F482273

General Info

Members Datasets Scaffolds Average Seq Length
821 423 803 101

Family's Representative Sequence

Representative Sequence 3300049569|Ga0501032_0040636|Ga0501032_0040636_633_974
Length 113
Sequence LLGDSIKEEVNSLVSLSHYLVLGAVLFAIGIVGIFLNRKNVIIILMSIELMLLAVNMNFVAFSHYLQDISGQIFVFFILTVAAAESAIGLAILVVLFRNQQTINVDDLDKLKG

Samples

Sample ID Description Type Environment
1 2547132512 Azospira oryzae 6a3 Isolate Unclassified
2 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
3 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
4 2734482258 Glomeribacter sp. phylotype 3 Isolate Unclassified
5 2738541297 Duganella sp. GV083 Isolate Unclassified
6 2738541357 Duganella sp. GV053 Isolate Unclassified
7 2738543003 Duganella sp. GV066 Isolate Unclassified
8 2738543026 Duganella sp. GV089 Isolate Unclassified
9 2738543029 Duganella sp. GV039 Isolate Unclassified
10 2821131069 Duganella sp. 1224 Isolate Unclassified
11 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
12 2857564685 Duganella sp. R-74599 Isolate Unclassified
13 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
14 2885266251 Ralstonia sp. SET104 Isolate Nodule
15 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
16 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
17 2928058823 Ralstonia sp. 1138 Isolate Unclassified
18 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
19 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
20 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
21 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
22 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
23 3300003479 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_06_lowP_mix1_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
24 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
25 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
26 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
27 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
28 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
29 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
30 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
31 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
32 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
33 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
34 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
35 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
36 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
37 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
38 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
39 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
40 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
41 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
42 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
43 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
44 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
45 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
46 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
47 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
48 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
49 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
50 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
51 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
52 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
53 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
54 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
55 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
56 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
57 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
58 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
59 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
60 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
61 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
62 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
63 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
64 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
65 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
66 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
67 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
68 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
69 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
70 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
71 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
72 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
73 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
74 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
75 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
76 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
77 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
78 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
79 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
80 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
81 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
82 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
83 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
84 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
85 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
86 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
87 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
88 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
89 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
90 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
91 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
92 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
93 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
94 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
95 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
96 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
97 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
98 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
99 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
100 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
101 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
102 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
103 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
104 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
105 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
106 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
107 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
108 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
109 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
110 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
111 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
112 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
113 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
114 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
115 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
116 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
117 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
118 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
119 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
120 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
121 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
122 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
123 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
124 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
125 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
126 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
127 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
128 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
129 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
130 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
131 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
132 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
133 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
134 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
135 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
136 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
137 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
138 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
139 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
140 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
141 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
142 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
143 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
144 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
145 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
146 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
147 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
148 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
149 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
150 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
151 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
152 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
153 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
154 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
155 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
