0495632_0006798 Ga0495632_0006798_4834_5313 159
610 3300046522 Ga0495643_0022175 Ga0495643_0022175_1175_1654 159
611 3300046522 Ga0495643_0025967 Ga0495643_0025967_2495_2974 159
612 3300046522 Ga0495643_0138843 Ga0495643_0138843_134_658 159
613 3300046524 Ga0495648_0091482 Ga0495648_0091482_287_790 159
614 3300046524 Ga0495648_0107718 Ga0495648_0107718_563_1042 159
615 3300046524 Ga0495648_0207077 Ga0495648_0207077_132_611 159
616 3300046525 Ga0495663_0040069 Ga0495663_0040069_716_1195 159
617 3300046530 Ga0495654_0301224 Ga0495654_0301224_76_555 159
618 3300046538 Ga0495609_0103373 Ga0495609_0103373_306_785 159
619 3300046542 Ga0495597_0011753 Ga0495597_0011753_2525_3004 159
620 3300046558 Ga0495633_0020507 Ga0495633_0020507_2102_2581 159
621 3300046616 Ga0495668_0007895 Ga0495668_0007895_1545_2024 159
622 3300046616 Ga0495668_0037619 Ga0495668_0037619_199_678 159
623 3300046616 Ga0495668_0136847 Ga0495668_0136847_639_1142 159
624 3300046648 Ga0495611_0007176 Ga0495611_0007176_807_1286 159
625 3300046648 Ga0495611_0395127 Ga0495611_0395127_57_536 159
626 3300046660 Ga0495625_0033539 Ga0495625_0033539_1181_1660 159
627 3300046660 Ga0495625_0060124 Ga0495625_0060124_492_971 159
628 3300046660 Ga0495625_0253865 Ga0495625_0253865_133_612 159
629 3300046660 Ga0495625_0428701 Ga0495625_0428701_15_494 159
630 3300046660 Ga0495625_0588212 Ga0495625_0588212_133_612 159
631 3300046665 Ga0495661_0273255 Ga0495661_0273255_239_718 159
632 3300046674 Ga0495588_0026546 Ga0495588_0026546_137_616 159
633 3300046674 Ga0495588_0030853 Ga0495588_0030853_1980_2459 159
634 3300046675 Ga0495657_0236328 Ga0495657_0236328_488_967 159
635 3300046691 Ga0495670_0118856 Ga0495670_0118856_594_1073 159
636 3300046691 Ga0495670_0154437 Ga0495670_0154437_674_1153 159
637 3300046694 Ga0495649_0004881 Ga0495649_0004881_885_1364 159
638 3300046694 Ga0495649_0030379 Ga0495649_0030379_1223_1702 159
639 3300046810 Ga0495660_0085457 Ga0495660_0085457_671_1150 159
640 3300046810 Ga0495660_0099765 Ga0495660_0099765_960_1439 159
641 3300047317 Ga0495604_0290825 Ga0495604_0290825_208_687 159
642 3300047318 Ga0495636_0138244 Ga0495636_0138244_235_714 159
643 3300047318 Ga0495636_0556328 Ga0495636_0556328_68_547 159
644 3300047320 Ga0495672_0022787 Ga0495672_0022787_212_691 159
645 3300047320 Ga0495672_0084243 Ga0495672_0084243_424_903 159
646 3300047443 Ga0495687_063388 Ga0495687_063388_590_1069 159
647 3300047446 Ga0495679_053875 Ga0495679_053875_123_602 159
648 3300047472 Ga0495686_0003461 Ga0495686_0003461_2366_2866 159
649 3300047472 Ga0495686_0028813 Ga0495686_0028813_1236_1736 159
650 3300047472 Ga0495686_0030555 Ga0495686_0030555_847_1404 159
651 3300047472 Ga0495686_0036792 Ga0495686_0036792_1105_1584 159
652 3300047472 Ga0495686_0293505 Ga0495686_0293505_243_722 159
653 3300047472 Ga0495686_0569409 Ga0495686_0569409_15_494 159
654 3300048090 Ga0495615_0048901 Ga0495615_0048901_38_517 159
655 3300048091 Ga0495626_0068568 Ga0495626_0068568_434_913 159
656 3300048904 Ga0496101_0011657 Ga0496101_0011657_814_1293 159
657 3300048904 Ga0496101_0155478 Ga0496101_0155478_1169_1648 159
658 3300048904 Ga0496101_0696203 Ga0496101_0696203_137_616 159
