F482296

General Info

Members Datasets Scaffolds Average Seq Length
822 306 1644 237

Family's Representative Sequence

Representative Sequence 3300006028|Ga0070717_10004351|Ga0070717_1000435112
Length 229
Sequence MEDEKLERIVEARMKLRERYLDKIKQTPGASDARPMGEGPTNRHGMPKLPVGQHLTQKWPVLDLGVKPTVSTDKWQLRIDGAVEEPVTLAWADFQKLPQAEDVSDFHCVTTWSLMDQRWKGVQFSTLAALVKVRPEASHVFIHAYDGYTTNVPMEEALKDDVLLVHTWNGQPLPKEHGGPVRMITPQLYAWKGAKWISRIEFLTQDRKGFWEERGYSNTAHPWQDDRYS

Samples

Sample ID Description Type Environment
1 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
104 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
161 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
165 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
166 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
167 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
168 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
169 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
170 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
171 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
172 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
173 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
174 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
175 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
176 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
177 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
178 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
179 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
180 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
181 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
182 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
183 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
184 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
185 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
186 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
187 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
188 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
189 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
190 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
191 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
192 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
193 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
194 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
195 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
196 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
197 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
198 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
199 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
200 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
201 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
202 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
203 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
204 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
205 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
206 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
207 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
208 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
209 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
210 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
211 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
212 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
213 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
214 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
215 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
216 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
217 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
218 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
219 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
220 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
221 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
222 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
223 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
224 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
225 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
226 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
227 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
228 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
229 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
230 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
231 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
232 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
233 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
234 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
235 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
236 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
237 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
238 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
239 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
240 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
241 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
242 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
243 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
244 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
245 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
246 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
247 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
248 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
249 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
250 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
251 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
252 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
253 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
254 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
255 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
256 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
257 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
258 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
259 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
260 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
261 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
262 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
263 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
264 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
265 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
266 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
267 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
268 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
269 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
270 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
271 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
272 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
273 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
274 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
275 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
277 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
281 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
282 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
283 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
284 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
285 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
286 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
287 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
288 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
289 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
291 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
292 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
293 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
294 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
295 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
296 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
297 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
298 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
299 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
300 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
301 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
302 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
303 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
304 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
305 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
306 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.26
Rhizosphere 94.77
Stem 0
Stem Tuber 0
Unclassified 11.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070717_10004351 3300006028 Bacteria 10217
2 Ga0065704_10134010 3300005289 Unclassified 1593