162 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
163 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
164 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
165 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
167 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
168 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
169 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
170 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
171 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
172 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
173 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
174 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
175 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
176 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
177 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
178 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
179 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
230 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
231 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
232 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
233 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
237 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
238 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
239 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
240 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
241 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
242 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
243 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
244 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
245 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
246 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
247 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
248 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
249 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
250 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
251 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
252 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
253 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
254 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
255 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
256 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
257 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
258 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
259 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
260 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
261 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
262 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
263 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
264 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
265 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
266 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
267 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
268 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
269 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
270 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
271 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
272 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
273 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
274 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
275 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
276 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
277 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
278 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
279 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
280 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
281 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
282 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
283 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
284 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
285 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
286 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
287 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
288 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
289 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
290 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
291 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
292 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
293 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
294 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
295 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
296 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
297 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
298 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
299 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
300 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
301 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
302 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
303 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
304 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
305 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
306 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
307 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
308 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
309 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
310 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
311 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
312 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
313 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
314 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
315 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
316 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
317 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
318 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
319 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
320 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
321 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
322 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
323 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
324 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
325 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
326 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
327 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
328 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
329 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
330 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
331 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
332 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
333 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
334 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
335 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
336 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
337 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
338 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
339 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
340 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
341 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
342 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
343 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
344 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
345 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
346 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
347 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
348 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
349 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
350 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
351 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
352 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
353 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
354 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
355 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
356 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
357 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
358 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
359 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
360 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
361 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
362 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
363 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
364 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
365 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
366 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
367 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
368 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
369 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
370 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
371 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
372 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
373 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
374 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
375 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
376 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