659 3300048905 Ga0496102_0016755 Ga0496102_0016755_482_961 159
660 3300048905 Ga0496102_1763904 Ga0496102_1763904_34_513 159
661 3300048906 Ga0496103_0145406 Ga0496103_0145406_504_983 159
662 3300048909 Ga0496106_0003275 Ga0496106_0003275_835_1314 159
663 3300048909 Ga0496106_0339538 Ga0496106_0339538_450_929 159
664 3300048913 Ga0496110_0132425 Ga0496110_0132425_1417_1896 159
665 3300048913 Ga0496110_0331341 Ga0496110_0331341_211_711 159
666 3300048914 Ga0496111_0004639 Ga0496111_0004639_7595_8074 159
667 3300048916 Ga0496113_0172590 Ga0496113_0172590_1209_1688 159
668 3300048916 Ga0496113_0214156 Ga0496113_0214156_730_1209 159
669 3300048916 Ga0496113_0993460 Ga0496113_0993460_20_499 159
670 3300048917 Ga0496114_0252577 Ga0496114_0252577_610_1110 159
671 3300048917 Ga0496114_1484558 Ga0496114_1484558_75_554 159
672 3300048919 Ga0496116_0004014 Ga0496116_0004014_11354_11833 159
673 3300048919 Ga0496116_0029898 Ga0496116_0029898_1456_1935 159
674 3300048919 Ga0496116_0235391 Ga0496116_0235391_196_675 159
675 3300048920 Ga0496117_0001675 Ga0496117_0001675_24993_25472 159
676 3300048920 Ga0496117_0010155 Ga0496117_0010155_2467_2946 159
677 3300048920 Ga0496117_0028469 Ga0496117_0028469_2611_3090 159
678 3300048920 Ga0496117_0060488 Ga0496117_0060488_847_1326 159
679 3300048920 Ga0496117_0149729 Ga0496117_0149729_366_845 159
680 3300048920 Ga0496117_0238795 Ga0496117_0238795_320_799 159
681 3300048920 Ga0496117_0353566 Ga0496117_0353566_127_606 159
682 3300048921 Ga0496118_0005907 Ga0496118_0005907_758_1237 159
683 3300048921 Ga0496118_0018004 Ga0496118_0018004_3462_3941 159
684 3300048921 Ga0496118_0053917 Ga0496118_0053917_1893_2372 159
685 3300048921 Ga0496118_0153714 Ga0496118_0153714_504_983 159
686 3300048922 Ga0496119_0010381 Ga0496119_0010381_1994_2473 159
687 3300048922 Ga0496119_0028043 Ga0496119_0028043_2862_3341 159
688 3300048922 Ga0496119_0048643 Ga0496119_0048643_1882_2361 159
689 3300048923 Ga0496120_0011761 Ga0496120_0011761_758_1237 159
690 3300048924 Ga0496121_0023159 Ga0496121_0023159_758_1237 159
691 3300048924 Ga0496121_0027344 Ga0496121_0027344_3069_3569 159
692 3300048924 Ga0496121_0043849 Ga0496121_0043849_2654_3133 159
693 3300048924 Ga0496121_0048646 Ga0496121_0048646_3026_3505 159
694 3300048924 Ga0496121_0060980 Ga0496121_0060980_58_537 159
695 3300048924 Ga0496121_0096979 Ga0496121_0096979_99_578 159
696 3300048924 Ga0496121_0198212 Ga0496121_0198212_630_1109 159
697 3300048924 Ga0496121_0235141 Ga0496121_0235141_343_822 159
698 3300048924 Ga0496121_0246688 Ga0496121_0246688_629_1108 159
699 3300048924 Ga0496121_0285232 Ga0496121_0285232_101_580 159
700 3300048925 Ga0496122_0000777 Ga0496122_0000777_55121_55600 159
701 3300048925 Ga0496122_0007570 Ga0496122_0007570_400_879 159
702 3300048925 Ga0496122_0010344 Ga0496122_0010344_1239_1718 159
703 3300048925 Ga0496122_0019424 Ga0496122_0019424_2711_3190 159
704 3300048925 Ga0496122_0019830 Ga0496122_0019830_3681_4160 159
705 3300048925 Ga0496122_0041920 Ga0496122_0041920_1029_1508 159
706 3300048925 Ga0496122_0098191 Ga0496122_0098191_710_1189 159