3 Ga0065704_10159363 3300005289 Bacteria 1366
4 Ga0065712_10093440 3300005290 Bacteria 2292
5 Ga0065715_10013058 3300005293 Bacteria 3407
6 Ga0065715_10091749 3300005293 Bacteria 5574
7 Ga0065715_10277269 3300005293 Bacteria 1095
8 Ga0065707_10001592 3300005295 Bacteria 10725
9 Ga0065707_10097379 3300005295 Bacteria 3175
10 Ga0065707_10444975 3300005295 Unclassified 806
11 Ga0070676_10060959 3300005328 Bacteria 2242
12 Ga0070676_10096033 3300005328 Unclassified 1823
13 Ga0070683_100214710 3300005329 Bacteria 1828
14 Ga0070683_100271749 3300005329 Bacteria 1612
15 Ga0070690_100189520 3300005330 Bacteria 1425
16 Ga0070690_100520165 3300005330 Bacteria 893
17 Ga0070670_100002606 3300005331 Bacteria 14902
18 Ga0070670_100028638 3300005331 Bacteria 4794
19 Ga0070670_100099769 3300005331 Bacteria 2499
20 Ga0070670_100353690 3300005331 Bacteria 1291
21 Ga0068869_100376879 3300005334 Bacteria 1162
22 Ga0070666_10088304 3300005335 Unclassified 2127
23 Ga0070666_10233450 3300005335 Bacteria 1299
24 Ga0068868_100066929 3300005338 Bacteria 2858
25 Ga0068868_100081286 3300005338 Bacteria 2598
26 Ga0068868_100109340 3300005338 Bacteria 2245
27 Ga0070660_100004836 3300005339 Bacteria 9311
28 Ga0070660_100272885 3300005339 Bacteria 1383
29 Ga0070689_100155636 3300005340 Bacteria 1845
30 Ga0070689_100192797 3300005340 Bacteria 1660
31 Ga0070691_10039453 3300005341 Bacteria 2231
32 Ga0070687_100022659 3300005343 Bacteria 2973
33 Ga0070687_100053794 3300005343 Unclassified 2095
34 Ga0070661_100047733 3300005344 Bacteria 3134
35 Ga0070668_100318220 3300005347 Bacteria 1309
36 Ga0070668_100379970 3300005347 Bacteria 1202
37 Ga0070669_100015360 3300005353 Bacteria 5456
38 Ga0070669_100017715 3300005353 Bacteria 5082
39 Ga0070669_100150864 3300005353 Bacteria 1799
40 Ga0070675_100000051 3300005354 Bacteria 71129
41 Ga0070675_100062051 3300005354 Bacteria 3087
42 Ga0070675_100160197 3300005354 Bacteria 1935
43 Ga0070675_100163813 3300005354 Bacteria 1914
44 Ga0070675_100184956 3300005354 Unclassified 1803
45 Ga0070675_100338376 3300005354 Bacteria 1333
46 Ga0070675_100460895 3300005354 Unclassified 1141
47 Ga0070671_100059067 3300005355 Bacteria 3191
48 Ga0070674_100002166 3300005356 Bacteria 10795
49 Ga0070674_100006272 3300005356 Bacteria 6923
50 Ga0070674_100012113 3300005356 Bacteria 5285
51 Ga0070674_100200450 3300005356 Unclassified 1541
52 Ga0070673_100016868 3300005364 Bacteria 5177
53 Ga0070673_100264969 3300005364 Bacteria 1502
54 Ga0070673_100570529 3300005364 Bacteria 1029
55 Ga0070673_100770952 3300005364 Bacteria 887
56 Ga0070688_100006754 3300005365 Bacteria 6152
57 Ga0070688_100037022 3300005365 Bacteria 2971
58 Ga0070688_100114422 3300005365 Bacteria 1799
59 Ga0070688_100288507 3300005365 Bacteria 1182
60 Ga0070688_100672488 3300005365 Unclassified 799
61 Ga0070667_100208368 3300005367 Bacteria 1737
62 Ga0070667_100323400 3300005367 Archaea 1392
63 Ga0070667_100588410 3300005367 Unclassified 1025
64 Ga0070667_100613900 3300005367 Bacteria 1002
65 Ga0070714_100033850 3300005435 Bacteria 4276
66 Ga0070713_100014854 3300005436 Bacteria 5797
67 Ga0070701_10010099 3300005438 Bacteria 4163
68 Ga0070701_10178773 3300005438 Archaea 1240
69 Ga0070711_100205641 3300005439 Bacteria 1522
70 Ga0070705_100007859 3300005440 Bacteria 5267
71 Ga0070705_100246214 3300005440 Bacteria 1252
72 Ga0070700_100007530 3300005441 Bacteria 5887
73 Ga0070700_100064656 3300005441 Bacteria 2317
74 Ga0070700_100141934 3300005441 Bacteria 1633
75 Ga0070694_100070838 3300005444 Bacteria 2401
76 Ga0070694_100218061 3300005444 Unclassified 1430
77 Ga0070708_100082906 3300005445 Bacteria 2905
78 Ga0070708_100430110 3300005445 Bacteria 1245
79 Ga0070678_100032030 3300005456 Bacteria 3634
80 Ga0070678_100174503 3300005456 Bacteria 1754
81 Ga0070662_100078448 3300005457 Bacteria 2453
82 Ga0070662_100129249 3300005457 Bacteria 1945
83 Ga0070662_100394419 3300005457 Bacteria 1141
84 Ga0070662_100459629 3300005457 Bacteria 1058
85 Ga0070681_10014105 3300005458 Bacteria 7953
86 Ga0070681_10455949 3300005458 Bacteria 1191
87 Ga0068867_100062089 3300005459 Bacteria 2776
88 Ga0068867_100087453 3300005459 Bacteria 2360
89 Ga0068867_100187100 3300005459 Bacteria 1650
90 Ga0068867_100365448 3300005459 Bacteria 1208
91 Ga0070706_100020841 3300005467 Bacteria 6035
92 Ga0070706_100031397 3300005467 Unclassified 4898
93 Ga0070706_100059330 3300005467 Bacteria 3531
94 Ga0070706_100300621 3300005467 Bacteria 1497
95 Ga0070707_100040710 3300005468 Bacteria 4446
96 Ga0070707_100073142 3300005468 Unclassified 3305
97 Ga0070707_100152060 3300005468 Bacteria 2254
98 Ga0070707_100448059 3300005468 Bacteria 1251
99 Ga0070698_100061351 3300005471 Bacteria 3794
100 Ga0070698_100143514 3300005471 Bacteria 2338
101 Ga0070698_100204458 3300005471 Bacteria 1910
102 Ga0070698_100351225 3300005471 Unclassified 1406
103 Ga0070698_100381582 3300005471 Bacteria 1342
104 Ga0070699_100019206 3300005518 Bacteria 5881
105 Ga0070699_100098399 3300005518 Bacteria 2563
106 Ga0070699_100149685 3300005518 Unclassified 2063
107 Ga0070699_100208734 3300005518 Bacteria 1738
108 Ga0070679_100081218 3300005530 Bacteria 3231
109 Ga0070684_100099617 3300005535 Bacteria 2594
110 Ga0070684_100718114 3300005535 Unclassified 932
111 Ga0070697_100018227 3300005536 Bacteria 5534
112 Ga0070697_100102883 3300005536 Bacteria 2373
113 Ga0070697_100110109 3300005536 Bacteria 2294
114 Ga0070697_100199852 3300005536 Unclassified 1699
115 Ga0070697_100434055 3300005536 Bacteria 1142
116 Ga0070672_100006251 3300005543 Bacteria 7981
117 Ga0070672_100256504 3300005543 Unclassified 1474
118 Ga0070672_100351184 3300005543 Bacteria 1257
119 Ga0070686_100001620 3300005544 Bacteria 12631
120 Ga0070686_100060428 3300005544 Bacteria 2445
121 Ga0070686_100075823 3300005544 Bacteria 2213
122 Ga0070686_100097982 3300005544 Unclassified 1975
123 Ga0070695_100002657 3300005545 Bacteria 10340
124 Ga0070695_100018884 3300005545 Bacteria 4191
125 Ga0070695_100025469 3300005545 Bacteria 3653
126 Ga0070695_100063564 3300005545 Unclassified 2399
127 Ga0070695_100177024 3300005545 Bacteria 1509
128 Ga0070696_100006698 3300005546 Bacteria 7696
129 Ga0070696_100096874 3300005546 Bacteria 2109
130 Ga0070693_100101333 3300005547 Bacteria 1755
131 Ga0070693_100509016 3300005547 Unclassified 855
132 Ga0070665_100003617 3300005548 Bacteria 16373
133 Ga0070665_100217201 3300005548 Unclassified 1913
134 Ga0070704_100002091 3300005549 Bacteria 11104
135 Ga0070704_100009394 3300005549 Bacteria 5906
136 Ga0070704_100031422 3300005549 Bacteria 3572
137 Ga0070704_100354743 3300005549 Bacteria 1239
138 Ga0070704_100780138 3300005549 Archaea 853
139 Ga0068855_100404717 3300005563 Bacteria 1495
140 Ga0070664_100414478 3300005564 Bacteria 1233
141 Ga0068854_100029932 3300005578 Bacteria 3774
142 Ga0068854_100155101 3300005578 Bacteria 1769
143 Ga0068854_100343452 3300005578 Bacteria 1220
144 Ga0068854_100629043 3300005578 Bacteria 919
145 Ga0068852_100172789 3300005616 Bacteria 2027
146 Ga0068852_100237666 3300005616 Bacteria 1740
147 Ga0068852_100707100 3300005616 Bacteria 1018
148 Ga0068859_100002272 3300005617 Bacteria 19501
149 Ga0068859_100326282 3300005617 Bacteria 1629
150 Ga0068859_100598483 3300005617 Bacteria 1196
151 Ga0068859_100610312 3300005617 Bacteria 1184
152 Ga0068864_100003740 3300005618 Bacteria 12560
153 Ga0068864_100119639 3300005618 Bacteria 2353
154 Ga0068864_100316231 3300005618 Bacteria 1465
155 Ga0068864_100790184 3300005618 Bacteria 932
156 Ga0068864_100838386 3300005618 Bacteria 905
157 Ga0068866_10427955 3300005718 Bacteria 860
158 Ga0068861_100016516 3300005719 Bacteria 5225
159 Ga0068861_100081657 3300005719 Bacteria 2531
160 Ga0068861_100209025 3300005719 Bacteria 1643
161 Ga0068861_100271107 3300005719 Bacteria 1457
162 Ga0068870_10267727 3300005840 Unclassified 1066
163 Ga0068863_100009883 3300005841 Bacteria 9292
164 Ga0068863_100102793 3300005841 Unclassified 2717
165 Ga0068863_100144708 3300005841 Bacteria 2273
166 Ga0068863_100233847 3300005841 Unclassified 1773
167 Ga0068858_100052743 3300005842 Bacteria 3763
168 Ga0068858_100149511 3300005842 Bacteria 2195
169 Ga0068858_100155372 3300005842 Bacteria 2152
170 Ga0068858_100448609 3300005842 Bacteria 1243
171 Ga0068858_100535219 3300005842 Bacteria 1134
172 Ga0068860_100152469 3300005843 Bacteria 2226
173 Ga0068860_100183049 3300005843 Bacteria 2025
174 Ga0068860_100207452 3300005843 Bacteria 1900
175 Ga0068860_100222999 3300005843 Bacteria 1831
176 Ga0068860_100279561 3300005843 Bacteria 1631
177 Ga0068862_100057712 3300005844 Bacteria 3330
178 Ga0068862_100077693 3300005844 Bacteria 2875
179 Ga0068862_100368918 3300005844 Bacteria 1336
180 Ga0081539_10117287 3300005985 Bacteria 1328
181 Ga0070716_100181526 3300006173 Unclassified 1382
182 Ga0070716_100570073 3300006173 Bacteria 847