377 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
378 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
379 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
380 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
381 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
382 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
383 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
384 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
385 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
386 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
387 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
388 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
389 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
390 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
391 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
392 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
393 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
394 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
395 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
396 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
397 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
398 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
399 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
400 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
401 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
402 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
403 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
404 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
405 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
406 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
407 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
408 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
409 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
410 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
411 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
412 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
413 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
414 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
415 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
416 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
417 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
418 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
419 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
420 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
421 3300059650 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 69R_SD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
422 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
423 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.15
Metatranscriptomes 3.65
Isolates 2.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.6
Nodule 0.37
Rhizoplane 3.41
Rhizosphere 80.27
Stem 0
Stem Tuber 0
Unclassified 5.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1000152 3300001915 Bacteria 19659
2 JGI24740J21852_10000682 3300001979 Bacteria 14718
3 JGI24740J21852_10005259 3300001979 Bacteria 5494
4 JGI25156J39149_1005831 3300002705 Bacteria 3479
5 JGI25156J39149_1009597 3300002705 Bacteria 2338
6 JGI25154J39366_1001844 3300002738 Bacteria 6472
7 JGI25157J39369_1008788 3300002741 Bacteria 1388
8 Ga0006556J51387_1039703 3300003479 Bacteria 3334
9 Ga0055538_1004147 3300003751 Bacteria 1693
10 Ga0055538_1007419 3300003751 Bacteria 990
11 Ga0055539_1000095 3300003752 Bacteria 102639
12 Ga0055539_1027922 3300003752 Bacteria 649
13 Ga0055533_1004171 3300003756 Bacteria 2679
14 Ga0055533_1011122 3300003756 Bacteria 990
15 Ga0055532_1000058 3300003758 Bacteria 153303
16 Ga0055525_1000379 3300003759 Bacteria 29078
17 Ga0055525_1016883 3300003759 Bacteria 619
18 Ga0055527_1001095 3300003760 Bacteria 6353
19 Ga0055535_1000041 3300003761 Bacteria 153303
20 Ga0055542_1002640 3300003762 Bacteria 5614
21 Ga0055542_1021709 3300003762 Bacteria 922
22 Ga0055529_1000077 3300003763 Bacteria 153303
23 Ga0055526_1021364 3300003771 Bacteria 2254
24 Ga0055537_1007379 3300003773 Bacteria 2656
25 Ga0055537_1039771 3300003773 Bacteria 566
26 Ga0055524_1006928 3300003775 Bacteria 4874
27 Ga0055524_1036225 3300003775 Bacteria 1330
28 Ga0055536_1000020 3300003781 Bacteria 199649
29 Ga0055540_1037782 3300003792 Bacteria 1062
30 Ga0055541_1000265 3300003841 Bacteria 18362
31 Ga0055541_1009075 3300003841 Bacteria 1554
32 Ga0065712_10016198 3300005290 Bacteria 1718
33 Ga0065712_10681683 3300005290 Bacteria 554
34 Ga0070676_11272613 3300005328 Bacteria 561
35 Ga0070690_101517588 3300005330 Bacteria 542
36 Ga0070670_101086542 3300005331 Bacteria 729
37 Ga0070666_10960526 3300005335 Bacteria 633
38 Ga0070682_100301124 3300005337 Bacteria 1177
39 Ga0068868_100033436 3300005338 Bacteria 3963
40 Ga0070660_100280239 3300005339 Bacteria 1364
41 Ga0070660_100475699 3300005339 Bacteria 1038
42 Ga0070660_100849106 3300005339 Bacteria 769
43 Ga0070660_100993807 3300005339 Bacteria 709
44 Ga0070689_100383370 3300005340 Bacteria 1185
45 Ga0070689_101465307 3300005340 Bacteria 618
46 Ga0070691_10801496 3300005341 Bacteria 574
47 Ga0070691_11015504 3300005341 Bacteria 518
48 Ga0070687_100311980 3300005343 Bacteria 1002
49 Ga0070687_100512500 3300005343 Bacteria 809
50 Ga0070687_100724582 3300005343 Bacteria 697
51 Ga0070661_100000193 3300005344 Bacteria 50382
52 Ga0070692_10724106 3300005345 Bacteria 672
53 Ga0070668_100177100 3300005347 Bacteria 1740
54 Ga0070668_100709277 3300005347 Bacteria 888
55 Ga0070668_100991062 3300005347 Bacteria 755
56 Ga0070669_100551466 3300005353 Bacteria 961
57 Ga0070669_100887557 3300005353 Bacteria 761
58 Ga0070675_100120349 3300005354 Bacteria 2230
59 Ga0070675_102130979 3300005354 Bacteria 517
60 Ga0070671_101104056 3300005355 Bacteria 697
61 Ga0070674_100042844 3300005356 Bacteria 3077
62 Ga0070674_100336562 3300005356 Bacteria 1214
63 Ga0070674_100772253 3300005356 Bacteria 827
64 Ga0070673_100856545 3300005364 Bacteria 841
65 Ga0070688_100064162 3300005365 Bacteria 2330
66 Ga0070659_100001577 3300005366 Bacteria 16412
67 Ga0070659_100048222 3300005366 Bacteria 3345
68 Ga0070659_100208597 3300005366 Bacteria 1610
69 Ga0070659_101850324 3300005366 Bacteria 541
70 Ga0070659_102144090 3300005366 Bacteria 502
71 Ga0070667_100012161 3300005367 Bacteria 7123
72 Ga0070667_100161863 3300005367 Bacteria 1971
73 Ga0070667_100179792 3300005367 Bacteria 1870
74 Ga0070667_100728202 3300005367 Bacteria 919
75 Ga0070714_100076400 3300005435 Bacteria 2908
76 Ga0070701_10004017 3300005438 Bacteria 5895
77 Ga0070701_10293380 3300005438 Bacteria 997
78 Ga0070700_100531126 3300005441 Bacteria 910
79 Ga0070700_100546590 3300005441 Bacteria 899
80 Ga0070700_100665547 3300005441 Bacteria 824
81 Ga0070700_100676725 3300005441 Bacteria 817
82 Ga0070700_102008294 3300005441 Bacteria 502
83 Ga0070694_101056482 3300005444 Bacteria 676
84 Ga0070708_100497048 3300005445 Bacteria 1151
85 Ga0070663_100000025 3300005455 Bacteria 101896
86 Ga0070663_100314264 3300005455 Bacteria 1258
87 Ga0070663_100552618 3300005455 Bacteria 963
88 Ga0070663_100572439 3300005455 Bacteria 947
89 Ga0070663_100739738 3300005455 Bacteria 839
90 Ga0070663_101461376 3300005455 Bacteria 607
91 Ga0070663_101472627 3300005455 Bacteria 605
92 Ga0070678_101474070 3300005456 Bacteria 637
93 Ga0070662_101147189 3300005457 Bacteria 667
94 Ga0068867_100031005 3300005459 Bacteria 3858
95 Ga0070706_100789299 3300005467 Bacteria 879
96 Ga0070707_100328584 3300005468 Bacteria 1486
97 Ga0070698_100359923 3300005471 Bacteria 1387
98 Ga0070699_100260664 3300005518 Bacteria 1550
99 Ga0070699_101377901 3300005518 Bacteria 647
100 Ga0070679_100269815 3300005530 Bacteria 1656
101 Ga0070679_101092838 3300005530 Bacteria 742
102 Ga0070697_100061456 3300005536 Bacteria 3064
103 Ga0070697_101024946 3300005536 Bacteria 734
104 Ga0068853_100004519 3300005539 Bacteria 10792
105 Ga0068853_100309228 3300005539 Bacteria 1463
106 Ga0068853_100371845 3300005539 Bacteria 1333
107 Ga0068853_100505651 3300005539 Bacteria 1141
108 Ga0068853_101653468 3300005539 Bacteria 621
109 Ga0068853_102198533 3300005539 Bacteria 535
110 Ga0070672_100517947 3300005543 Bacteria 1033
111 Ga0070672_100705425 3300005543 Bacteria 884
112 Ga0070672_100840461 3300005543 Bacteria 809
113 Ga0070686_100078123 3300005544 Bacteria 2185
114 Ga0070695_100649680 3300005545 Bacteria 833
115 Ga0070695_100875064 3300005545 Bacteria 724
116 Ga0070696_100111400 3300005546 Bacteria 1971
117 Ga0070696_100211730 3300005546 Bacteria 1451
118 Ga0070696_100602539 3300005546 Bacteria 886
119 Ga0070693_100176433 3300005547 Bacteria 1372
120 Ga0070693_100352397 3300005547 Bacteria 1008
121 Ga0070693_101422821 3300005547 Bacteria 540
122 Ga0070665_100047359 3300005548 Bacteria 4316
123 Ga0070665_100141520 3300005548 Bacteria 2409
124 Ga0070665_100227409 3300005548 Bacteria 1865
125 Ga0070665_100837909 3300005548 Bacteria 933
126 Ga0070704_100091278 3300005549 Bacteria 2271
127 Ga0070704_100137956 3300005549 Bacteria 1900
128 Ga0070704_100317132 3300005549 Bacteria 1305
129 Ga0068855_101139151 3300005563 Bacteria 814
130 Ga0068855_101470981 3300005563 Bacteria 700
131 Ga0068855_102374986 3300005563 Bacteria 529
132 Ga0068855_102589198 3300005563 Bacteria 503
133 Ga0070664_100000020 3300005564 Bacteria 119858