707 3300048925 Ga0496122_0141589 Ga0496122_0141589_843_1322 159
708 3300048925 Ga0496122_0203257 Ga0496122_0203257_51_530 159
709 3300048926 Ga0496123_0000519 Ga0496123_0000519_56130_56609 159
710 3300048926 Ga0496123_0022279 Ga0496123_0022279_2384_2863 159
711 3300048926 Ga0496123_0025267 Ga0496123_0025267_488_967 159
712 3300048926 Ga0496123_0026543 Ga0496123_0026543_2140_2619 159
713 3300048926 Ga0496123_0079855 Ga0496123_0079855_713_1192 159
714 3300048926 Ga0496123_0123005 Ga0496123_0123005_175_654 159
715 3300048927 Ga0496124_0000574 Ga0496124_0000574_44007_44486 159
716 3300048927 Ga0496124_0010139 Ga0496124_0010139_1919_2398 159
717 3300048927 Ga0496124_0011802 Ga0496124_0011802_2348_2827 159
718 3300048927 Ga0496124_0022544 Ga0496124_0022544_2574_3053 159
719 3300048927 Ga0496124_0057395 Ga0496124_0057395_513_992 159
720 3300048927 Ga0496124_0145769 Ga0496124_0145769_1223_1702 159
721 3300048927 Ga0496124_0203316 Ga0496124_0203316_607_1086 159
722 3300048927 Ga0496124_0621851 Ga0496124_0621851_54_557 159
723 3300048928 Ga0496125_0000790 Ga0496125_0000790_42149_42628 159
724 3300048928 Ga0496125_0070064 Ga0496125_0070064_793_1272 159
725 3300048928 Ga0496125_0074850 Ga0496125_0074850_817_1296 159
726 3300048928 Ga0496125_0132852 Ga0496125_0132852_875_1354 159
727 3300048928 Ga0496125_0145729 Ga0496125_0145729_528_1007 159
728 3300048929 Ga0496126_0000466 Ga0496126_0000466_70833_71312 159
729 3300048929 Ga0496126_0060122 Ga0496126_0060122_2232_2711 159
730 3300048929 Ga0496126_0205504 Ga0496126_0205504_1091_1570 159
731 3300049459 Ga0495678_062308 Ga0495678_062308_659_1138 159
732 3300049459 Ga0495678_090851 Ga0495678_090851_450_929 159
733 3300049460 Ga0495682_0018055 Ga0495682_0018055_306_785 159
734 3300049568 Ga0501031_0019286 Ga0501031_0019286_2165_2644 159
735 3300049568 Ga0501031_0111024 Ga0501031_0111024_399_878 159
736 3300049569 Ga0501032_0043928 Ga0501032_0043928_1575_2108 159
737 3300049570 Ga0501033_0082976 Ga0501033_0082976_1597_2076 159
738 3300049570 Ga0501033_0194743 Ga0501033_0194743_320_799 159
739 3300049570 Ga0501033_0522763 Ga0501033_0522763_177_710 159
740 3300049571 Ga0501034_0026144 Ga0501034_0026144_3026_3505 159
741 3300049571 Ga0501034_0106309 Ga0501034_0106309_142_621 159
742 3300049571 Ga0501034_0251041 Ga0501034_0251041_113_592 159
743 3300049571 Ga0501034_0463822 Ga0501034_0463822_325_804 159
744 3300049571 Ga0501034_0964367 Ga0501034_0964367_16_549 159
745 3300049572 Ga0501036_0219603 Ga0501036_0219603_247_726 159
746 3300049572 Ga0501036_0232296 Ga0501036_0232296_848_1327 159
747 3300049573 Ga0501037_0116744 Ga0501037_0116744_85_564 159
748 3300049573 Ga0501037_0168959 Ga0501037_0168959_209_688 159
749 3300049574 Ga0501038_0026508 Ga0501038_0026508_236_715 159
750 3300049574 Ga0501038_0091915 Ga0501038_0091915_1570_2049 159
751 3300049574 Ga0501038_0963358 Ga0501038_0963358_131_610 159
752 3300049575 Ga0501039_0242833 Ga0501039_0242833_518_997 159
753 3300049575 Ga0501039_0868789 Ga0501039_0868789_15_494 159
754 3300049576 Ga0501040_0289498 Ga0501040_0289498_246_725 159
755 3300049577 Ga0501041_0074743 Ga0501041_0074743_774_1253 159
756 3300049578 Ga0501042_0020859 Ga0501042_0020859_661_1140 159