183 Ga0097621_100027833 3300006237 Bacteria 4450
184 Ga0097621_100051623 3300006237 Bacteria 3347
185 Ga0097621_100120570 3300006237 Unclassified 2224
186 Ga0097621_100770587 3300006237 Bacteria 890
187 Ga0068871_100001043 3300006358 Bacteria 18562
188 Ga0068871_100004461 3300006358 Bacteria 9746
189 Ga0068871_100007147 3300006358 Bacteria 7964
190 Ga0068871_100008036 3300006358 Bacteria 7571
191 Ga0068871_100049103 3300006358 Bacteria 3409
192 Ga0068871_100372302 3300006358 Bacteria 1267
193 Ga0068871_100442946 3300006358 Bacteria 1163
194 Ga0068871_100478529 3300006358 Bacteria 1120
195 Ga0075428_100000004 3300006844 Bacteria 326694
196 Ga0075428_100050154 3300006844 Bacteria 4578
197 Ga0075428_100190825 3300006844 Bacteria 2216
198 Ga0075428_100311561 3300006844 Bacteria 1692
199 Ga0075428_100504399 3300006844 Bacteria 1294
200 Ga0075428_100524798 3300006844 Bacteria 1266
201 Ga0075428_100665704 3300006844 Bacteria 1110
202 Ga0075430_100001280 3300006846 Bacteria 20272
203 Ga0075431_100188637 3300006847 Bacteria 2113
204 Ga0075433_10011921 3300006852 Bacteria 7006
205 Ga0075433_10081808 3300006852 Bacteria 2847
206 Ga0075433_10099871 3300006852 Bacteria 2569
207 Ga0075433_10154793 3300006852 Unclassified 2039
208 Ga0075433_10181875 3300006852 Unclassified 1871
209 Ga0075434_100000046 3300006871 Bacteria 58053
210 Ga0075434_100000734 3300006871 Bacteria 25739
211 Ga0075434_100001398 3300006871 Bacteria 20271
212 Ga0075434_100017455 3300006871 Bacteria 6916
213 Ga0075434_100026654 3300006871 Bacteria 5665
214 Ga0075434_100128469 3300006871 Bacteria 2552
215 Ga0075434_100348343 3300006871 Bacteria 1502
216 Ga0075434_100454355 3300006871 Bacteria 1302
217 Ga0075434_100641979 3300006871 Bacteria 1080
218 Ga0075429_100091014 3300006880 Bacteria 2661
219 Ga0075429_100092636 3300006880 Bacteria 2635
220 Ga0068865_100012402 3300006881 Bacteria 5364
221 Ga0068865_100032144 3300006881 Bacteria 3504
222 Ga0068865_100051657 3300006881 Bacteria 2847
223 Ga0068865_100781907 3300006881 Bacteria 822
224 Ga0075436_100000322 3300006914 Bacteria 30570
225 Ga0075436_100000713 3300006914 Bacteria 22019
226 Ga0075436_100001187 3300006914 Bacteria 17698
227 Ga0075436_100004567 3300006914 Bacteria 9476
228 Ga0075436_100008893 3300006914 Bacteria 6872
229 Ga0075436_100014896 3300006914 Bacteria 5328
230 Ga0075436_100035585 3300006914 Bacteria 3434
231 Ga0075436_100043430 3300006914 Bacteria 3099
232 Ga0097620_100002272 3300006931 Bacteria 19501
233 Ga0097620_100326280 3300006931 Bacteria 1629
234 Ga0097620_100598474 3300006931 Bacteria 1196
235 Ga0097620_100610343 3300006931 Bacteria 1184
236 Ga0075435_100000021 3300007076 Bacteria 90065
237 Ga0075435_100000046 3300007076 Bacteria 60893
238 Ga0075435_100000369 3300007076 Bacteria 27571
239 Ga0075435_100001027 3300007076 Bacteria 17693
240 Ga0075435_100035899 3300007076 Bacteria 3936
241 Ga0075435_100048190 3300007076 Bacteria 3423
242 Ga0075435_100066569 3300007076 Bacteria 2931
243 Ga0075435_100085428 3300007076 Bacteria 2597
244 Ga0075435_100112970 3300007076 Bacteria 2260
245 Ga0075435_100120745 3300007076 Bacteria 2187
246 Ga0075435_100144577 3300007076 Bacteria 1997
247 Ga0099795_10077411 3300007788 Unclassified 1266
248 Ga0105240_10076414 3300009093 Bacteria 4129
249 Ga0111539_10000005 3300009094 Bacteria 467342
250 Ga0111539_10001037 3300009094 Bacteria 36456
251 Ga0111539_10006896 3300009094 Bacteria 14594
252 Ga0111539_10052917 3300009094 Bacteria 4833
253 Ga0111539_10086979 3300009094 Unclassified 3672
254 Ga0111539_10147015 3300009094 Bacteria 2759
255 Ga0111539_10206595 3300009094 Bacteria 2289
256 Ga0111539_10329841 3300009094 Bacteria 1776
257 Ga0111539_10473984 3300009094 Bacteria 1458
258 Ga0111539_10484063 3300009094 Bacteria 1441
259 Ga0111539_10984842 3300009094 Bacteria 980
260 Ga0105245_10003345 3300009098 Bacteria 14386
261 Ga0105245_10016238 3300009098 Bacteria 6490
262 Ga0105245_10123090 3300009098 Bacteria 2425
263 Ga0105245_10647031 3300009098 Unclassified 1087
264 Ga0105247_10111908 3300009101 Bacteria 1758
265 Ga0114129_10001099 3300009147 Bacteria 35539
266 Ga0114129_10009295 3300009147 Bacteria 14019
267 Ga0114129_10011701 3300009147 Bacteria 12485
268 Ga0114129_10039884 3300009147 Bacteria 6624
269 Ga0114129_10060649 3300009147 Bacteria 5288
270 Ga0114129_10176058 3300009147 Bacteria 2914
271 Ga0114129_10182616 3300009147 Unclassified 2853
272 Ga0114129_10208276 3300009147 Bacteria 2645
273 Ga0114129_10227170 3300009147 Bacteria 2515
274 Ga0114129_10303096 3300009147 Unclassified 2129
275 Ga0114129_10582022 3300009147 Unclassified 1452
276 Ga0114129_10801002 3300009147 Bacteria 1202
277 Ga0105243_10032750 3300009148 Bacteria 4018
278 Ga0105243_10223301 3300009148 Bacteria 1667
279 Ga0105243_10296270 3300009148 Bacteria 1464
280 Ga0105243_10428259 3300009148 Bacteria 1236
281 Ga0105243_10921541 3300009148 Bacteria 871
282 Ga0105241_10043803 3300009174 Bacteria 3390
283 Ga0105241_10132107 3300009174 Bacteria 2023
284 Ga0105242_10036079 3300009176 Unclassified 3965
285 Ga0105242_10083856 3300009176 Bacteria 2669
286 Ga0105242_10790084 3300009176 Unclassified 938
287 Ga0105242_10819960 3300009176 Bacteria 923
288 Ga0105248_10025256 3300009177 Bacteria 6606
289 Ga0105248_10051987 3300009177 Bacteria 4598
290 Ga0105248_10071367 3300009177 Bacteria 3901
291 Ga0105248_10074644 3300009177 Bacteria 3812
292 Ga0105248_10085267 3300009177 Bacteria 3554
293 Ga0105248_10090420 3300009177 Bacteria 3447
294 Ga0105248_10093862 3300009177 Unclassified 3379
295 Ga0105248_10115883 3300009177 Bacteria 3022
296 Ga0105248_10115890 3300009177 Bacteria 3022
297 Ga0105248_10139428 3300009177 Bacteria 2735
298 Ga0105248_10179269 3300009177 Bacteria 2388
299 Ga0105248_10184687 3300009177 Unclassified 2350
300 Ga0105248_10192378 3300009177 Bacteria 2299
301 Ga0105248_10228698 3300009177 Bacteria 2093
302 Ga0105248_10291779 3300009177 Bacteria 1836
303 Ga0105248_10297567 3300009177 Bacteria 1817
304 Ga0105248_10929900 3300009177 Unclassified 982
305 Ga0105238_10302283 3300009551 Bacteria 1584
306 Ga0105238_10448815 3300009551 Bacteria 1286
307 Ga0105249_10251302 3300009553 Bacteria 1753
308 Ga0105249_10459793 3300009553 Bacteria 1313
309 Ga0105249_10527328 3300009553 Bacteria 1229
310 Ga0105249_10606485 3300009553 Bacteria 1150
311 Ga0105249_10939082 3300009553 Bacteria 933
312 Ga0105249_11118243 3300009553 Bacteria 858
313 Ga0105246_10043903 3300011119 Bacteria 3035
314 Ga0157374_10103019 3300013296 Bacteria 2738
315 Ga0157374_10175601 3300013296 Bacteria 2091
316 Ga0157374_10200851 3300013296 Unclassified 1952
317 Ga0157374_11082292 3300013296 Bacteria 822
318 Ga0157378_10004804 3300013297 Bacteria 11841
319 Ga0157378_10152171 3300013297 Bacteria 2156
320 Ga0157378_10186731 3300013297 Bacteria 1953
321 Ga0157378_10285004 3300013297 Bacteria 1594
322 Ga0163162_10029778 3300013306 Bacteria 5404
323 Ga0163162_10048165 3300013306 Bacteria 4270
324 Ga0163162_10090255 3300013306 Unclassified 3145
325 Ga0163162_10683599 3300013306 Bacteria 1149
326 Ga0163162_10709330 3300013306 Bacteria 1127
327 Ga0163162_10927544 3300013306 Bacteria 983
328 Ga0163162_10955226 3300013306 Bacteria 968
329 Ga0157372_10318675 3300013307 Bacteria 1810
330 Ga0157375_10016265 3300013308 Bacteria 6675
331 Ga0157375_10041186 3300013308 Bacteria 4458
332 Ga0157375_10047873 3300013308 Bacteria 4178
333 Ga0157375_10219254 3300013308 Bacteria 2061
334 Ga0157375_10337800 3300013308 Bacteria 1672
335 Ga0157375_11407492 3300013308 Unclassified 821
336 Ga0163163_10000008 3300014325 Bacteria 286490
337 Ga0163163_10004315 3300014325 Bacteria 12115
338 Ga0163163_10019642 3300014325 Bacteria 6348
339 Ga0163163_10031827 3300014325 Bacteria 5094
340 Ga0163163_10794195 3300014325 Bacteria 1010
341 Ga0163163_11142432 3300014325 Bacteria 842
342 Ga0157380_10009562 3300014326 Bacteria 6957
343 Ga0157380_10057584 3300014326 Bacteria 3095
344 Ga0157380_10167423 3300014326 Bacteria 1916
345 Ga0157380_10181698 3300014326 Bacteria 1849
346 Ga0157380_10194362 3300014326 Bacteria 1794
347 Ga0157380_10292445 3300014326 Bacteria 1496
348 Ga0157380_10339216 3300014326 Bacteria 1401
349 Ga0157380_10482129 3300014326 Bacteria 1200
350 Ga0157377_10089858 3300014745 Bacteria 1811
351 Ga0157377_10185622 3300014745 Bacteria 1311
352 Ga0157377_10219812 3300014745 Bacteria 1215
353 Ga0157379_10049663 3300014968 Bacteria 3746
354 Ga0157379_10050937 3300014968 Bacteria 3697
355 Ga0157379_10079880 3300014968 Bacteria 2929
356 Ga0157379_10109621 3300014968 Bacteria 2480
357 Ga0157379_10278302 3300014968 Bacteria 1523
358 Ga0157379_10676331 3300014968 Unclassified 968
359 Ga0157376_10002435 3300014969 Bacteria 12586
360 Ga0157376_10041538 3300014969 Bacteria 3766
361 Ga0157376_10052068 3300014969 Bacteria 3403
362 Ga0157376_10057566 3300014969 Bacteria 3252