134 Ga0070664_100885042 3300005564 Bacteria 837
135 Ga0070664_101093534 3300005564 Bacteria 751
136 Ga0068857_100023305 3300005577 Bacteria 5448
137 Ga0068857_100283951 3300005577 Bacteria 1523
138 Ga0068857_101275969 3300005577 Bacteria 712
139 Ga0068854_100000251 3300005578 Bacteria 36522
140 Ga0068854_100186830 3300005578 Bacteria 1622
141 Ga0068856_100000094 3300005614 Bacteria 84534
142 Ga0068856_100433455 3300005614 Bacteria 1335
143 Ga0068856_100493966 3300005614 Bacteria 1245
144 Ga0070702_100566912 3300005615 Bacteria 846
145 Ga0070702_100594089 3300005615 Bacteria 829
146 Ga0070702_100709355 3300005615 Bacteria 768
147 Ga0070702_100810227 3300005615 Bacteria 725
148 Ga0068852_100104238 3300005616 Bacteria 2567
149 Ga0068852_101219035 3300005616 Bacteria 774
150 Ga0068859_100004143 3300005617 Bacteria 14805
151 Ga0068859_100324427 3300005617 Bacteria 1634
152 Ga0068859_100424122 3300005617 Bacteria 1426
153 Ga0068859_102320549 3300005617 Bacteria 592
154 Ga0068859_102584413 3300005617 Bacteria 559
155 Ga0068866_10300843 3300005718 Bacteria 1002
156 Ga0068866_10599164 3300005718 Bacteria 744
157 Ga0068861_100349928 3300005719 Bacteria 1296
158 Ga0068861_101818528 3300005719 Bacteria 605
159 Ga0068861_102539056 3300005719 Bacteria 516
160 Ga0068851_10481722 3300005834 Bacteria 742
161 Ga0068870_10252500 3300005840 Bacteria 1094
162 Ga0068870_10321309 3300005840 Bacteria 983
163 Ga0068863_100242753 3300005841 Bacteria 1739
164 Ga0068858_100017294 3300005842 Bacteria 6764
165 Ga0068858_100138949 3300005842 Bacteria 2280
166 Ga0068858_100146546 3300005842 Bacteria 2217
167 Ga0068858_100232044 3300005842 Bacteria 1750
168 Ga0068860_100108335 3300005843 Bacteria 2655
169 Ga0068860_100299294 3300005843 Bacteria 1575
170 Ga0068860_100627273 3300005843 Bacteria 1082
171 Ga0068860_100797402 3300005843 Bacteria 958
172 Ga0068860_101301383 3300005843 Bacteria 748
173 Ga0068860_101383753 3300005843 Bacteria 725
174 Ga0068862_100192967 3300005844 Bacteria 1834
175 Ga0068862_100908855 3300005844 Bacteria 866
176 Ga0070712_100082642 3300006175 Bacteria 2330
177 Ga0075367_10314208 3300006178 Bacteria 987
178 Ga0075367_10533413 3300006178 Bacteria 745
179 Ga0075369_10241995 3300006186 Bacteria 837
180 Ga0075366_10045156 3300006195 Bacteria 2611
181 Ga0075366_10166536 3300006195 Bacteria 1337
182 Ga0075366_10213676 3300006195 Bacteria 1174
183 Ga0075366_10242038 3300006195 Bacteria 1100
184 Ga0075366_10439493 3300006195 Bacteria 804
185 Ga0075366_10752613 3300006195 Bacteria 606
186 Ga0097621_100020693 3300006237 Bacteria 5073
187 Ga0097621_100307001 3300006237 Bacteria 1403
188 Ga0075370_10009133 3300006353 Bacteria 5132
189 Ga0075370_10814016 3300006353 Bacteria 570
190 Ga0068871_100030701 3300006358 Bacteria 4234
191 Ga0068871_101518672 3300006358 Bacteria 633
192 Ga0068865_100077772 3300006881 Bacteria 2372
193 Ga0068865_100208989 3300006881 Bacteria 1519
194 Ga0075436_100030807 3300006914 Bacteria 3691
195 Ga0097620_100004143 3300006931 Bacteria 14805
196 Ga0097620_100324423 3300006931 Bacteria 1634
197 Ga0097620_100424081 3300006931 Bacteria 1426
198 Ga0097620_102320710 3300006931 Bacteria 592
199 Ga0097620_102584873 3300006931 Bacteria 559
200 Ga0099826_10000004 3300006948 Bacteria 802669
201 Ga0075435_100298910 3300007076 Bacteria 1377
202 Ga0105251_10061983 3300009011 Bacteria 1757
203 Ga0105244_10359606 3300009036 Bacteria 671
204 Ga0105240_10022527 3300009093 Bacteria 8348
205 Ga0105240_10027802 3300009093 Bacteria 7400
206 Ga0105240_10155943 3300009093 Bacteria 2715
207 Ga0105240_10349152 3300009093 Bacteria 1679
208 Ga0105240_10771454 3300009093 Bacteria 1044
209 Ga0111539_10103738 3300009094 Bacteria 3337
210 Ga0111539_10424204 3300009094 Bacteria 1549
211 Ga0111539_11391977 3300009094 Bacteria 814
212 Ga0111539_11656127 3300009094 Bacteria 742
213 Ga0105245_10009298 3300009098 Bacteria 8569
214 Ga0105245_10206271 3300009098 Bacteria 1890
215 Ga0105245_10892882 3300009098 Bacteria 930
216 Ga0105245_11622096 3300009098 Bacteria 699
217 Ga0105245_11850084 3300009098 Bacteria 657
218 Ga0105247_10021354 3300009101 Bacteria 3896
219 Ga0105243_10270576 3300009148 Bacteria 1525
220 Ga0105243_10408808 3300009148 Bacteria 1263
221 Ga0105243_10415469 3300009148 Bacteria 1253
222 Ga0105243_11298636 3300009148 Bacteria 745
223 Ga0105243_11937726 3300009148 Bacteria 623
224 Ga0105243_12583641 3300009148 Bacteria 547
225 Ga0105243_12811942 3300009148 Bacteria 527
226 Ga0105241_10048828 3300009174 Bacteria 3221
227 Ga0105241_10121297 3300009174 Bacteria 2105
228 Ga0105241_10392849 3300009174 Bacteria 1215
229 Ga0105241_10457142 3300009174 Bacteria 1130
230 Ga0105241_10858168 3300009174 Bacteria 840
231 Ga0105241_11236893 3300009174 Bacteria 709
232 Ga0105241_12183422 3300009174 Bacteria 549
233 Ga0105242_10234236 3300009176 Bacteria 1647
234 Ga0105242_10235481 3300009176 Bacteria 1643
235 Ga0105242_13266868 3300009176 Bacteria 504
236 Ga0105248_10002218 3300009177 Bacteria 21485
237 Ga0105248_10448199 3300009177 Bacteria 1454
238 Ga0105248_10765760 3300009177 Bacteria 1089
239 Ga0105248_11462106 3300009177 Bacteria 773
240 Ga0105237_10000548 3300009545 Bacteria 52739
241 Ga0105237_10012855 3300009545 Bacteria 8800
242 Ga0105237_10499583 3300009545 Bacteria 1223
243 Ga0105237_11370077 3300009545 Bacteria 714
244 Ga0105237_12444881 3300009545 Bacteria 533
245 Ga0105237_12555269 3300009545 Bacteria 521
246 Ga0105238_10002440 3300009551 Bacteria 18658
247 Ga0105238_10178772 3300009551 Bacteria 2098
248 Ga0105238_10346624 3300009551 Bacteria 1474
249 Ga0105238_10503631 3300009551 Bacteria 1212
250 Ga0105238_12922857 3300009551 Bacteria 514
251 Ga0105249_10396859 3300009553 Bacteria 1409
252 Ga0105249_12392275 3300009553 Bacteria 601
253 Ga0105239_10004988 3300010375 Bacteria 15674
254 Ga0105239_10028073 3300010375 Bacteria 6192
255 Ga0105239_10888913 3300010375 Bacteria 1022
256 Ga0105239_11403163 3300010375 Bacteria 806
257 Ga0105239_11687347 3300010375 Bacteria 733
258 Ga0105246_10154272 3300011119 Bacteria 1742
259 Ga0105246_10232409 3300011119 Bacteria 1453
260 Ga0105246_10684547 3300011119 Bacteria 897
261 Ga0157335_1027327 3300012492 Bacteria 579
262 Ga0157315_1014802 3300012508 Bacteria 752
263 Ga0157373_10015843 3300013100 Bacteria 5503
264 Ga0157373_10184308 3300013100 Bacteria 1470
265 Ga0157373_10357414 3300013100 Bacteria 1042
266 Ga0157373_10683726 3300013100 Bacteria 751
267 Ga0157373_11165054 3300013100 Bacteria 580
268 Ga0157371_10000082 3300013102 Bacteria 149981
269 Ga0157371_10746937 3300013102 Bacteria 734
270 Ga0157370_10000423 3300013104 Bacteria 53080
271 Ga0157370_10007010 3300013104 Bacteria 12309
272 Ga0157369_10040287 3300013105 Bacteria 5100
273 Ga0157374_10000493 3300013296 Bacteria 35816
274 Ga0157374_10075475 3300013296 Bacteria 3185
275 Ga0157374_10649569 3300013296 Bacteria 1067
276 Ga0157374_10675090 3300013296 Bacteria 1045
277 Ga0157374_10689354 3300013296 Bacteria 1034
278 Ga0157378_10088875 3300013297 Bacteria 2804
279 Ga0157378_10121654 3300013297 Bacteria 2406
280 Ga0157378_10125921 3300013297 Bacteria 2366
281 Ga0157378_10178140 3300013297 Bacteria 1998
282 Ga0157378_10699865 3300013297 Bacteria 1033
283 Ga0157378_11296523 3300013297 Bacteria 769
284 Ga0157378_12670951 3300013297 Bacteria 552
285 Ga0163162_10535822 3300013306 Bacteria 1300
286 Ga0163162_10807802 3300013306 Bacteria 1055
287 Ga0163162_12008312 3300013306 Bacteria 663
288 Ga0163162_12252460 3300013306 Bacteria 626
289 Ga0157372_10001447 3300013307 Bacteria 25689
290 Ga0157372_11361023 3300013307 Bacteria 819
291 Ga0157375_10089299 3300013308 Bacteria 3138
292 Ga0163163_10298236 3300014325 Bacteria 1664
293 Ga0163163_12799133 3300014325 Bacteria 544
294 Ga0157380_10239314 3300014326 Bacteria 1635
295 Ga0157380_10747471 3300014326 Bacteria 989
296 Ga0157380_12200807 3300014326 Bacteria 615
297 Ga0157377_11040988 3300014745 Bacteria 623
298 Ga0157377_11201276 3300014745 Bacteria 587
299 Ga0157377_11576684 3300014745 Bacteria 525
300 Ga0157379_10115193 3300014968 Bacteria 2417
301 Ga0157379_11302866 3300014968 Bacteria 701
302 Ga0157379_11392672 3300014968 Bacteria 679
303 Ga0157376_10065502 3300014969 Bacteria 3068
304 Ga0157376_11018048 3300014969 Bacteria 851
305 Ga0157376_11072771 3300014969 Bacteria 830
306 Ga0157376_11535964 3300014969 Bacteria 699
307 Ga0157376_12149917 3300014969 Bacteria 597
308 Ga0182006_1001223 3300015261 Bacteria 16011
309 Ga0182006_1084575 3300015261 Bacteria 1151
310 Ga0182007_10139649 3300015262 Bacteria 819
311 Ga0182005_1051097 3300015265 Bacteria 1124
312 Ga0163161_10223739 3300017792 Bacteria 1458
313 Ga0163161_10993002 3300017792 Bacteria 716
314 Ga0163161_11168939 3300017792 Bacteria 664
315 Ga0197907_10464694 3300020069 Bacteria 1436
316 Ga0206356_10209806 3300020070 Bacteria 1029
317 Ga0206351_10301891 3300020077 Bacteria 1068
318 Ga0206350_11251963 3300020080 Bacteria 663
319 Ga0206354_10128724 3300020081 Bacteria 819
320 Ga0206353_11396399 3300020082 Bacteria 882
321 Ga0154015_1262301 3300020610 Bacteria 32661
322 Ga0154015_1429522 3300020610 Bacteria 679
323 Ga0224712_10000145 3300022467 Bacteria 11882
324 Ga0209784_100055 3300025224 Bacteria 177507
325 Ga0209784_100213 3300025224 Bacteria 39886
326 Ga0209784_100714 3300025224 Bacteria 8818
327 Ga0209566_100002 3300025225 Bacteria 2614868
328 Ga0209566_100386 3300025225 Bacteria 35703
329 Ga0209566_100695 3300025225 Bacteria 19492