757 3300049579 Ga0501043_0067906 Ga0501043_0067906_1793_2272 159
758 3300049579 Ga0501043_0154843 Ga0501043_0154843_1105_1584 159
759 3300049579 Ga0501043_0556238 Ga0501043_0556238_116_595 159
760 3300049580 Ga0501046_0032362 Ga0501046_0032362_422_901 159
761 3300049580 Ga0501046_0086897 Ga0501046_0086897_1030_1563 159
762 3300049581 Ga0501047_0029183 Ga0501047_0029183_896_1429 159
763 3300049581 Ga0501047_0064904 Ga0501047_0064904_3027_3506 159
764 3300049581 Ga0501047_0292116 Ga0501047_0292116_373_852 159
765 3300049582 Ga0501048_0011044 Ga0501048_0011044_4136_4615 159
766 3300049583 Ga0501067_0022697 Ga0501067_0022697_2379_2858 159
767 3300049584 Ga0501068_0037470 Ga0501068_0037470_2197_2676 159
768 3300049584 Ga0501068_0682675 Ga0501068_0682675_174_653 159
769 3300049586 Ga0501070_0044862 Ga0501070_0044862_2631_3110 159
770 3300049587 Ga0501071_0053381 Ga0501071_0053381_1232_1711 159
771 3300049589 Ga0501073_0032824 Ga0501073_0032824_889_1368 159
772 3300049589 Ga0501073_0053843 Ga0501073_0053843_734_1267 159
773 3300049741 Ga0501079_0281217 Ga0501079_0281217_236_715 159
774 3300049744 Ga0501083_0057375 Ga0501083_0057375_1875_2408 159
775 3300049744 Ga0501083_0169980 Ga0501083_0169980_658_1137 159
776 3300049822 Ga0501035_0010541 Ga0501035_0010541_3767_4246 159
777 3300049822 Ga0501035_0062185 Ga0501035_0062185_227_706 159
778 3300049823 Ga0501044_0038105 Ga0501044_0038105_4267_4746 159
779 3300049823 Ga0501044_0094855 Ga0501044_0094855_1941_2420 159
780 3300049823 Ga0501044_0150577 Ga0501044_0150577_598_1077 159
781 3300049823 Ga0501044_0254180 Ga0501044_0254180_825_1304 159
782 3300049824 Ga0501045_0005925 Ga0501045_0005925_4745_5224 159
783 3300050492 nmdc:mga0yw44_41508_c1 nmdc:mga0yw44_41508_c1_1977_2456 159
784 3300050493 nmdc:mga0k408_22809_c1 nmdc:mga0k408_22809_c1_968_1447 159
785 3300050494 nmdc:mga06z11_7641_c1 nmdc:mga06z11_7641_c1_1943_2422 159
786 3300050496 nmdc:mga07m45_40598_c1 nmdc:mga07m45_40598_c1_538_1017 159
787 3300050516 nmdc:mga0sz30_75994_c1 nmdc:mga0sz30_75994_c1_665_1144 159
788 3300050516 nmdc:mga0sz30_89954_c1 nmdc:mga0sz30_89954_c1_542_1021 159
789 3300053079 Ga0500610_0099306 Ga0500610_0099306_592_1071 159
790 3300053086 Ga0500578_0051786 Ga0500578_0051786_2074_2553 159
791 3300053086 Ga0500578_0541689 Ga0500578_0541689_18_497 159
792 3300053087 Ga0500643_049242 Ga0500643_049242_609_1088 159
793 3300053104 Ga0500556_0071340 Ga0500556_0071340_142_621 159
794 3300053109 Ga0500569_023739 Ga0500569_023739_698_1177 159
795 3300053109 Ga0500569_093176 Ga0500569_093176_364_843 159
796 3300053118 Ga0500594_0029192 Ga0500594_0029192_340_819 159
797 3300053118 Ga0500594_0038369 Ga0500594_0038369_263_742 159
798 3300053120 Ga0500597_160443 Ga0500597_160443_244_723 159
799 3300053125 Ga0500618_003843 Ga0500618_003843_2064_2588 159
800 3300053125 Ga0500618_007517 Ga0500618_007517_175_654 159
801 3300053134 Ga0500658_0002072 Ga0500658_0002072_2003_2482 159
802 3300053134 Ga0500658_0004778 Ga0500658_0004778_3740_4219 159
803 3300053139 Ga0500568_0004625 Ga0500568_0004625_5929_6408 159
804 3300053139 Ga0500568_0007583 Ga0500568_0007583_4204_4683 159