363 Ga0157376_10099317 3300014969 Unclassified 2539
364 Ga0157376_10142510 3300014969 Bacteria 2152
365 Ga0157376_10366276 3300014969 Bacteria 1384
366 Ga0157376_10593783 3300014969 Bacteria 1101
367 Ga0157376_10781488 3300014969 Unclassified 966
368 Ga0163161_10105057 3300017792 Unclassified 2106
369 Ga0213876_10002397 3300021384 Bacteria 11035
370 Ga0213876_10086902 3300021384 Unclassified 1655
371 Ga0213876_10323299 3300021384 Unclassified 820
372 Ga0207697_10139206 3300025315 Bacteria 1052
373 Ga0207642_10096852 3300025899 Unclassified 1472
374 Ga0207642_10102370 3300025899 Bacteria 1441
375 Ga0207710_10188386 3300025900 Bacteria 1015
376 Ga0207688_10079005 3300025901 Bacteria 1876
377 Ga0207688_10219889 3300025901 Bacteria 1144
378 Ga0207680_10007201 3300025903 Bacteria 5408
379 Ga0207680_10037783 3300025903 Bacteria 2790
380 Ga0207680_10178775 3300025903 Bacteria 1433
381 Ga0207680_10427742 3300025903 Unclassified 938
382 Ga0207680_10436582 3300025903 Bacteria 928
383 Ga0207699_10008546 3300025906 Bacteria 5062
384 Ga0207699_10270028 3300025906 Bacteria 1178
385 Ga0207645_10007501 3300025907 Bacteria 7698
386 Ga0207645_10040738 3300025907 Bacteria 2975
387 Ga0207645_10162436 3300025907 Bacteria 1462
388 Ga0207645_10259438 3300025907 Bacteria 1151
389 Ga0207643_10184162 3300025908 Unclassified 1265
390 Ga0207705_10065101 3300025909 Bacteria 2635
391 Ga0207684_10078238 3300025910 Bacteria 2813
392 Ga0207684_10121997 3300025910 Bacteria 2234
393 Ga0207684_10724441 3300025910 Bacteria 844
394 Ga0207654_10121962 3300025911 Bacteria 1638
395 Ga0207707_10027223 3300025912 Bacteria 5000
396 Ga0207707_10231432 3300025912 Bacteria 1608
397 Ga0207707_10279746 3300025912 Bacteria 1445
398 Ga0207707_10560569 3300025912 Bacteria 970
399 Ga0207695_10283335 3300025913 Unclassified 1551
400 Ga0207671_10279911 3300025914 Bacteria 1315
401 Ga0207662_10007425 3300025918 Bacteria 5969
402 Ga0207662_10158730 3300025918 Bacteria 1443
403 Ga0207657_10015910 3300025919 Bacteria 7268
404 Ga0207652_10062696 3300025921 Bacteria 3213
405 Ga0207646_10101765 3300025922 Unclassified 2576
406 Ga0207646_10221281 3300025922 Bacteria 1710
407 Ga0207646_10250083 3300025922 Bacteria 1601
408 Ga0207646_10537718 3300025922 Bacteria 1051
409 Ga0207681_10002033 3300025923 Bacteria 12981
410 Ga0207681_10041244 3300025923 Bacteria 3076
411 Ga0207681_10182689 3300025923 Unclassified 1599
412 Ga0207681_10232404 3300025923 Bacteria 1432
413 Ga0207694_10626518 3300025924 Bacteria 905
414 Ga0207650_10033595 3300025925 Bacteria 3716
415 Ga0207650_10034840 3300025925 Bacteria 3652
416 Ga0207650_10193214 3300025925 Unclassified 1627
417 Ga0207650_10222218 3300025925 Bacteria 1520
418 Ga0207659_10002806 3300025926 Bacteria 10388
419 Ga0207659_10014676 3300025926 Bacteria 5059
420 Ga0207659_10076917 3300025926 Bacteria 2455
421 Ga0207659_10167223 3300025926 Bacteria 1732
422 Ga0207659_10213148 3300025926 Bacteria 1549
423 Ga0207687_10010046 3300025927 Bacteria 6193
424 Ga0207687_10543755 3300025927 Bacteria 974
425 Ga0207664_10349651 3300025929 Bacteria 1308
426 Ga0207644_10139882 3300025931 Bacteria 1863
427 Ga0207690_10352556 3300025932 Bacteria 1164
428 Ga0207706_10236231 3300025933 Bacteria 1598
429 Ga0207706_10410581 3300025933 Unclassified 1173
430 Ga0207706_10428201 3300025933 Bacteria 1146
431 Ga0207706_10428247 3300025933 Bacteria 1146
432 Ga0207709_10366629 3300025935 Bacteria 1092
433 Ga0207670_10072972 3300025936 Bacteria 2378
434 Ga0207670_10270859 3300025936 Bacteria 1320
435 Ga0207670_10680735 3300025936 Bacteria 850
436 Ga0207669_10003785 3300025937 Bacteria 6579
437 Ga0207669_10022096 3300025937 Bacteria 3373
438 Ga0207669_10035637 3300025937 Bacteria 2834
439 Ga0207669_10046547 3300025937 Bacteria 2564
440 Ga0207669_10059517 3300025937 Bacteria 2337
441 Ga0207669_10253993 3300025937 Bacteria 1311
442 Ga0207669_10517367 3300025937 Bacteria 958
443 Ga0207704_10014709 3300025938 Bacteria 3961
444 Ga0207704_10040677 3300025938 Bacteria 2719
445 Ga0207704_10157833 3300025938 Bacteria 1610
446 Ga0207704_10460823 3300025938 Bacteria 1016
447 Ga0207665_10130148 3300025939 Bacteria 1785
448 Ga0207691_10468597 3300025940 Bacteria 1071
449 Ga0207711_10031453 3300025941 Bacteria 4480
450 Ga0207711_10052611 3300025941 Bacteria 3490
451 Ga0207711_10057206 3300025941 Bacteria 3353
452 Ga0207711_10086493 3300025941 Bacteria 2748
453 Ga0207711_10139379 3300025941 Unclassified 2181
454 Ga0207711_10235897 3300025941 Unclassified 1676
455 Ga0207711_10255376 3300025941 Bacteria 1610
456 Ga0207711_10296299 3300025941 Bacteria 1491
457 Ga0207711_10675552 3300025941 Bacteria 963
458 Ga0207689_10120585 3300025942 Bacteria 2157
459 Ga0207689_10219914 3300025942 Bacteria 1569
460 Ga0207661_10113524 3300025944 Bacteria 2296
461 Ga0207661_10310368 3300025944 Bacteria 1416
462 Ga0207661_10615938 3300025944 Bacteria 997
463 Ga0207679_10065819 3300025945 Bacteria 2714
464 Ga0207679_10084576 3300025945 Bacteria 2435
465 Ga0207679_10547950 3300025945 Bacteria 1037
466 Ga0207667_10978703 3300025949 Bacteria 834
467 Ga0207651_10094571 3300025960 Bacteria 2198
468 Ga0207651_10207602 3300025960 Bacteria 1574
469 Ga0207651_10216036 3300025960 Bacteria 1547
470 Ga0207651_10216429 3300025960 Bacteria 1546
471 Ga0207651_10226834 3300025960 Bacteria 1514
472 Ga0207651_10256112 3300025960 Bacteria 1434
473 Ga0207712_10161811 3300025961 Bacteria 1740
474 Ga0207712_10301033 3300025961 Unclassified 1316
475 Ga0207668_10205082 3300025972 Bacteria 1573
476 Ga0207668_10657995 3300025972 Bacteria 917
477 Ga0207640_10010651 3300025981 Bacteria 5186
478 Ga0207640_10039360 3300025981 Bacteria 2992
479 Ga0207640_10367130 3300025981 Bacteria 1162
480 Ga0207658_10089389 3300025986 Bacteria 2384
481 Ga0207658_10310026 3300025986 Unclassified 1363
482 Ga0207677_10158001 3300026023 Bacteria 1758
483 Ga0207677_10238904 3300026023 Bacteria 1468
484 Ga0207677_10312540 3300026023 Bacteria 1303
485 Ga0207677_10649082 3300026023 Bacteria 931
486 Ga0207703_10008420 3300026035 Bacteria 8152
487 Ga0207703_10245994 3300026035 Bacteria 1610
488 Ga0207703_10483832 3300026035 Bacteria 1160
489 Ga0207703_10484569 3300026035 Bacteria 1159
490 Ga0207703_10500302 3300026035 Bacteria 1141
491 Ga0207639_10103253 3300026041 Bacteria 2309
492 Ga0207678_10023546 3300026067 Bacteria 5386
493 Ga0207678_10469823 3300026067 Bacteria 1095
494 Ga0207708_10077621 3300026075 Bacteria 2549
495 Ga0207708_10081119 3300026075 Bacteria 2493
496 Ga0207708_10284813 3300026075 Bacteria 1340
497 Ga0207708_10479735 3300026075 Bacteria 1039
498 Ga0207708_10499818 3300026075 Bacteria 1019
499 Ga0207702_10161325 3300026078 Bacteria 2047
500 Ga0207702_10302983 3300026078 Bacteria 1517
501 Ga0207641_10001282 3300026088 Bacteria 25011
502 Ga0207641_10234207 3300026088 Bacteria 1708
503 Ga0207641_10371319 3300026088 Bacteria 1368
504 Ga0207641_10633798 3300026088 Archaea 1049
505 Ga0207641_11011226 3300026088 Bacteria 828
506 Ga0207648_10010445 3300026089 Bacteria 8798
507 Ga0207648_10090474 3300026089 Bacteria 2674
508 Ga0207648_10114067 3300026089 Bacteria 2374
509 Ga0207648_10268597 3300026089 Bacteria 1523
510 Ga0207648_10273464 3300026089 Bacteria 1509
511 Ga0207648_10339142 3300026089 Bacteria 1353
512 Ga0207648_10342935 3300026089 Bacteria 1346
513 Ga0207648_10367189 3300026089 Bacteria 1299
514 Ga0207676_10025605 3300026095 Bacteria 4378
515 Ga0207676_10057501 3300026095 Bacteria 3063
516 Ga0207676_10314306 3300026095 Bacteria 1435
517 Ga0207676_10726536 3300026095 Bacteria 964
518 Ga0207674_10069504 3300026116 Bacteria 3542
519 Ga0207674_10384377 3300026116 Bacteria 1357
520 Ga0207675_100006860 3300026118 Bacteria 10780
521 Ga0207675_100027086 3300026118 Bacteria 5337
522 Ga0207675_100112177 3300026118 Bacteria 2573
523 Ga0207675_100189881 3300026118 Bacteria 1970
524 Ga0207675_100897981 3300026118 Bacteria 902
525 Ga0207683_10061080 3300026121 Bacteria 3315
526 Ga0207683_10443728 3300026121 Bacteria 1196
527 Ga0207683_10885468 3300026121 Bacteria 829
528 Ga0207698_10105517 3300026142 Bacteria 2348
529 Ga0207698_10134115 3300026142 Bacteria 2121
530 Ga0207698_10934663 3300026142 Bacteria 876
531 Ga0207428_10000024 3300027907 Bacteria 265587
532 Ga0207428_10002382 3300027907 Bacteria 18773
533 Ga0207428_10023241 3300027907 Bacteria 5216
534 Ga0207428_10073682 3300027907 Bacteria 2678
535 Ga0207428_10078751 3300027907 Bacteria 2578
536 Ga0207428_10154303 3300027907 Bacteria 1747
537 Ga0268266_10009815 3300028379 Bacteria 8415
538 Ga0268266_10026180 3300028379 Bacteria 4963
539 Ga0268266_10059725 3300028379 Bacteria 3285
540 Ga0268265_10005365 3300028380 Bacteria 8775
541 Ga0268265_10044705 3300028380 Bacteria 3300
542 Ga0268265_10401641 3300028380 Bacteria 1267
543 Ga0268265_10449767 3300028380 Bacteria 1203
544 Ga0268265_10810243 3300028380 Unclassified 913