330 Ga0209674_100090 3300025226 Bacteria 175563
331 Ga0209674_100213 3300025226 Bacteria 55913
332 Ga0209672_100126 3300025228 Bacteria 79084
333 Ga0209672_100690 3300025228 Bacteria 16916
334 Ga0209147_100002 3300025229 Bacteria 2158988
335 Ga0209563_100095 3300025230 Bacteria 165592
336 Ga0209563_116947 3300025230 Bacteria 884
337 Ga0207427_100380 3300025231 Bacteria 26848
338 Ga0209258_100002 3300025242 Bacteria 2158988
339 Ga0209646_1000019 3300025246 Bacteria 475248
340 Ga0209026_1004707 3300025250 Bacteria 3941
341 Ga0209677_100069 3300025253 Bacteria 144999
342 Ga0209677_102741 3300025253 Bacteria 6308
343 Ga0209148_1000330 3300025254 Bacteria 65396
344 Ga0209148_1001723 3300025254 Bacteria 9578
345 Ga0209759_1002810 3300025256 Bacteria 7351
346 Ga0209759_1007390 3300025256 Bacteria 3536
347 Ga0209565_1000103 3300025263 Bacteria 127199
348 Ga0209565_1009258 3300025263 Bacteria 2516
349 Ga0209455_1000009 3300025272 Bacteria 1042273
350 Ga0209673_1030242 3300025273 Bacteria 1709
351 Ga0209675_1001091 3300025291 Bacteria 16693
352 Ga0209675_1001094 3300025291 Bacteria 16654
353 Ga0209676_1000066 3300025292 Bacteria 317897
354 Ga0209025_1001357 3300025294 Bacteria 32874
355 Ga0209025_1002856 3300025294 Bacteria 17327
356 Ga0209025_1033381 3300025294 Bacteria 2379
357 Ga0209564_1002778 3300025295 Bacteria 13094
358 Ga0209758_1012665 3300025297 Bacteria 4690
359 Ga0209050_1083757 3300025298 Bacteria 670
360 Ga0209256_1001633 3300025299 Bacteria 21846
361 Ga0209256_1003124 3300025299 Bacteria 12084
362 Ga0209051_1007477 3300025303 Bacteria 5963
363 Ga0207642_10387481 3300025899 Bacteria 833
364 Ga0207688_10365452 3300025901 Bacteria 891
365 Ga0207647_10053616 3300025904 Bacteria 2484
366 Ga0207645_11055013 3300025907 Bacteria 549
367 Ga0207643_10818365 3300025908 Bacteria 604
368 Ga0207654_10038625 3300025911 Bacteria 2680
369 Ga0207654_10134864 3300025911 Bacteria 1567
370 Ga0207654_10518309 3300025911 Bacteria 844
371 Ga0207707_10298049 3300025912 Bacteria 1394
372 Ga0207695_10000464 3300025913 Bacteria 87951
373 Ga0207695_10386349 3300025913 Bacteria 1285
374 Ga0207695_10628370 3300025913 Bacteria 955
375 Ga0207671_10017015 3300025914 Bacteria 5626
376 Ga0207671_10070054 3300025914 Bacteria 2613
377 Ga0207671_10223696 3300025914 Bacteria 1475
378 Ga0207671_10372449 3300025914 Bacteria 1134
379 Ga0207693_10146345 3300025915 Bacteria 1858
380 Ga0207660_10436470 3300025917 Bacteria 1058
381 Ga0207662_10468555 3300025918 Bacteria 864
382 Ga0207657_10143253 3300025919 Bacteria 1951
383 Ga0207657_10166266 3300025919 Bacteria 1789
384 Ga0207649_10000065 3300025920 Bacteria 94778
385 Ga0207649_10358884 3300025920 Bacteria 1081
386 Ga0207652_10103276 3300025921 Bacteria 2520
387 Ga0207652_10307136 3300025921 Bacteria 1432
388 Ga0207652_10550916 3300025921 Bacteria 1036
389 Ga0207646_10141462 3300025922 Bacteria 2167
390 Ga0207694_10072877 3300025924 Bacteria 2686
391 Ga0207694_10303494 3300025924 Bacteria 1315
392 Ga0207694_11006571 3300025924 Bacteria 705
393 Ga0207694_11210418 3300025924 Bacteria 639
394 Ga0207694_11589237 3300025924 Bacteria 551
395 Ga0207650_10478389 3300025925 Bacteria 1039
396 Ga0207659_10095357 3300025926 Bacteria 2231
397 Ga0207687_10010408 3300025927 Bacteria 6077
398 Ga0207687_10144135 3300025927 Bacteria 1810
399 Ga0207687_10440401 3300025927 Bacteria 1079
400 Ga0207644_10688900 3300025931 Bacteria 852
401 Ga0207644_10753183 3300025931 Bacteria 814
402 Ga0207690_10001437 3300025932 Bacteria 14907
403 Ga0207690_10036383 3300025932 Bacteria 3187
404 Ga0207690_10046550 3300025932 Bacteria 2874
405 Ga0207706_11008458 3300025933 Bacteria 699
406 Ga0207686_10105954 3300025934 Bacteria 1886
407 Ga0207709_10268559 3300025935 Bacteria 1254
408 Ga0207709_11791454 3300025935 Bacteria 511
409 Ga0207670_10150638 3300025936 Bacteria 1726
410 Ga0207670_10436496 3300025936 Bacteria 1053
411 Ga0207670_10651146 3300025936 Bacteria 869
412 Ga0207669_10282967 3300025937 Bacteria 1252
413 Ga0207669_11328296 3300025937 Bacteria 611
414 Ga0207704_10133644 3300025938 Bacteria 1723
415 Ga0207704_10257559 3300025938 Bacteria 1314
416 Ga0207691_10124826 3300025940 Bacteria 2278
417 Ga0207691_10243693 3300025940 Bacteria 1553
418 Ga0207691_10768822 3300025940 Bacteria 810
419 Ga0207691_11031965 3300025940 Bacteria 686
420 Ga0207711_10011049 3300025941 Bacteria 7504
421 Ga0207689_10001526 3300025942 Bacteria 22022
422 Ga0207689_10083875 3300025942 Bacteria 2620
423 Ga0207679_10000028 3300025945 Bacteria 187787
424 Ga0207679_10892961 3300025945 Bacteria 813
425 Ga0207651_10463936 3300025960 Bacteria 1089
426 Ga0207712_11835665 3300025961 Bacteria 543
427 Ga0207668_10283686 3300025972 Bacteria 1359
428 Ga0207640_10000250 3300025981 Bacteria 36539
429 Ga0207640_10148107 3300025981 Bacteria 1721
430 Ga0207640_10464832 3300025981 Bacteria 1046
431 Ga0207658_10007151 3300025986 Bacteria 7605
432 Ga0207658_10268024 3300025986 Bacteria 1458
433 Ga0207677_10029824 3300026023 Bacteria 3473
434 Ga0207677_10342155 3300026023 Bacteria 1250
435 Ga0207677_10474765 3300026023 Bacteria 1076
436 Ga0207677_10558464 3300026023 Bacteria 999
437 Ga0207703_10126110 3300026035 Bacteria 2204
438 Ga0207703_10176633 3300026035 Bacteria 1882
439 Ga0207703_10205131 3300026035 Bacteria 1754
440 Ga0207703_10885194 3300026035 Bacteria 855
441 Ga0207639_10510382 3300026041 Bacteria 1100
442 Ga0207678_10000376 3300026067 Bacteria 40752
443 Ga0207678_10247902 3300026067 Bacteria 1525
444 Ga0207678_10318762 3300026067 Bacteria 1337
445 Ga0207678_10499661 3300026067 Bacteria 1060
446 Ga0207678_11414077 3300026067 Bacteria 615
447 Ga0207708_10273384 3300026075 Bacteria 1367
448 Ga0207708_10547994 3300026075 Bacteria 975
449 Ga0207708_11431851 3300026075 Bacteria 607
450 Ga0207702_10000046 3300026078 Bacteria 144265
451 Ga0207702_10452537 3300026078 Bacteria 1246
452 Ga0207641_10016613 3300026088 Bacteria 6026
453 Ga0207641_10221425 3300026088 Bacteria 1755
454 Ga0207648_10172810 3300026089 Bacteria 1910
455 Ga0207648_11799275 3300026089 Bacteria 574
456 Ga0207676_10203796 3300026095 Bacteria 1750
457 Ga0207674_10025675 3300026116 Bacteria 6274
458 Ga0207674_10046269 3300026116 Bacteria 4468
459 Ga0207674_11214591 3300026116 Bacteria 723
460 Ga0207675_100253113 3300026118 Bacteria 1705
461 Ga0207675_100370235 3300026118 Bacteria 1407
462 Ga0207683_10219502 3300026121 Bacteria 1732
463 Ga0207698_10048794 3300026142 Bacteria 3217
464 Ga0207698_10932457 3300026142 Bacteria 877
465 Ga0209984_1029863 3300027424 Bacteria 768
466 Ga0209282_1000015 3300027666 Bacteria 206531
467 Ga0209971_1016062 3300027682 Bacteria 1775
468 Ga0207428_10155634 3300027907 Bacteria 1738
469 Ga0268266_10089699 3300028379 Bacteria 2693
470 Ga0268266_10129900 3300028379 Bacteria 2252
471 Ga0268266_10229893 3300028379 Bacteria 1708
472 Ga0268266_10450789 3300028379 Bacteria 1223
473 Ga0268265_10315103 3300028380 Bacteria 1414
474 Ga0268265_10775702 3300028380 Bacteria 932
475 Ga0268264_10065291 3300028381 Bacteria 3066
476 Ga0268264_10100331 3300028381 Bacteria 2514
477 Ga0268264_10760381 3300028381 Bacteria 966
478 Ga0268264_11032797 3300028381 Bacteria 829
479 Ga0265318_10001257 3300028577 Bacteria 15341
480 Ga0307515_10046228 3300028794 Bacteria 6661
481 Ga0307515_10262900 3300028794 Bacteria 1459
482 Ga0265328_10000001 3300031239 Bacteria 371500
483 Ga0265328_10022673 3300031239 Bacteria 2387
484 Ga0265320_10099794 3300031240 Bacteria 1338
485 Ga0265325_10332937 3300031241 Bacteria 673
486 Ga0265340_10279657 3300031247 Bacteria 741
487 Ga0265331_10059937 3300031250 Bacteria 1799
488 Ga0265327_10000235 3300031251 Bacteria 111362
489 Ga0265327_10016776 3300031251 Bacteria 4629
490 Ga0265316_10069121 3300031344 Bacteria 2726
491 Ga0265316_10391567 3300031344 Bacteria 1002
492 Ga0265316_10522256 3300031344 Bacteria 847
493 Ga0265316_10863014 3300031344 Bacteria 633
494 Ga0307513_10726348 3300031456 Bacteria 699
495 Ga0307509_10000006 3300031507 Bacteria 421538
496 Ga0307509_10536956 3300031507 Bacteria 849
497 Ga0307509_10600405 3300031507 Bacteria 773
498 Ga0307408_100047223 3300031548 Bacteria 3082
499 Ga0307408_100096742 3300031548 Bacteria 2241
500 Ga0307408_100182250 3300031548 Bacteria 1685
501 Ga0307408_100337892 3300031548 Bacteria 1274
502 Ga0307408_100371790 3300031548 Bacteria 1219
503 Ga0307408_100503811 3300031548 Bacteria 1060
504 Ga0265313_10000482 3300031595 Bacteria 41863
505 Ga0265313_10016122 3300031595 Bacteria 4312
506 Ga0307508_10030541 3300031616 Bacteria 4871
507 Ga0316575_10313381 3300031665 Bacteria 665
508 Ga0316579_10021079 3300031691 Bacteria 2899
509 Ga0316579_10433272 3300031691 Bacteria 636
510 Ga0265314_10019786 3300031711 Bacteria 5205
511 Ga0265314_10331643 3300031711 Bacteria 843
512 Ga0265342_10306756 3300031712 Bacteria 835
513 Ga0316576_10132191 3300031727 Bacteria 1877
514 Ga0316578_10003673 3300031728 Bacteria 7079
515 Ga0316578_10460919 3300031728 Bacteria 751
516 Ga0307516_10935563 3300031730 Bacteria 535
517 Ga0307405_10015558 3300031731 Bacteria 4125
518 Ga0307405_10043771 3300031731 Bacteria 2734
519 Ga0307405_11697123 3300031731 Bacteria 559
520 Ga0316577_10003197 3300031733 Bacteria 8237
521 Ga0316577_10066378 3300031733 Bacteria 2015
522 Ga0307413_11029252 3300031824 Bacteria 707
523 Ga0307410_10002755 3300031852 Bacteria 8598
524 Ga0307410_10390469 3300031852 Bacteria 1122