805 3300053139 Ga0500568_0035878 Ga0500568_0035878_193_735 159
806 3300053139 Ga0500568_0076787 Ga0500568_0076787_708_1187 159
807 3300053142 Ga0500577_0183323 Ga0500577_0183323_270_749 159
808 3300053151 Ga0500604_0103018 Ga0500604_0103018_414_893 159
809 3300053153 Ga0500616_0001463 Ga0500616_0001463_21541_22020 159
810 3300053153 Ga0500616_0043989 Ga0500616_0043989_149_628 159
811 3300053156 Ga0500622_0002296 Ga0500622_0002296_10801_11280 159
812 3300053158 Ga0500627_0431995 Ga0500627_0431995_11_490 159
813 3300053160 Ga0500633_0034799 Ga0500633_0034799_560_1039 159
814 3300053727 Ga0500611_133181 Ga0500611_133181_143_622 159
815 3300059646 Ga0587078_015009 Ga0587078_015009_114_593 159
816 3300060353 Ga0501082_0716774 Ga0501082_0716774_110_643 159
817 3300061719 Ga0466962_0184563 Ga0466962_0184563_17_496 159
818 iso_pu_bacteria 2718218365 2721160369 159
819 iso_pu_bacteria 2728369397 2730300001 159
820 iso_pu_bacteria 2791355264 2793346496 159
821 iso_pu_bacteria 2842285085 2842288395 159
822 iso_pu_bacteria 2842402390 2842406259 159
823 iso_pu_bacteria 2842409023 2842412844 159
824 iso_pu_bacteria 2842415677 2842419277 159
825 iso_pu_bacteria 8005282627 8005286861 159

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01257

2Fe-2S_thioredx

Thioredoxin-like [2Fe-2S] ferredoxin

47

191

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7t30-assembly1.cif.gz_H structure of electron bifurcating ni-fe hydrogenase complex hydabcsl in fmn/nad(h) bound state 0.9075 9 77
7t30-assembly1.cif.gz_H structure of electron bifurcating ni-fe hydrogenase complex hydabcsl in fmn/nad(h) bound state 0.8615 9 77
7p92-assembly1.cif.gz_B tmhydabc- t. maritima bifurcating hydrogenase with bridge domain up 0.8325 77 158
7p8n-assembly1.cif.gz_B tmhydabc- t. maritima hydrogenase with bridge closed 0.8276 79 155
7p5h-assembly1.cif.gz_b tmhydabc- d2 map 0.8155 77 158
ID Description Score Start End Superfamily
af_Q9D6J6_126_223_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9673 76 156 3.40.30.10
af_P0AFD1_83_165_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9576 75 156 3.40.30.10
3iamB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;NADH-quinone oxidoreductase subunit E 0.9553 28 75 1.10.10.1590
af_A4HX94_128_234_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9541 76 158 3.40.30.10
af_P9WIV5_106_200_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9433 76 158 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A7W7Z118-F1-model_v4 Formate dehydrogenase subunit gamma 0.8283 12 159 GO:0016491
GO:0046872
GO:0051537
AF-A0A6A7Y881-F1-model_v4 Formate dehydrogenase subunit gamma 0.8262 11 157 GO:0016491
GO:0046872
GO:0051537
AF-A0A1M5MYF5-F1-model_v4 Formate dehydrogenase gamma subunit 0.8261 11 159 GO:0016491
GO:0046872
GO:0051537
AF-A0A1M7SUZ6-F1-model_v4 Formate dehydrogenase gamma subunit 0.825 12 159 GO:0016491
GO:0046872
GO:0051537
AF-A0A0A8K1J0-F1-model_v4 NAD-dependent formate dehydrogenase gamma subunit 0.8242 11 159 GO:0016491
GO:0046872
GO:0051537

Feature Viewer

pLDDT pTM Quality
93.64 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map