545 Ga0268264_10067376 3300028381 Bacteria 3022
546 Ga0268264_10185137 3300028381 Bacteria 1894
547 Ga0268264_10246161 3300028381 Bacteria 1659
548 Ga0268264_10254110 3300028381 Bacteria 1634
549 Ga0268264_10299468 3300028381 Bacteria 1513
550 Ga0268264_10618913 3300028381 Bacteria 1069
551 Ga0265336_10063297 3300028666 Unclassified 1108
552 Ga0265328_10040576 3300031239 Bacteria 1715
553 Ga0307408_100361706 3300031548 Bacteria 1235
554 Ga0307405_10084765 3300031731 Bacteria 2081
555 Ga0307405_10199900 3300031731 Bacteria 1451
556 Ga0307413_10017283 3300031824 Bacteria 3753
557 Ga0307413_10425421 3300031824 Bacteria 1047
558 Ga0307410_10031674 3300031852 Bacteria 3397
559 Ga0307409_100039634 3300031995 Bacteria 3498
560 Ga0307416_100282603 3300032002 Bacteria 1637
561 Ga0307414_10357405 3300032004 Bacteria 1256
562 Ga0307411_10139444 3300032005 Unclassified 1786
563 Ga0373930_0000075 3300034816 Bacteria 9794
564 Ga0373948_0000707 3300034817 Bacteria 4343
565 Ga0373950_0000829 3300034818 Bacteria 3880
566 Ga0373958_0063387 3300034819 Bacteria 805
567 Ga0373938_0036995 3300034957 Bacteria 1070
568 Ga0373926_0057577 3300035083 Bacteria 1412
569 Ga0373928_0027684 3300035084 Bacteria 1236
570 Ga0373929_0000640 3300035085 Bacteria 6758
571 Ga0373940_0000122 3300035088 Bacteria 9822
572 Ga0373949_0022891 3300035090 Bacteria 1443
573 Ga0373951_0001612 3300035091 Bacteria 5922
574 Ga0373952_0000267 3300035092 Bacteria 8595
575 Ga0373932_0000109 3300035112 Bacteria 22698
576 Ga0373932_0000680 3300035112 Bacteria 10284
577 Ga0373932_0021565 3300035112 Bacteria 1702
578 Ga0373939_0000190 3300035114 Bacteria 17092
579 Ga0373941_0000533 3300035115 Bacteria 7587
580 Ga0373953_0079340 3300035117 Unclassified 1363
581 Ga0373960_0000672 3300035121 Bacteria 7048
582 Ga0373960_0125163 3300035121 Bacteria 857
583 Ga0373943_0007733 3300035170 Bacteria 4828
584 Ga0373946_0023267 3300035171 Bacteria 2419
585 Ga0373955_0062263 3300035172 Bacteria 2063
586 Ga0373955_0298151 3300035172 Bacteria 972
587 Ga0373955_0397666 3300035172 Unclassified 837
588 Ga0373955_0448949 3300035172 Bacteria 786
589 Ga0373942_0001459 3300035207 Bacteria 6074
590 Ga0373942_0064689 3300035207 Unclassified 1055
591 Ga0373961_0000532 3300035241 Bacteria 14499
592 Ga0373962_0001183 3300035242 Bacteria 6098
593 Ga0373924_0029963 3300035410 Bacteria 2178
594 Ga0373931_0038125 3300035691 Bacteria 2513
595 Ga0373931_0080566 3300035691 Bacteria 1795
596 Ga0373927_0156641 3300035695 Bacteria 1492
597 Ga0373933_0203080 3300035724 Bacteria 1269
598 Ga0373933_0217339 3300035724 Bacteria 1226
599 Ga0373947_0098006 3300035725 Bacteria 1838
600 Ga0373937_0433424 3300036401 Bacteria 1248
601 Ga0373925_0034570 3300037068 Bacteria 3726
602 Ga0395899_0262357 3300037312 Bacteria 1181
603 Ga0395900_0236222 3300037418 Bacteria 1836
604 Ga0395898_0071392 3300037466 Bacteria 3355
605 Ga0395905_0507218 3300037471 Bacteria 1107
606 Ga0395905_0739756 3300037471 Bacteria 886
607 Ga0395901_0117396 3300038443 Bacteria 2796
608 Ga0436365_0318573 3300039437 Bacteria 1711
609 Ga0436365_0640910 3300039437 Bacteria 3361
610 Ga0436365_1614638 3300039437 Unclassified 1020
611 Ga0436365_1934805 3300039437 Bacteria 9128
612 Ga0439436_0075375 3300041404 Bacteria 940
613 Ga0451851_0314766 3300041507 Unclassified 839
614 Ga0439433_0062202 3300041999 Bacteria 891
615 Ga0439448_0117924 3300042005 Bacteria 910
616 Ga0439449_0101434 3300042007 Bacteria 1064
617 Ga0439457_029797 3300042014 Bacteria 1210
618 Ga0439462_0084647 3300042015 Bacteria 867
619 Ga0439463_074604 3300042016 Bacteria 870
620 Ga0450920_014523 3300042122 Bacteria 1492
621 Ga0450897_001745 3300042128 Bacteria 1529
622 Ga0450896_001698 3300042133 Bacteria 2763
623 Ga0439458_0007424 3300042157 Bacteria 2442
624 Ga0450908_019235 3300042184 Bacteria 1203
625 Ga0439435_0006856 3300042436 Bacteria 2578
626 Ga0439435_0007215 3300042436 Bacteria 2532
627 Ga0439435_0008423 3300042436 Bacteria 2390
628 Ga0439435_0097857 3300042436 Bacteria 899
629 Ga0439444_0001522 3300042437 Bacteria 3035
630 Ga0439459_0060416 3300042438 Unclassified 855
631 Ga0439460_0033009 3300042461 Bacteria 1485
632 Ga0450918_002892 3300042531 Bacteria 3229
633 Ga0451577_0169909 3300042876 Bacteria 1965
634 Ga0453683_0075311 3300044673 Bacteria 2113
635 Ga0466966_0273735 3300044684 Bacteria 1016
636 Ga0466964_0076960 3300044706 Bacteria 1424
637 Ga0466957_0104423 3300044842 Unclassified 1790
638 Ga0451576_0018681 3300045051 Bacteria 7584
639 Ga0451576_0075469 3300045051 Bacteria 3508
640 Ga0451576_0535379 3300045051 Unclassified 1231
641 Ga0466967_0279685 3300045976 Bacteria 1601
642 Ga0495592_0084011 3300046454 Bacteria 2298
643 Ga0495592_0366436 3300046454 Bacteria 920
644 Ga0495629_0165839 3300046459 Bacteria 1534
645 Ga0495629_0344681 3300046459 Bacteria 1017
646 Ga0495653_0204295 3300046463 Bacteria 1339
647 Ga0495653_0408311 3300046463 Bacteria 862
648 Ga0495580_0176623 3300046472 Bacteria 1475
649 Ga0495580_0262178 3300046472 Bacteria 1182
650 Ga0495582_0023072 3300046473 Bacteria 3404
651 Ga0495583_0155689 3300046506 Bacteria 945
652 Ga0495608_0005169 3300046511 Bacteria 9325
653 Ga0495608_0111205 3300046511 Bacteria 1762
654 Ga0495628_0059974 3300046516 Bacteria 2986
655 Ga0495652_0204084 3300046529 Bacteria 1498
656 Ga0495652_0258070 3300046529 Bacteria 1288
657 Ga0495587_0031007 3300046536 Bacteria 3240
658 Ga0495621_0205609 3300046539 Unclassified 793
659 Ga0495645_0140722 3300046543 Bacteria 1683
660 Ga0495633_0121726 3300046558 Bacteria 1209
661 Ga0495634_0058336 3300046642 Bacteria 2573
662 Ga0495635_0097544 3300046663 Bacteria 2009
663 Ga0495635_0478531 3300046663 Bacteria 821
664 Ga0495659_0040431 3300046664 Unclassified 1662
665 Ga0495659_0049346 3300046664 Bacteria 1528
666 Ga0495659_0211599 3300046664 Unclassified 798
667 Ga0495647_0020723 3300046681 Bacteria 2363
668 Ga0495658_0064445 3300046683 Bacteria 2111
669 Ga0495658_0571181 3300046683 Bacteria 724
670 Ga0495669_0156767 3300046684 Bacteria 1079
671 Ga0495613_0016398 3300046689 Bacteria 5519
672 Ga0495613_0252745 3300046689 Bacteria 1230
673 Ga0495600_0286221 3300046809 Bacteria 1042
674 Ga0495674_0041014 3300047319 Bacteria 4137
675 Ga0495676_0076520 3300047321 Bacteria 2555
676 Ga0495680_0408143 3300047322 Bacteria 937
677 Ga0495684_0000177 3300047471 Bacteria 48507
678 Ga0495684_0035248 3300047471 Bacteria 3838
679 Ga0495684_0323195 3300047471 Bacteria 1103
680 Ga0495684_0433376 3300047471 Bacteria 917
681 Ga0495684_0499066 3300047471 Bacteria 837
682 Ga0496100_0024529 3300048903 Bacteria 3679
683 Ga0496101_0002257 3300048904 Bacteria 11774
684 Ga0496101_0538547 3300048904 Unclassified 923
685 Ga0496103_0282277 3300048906 Bacteria 1068
686 Ga0496104_0105181 3300048907 Bacteria 2705
687 Ga0496104_0422573 3300048907 Bacteria 1245
688 Ga0496105_0010070 3300048908 Bacteria 7420
689 Ga0496105_0405052 3300048908 Unclassified 1082
690 Ga0496106_0066464 3300048909 Bacteria 2746
691 Ga0496106_0066847 3300048909 Bacteria 2739
692 Ga0496107_0003799 3300048910 Bacteria 10140
693 Ga0496107_0680616 3300048910 Unclassified 757
694 Ga0496108_0005186 3300048911 Bacteria 10529
695 Ga0496108_0016848 3300048911 Bacteria 5972
696 Ga0496109_0033723 3300048912 Bacteria 4607
697 Ga0496109_0182065 3300048912 Bacteria 1974
698 Ga0496109_0271661 3300048912 Bacteria 1597
699 Ga0496109_0504385 3300048912 Bacteria 1142
700 Ga0496110_0079389 3300048913 Bacteria 2922
701 Ga0496110_0079987 3300048913 Bacteria 2911
702 Ga0496111_0042526 3300048914 Bacteria 3263
703 Ga0496112_0018686 3300048915 Bacteria 6533
704 Ga0496112_0056613 3300048915 Bacteria 3859
705 Ga0496112_0128868 3300048915 Bacteria 2501
706 Ga0496112_0229701 3300048915 Unclassified 1810
707 Ga0496112_0559141 3300048915 Bacteria 1078
708 Ga0496112_0563508 3300048915 Bacteria 1073
709 Ga0496112_0653873 3300048915 Bacteria 981
710 Ga0496113_0437816 3300048916 Bacteria 1050
711 Ga0496114_0001468 3300048917 Bacteria 17934
712 Ga0496114_0016818 3300048917 Bacteria 5898
713 Ga0496114_0018005 3300048917 Bacteria 5707
714 Ga0496114_0045645 3300048917 Bacteria 3641
715 Ga0496114_0343042 3300048917 Bacteria 1321
716 Ga0496115_0114771 3300048918 Bacteria 2214
717 Ga0501034_0060848 3300049571 Bacteria 3793
718 Ga0501039_0555378 3300049575 Bacteria 901
719 Ga0501040_0086855 3300049576 Unclassified 2172
720 Ga0501040_0321426 3300049576 Viruses 1107
721 Ga0501042_0048930 3300049578 Unclassified 3015
722 Ga0501042_0079522 3300049578 Bacteria 2349
723 Ga0501046_0146102 3300049580 Bacteria 1786
724 Ga0501071_0018735 3300049587 Bacteria 4799
725 Ga0501072_0118737 3300049588 Unclassified 2107
726 Ga0501073_0007844 3300049589 Bacteria 7925
727 Ga0501075_0424868 3300049591 Bacteria 1013
728 Ga0501075_0447514 3300049591 Bacteria 985
729 Ga0501075_0818701 3300049591 Unclassified 708