525 Ga0307410_10497892 3300031852 Bacteria 1002
526 Ga0307406_10027397 3300031901 Bacteria 3433
527 Ga0307406_11089325 3300031901 Bacteria 689
528 Ga0307406_11649236 3300031901 Bacteria 567
529 Ga0307407_10347356 3300031903 Bacteria 1049
530 Ga0307412_10011261 3300031911 Bacteria 5174
531 Ga0307412_10101112 3300031911 Bacteria 2039
532 Ga0307412_10554742 3300031911 Bacteria 966
533 Ga0307412_10575971 3300031911 Bacteria 949
534 Ga0307412_10823855 3300031911 Bacteria 807
535 Ga0307409_100003730 3300031995 Bacteria 8367
536 Ga0307409_100028119 3300031995 Bacteria 3999
537 Ga0307409_100750979 3300031995 Bacteria 979
538 Ga0307409_101754937 3300031995 Bacteria 650
539 Ga0307416_100001678 3300032002 Bacteria 12247
540 Ga0307416_100051722 3300032002 Bacteria 3283
541 Ga0307416_100073914 3300032002 Bacteria 2845
542 Ga0307416_100412554 3300032002 Bacteria 1392
543 Ga0307416_100961210 3300032002 Bacteria 956
544 Ga0307411_10018945 3300032005 Bacteria 3962
545 Ga0307411_10247111 3300032005 Bacteria 1401
546 Ga0307411_10259147 3300032005 Bacteria 1372
547 Ga0307411_10283443 3300032005 Bacteria 1320
548 Ga0307411_11525860 3300032005 Bacteria 615
549 Ga0307411_11808285 3300032005 Bacteria 567
550 Ga0307415_100002191 3300032126 Bacteria 9675
551 Ga0307415_100003681 3300032126 Bacteria 7845
552 Ga0307415_102567512 3300032126 Bacteria 502
553 Ga0316583_10094013 3300032133 Bacteria 1045
554 Ga0316585_10064679 3300032137 Bacteria 1184
555 Ga0316580_10001189 3300032139 Bacteria 6631
556 Ga0316593_10000841 3300032168 Bacteria 6213
557 Ga0316593_10014809 3300032168 Bacteria 2335
558 Ga0316593_10113944 3300032168 Bacteria 967
559 Ga0316596_1002972 3300033541 Bacteria 3680
560 Ga0316596_1147587 3300033541 Bacteria 645
561 Ga0373934_0001684 3300035086 Bacteria 8120
562 Ga0373952_0054415 3300035092 Bacteria 962
563 Ga0373956_0000615 3300035119 Bacteria 14591
564 Ga0373957_0060102 3300035120 Bacteria 1471
565 Ga0373946_0198923 3300035171 Bacteria 959
566 Ga0373961_0262207 3300035241 Bacteria 628
567 Ga0373962_0017274 3300035242 Bacteria 1869
568 Ga0316574_0007145 3300035398 Bacteria 6103
569 Ga0373931_0571738 3300035691 Bacteria 736
570 Ga0373931_0941184 3300035691 Bacteria 582
571 Ga0373927_0611853 3300035695 Bacteria 720
572 Ga0373933_0001188 3300035724 Bacteria 15438
573 Ga0373937_0037625 3300036401 Bacteria 4409
574 Ga0316582_0048337 3300036647 Bacteria 2689
575 Ga0316584_0009967 3300036712 Bacteria 6619
576 Ga0316584_0030340 3300036712 Bacteria 3994
577 Ga0373925_1237187 3300037068 Bacteria 613
578 Ga0395899_0262448 3300037312 Bacteria 1181
579 Ga0395900_0098953 3300037418 Bacteria 2996
580 Ga0395900_0278896 3300037418 Bacteria 1664
581 Ga0395900_0629401 3300037418 Bacteria 1011
582 Ga0395898_0808129 3300037466 Bacteria 878
583 Ga0395905_0004037 3300037471 Bacteria 15407
584 Ga0395905_0048304 3300037471 Bacteria 3988
585 Ga0395901_0011265 3300038443 Bacteria 9060
586 Ga0395901_0739167 3300038443 Bacteria 978
587 Ga0395901_1010479 3300038443 Bacteria 807
588 Ga0436360_0391140 3300039438 Bacteria 957
589 Ga0436361_1095639 3300039447 Bacteria 1343
590 Ga0451789_0341123 3300041443 Bacteria 537
591 Ga0451841_0113566 3300041498 Bacteria 666
592 Ga0451843_0038411 3300041509 Bacteria 514
593 Ga0451843_1449225 3300041509 Bacteria 793
594 Ga0451855_0517695 3300041511 Bacteria 954
595 Ga0439454_105206 3300042011 Bacteria 534
596 Ga0439458_0142971 3300042157 Bacteria 638
597 Ga0439459_0215021 3300042438 Bacteria 530
598 Ga0451577_0025902 3300042876 Bacteria 5317
599 Ga0451577_0120151 3300042876 Bacteria 2354
600 Ga0451577_0143177 3300042876 Bacteria 2149
601 Ga0451577_0491026 3300042876 Bacteria 1115
602 Ga0453683_1021694 3300044673 Bacteria 549
603 Ga0453684_0002102 3300044712 Bacteria 50310
604 Ga0453684_0003300 3300044712 Bacteria 36795
605 Ga0453684_0006085 3300044712 Bacteria 23282
606 Ga0453684_0560017 3300044712 Bacteria 1258
607 Ga0453684_0598549 3300044712 Bacteria 1209
608 Ga0453684_0745325 3300044712 Bacteria 1061
609 Ga0453684_0777818 3300044712 Bacteria 1034
610 Ga0451576_0002470 3300045051 Bacteria 27511
611 Ga0451576_0082681 3300045051 Bacteria 3340
612 Ga0451576_0683500 3300045051 Bacteria 1078
613 Ga0451576_1603875 3300045051 Bacteria 675
614 Ga0495591_163069 3300046458 Bacteria 533
615 Ga0495638_0001797 3300046460 Bacteria 18668
616 Ga0495651_0002995 3300046462 Bacteria 13035
617 Ga0495605_0033114 3300046474 Bacteria 2626
618 Ga0495605_0052559 3300046474 Bacteria 1979
619 Ga0495584_0053684 3300046491 Bacteria 2028
620 Ga0495596_0018384 3300046500 Bacteria 2881
621 Ga0495607_0064557 3300046501 Bacteria 2067
622 Ga0495607_0135161 3300046501 Bacteria 1278
623 Ga0495608_0202845 3300046511 Bacteria 1249
624 Ga0495610_0025039 3300046512 Bacteria 3212
625 Ga0495616_0028541 3300046513 Bacteria 2954
626 Ga0495631_0010437 3300046518 Bacteria 4594
627 Ga0495643_0490299 3300046522 Bacteria 530
628 Ga0495644_0230437 3300046523 Bacteria 717
629 Ga0495663_0387010 3300046525 Bacteria 513
630 Ga0495598_0299586 3300046537 Bacteria 608
631 Ga0495609_0024107 3300046538 Bacteria 2793
632 Ga0495609_0113417 3300046538 Bacteria 1169
633 Ga0495597_0156006 3300046542 Bacteria 934
634 Ga0495611_0022876 3300046648 Bacteria 2707
635 Ga0495625_0066431 3300046660 Bacteria 2540
636 Ga0495661_0151493 3300046665 Bacteria 1252
637 Ga0495588_0264213 3300046674 Bacteria 907
638 Ga0495657_0342810 3300046675 Bacteria 885
639 Ga0495657_0399939 3300046675 Bacteria 808
640 Ga0495671_0028011 3300046692 Bacteria 2905
641 Ga0495649_0044015 3300046694 Bacteria 2437
642 Ga0495604_0407987 3300047317 Bacteria 894
643 Ga0495672_0049991 3300047320 Bacteria 2472
644 Ga0495672_0051319 3300047320 Bacteria 2430
645 Ga0495680_0360085 3300047322 Bacteria 1011
646 Ga0495593_0685051 3300047673 Bacteria 515
647 Ga0496100_0156446 3300048903 Bacteria 1630
648 Ga0496100_0805931 3300048903 Bacteria 736
649 Ga0496100_1641832 3300048903 Bacteria 508
650 Ga0496101_0065600 3300048904 Bacteria 2647
651 Ga0496101_0108425 3300048904 Bacteria 2088
652 Ga0496101_1033129 3300048904 Bacteria 646
653 Ga0496102_0395388 3300048905 Bacteria 1300
654 Ga0496104_0151061 3300048907 Bacteria 2229
655 Ga0496104_1003720 3300048907 Bacteria 739
656 Ga0496105_0303414 3300048908 Bacteria 1283
657 Ga0496106_0221607 3300048909 Bacteria 1509
658 Ga0496108_0641109 3300048911 Bacteria 924
659 Ga0496108_0972540 3300048911 Bacteria 726
660 Ga0496109_0237498 3300048912 Bacteria 1715
661 Ga0496109_0310644 3300048912 Bacteria 1487
662 Ga0496109_0631824 3300048912 Bacteria 1007
663 Ga0496109_1074102 3300048912 Bacteria 742
664 Ga0496110_0322106 3300048913 Bacteria 1408
665 Ga0496110_1164866 3300048913 Bacteria 679
666 Ga0496111_0734245 3300048914 Bacteria 717
667 Ga0496113_0213023 3300048916 Bacteria 1538
668 Ga0496113_0244565 3300048916 Bacteria 1432
669 Ga0496114_0013659 3300048917 Bacteria 6510
670 Ga0496114_0332435 3300048917 Bacteria 1343
671 Ga0496114_0983420 3300048917 Bacteria 727
672 Ga0496115_0296072 3300048918 Bacteria 1326
673 Ga0496116_0048325 3300048919 Bacteria 2856
674 Ga0496118_0079995 3300048921 Bacteria 2303
675 Ga0496121_0109730 3300048924 Bacteria 2107
676 Ga0496121_0161311 3300048924 Bacteria 1639
677 Ga0496122_0058111 3300048925 Bacteria 2866
678 Ga0496123_0071897 3300048926 Bacteria 2155
679 Ga0496124_0000206 3300048927 Bacteria 116591
680 Ga0496124_0001201 3300048927 Bacteria 40242
681 Ga0496125_0141105 3300048928 Bacteria 1675
682 Ga0496125_0150802 3300048928 Bacteria 1597
683 Ga0496126_0236833 3300048929 Bacteria 1527
684 Ga0501304_028359 3300049160 Bacteria 585
685 Ga0501290_005019 3300049513 Bacteria 1652
686 Ga0501292_005367 3300049515 Bacteria 1786
687 Ga0501294_005096 3300049517 Bacteria 1242
688 Ga0501295_160906 3300049518 Bacteria 558
689 Ga0501031_0004430 3300049568 Bacteria 9105
690 Ga0501031_0110195 3300049568 Bacteria 1797
691 Ga0501031_0615755 3300049568 Bacteria 698
692 Ga0501032_0001741 3300049569 Bacteria 17208
693 Ga0501032_0010188 3300049569 Bacteria 6784
694 Ga0501032_0015048 3300049569 Bacteria 5467
695 Ga0501032_0040636 3300049569 Bacteria 3161
696 Ga0501032_0318473 3300049569 Bacteria 1004
697 Ga0501033_0000364 3300049570 Bacteria 43293
698 Ga0501033_0005262 3300049570 Bacteria 10267
699 Ga0501033_0006818 3300049570 Bacteria 8916
700 Ga0501034_0005376 3300049571 Bacteria 14011
701 Ga0501034_0019811 3300049571 Bacteria 6875
702 Ga0501034_0039568 3300049571 Bacteria 4775
703 Ga0501034_0222923 3300049571 Bacteria 1837
704 Ga0501036_0208777 3300049572 Bacteria 1641
705 Ga0501036_0270537 3300049572 Bacteria 1422
706 Ga0501036_0903900 3300049572 Bacteria 724
707 Ga0501037_0000162 3300049573 Bacteria 62629
708 Ga0501038_0003864 3300049574 Bacteria 13921
709 Ga0501038_0008423 3300049574 Bacteria 9485
710 Ga0501038_0011277 3300049574 Bacteria 8160
711 Ga0501038_0108142 3300049574 Bacteria 2306
712 Ga0501039_0003351 3300049575 Bacteria 11972
713 Ga0501039_0008915 3300049575 Bacteria 7641
714 Ga0501040_0023959 3300049576 Bacteria 4094
715 Ga0501040_0394221 3300049576 Bacteria 994
716 Ga0501042_0000536 3300049578 Bacteria 19889
717 Ga0501043_0003874 3300049579 Bacteria 12289
718 Ga0501043_0015184 3300049579 Bacteria 6030
719 Ga0501043_0021892 3300049579 Bacteria 5013
720 Ga0501043_0228914 3300049579 Bacteria 1436
721 Ga0501043_0671568 3300049579 Bacteria 759
722 Ga0501043_1076067 3300049579 Bacteria 569
723 Ga0501046_0006470 3300049580 Bacteria 10362
724 Ga0501046_0036301 3300049580 Bacteria 3967
725 Ga0501047_0034699 3300049581 Bacteria 4870
726 Ga0501047_0399516 3300049581 Bacteria 1207
727 Ga0501067_0132629 3300049583 Bacteria 1386
728 Ga0501068_0039781 3300049584 Bacteria 2820
729 Ga0501070_0024315 3300049586 Bacteria 5081
730 Ga0501070_0155438 3300049586 Bacteria 1886
731 Ga0501071_1151839 3300049587 Bacteria 599
732 Ga0501072_0924082 3300049588 Bacteria 681
733 Ga0501076_0229878 3300049592 Bacteria 1516
734 Ga0501076_0573202 3300049592 Bacteria 931
735 Ga0501076_0819307 3300049592 Bacteria 768
736 Ga0501198_000011 3300049649 Bacteria 115612
737 Ga0501207_057861 3300049654 Bacteria 704
738 Ga0501222_000022 3300049662 Bacteria 66333
739 Ga0501222_048286 3300049662 Bacteria 619
740 Ga0501228_003345 3300049666 Bacteria 1317
741 Ga0501250_005766 3300049680 Bacteria 1285
742 Ga0501083_0136365 3300049744 Bacteria 1608
743 Ga0501262_012033 3300049759 Bacteria 1102
744 Ga0501269_036219 3300049766 Bacteria 646
745 Ga0501270_118778 3300049767 Bacteria 573
746 Ga0501281_03705 3300049777 Bacteria 1088
747 Ga0501282_005143 3300049778 Bacteria 1398
748 Ga0501035_0005055 3300049822 Bacteria 12496
749 Ga0501035_0103882 3300049822 Bacteria 2492
750 Ga0501035_0131593 3300049822 Bacteria 2180
751 Ga0501035_0443245 3300049822 Bacteria 1075
752 Ga0501035_1437982 3300049822 Bacteria 527
753 Ga0501044_0001481 3300049823 Bacteria 27531
754 Ga0501044_0003222 3300049823 Bacteria 18385
755 Ga0501044_0018325 3300049823 Bacteria 7503
756 Ga0501044_0024640 3300049823 Bacteria 6384
757 Ga0501044_0059334 3300049823 Bacteria 3920
758 Ga0501044_0116851 3300049823 Bacteria 2672
759 Ga0501044_0457246 3300049823 Bacteria 1182
760 Ga0501044_0548151 3300049823 Bacteria 1054
761 Ga0501045_0014729 3300049824 Bacteria 5543
762 Ga0501045_0715750 3300049824 Bacteria 738
763 nmdc:mga03683_178041_c1 3300050489 Bacteria 969
764 nmdc:mga0k408_115321_c1 3300050493 Bacteria 1589
765 nmdc:mga0k408_148325_c1 3300050493 Bacteria 1396
766 nmdc:mga0k408_172752_c1 3300050493 Bacteria 1288
767 nmdc:mga0k408_17631_c1 3300050493 Bacteria 3979
768 nmdc:mga0k408_563343_c1 3300050493 Unclassified 673
769 nmdc:mga06z11_259474_c1 3300050494 Bacteria 1025
770 nmdc:mga07m45_10321_c1 3300050496 Bacteria 4874
771 nmdc:mga07m45_295151_c1 3300050496 Bacteria 943
772 nmdc:mga06r32_1364471_c1 3300050510 Bacteria 651
773 nmdc:mga08y16_1374483_c1 3300050511 Bacteria 670
774 nmdc:mga08y16_1922955_c1 3300050511 Bacteria 542
775 nmdc:mga08y16_299492_c1 3300050511 Bacteria 1658
776 nmdc:mga0rr50_131794_c1 3300050513 Bacteria 2002
777 nmdc:mga08x19_745_c1 3300050514 Bacteria 20774
778 nmdc:mga0a205_1252467_c1 3300050515 Bacteria 589
779 Ga0500646_0057574 3300053090 Bacteria 1136
780 Ga0500658_0085132 3300053134 Bacteria 1359
781 Ga0500568_0041414 3300053139 Bacteria 1850
782 Ga0500568_0054943 3300053139 Bacteria 1555
783 Ga0500604_0000078 3300053151 Bacteria 34635
784 Ga0500616_0000128 3300053153 Bacteria 134307
785 Ga0500616_0006548 3300053153 Bacteria 7605
786 Ga0500622_0000002 3300053156 Bacteria 646442
787 Ga0500645_062236 3300053730 Bacteria 1078
788 Ga0590071_001070 3300059421 Bacteria 7412
789 Ga0590075_150228 3300059424 Bacteria 614
790 Ga0587080_087219 3300059503 Bacteria 649
791 Ga0587083_0068047 3300059505 Bacteria 820
792 Ga0587083_0124428 3300059505 Bacteria 670
793 Ga0587088_125521 3300059508 Bacteria 598
794 Ga0587091_139457 3300059511 Bacteria 606
795 Ga0587094_077547 3300059513 Bacteria 609
796 Ga0587098_055952 3300059604 Bacteria 609
797 Ga0587067_091675 3300059640 Bacteria 689
798 Ga0587068_091984 3300059641 Bacteria 626
799 Ga0587072_087172 3300059643 Bacteria 683
800 Ga0587072_096855 3300059643 Bacteria 657
801 Ga0587076_117715 3300059645 Bacteria 612
802 Ga0587104_016271 3300059650 Bacteria 590
803 Ga0587107_083582 3300059652 Bacteria 605

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300010375 Ga0105239_11687347 Ga0105239_116873471 92
2 3300045051 Ga0451576_1603875 Ga0451576_1603875_127_432 92
3 3300005539 Ga0068853_100505651 Ga0068853_1005056511 93
4 3300009176 Ga0105242_10235481 Ga0105242_102354812 93
5 3300010375 Ga0105239_11403163 Ga0105239_114031632 93
6 3300013296 Ga0157374_10000493 Ga0157374_1000049320 93
7 3300013297 Ga0157378_10699865 Ga0157378_106998652 93
8 3300049569 Ga0501032_0010188 Ga0501032_0010188_6058_6339 93
9 3300049571 Ga0501034_0005376 Ga0501034_0005376_11097_11378 93
10 3300049574 Ga0501038_0003864 Ga0501038_0003864_2643_2924 93
11 3300049574 Ga0501038_0108142 Ga0501038_0108142_1869_2150 93
12 3300049575 Ga0501039_0003351 Ga0501039_0003351_3018_3299 93
13 3300049579 Ga0501043_0671568 Ga0501043_0671568_249_530 93
14 3300049680 Ga0501250_005766 Ga0501250_005766_120_401 93
15 3300049767 Ga0501270_118778 Ga0501270_118778_253_534 93
16 3300049778 Ga0501282_005143 Ga0501282_005143_14_295 93
17 3300049822 Ga0501035_0103882 Ga0501035_0103882_1837_2118 93
18 3300049824 Ga0501045_0715750 Ga0501045_0715750_441_722 93
19 3300050515 nmdc:mga0a205_1252467_c1 nmdc:mga0a205_1252467_c1_202_507 93
20 3300005331 Ga0070670_101086542 Ga0070670_1010865421 94
21 3300005340 Ga0070689_100383370 Ga0070689_1003833702 94
22 3300005341 Ga0070691_11015504 Ga0070691_110155042 94
23 3300005343 Ga0070687_100311980 Ga0070687_1003119802 94
24 3300005353 Ga0070669_100887557 Ga0070669_1008875572 94
25 3300005354 Ga0070675_100120349 Ga0070675_1001203492 94
26 3300005356 Ga0070674_100336562 Ga0070674_1003365622 94
27 3300005364 Ga0070673_100856545 Ga0070673_1008565452 94
28 3300005365 Ga0070688_100064162 Ga0070688_1000641623 94
29 3300005366 Ga0070659_100208597 Ga0070659_1002085972 94
30 3300005367 Ga0070667_100179792 Ga0070667_1001797922 94
31 3300005438 Ga0070701_10293380 Ga0070701_102933802 94
32 3300005444 Ga0070694_101056482 Ga0070694_1010564822 94
33 3300005455 Ga0070663_101461376 Ga0070663_1014613761 94
34 3300005459 Ga0068867_100031005 Ga0068867_1000310053 94
35 3300005530 Ga0070679_101092838 Ga0070679_1010928382 94
36 3300005539 Ga0068853_100004519 Ga0068853_1000045199 94
37 3300005539 Ga0068853_101653468 Ga0068853_1016534682 94
38 3300005543 Ga0070672_100705425 Ga0070672_1007054252 94
39 3300005545 Ga0070695_100649680 Ga0070695_1006496801 94
40 3300005545 Ga0070695_100875064 Ga0070695_1008750642 94
41 3300005546 Ga0070696_100211730 Ga0070696_1002117301 94
42 3300005548 Ga0070665_100227409 Ga0070665_1002274094 94
43 3300005549 Ga0070704_100137956 Ga0070704_1001379564 94
44 3300005577 Ga0068857_100023305 Ga0068857_1000233055 94
45 3300005615 Ga0070702_100566912 Ga0070702_1005669122 94
46 3300005615 Ga0070702_100810227 Ga0070702_1008102272 94
47 3300005617 Ga0068859_100004143 Ga0068859_1000041438 94
48 3300005718 Ga0068866_10300843 Ga0068866_103008432 94
49 3300005719 Ga0068861_100349928 Ga0068861_1003499282 94
50 3300005834 Ga0068851_10481722 Ga0068851_104817222 94
51 3300005840 Ga0068870_10252500 Ga0068870_102525002 94
52 3300005841 Ga0068863_100242753 Ga0068863_1002427532 94
53 3300005842 Ga0068858_100017294 Ga0068858_1000172942 94
54 3300005843 Ga0068860_100299294 Ga0068860_1002992942 94
55 3300005844 Ga0068862_100192967 Ga0068862_1001929673 94
56 3300006237 Ga0097621_100020693 Ga0097621_1000206932 94
57 3300006358 Ga0068871_100030701 Ga0068871_1000307014 94
58 3300006358 Ga0068871_101518672 Ga0068871_1015186721 94
59 3300006881 Ga0068865_100077772 Ga0068865_1000777724 94
60 3300006931 Ga0097620_100004143 Ga0097620_1000041438 94
61 3300009093 Ga0105240_10771454 Ga0105240_107714541 94
62 3300009094 Ga0111539_10424204 Ga0111539_104242043 94
63 3300009098 Ga0105245_10206271 Ga0105245_102062712 94
64 3300009101 Ga0105247_10021354 Ga0105247_100213543 94
65 3300009148 Ga0105243_10408808 Ga0105243_104088082 94
66 3300009148 Ga0105243_11298636 Ga0105243_112986362 94
67 3300009148 Ga0105243_12811942 Ga0105243_128119422 94
68 3300009174 Ga0105241_10048828 Ga0105241_100488282 94
69 3300009174 Ga0105241_11236893 Ga0105241_112368932 94
70 3300009176 Ga0105242_10234236 Ga0105242_102342363 94
71 3300009177 Ga0105248_10002218 Ga0105248_100022187 94
72 3300009545 Ga0105237_10012855 Ga0105237_100128553 94
73 3300009551 Ga0105238_10503631 Ga0105238_105036312 94
74 3300009553 Ga0105249_10396859 Ga0105249_103968592 94
75 3300010375 Ga0105239_10028073 Ga0105239_100280735 94
76 3300011119 Ga0105246_10154272 Ga0105246_101542723 94
77 3300011119 Ga0105246_10684547 Ga0105246_106845472 94
78 3300013100 Ga0157373_11165054 Ga0157373_111650542 94
79 3300013296 Ga0157374_10075475 Ga0157374_100754752 94
80 3300013296 Ga0157374_10649569 Ga0157374_106495692 94
81 3300013297 Ga0157378_10125921 Ga0157378_101259214 94
82 3300013297 Ga0157378_12670951 Ga0157378_126709511 94
83 3300013306 Ga0163162_12252460 Ga0163162_122524601 94
84 3300014325 Ga0163163_10298236 Ga0163163_102982363 94
85 3300014326 Ga0157380_12200807 Ga0157380_122008072 94
86 3300014745 Ga0157377_11201276 Ga0157377_112012762 94
87 3300014968 Ga0157379_10115193 Ga0157379_101151932 94
88 3300014968 Ga0157379_11302866 Ga0157379_113028662 94
89 3300014969 Ga0157376_11018048 Ga0157376_110180481 94
90 3300025908 Ga0207643_10818365 Ga0207643_108183651 94
91 3300025911 Ga0207654_10038625 Ga0207654_100386252 94
92 3300025913 Ga0207695_10628370 Ga0207695_106283701 94
93 3300025914 Ga0207671_10070054 Ga0207671_100700542 94
94 3300025917 Ga0207660_10436470 Ga0207660_104364702 94
95 3300025918 Ga0207662_10468555 Ga0207662_104685552 94