730 Ga0501076_0013710 3300049592 Bacteria 6082
731 Ga0501077_0196413 3300049593 Bacteria 1282
732 Ga0501077_0249462 3300049593 Bacteria 1129
733 Ga0501079_0128740 3300049741 Bacteria 1970
734 Ga0501079_0873505 3300049741 Unclassified 708
735 Ga0501081_0237996 3300049743 Unclassified 1327
736 Ga0501081_0514840 3300049743 Bacteria 892
737 Ga0501083_0171261 3300049744 Bacteria 1419
738 Ga0501044_0072060 3300049823 Bacteria 3513
739 Ga0501045_0084495 3300049824 Unclassified 2342
740 Ga0501045_0496184 3300049824 Bacteria 907
741 Ga0501045_0540758 3300049824 Bacteria 864
742 nmdc:mga05p37_1428_c1 3300050507 Bacteria 27771
743 nmdc:mga05p37_220834_c1 3300050507 Bacteria 2287
744 nmdc:mga05p37_227524_c1 3300050507 Bacteria 2248
745 nmdc:mga05p37_28333_c1 3300050507 Bacteria 6830
746 nmdc:mga05p37_48056_c1 3300050507 Bacteria 5248
747 nmdc:mga05p37_500557_c1 3300050507 Bacteria 1395
748 nmdc:mga05p37_58281_c1 3300050507 Bacteria 4756
749 nmdc:mga05p37_59705_c1 3300050507 Bacteria 4696
750 nmdc:mga05p37_6161_c1 3300050507 Bacteria 14116
751 nmdc:mga05p37_85478_c1 3300050507 Unclassified 3887
752 nmdc:mga09592_179302_c1 3300050508 Bacteria 1832
753 nmdc:mga09592_373261_c1 3300050508 Bacteria 1234
754 nmdc:mga09592_692381_c1 3300050508 Bacteria 868
755 nmdc:mga09592_96089_c1 3300050508 Bacteria 2534
756 nmdc:mga0qj67_49137_c1 3300050509 Unclassified 3334
757 nmdc:mga06r32_103705_c1 3300050510 Unclassified 2792
758 nmdc:mga06r32_281084_c1 3300050510 Bacteria 1651
759 nmdc:mga08y16_148143_c1 3300050511 Bacteria 2440
760 nmdc:mga08y16_29684_c1 3300050511 Bacteria 5759
761 nmdc:mga08y16_316145_c1 3300050511 Unclassified 1608
762 nmdc:mga08y16_52728_c1 3300050511 Bacteria 4255
763 nmdc:mga08y16_5871_c1 3300050511 Bacteria 12861
764 nmdc:mga08y16_597632_c1 3300050511 Bacteria 1112
765 nmdc:mga08y16_6_c1 3300050511 Bacteria 622294
766 nmdc:mga08y16_79936_c1 3300050511 Bacteria 3409
767 nmdc:mga08y16_8305_c1 3300050511 Bacteria 10866
768 nmdc:mga08y16_85280_c1 3300050511 Bacteria 3292
769 nmdc:mga0n895_225438_c1 3300050512 Bacteria 1902
770 nmdc:mga0n895_23869_c1 3300050512 Bacteria 5755
771 nmdc:mga0n895_305005_c1 3300050512 Bacteria 1614
772 nmdc:mga0n895_399313_c1 3300050512 Bacteria 1390
773 nmdc:mga0n895_41_c1 3300050512 Bacteria 75026
774 nmdc:mga0n895_548_c1 3300050512 Bacteria 25721
775 nmdc:mga0n895_611939_c1 3300050512 Bacteria 1091
776 nmdc:mga0n895_72638_c1 3300050512 Bacteria 3413
777 nmdc:mga0n895_74253_c1 3300050512 Bacteria 3377
778 nmdc:mga0n895_9414_c1 3300050512 Bacteria 8547
779 nmdc:mga0n895_970739_c1 3300050512 Bacteria 832
780 nmdc:mga0rr50_103369_c1 3300050513 Bacteria 2242
781 nmdc:mga0rr50_119020_c1 3300050513 Bacteria 2099
782 nmdc:mga0rr50_142049_c1 3300050513 Bacteria 1932
783 nmdc:mga0rr50_144039_c1 3300050513 Unclassified 1919
784 nmdc:mga0rr50_173381_c1 3300050513 Bacteria 1759
785 nmdc:mga0rr50_2065_c1 3300050513 Bacteria 11208
786 nmdc:mga0rr50_22_c1 3300050513 Bacteria 123539
787 nmdc:mga0rr50_24266_c1 3300050513 Bacteria 4198
788 nmdc:mga0rr50_352280_c1 3300050513 Unclassified 1238
789 nmdc:mga0rr50_4_c1 3300050513 Bacteria 338870
790 nmdc:mga0rr50_602669_c1 3300050513 Bacteria 936
791 nmdc:mga0rr50_7397_c1 3300050513 Bacteria 6770
792 nmdc:mga0rr50_7524_c1 3300050513 Bacteria 6725
793 nmdc:mga0rr50_78_c1 3300050513 Bacteria 55084
794 nmdc:mga08x19_105_c1 3300050514 Bacteria 74489
795 nmdc:mga08x19_12088_c1 3300050514 Bacteria 5195
796 nmdc:mga08x19_124151_c1 3300050514 Bacteria 1733
797 nmdc:mga08x19_151297_c1 3300050514 Unclassified 1572
798 nmdc:mga08x19_196_c1 3300050514 Bacteria 47273
799 nmdc:mga08x19_2098_c1 3300050514 Bacteria 12189
800 nmdc:mga08x19_2648_c1 3300050514 Bacteria 10831
801 nmdc:mga08x19_400455_c1 3300050514 Bacteria 963
802 nmdc:mga0a205_109528_c1 3300050515 Bacteria 2660
803 nmdc:mga0a205_126209_c1 3300050515 Bacteria 2459
804 nmdc:mga0a205_135107_c1 3300050515 Bacteria 2367
805 nmdc:mga0a205_210057_c1 3300050515 Bacteria 1835
806 nmdc:mga0a205_28322_c1 3300050515 Bacteria 5356
807 nmdc:mga0a205_319963_c1 3300050515 Bacteria 1422
808 nmdc:mga0a205_74193_c1 3300050515 Unclassified 3287
809 Ga0495601_0001191 3300053077 Bacteria 14233
810 Ga0495601_0039802 3300053077 Bacteria 2944
811 Ga0495601_0077781 3300053077 Bacteria 2125
812 Ga0495601_0508017 3300053077 Bacteria 777
813 Ga0495595_0155659 3300053084 Unclassified 1126
814 Ga0495619_0109678 3300053085 Bacteria 1885
815 Ga0495619_0124101 3300053085 Bacteria 1771
816 Ga0495619_0220624 3300053085 Bacteria 1313
817 Ga0501084_0330963 3300054114 Unclassified 1286
818 Ga0501084_0342178 3300054114 Unclassified 1263
819 Ga0590077_025330 3300059426 Bacteria 1278
820 Ga0501082_0083335 3300060353 Bacteria 2759
821 Ga0501082_0559794 3300060353 Bacteria 1000
822 Ga0530510_0109345 3300061734 Bacteria 2024
823 Ga0070717_10004351
824 Ga0065704_10134010
825 Ga0065704_10159363
826 Ga0065712_10093440
827 Ga0065715_10013058
828 Ga0065715_10091749
829 Ga0065715_10277269
830 Ga0065707_10001592
831 Ga0065707_10097379
832 Ga0065707_10444975
833 Ga0070676_10060959
834 Ga0070676_10096033
835 Ga0070683_100214710
836 Ga0070683_100271749
837 Ga0070690_100189520
838 Ga0070690_100520165
839 Ga0070670_100002606
840 Ga0070670_100028638
841 Ga0070670_100099769
842 Ga0070670_100353690
843 Ga0068869_100376879
844 Ga0070666_10088304
845 Ga0070666_10233450
846 Ga0068868_100066929
847 Ga0068868_100081286
848 Ga0068868_100109340
849 Ga0070660_100004836
850 Ga0070660_100272885
851 Ga0070689_100155636
852 Ga0070689_100192797
853 Ga0070691_10039453
854 Ga0070687_100022659
855 Ga0070687_100053794
856 Ga0070661_100047733
857 Ga0070668_100318220
858 Ga0070668_100379970
859 Ga0070669_100015360
860 Ga0070669_100017715
861 Ga0070669_100150864
862 Ga0070675_100000051
863 Ga0070675_100062051
864 Ga0070675_100160197
865 Ga0070675_100163813
866 Ga0070675_100184956
867 Ga0070675_100338376
868 Ga0070675_100460895
869 Ga0070671_100059067
870 Ga0070674_100002166
871 Ga0070674_100006272
872 Ga0070674_100012113
873 Ga0070674_100200450
874 Ga0070673_100016868
875 Ga0070673_100264969
876 Ga0070673_100570529
877 Ga0070673_100770952
878 Ga0070688_100006754
879 Ga0070688_100037022
880 Ga0070688_100114422
881 Ga0070688_100288507
882 Ga0070688_100672488
883 Ga0070667_100208368
884 Ga0070667_100323400
885 Ga0070667_100588410
886 Ga0070667_100613900
887 Ga0070714_100033850
888 Ga0070713_100014854
889 Ga0070701_10010099
890 Ga0070701_10178773
891 Ga0070711_100205641
892 Ga0070705_100007859
893 Ga0070705_100246214
894 Ga0070700_100007530
895 Ga0070700_100064656
896 Ga0070700_100141934
897 Ga0070694_100070838
898 Ga0070694_100218061
899 Ga0070708_100082906
900 Ga0070708_100430110
901 Ga0070678_100032030
902 Ga0070678_100174503
903 Ga0070662_100078448
904 Ga0070662_100129249
905 Ga0070662_100394419
906 Ga0070662_100459629
907 Ga0070681_10014105
908 Ga0070681_10455949
909 Ga0068867_100062089
910 Ga0068867_100087453
911 Ga0068867_100187100
912 Ga0068867_100365448
913 Ga0070706_100020841
914 Ga0070706_100031397
915 Ga0070706_100059330
916 Ga0070706_100300621
917 Ga0070707_100040710
918 Ga0070707_100073142
919 Ga0070707_100152060
920 Ga0070707_100448059
921 Ga0070698_100061351
922 Ga0070698_100143514
923 Ga0070698_100204458
924 Ga0070698_100351225
925 Ga0070698_100381582
926 Ga0070699_100019206
927 Ga0070699_100098399
928 Ga0070699_100149685
929 Ga0070699_100208734
930 Ga0070679_100081218
931 Ga0070684_100099617
932 Ga0070684_100718114
933 Ga0070697_100018227
934 Ga0070697_100102883
935 Ga0070697_100110109
936 Ga0070697_100199852
937 Ga0070697_100434055
938 Ga0070672_100006251
939 Ga0070672_100256504
940 Ga0070672_100351184
941 Ga0070686_100001620
942 Ga0070686_100060428
943 Ga0070686_100075823
944 Ga0070686_100097982
945 Ga0070695_100002657
946 Ga0070695_100018884
947 Ga0070695_100025469
948 Ga0070695_100063564
949 Ga0070695_100177024
950 Ga0070696_100006698
951 Ga0070696_100096874
952 Ga0070693_100101333
953 Ga0070693_100509016
954 Ga0070665_100003617
955 Ga0070665_100217201
956 Ga0070704_100002091
957 Ga0070704_100009394
958 Ga0070704_100031422
959 Ga0070704_100354743
960 Ga0070704_100780138
961 Ga0068855_100404717
962 Ga0070664_100414478
963 Ga0068854_100029932
964 Ga0068854_100155101
965 Ga0068854_100343452
966 Ga0068854_100629043
967 Ga0068852_100172789
968 Ga0068852_100237666
969 Ga0068852_100707100
970 Ga0068859_100002272
971 Ga0068859_100326282
972 Ga0068859_100598483
973 Ga0068859_100610312
974 Ga0068864_100003740
975 Ga0068864_100119639
976 Ga0068864_100316231
977 Ga0068864_100790184
978 Ga0068864_100838386
979 Ga0068866_10427955
980 Ga0068861_100016516
981 Ga0068861_100081657
982 Ga0068861_100209025
983 Ga0068861_100271107
984 Ga0068870_10267727
985 Ga0068863_100009883
986 Ga0068863_100102793
987 Ga0068863_100144708
988 Ga0068863_100233847
989 Ga0068858_100052743
990 Ga0068858_100149511
991 Ga0068858_100155372
992 Ga0068858_100448609
993 Ga0068858_100535219
994 Ga0068860_100152469
995 Ga0068860_100183049
996 Ga0068860_100207452
997 Ga0068860_100222999
998 Ga0068860_100279561
999 Ga0068862_100057712
1000 Ga0068862_100077693
1001 Ga0068862_100368918
1002 Ga0081539_10117287
1003 Ga0070716_100181526
1004 Ga0070716_100570073
1005 Ga0097621_100027833
1006 Ga0097621_100051623
1007 Ga0097621_100120570
1008 Ga0097621_100770587
1009 Ga0068871_100001043
1010 Ga0068871_100004461
1011 Ga0068871_100007147
1012 Ga0068871_100008036
1013 Ga0068871_100049103
1014 Ga0068871_100372302
1015 Ga0068871_100442946
1016 Ga0068871_100478529
1017 Ga0075428_100000004
1018 Ga0075428_100050154
1019 Ga0075428_100190825
1020 Ga0075428_100311561
1021 Ga0075428_100504399
1022 Ga0075428_100524798
1023 Ga0075428_100665704
1024 Ga0075430_100001280
1025 Ga0075431_100188637
1026 Ga0075433_10011921
1027 Ga0075433_10081808
1028 Ga0075433_10099871
1029 Ga0075433_10154793
1030 Ga0075433_10181875
1031 Ga0075434_100000046
1032 Ga0075434_100000734
1033 Ga0075434_100001398
1034 Ga0075434_100017455
1035 Ga0075434_100026654
1036 Ga0075434_100128469
1037 Ga0075434_100348343
1038 Ga0075434_100454355
1039 Ga0075434_100641979
1040 Ga0075429_100091014
1041 Ga0075429_100092636
1042 Ga0068865_100012402
1043 Ga0068865_100032144
1044 Ga0068865_100051657
1045 Ga0068865_100781907
1046 Ga0075436_100000322
1047 Ga0075436_100000713
1048 Ga0075436_100001187
1049 Ga0075436_100004567
1050 Ga0075436_100008893
1051 Ga0075436_100014896
1052 Ga0075436_100035585
1053 Ga0075436_100043430
1054 Ga0097620_100002272
1055 Ga0097620_100326280
1056 Ga0097620_100598474
1057 Ga0097620_100610343
1058 Ga0075435_100000021
1059 Ga0075435_100000046
1060 Ga0075435_100000369
1061 Ga0075435_100001027
1062 Ga0075435_100035899
1063 Ga0075435_100048190
1064 Ga0075435_100066569
1065 Ga0075435_100085428
1066 Ga0075435_100112970
1067 Ga0075435_100120745
1068 Ga0075435_100144577
1069 Ga0099795_10077411
1070 Ga0105240_10076414
1071 Ga0111539_10000005
1072 Ga0111539_10001037
1073 Ga0111539_10006896
1074 Ga0111539_10052917
1075 Ga0111539_10086979
1076 Ga0111539_10147015
1077 Ga0111539_10206595
1078 Ga0111539_10329841
1079 Ga0111539_10473984
1080 Ga0111539_10484063
1081 Ga0111539_10984842
1082 Ga0105245_10003345
1083 Ga0105245_10016238
1084 Ga0105245_10123090
1085 Ga0105245_10647031
1086 Ga0105247_10111908
1087 Ga0114129_10001099
1088 Ga0114129_10009295
1089 Ga0114129_10011701
1090 Ga0114129_10039884
1091 Ga0114129_10060649
1092 Ga0114129_10176058
1093 Ga0114129_10182616
1094 Ga0114129_10208276
1095 Ga0114129_10227170
1096 Ga0114129_10303096
1097 Ga0114129_10582022
1098 Ga0114129_10801002
1099 Ga0105243_10032750
1100 Ga0105243_10223301
1101 Ga0105243_10296270
1102 Ga0105243_10428259
1103 Ga0105243_10921541
1104 Ga0105241_10043803
1105 Ga0105241_10132107
1106 Ga0105242_10036079
1107 Ga0105242_10083856
1108 Ga0105242_10790084
1109 Ga0105242_10819960
1110 Ga0105248_10025256
1111 Ga0105248_10051987
1112 Ga0105248_10071367
1113 Ga0105248_10074644
1114 Ga0105248_10085267
1115 Ga0105248_10090420
1116 Ga0105248_10093862
1117 Ga0105248_10115883
1118 Ga0105248_10115890
1119 Ga0105248_10139428
1120 Ga0105248_10179269
1121 Ga0105248_10184687
1122 Ga0105248_10192378
1123 Ga0105248_10228698
1124 Ga0105248_10291779
1125 Ga0105248_10297567
1126 Ga0105248_10929900
1127 Ga0105238_10302283
1128 Ga0105238_10448815
1129 Ga0105249_10251302
1130 Ga0105249_10459793
1131 Ga0105249_10527328
1132 Ga0105249_10606485
1133 Ga0105249_10939082
1134 Ga0105249_11118243
1135 Ga0105246_10043903
1136 Ga0157374_10103019
1137 Ga0157374_10175601
1138 Ga0157374_10200851
1139 Ga0157374_11082292
1140 Ga0157378_10004804
1141 Ga0157378_10152171
1142 Ga0157378_10186731
1143 Ga0157378_10285004
1144 Ga0163162_10029778
1145 Ga0163162_10048165
1146 Ga0163162_10090255
1147 Ga0163162_10683599
1148 Ga0163162_10709330
1149 Ga0163162_10927544
1150 Ga0163162_10955226
1151 Ga0157372_10318675
1152 Ga0157375_10016265
1153 Ga0157375_10041186
1154 Ga0157375_10047873
1155 Ga0157375_10219254
1156 Ga0157375_10337800
1157 Ga0157375_11407492
1158 Ga0163163_10000008
1159 Ga0163163_10004315
1160 Ga0163163_10019642
1161 Ga0163163_10031827
1162 Ga0163163_10794195
1163 Ga0163163_11142432
1164 Ga0157380_10009562
1165 Ga0157380_10057584
1166 Ga0157380_10167423
1167 Ga0157380_10181698
1168 Ga0157380_10194362
1169 Ga0157380_10292445
1170 Ga0157380_10339216
1171 Ga0157380_10482129
1172 Ga0157377_10089858
1173 Ga0157377_10185622
1174 Ga0157377_10219812
1175 Ga0157379_10049663
1176 Ga0157379_10050937
1177 Ga0157379_10079880
1178 Ga0157379_10109621
1179 Ga0157379_10278302
1180 Ga0157379_10676331
1181 Ga0157376_10002435
1182 Ga0157376_10041538
1183 Ga0157376_10052068
1184 Ga0157376_10057566
1185 Ga0157376_10099317
1186 Ga0157376_10142510
1187 Ga0157376_10366276
1188 Ga0157376_10593783
1189 Ga0157376_10781488
1190 Ga0163161_10105057
1191 Ga0213876_10002397
1192 Ga0213876_10086902
1193 Ga0213876_10323299
1194 Ga0207697_10139206
1195 Ga0207642_10096852
1196 Ga0207642_10102370
1197 Ga0207710_10188386
1198 Ga0207688_10079005
1199 Ga0207688_10219889
1200 Ga0207680_10007201
1201 Ga0207680_10037783
1202 Ga0207680_10178775
1203 Ga0207680_10427742
1204 Ga0207680_10436582
1205 Ga0207699_10008546
1206 Ga0207699_10270028
1207 Ga0207645_10007501
1208 Ga0207645_10040738
1209 Ga0207645_10162436
1210 Ga0207645_10259438
1211 Ga0207643_10184162
1212 Ga0207705_10065101
1213 Ga0207684_10078238
1214 Ga0207684_10121997
1215 Ga0207684_10724441
1216 Ga0207654_10121962
1217 Ga0207707_10027223
1218 Ga0207707_10231432
1219 Ga0207707_10279746
1220 Ga0207707_10560569
1221 Ga0207695_10283335
1222 Ga0207671_10279911
1223 Ga0207662_10007425
1224 Ga0207662_10158730
1225 Ga0207657_10015910
1226 Ga0207652_10062696
1227 Ga0207646_10101765
1228 Ga0207646_10221281
1229 Ga0207646_10250083
1230 Ga0207646_10537718
1231 Ga0207681_10002033
1232 Ga0207681_10041244
1233 Ga0207681_10182689
1234 Ga0207681_10232404
1235 Ga0207694_10626518
1236 Ga0207650_10033595
1237 Ga0207650_10034840
1238 Ga0207650_10193214
1239 Ga0207650_10222218
1240 Ga0207659_10002806
1241 Ga0207659_10014676
1242 Ga0207659_10076917
1243 Ga0207659_10167223
1244 Ga0207659_10213148
1245 Ga0207687_10010046
1246 Ga0207687_10543755
1247 Ga0207664_10349651
1248 Ga0207644_10139882
1249 Ga0207690_10352556
1250 Ga0207706_10236231
1251 Ga0207706_10410581
1252 Ga0207706_10428201
1253 Ga0207706_10428247
1254 Ga0207709_10366629
1255 Ga0207670_10072972
1256 Ga0207670_10270859
1257 Ga0207670_10680735
1258 Ga0207669_10003785
1259 Ga0207669_10022096
1260 Ga0207669_10035637
1261 Ga0207669_10046547
1262 Ga0207669_10059517
1263 Ga0207669_10253993
1264 Ga0207669_10517367
1265 Ga0207704_10014709
1266 Ga0207704_10040677
1267 Ga0207704_10157833
1268 Ga0207704_10460823
1269 Ga0207665_10130148
1270 Ga0207691_10468597
1271 Ga0207711_10031453
1272 Ga0207711_10052611
1273 Ga0207711_10057206
1274 Ga0207711_10086493
1275 Ga0207711_10139379
1276 Ga0207711_10235897
1277 Ga0207711_10255376
1278 Ga0207711_10296299
1279 Ga0207711_10675552
1280 Ga0207689_10120585
1281 Ga0207689_10219914
1282 Ga0207661_10113524
1283 Ga0207661_10310368
1284 Ga0207661_10615938
1285 Ga0207679_10065819
1286 Ga0207679_10084576
1287 Ga0207679_10547950
1288 Ga0207667_10978703
1289 Ga0207651_10094571
1290 Ga0207651_10207602
1291 Ga0207651_10216036
1292 Ga0207651_10216429
1293 Ga0207651_10226834
1294 Ga0207651_10256112
1295 Ga0207712_10161811
1296 Ga0207712_10301033
1297 Ga0207668_10205082
1298 Ga0207668_10657995
1299 Ga0207640_10010651
1300 Ga0207640_10039360
1301 Ga0207640_10367130
1302 Ga0207658_10089389
1303 Ga0207658_10310026
1304 Ga0207677_10158001
1305 Ga0207677_10238904
1306 Ga0207677_10312540
1307 Ga0207677_10649082
1308 Ga0207703_10008420
1309 Ga0207703_10245994
1310 Ga0207703_10483832
1311 Ga0207703_10484569
1312 Ga0207703_10500302
1313 Ga0207639_10103253
1314 Ga0207678_10023546
1315 Ga0207678_10469823
1316 Ga0207708_10077621
1317 Ga0207708_10081119
1318 Ga0207708_10284813
1319 Ga0207708_10479735
1320 Ga0207708_10499818
1321 Ga0207702_10161325
1322 Ga0207702_10302983
1323 Ga0207641_10001282
1324 Ga0207641_10234207
1325 Ga0207641_10371319
1326 Ga0207641_10633798
1327 Ga0207641_11011226
1328 Ga0207648_10010445
1329 Ga0207648_10090474
1330 Ga0207648_10114067
1331 Ga0207648_10268597
1332 Ga0207648_10273464
1333 Ga0207648_10339142
1334 Ga0207648_10342935
1335 Ga0207648_10367189
1336 Ga0207676_10025605
1337 Ga0207676_10057501
1338 Ga0207676_10314306
1339 Ga0207676_10726536
1340 Ga0207674_10069504
1341 Ga0207674_10384377
1342 Ga0207675_100006860
1343 Ga0207675_100027086
1344 Ga0207675_100112177
1345 Ga0207675_100189881
1346 Ga0207675_100897981
1347 Ga0207683_10061080
1348 Ga0207683_10443728
1349 Ga0207683_10885468
1350 Ga0207698_10105517
1351 Ga0207698_10134115
1352 Ga0207698_10934663
1353 Ga0207428_10000024
1354 Ga0207428_10002382
1355 Ga0207428_10023241
1356 Ga0207428_10073682
1357 Ga0207428_10078751
1358 Ga0207428_10154303
1359 Ga0268266_10009815
1360 Ga0268266_10026180
1361 Ga0268266_10059725
1362 Ga0268265_10005365
1363 Ga0268265_10044705
1364 Ga0268265_10401641
1365 Ga0268265_10449767
1366 Ga0268265_10810243
1367 Ga0268264_10067376
1368 Ga0268264_10185137
1369 Ga0268264_10246161
1370 Ga0268264_10254110
1371 Ga0268264_10299468
1372 Ga0268264_10618913
1373 Ga0265336_10063297
1374 Ga0265328_10040576
1375 Ga0307408_100361706
1376 Ga0307405_10084765
1377 Ga0307405_10199900
1378 Ga0307413_10017283
1379 Ga0307413_10425421
1380 Ga0307410_10031674
1381 Ga0307409_100039634
1382 Ga0307416_100282603
1383 Ga0307414_10357405
1384 Ga0307411_10139444
1385 Ga0373930_0000075
1386 Ga0373948_0000707
1387 Ga0373950_0000829
1388 Ga0373958_0063387
1389 Ga0373938_0036995
1390 Ga0373926_0057577
1391 Ga0373928_0027684
1392 Ga0373929_0000640
1393 Ga0373940_0000122
1394 Ga0373949_0022891
1395 Ga0373951_0001612
1396 Ga0373952_0000267
1397 Ga0373932_0000109
1398 Ga0373932_0000680
1399 Ga0373932_0021565
1400 Ga0373939_0000190
1401 Ga0373941_0000533
1402 Ga0373953_0079340
1403 Ga0373960_0000672
1404 Ga0373960_0125163
1405 Ga0373943_0007733
1406 Ga0373946_0023267
1407 Ga0373955_0062263
1408 Ga0373955_0298151
1409 Ga0373955_0397666
1410 Ga0373955_0448949
1411 Ga0373942_0001459
1412 Ga0373942_0064689
1413 Ga0373961_0000532
1414 Ga0373962_0001183
1415 Ga0373924_0029963
1416 Ga0373931_0038125
1417 Ga0373931_0080566
1418 Ga0373927_0156641
1419 Ga0373933_0203080
1420 Ga0373933_0217339
1421 Ga0373947_0098006
1422 Ga0373937_0433424
1423 Ga0373925_0034570
1424 Ga0395899_0262357
1425 Ga0395900_0236222
1426 Ga0395898_0071392
1427 Ga0395905_0507218
1428 Ga0395905_0739756
1429 Ga0395901_0117396
1430 Ga0436365_0318573
1431 Ga0436365_0640910
1432 Ga0436365_1614638
1433 Ga0436365_1934805
1434 Ga0439436_0075375
1435 Ga0451851_0314766
1436 Ga0439433_0062202
1437 Ga0439448_0117924
1438 Ga0439449_0101434
1439 Ga0439457_029797
1440 Ga0439462_0084647
1441 Ga0439463_074604
1442 Ga0450920_014523
1443 Ga0450897_001745
1444 Ga0450896_001698
1445 Ga0439458_0007424
1446 Ga0450908_019235
1447 Ga0439435_0006856
1448 Ga0439435_0007215
1449 Ga0439435_0008423
1450 Ga0439435_0097857
1451 Ga0439444_0001522
1452 Ga0439459_0060416
1453 Ga0439460_0033009
1454 Ga0450918_002892
1455 Ga0451577_0169909
1456 Ga0453683_0075311
1457 Ga0466966_0273735
1458 Ga0466964_0076960
1459 Ga0466957_0104423
1460 Ga0451576_0018681
1461 Ga0451576_0075469
1462 Ga0451576_0535379
1463 Ga0466967_0279685
1464 Ga0495592_0084011
1465 Ga0495592_0366436
1466 Ga0495629_0165839
1467 Ga0495629_0344681
1468 Ga0495653_0204295
1469 Ga0495653_0408311
1470 Ga0495580_0176623
1471 Ga0495580_0262178
1472 Ga0495582_0023072
1473 Ga0495583_0155689
1474 Ga0495608_0005169
1475 Ga0495608_0111205
1476 Ga0495628_0059974
1477 Ga0495652_0204084
1478 Ga0495652_0258070
1479 Ga0495587_0031007
1480 Ga0495621_0205609
1481 Ga0495645_0140722
1482 Ga0495633_0121726
1483 Ga0495634_0058336
1484 Ga0495635_0097544
1485 Ga0495635_0478531
1486 Ga0495659_0040431
1487 Ga0495659_0049346
1488 Ga0495659_0211599
1489 Ga0495647_0020723
1490 Ga0495658_0064445
1491 Ga0495658_0571181
1492 Ga0495669_0156767
1493 Ga0495613_0016398
1494 Ga0495613_0252745
1495 Ga0495600_0286221
1496 Ga0495674_0041014
1497 Ga0495676_0076520
1498 Ga0495680_0408143
1499 Ga0495684_0000177
1500 Ga0495684_0035248
1501 Ga0495684_0323195
1502 Ga0495684_0433376
1503 Ga0495684_0499066
1504 Ga0496100_0024529
1505 Ga0496101_0002257
1506 Ga0496101_0538547
1507 Ga0496103_0282277
1508 Ga0496104_0105181
1509 Ga0496104_0422573
1510 Ga0496105_0010070
1511 Ga0496105_0405052
1512 Ga0496106_0066464
1513 Ga0496106_0066847
1514 Ga0496107_0003799
1515 Ga0496107_0680616
1516 Ga0496108_0005186
1517 Ga0496108_0016848
1518 Ga0496109_0033723
1519 Ga0496109_0182065
1520 Ga0496109_0271661
1521 Ga0496109_0504385
1522 Ga0496110_0079389
1523 Ga0496110_0079987
1524 Ga0496111_0042526
1525 Ga0496112_0018686
1526 Ga0496112_0056613
1527 Ga0496112_0128868
1528 Ga0496112_0229701
1529 Ga0496112_0559141
1530 Ga0496112_0563508
1531 Ga0496112_0653873
1532 Ga0496113_0437816
1533 Ga0496114_0001468
1534 Ga0496114_0016818
1535 Ga0496114_0018005
1536 Ga0496114_0045645
1537 Ga0496114_0343042
1538 Ga0496115_0114771
1539 Ga0501034_0060848
1540 Ga0501039_0555378
1541 Ga0501040_0086855
1542 Ga0501040_0321426
1543 Ga0501042_0048930
1544 Ga0501042_0079522
1545 Ga0501046_0146102
1546 Ga0501071_0018735
1547 Ga0501072_0118737
1548 Ga0501073_0007844
1549 Ga0501075_0424868
1550 Ga0501075_0447514
1551 Ga0501075_0818701
1552 Ga0501076_0013710
1553 Ga0501077_0196413
1554 Ga0501077_0249462
1555 Ga0501079_0128740
1556 Ga0501079_0873505
1557 Ga0501081_0237996
1558 Ga0501081_0514840
1559 Ga0501083_0171261
1560 Ga0501044_0072060
1561 Ga0501045_0084495
1562 Ga0501045_0496184
1563 Ga0501045_0540758
1564 nmdc:mga05p37_1428_c1
1565 nmdc:mga05p37_220834_c1
1566 nmdc:mga05p37_227524_c1
1567 nmdc:mga05p37_28333_c1
1568 nmdc:mga05p37_48056_c1
1569 nmdc:mga05p37_500557_c1
1570 nmdc:mga05p37_58281_c1
1571 nmdc:mga05p37_59705_c1
1572 nmdc:mga05p37_6161_c1
1573 nmdc:mga05p37_85478_c1
1574 nmdc:mga09592_179302_c1
1575 nmdc:mga09592_373261_c1
1576 nmdc:mga09592_692381_c1
1577 nmdc:mga09592_96089_c1
1578 nmdc:mga0qj67_49137_c1
1579 nmdc:mga06r32_103705_c1
1580 nmdc:mga06r32_281084_c1
1581 nmdc:mga08y16_148143_c1
1582 nmdc:mga08y16_29684_c1
1583 nmdc:mga08y16_316145_c1
1584 nmdc:mga08y16_52728_c1
1585 nmdc:mga08y16_5871_c1
1586 nmdc:mga08y16_597632_c1
1587 nmdc:mga08y16_6_c1
1588 nmdc:mga08y16_79936_c1
1589 nmdc:mga08y16_8305_c1
1590 nmdc:mga08y16_85280_c1
1591 nmdc:mga0n895_225438_c1
1592 nmdc:mga0n895_23869_c1
1593 nmdc:mga0n895_305005_c1
1594 nmdc:mga0n895_399313_c1
1595 nmdc:mga0n895_41_c1
1596 nmdc:mga0n895_548_c1
1597 nmdc:mga0n895_611939_c1
1598 nmdc:mga0n895_72638_c1
1599 nmdc:mga0n895_74253_c1
1600 nmdc:mga0n895_9414_c1
1601 nmdc:mga0n895_970739_c1
1602 nmdc:mga0rr50_103369_c1
1603 nmdc:mga0rr50_119020_c1
1604 nmdc:mga0rr50_142049_c1
1605 nmdc:mga0rr50_144039_c1
1606 nmdc:mga0rr50_173381_c1
1607 nmdc:mga0rr50_2065_c1
1608 nmdc:mga0rr50_22_c1
1609 nmdc:mga0rr50_24266_c1
1610 nmdc:mga0rr50_352280_c1
1611 nmdc:mga0rr50_4_c1
1612 nmdc:mga0rr50_602669_c1
1613 nmdc:mga0rr50_7397_c1
1614 nmdc:mga0rr50_7524_c1
1615 nmdc:mga0rr50_78_c1
1616 nmdc:mga08x19_105_c1
1617 nmdc:mga08x19_12088_c1
1618 nmdc:mga08x19_124151_c1
1619 nmdc:mga08x19_151297_c1
1620 nmdc:mga08x19_196_c1
1621 nmdc:mga08x19_2098_c1
1622 nmdc:mga08x19_2648_c1
1623 nmdc:mga08x19_400455_c1
1624 nmdc:mga0a205_109528_c1
1625 nmdc:mga0a205_126209_c1
1626 nmdc:mga0a205_135107_c1
1627 nmdc:mga0a205_210057_c1
1628 nmdc:mga0a205_28322_c1
1629 nmdc:mga0a205_319963_c1
1630 nmdc:mga0a205_74193_c1
1631 Ga0495601_0001191
1632 Ga0495601_0039802
1633 Ga0495601_0077781
1634 Ga0495601_0508017
1635 Ga0495595_0155659
1636 Ga0495619_0109678
1637 Ga0495619_0124101
1638 Ga0495619_0220624
1639 Ga0501084_0330963
1640 Ga0501084_0342178
1641 Ga0590077_025330
1642 Ga0501082_0083335
1643 Ga0501082_0559794
1644 Ga0530510_0109345

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00174

Oxidored_molyb

Oxidoreductase molybdopterin binding domain

64

211

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xdq-assembly3.cif.gz_C structural and biochemical identification of a novel bacterial oxidoreductase 0.9057 67 225
1xdy-assembly7.cif.gz_G structural and biochemical identification of a novel bacterial oxidoreductase, w-containing cofactor 0.8958 72 226
2ca3-assembly1.cif.gz_A sulfite dehydrogenase from starkeya novella r55m mutant 0.8893 65 215
1ogp-assembly3.cif.gz_E the crystal structure of plant sulfite oxidase provides insight into sulfite oxidation in plants and animals 0.8754 58 220
2a9d-assembly1.cif.gz_B crystal structure of recombinant chicken sulfite oxidase with arg at residue 161 0.8556 58 220
ID Description Score Start End Superfamily
1xdyH00 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.9098 67 225 3.90.420.10
af_P11035_116_359_3.90.420.10 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.909 58 215 3.90.420.10
af_I1N786_1_262_3.90.420.10 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.8802 68 220 3.90.420.10
af_Q54XJ8_10_262_3.90.420.10 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.88 58 215 3.90.420.10
2biiB01 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.8725 58 215 3.90.420.10
ID Description Score Start End GO Terms
AF-A0A2V8CLA2-F1-model_v4 Oxidoreductase 0.965 43 233
AF-A0A1Q7TMQ6-F1-model_v4 Oxidoreductase molybdopterin-binding domain-containing protein 0.9627 46 202
AF-A0A7C4TGK4-F1-model_v4 Sulfite oxidase-like oxidoreductase 0.9622 46 232
AF-A0A6B0VTD4-F1-model_v4 Molybdopterin-dependent oxidoreductase 0.9594 47 233
AF-A0A7Y5G5U4-F1-model_v4 Sulfite oxidase-like oxidoreductase 0.959 47 233

Map