96 3300025924 Ga0207694_10303494 Ga0207694_103034942 94
97 3300025925 Ga0207650_10478389 Ga0207650_104783892 94
98 3300025926 Ga0207659_10095357 Ga0207659_100953571 94
99 3300025927 Ga0207687_10144135 Ga0207687_101441352 94
100 3300025927 Ga0207687_10440401 Ga0207687_104404011 94
101 3300025932 Ga0207690_10046550 Ga0207690_100465502 94
102 3300025933 Ga0207706_11008458 Ga0207706_110084582 94
103 3300025934 Ga0207686_10105954 Ga0207686_101059542 94
104 3300025935 Ga0207709_11791454 Ga0207709_117914541 94
105 3300025936 Ga0207670_10651146 Ga0207670_106511462 94
106 3300025938 Ga0207704_10133644 Ga0207704_101336442 94
107 3300025940 Ga0207691_10243693 Ga0207691_102436932 94
108 3300025941 Ga0207711_10011049 Ga0207711_100110495 94
109 3300025942 Ga0207689_10001526 Ga0207689_100015266 94
110 3300025960 Ga0207651_10463936 Ga0207651_104639361 94
111 3300026023 Ga0207677_10342155 Ga0207677_103421551 94
112 3300026035 Ga0207703_10126110 Ga0207703_101261102 94
113 3300026035 Ga0207703_10885194 Ga0207703_108851942 94
114 3300026075 Ga0207708_10547994 Ga0207708_105479942 94
115 3300026088 Ga0207641_10016613 Ga0207641_100166136 94
116 3300026089 Ga0207648_10172810 Ga0207648_101728103 94
117 3300026095 Ga0207676_10203796 Ga0207676_102037961 94
118 3300026116 Ga0207674_10046269 Ga0207674_100462695 94
119 3300028379 Ga0268266_10089699 Ga0268266_100896992 94
120 3300028380 Ga0268265_10315103 Ga0268265_103151031 94
121 3300028381 Ga0268264_10100331 Ga0268264_101003312 94
122 3300048903 Ga0496100_1641832 Ga0496100_1641832_51_356 94
123 3300048917 Ga0496114_0983420 Ga0496114_0983420_244_549 94
124 3300005338 Ga0068868_100033436 Ga0068868_1000334364 95
125 3300005339 Ga0070660_100993807 Ga0070660_1009938071 95
126 3300005353 Ga0070669_100551466 Ga0070669_1005514662 95
127 3300005543 Ga0070672_100517947 Ga0070672_1005179472 95
128 3300005548 Ga0070665_100141520 Ga0070665_1001415204 95
129 3300005578 Ga0068854_100186830 Ga0068854_1001868301 95
130 3300005718 Ga0068866_10599164 Ga0068866_105991642 95
131 3300006186 Ga0075369_10241995 Ga0075369_102419952 95
132 3300009094 Ga0111539_11656127 Ga0111539_116561272 95
133 3300009148 Ga0105243_10415469 Ga0105243_104154692 95
134 3300009177 Ga0105248_11462106 Ga0105248_114621062 95
135 3300009545 Ga0105237_12444881 Ga0105237_124448811 95
136 3300011119 Ga0105246_10232409 Ga0105246_102324092 95
137 3300013296 Ga0157374_10689354 Ga0157374_106893542 95
138 3300014968 Ga0157379_11392672 Ga0157379_113926721 95
139 3300017792 Ga0163161_10993002 Ga0163161_109930021 95
140 3300025899 Ga0207642_10387481 Ga0207642_103874812 95
141 3300025914 Ga0207671_10223696 Ga0207671_102236961 95
142 3300025935 Ga0207709_10268559 Ga0207709_102685592 95
143 3300025937 Ga0207669_10282967 Ga0207669_102829672 95
144 3300025940 Ga0207691_11031965 Ga0207691_110319651 95
145 3300025981 Ga0207640_10464832 Ga0207640_104648322 95
146 3300026023 Ga0207677_10558464 Ga0207677_105584642 95
147 3300026067 Ga0207678_10499661 Ga0207678_104996612 95
148 3300026121 Ga0207683_10219502 Ga0207683_102195024 95
149 3300028379 Ga0268266_10229893 Ga0268266_102298932 95
150 3300041509 Ga0451843_1449225 Ga0451843_1449225_85_390 95
151 3300048911 Ga0496108_0972540 Ga0496108_0972540_24_344 95
152 3300050511 nmdc:mga08y16_1922955_c1 nmdc:mga08y16_1922955_c1_71_391 95
153 3300053090 Ga0500646_0057574 Ga0500646_0057574_156_461 95
154 3300053134 Ga0500658_0085132 Ga0500658_0085132_563_868 95
155 3300053139 Ga0500568_0054943 Ga0500568_0054943_848_1153 95
156 3300053151 Ga0500604_0000078 Ga0500604_0000078_27956_28261 95
157 3300053153 Ga0500616_0000128 Ga0500616_0000128_52085_52390 95
158 3300005339 Ga0070660_100280239 Ga0070660_1002802392 96
159 3300005455 Ga0070663_100739738 Ga0070663_1007397382 96
160 3300005543 Ga0070672_100840461 Ga0070672_1008404612 96
161 3300005563 Ga0068855_101139151 Ga0068855_1011391512 96
162 3300005564 Ga0070664_100885042 Ga0070664_1008850421 96
163 3300005577 Ga0068857_100283951 Ga0068857_1002839512 96
164 3300005614 Ga0068856_100493966 Ga0068856_1004939662 96
165 3300005719 Ga0068861_101818528 Ga0068861_1018185282 96
166 3300005842 Ga0068858_100232044 Ga0068858_1002320442 96
167 3300005844 Ga0068862_100908855 Ga0068862_1009088551 96
168 3300009148 Ga0105243_12583641 Ga0105243_125836411 96
169 3300009174 Ga0105241_10858168 Ga0105241_108581681 96
170 3300009551 Ga0105238_12922857 Ga0105238_129228571 96
171 3300010375 Ga0105239_10888913 Ga0105239_108889132 96
172 3300012508 Ga0157315_1014802 Ga0157315_10148023 96
173 3300013306 Ga0163162_10535822 Ga0163162_105358221 96
174 3300013306 Ga0163162_12008312 Ga0163162_120083122 96
175 3300014745 Ga0157377_11040988 Ga0157377_110409881 96
176 3300025901 Ga0207688_10365452 Ga0207688_103654522 96
177 3300025907 Ga0207645_11055013 Ga0207645_110550131 96
178 3300025911 Ga0207654_10518309 Ga0207654_105183091 96
179 3300025919 Ga0207657_10143253 Ga0207657_101432532 96
180 3300025940 Ga0207691_10768822 Ga0207691_107688221 96
181 3300025942 Ga0207689_10083875 Ga0207689_100838752 96
182 3300025945 Ga0207679_10892961 Ga0207679_108929612 96
183 3300026023 Ga0207677_10474765 Ga0207677_104747652 96
184 3300026035 Ga0207703_10205131 Ga0207703_102051313 96
185 3300026067 Ga0207678_11414077 Ga0207678_114140771 96
186 3300026078 Ga0207702_10452537 Ga0207702_104525372 96
187 3300026116 Ga0207674_11214591 Ga0207674_112145911 96
188 3300028380 Ga0268265_10775702 Ga0268265_107757021 96
189 3300031247 Ga0265340_10279657 Ga0265340_102796572 96
190 3300031456 Ga0307513_10726348 Ga0307513_107263482 96
191 3300039438 Ga0436360_0391140 Ga0436360_0391140_516_824 96
192 3300046460 Ga0495638_0001797 Ga0495638_0001797_3659_3967 96
193 3300046474 Ga0495605_0052559 Ga0495605_0052559_313_621 96
194 3300046501 Ga0495607_0135161 Ga0495607_0135161_292_600 96
195 3300046518 Ga0495631_0010437 Ga0495631_0010437_2986_3294 96
196 3300046538 Ga0495609_0113417 Ga0495609_0113417_489_797 96
197 3300046648 Ga0495611_0022876 Ga0495611_0022876_2086_2394 96
198 3300046660 Ga0495625_0066431 Ga0495625_0066431_1648_1956 96
199 3300047320 Ga0495672_0049991 Ga0495672_0049991_621_929 96
200 3300048905 Ga0496102_0395388 Ga0496102_0395388_737_1057 96
201 3300048909 Ga0496106_0221607 Ga0496106_0221607_30_350 96
202 3300048912 Ga0496109_1074102 Ga0496109_1074102_145_465 96
203 3300048913 Ga0496110_1164866 Ga0496110_1164866_73_393 96
204 3300048916 Ga0496113_0244565 Ga0496113_0244565_976_1296 96
205 3300048927 Ga0496124_0000206 Ga0496124_0000206_85202_85510 96
206 3300049571 Ga0501034_0039568 Ga0501034_0039568_3411_3719 96
207 3300049823 Ga0501044_0116851 Ga0501044_0116851_1005_1313 96
208 3300050510 nmdc:mga06r32_1364471_c1 nmdc:mga06r32_1364471_c1_123_431 96
209 3300053139 Ga0500568_0041414 Ga0500568_0041414_1141_1449 96
210 3300053153 Ga0500616_0006548 Ga0500616_0006548_1424_1732 96
211 3300053730 Ga0500645_062236 Ga0500645_062236_506_814 96
212 3300059513 Ga0587094_077547 Ga0587094_077547_136_444 96
213 iso_pu_bacteria 2547132512 2548846986 97
214 iso_pu_bacteria 2734482258 2735817355 97
215 iso_pu_bacteria 2834641062 2834641715 97
216 iso_pu_bacteria 2858688981 2858692757 97
217 iso_pu_bacteria 2891633521 2891634785 97
218 iso_pu_bacteria 8003400568 8003402802 97
219 3300035086 Ga0373934_0001684 Ga0373934_0001684_3669_3965 98
220 3300035119 Ga0373956_0000615 Ga0373956_0000615_9010_9306 98
221 3300035120 Ga0373957_0060102 Ga0373957_0060102_543_839 98
222 3300035724 Ga0373933_0001188 Ga0373933_0001188_10874_11170 98
223 3300036401 Ga0373937_0037625 Ga0373937_0037625_3272_3568 98
224 3300046462 Ga0495651_0002995 Ga0495651_0002995_758_1054 98
225 3300046511 Ga0495608_0202845 Ga0495608_0202845_722_1018 98
226 3300046675 Ga0495657_0342810 Ga0495657_0342810_145_441 98
227 3300047322 Ga0495680_0360085 Ga0495680_0360085_169_465 98
228 iso_pu_bacteria 2738541297 2738829397 98
229 iso_pu_bacteria 2738541357 2739153193 98
230 iso_pu_bacteria 2738543003 2739195113 98
231 iso_pu_bacteria 2738543026 2739321589 98
232 iso_pu_bacteria 2738543029 2739339855 98
233 iso_pu_bacteria 2821131069 2821131420 98
234 iso_pu_bacteria 2857564685 2857564911 98
235 iso_pu_bacteria 2596583598 2597030029 99
236 iso_pu_bacteria 2599185178 2599443886 99
237 iso_pu_bacteria 2885266251 2885267230 99
238 iso_pu_bacteria 2900577576 2900582615 99
239 iso_pu_bacteria 2928058823 2928062167 99
240 3300042876 Ga0451577_0491026 Ga0451577_0491026_467_769 100
241 3300003771 Ga0055526_1021364 Ga0055526_10213642 101
242 3300003773 Ga0055537_1007379 Ga0055537_10073792 101
243 3300003773 Ga0055537_1039771 Ga0055537_10397712 101
244 3300003775 Ga0055524_1006928 Ga0055524_10069283 101
245 3300003775 Ga0055524_1036225 Ga0055524_10362252 101
246 3300003781 Ga0055536_1000020 Ga0055536_100002026 101
247 3300005290 Ga0065712_10016198 Ga0065712_100161982 101
248 3300005290 Ga0065712_10681683 Ga0065712_106816831 101
249 3300005328 Ga0070676_11272613 Ga0070676_112726131 101
250 3300005335 Ga0070666_10960526 Ga0070666_109605261 101
251 3300005337 Ga0070682_100301124 Ga0070682_1003011242 101
252 3300005339 Ga0070660_100475699 Ga0070660_1004756992 101
253 3300005339 Ga0070660_100849106 Ga0070660_1008491061 101
254 3300005340 Ga0070689_101465307 Ga0070689_1014653072 101
255 3300005341 Ga0070691_10801496 Ga0070691_108014961 101
256 3300005343 Ga0070687_100724582 Ga0070687_1007245822 101
257 3300005345 Ga0070692_10724106 Ga0070692_107241062 101
258 3300005356 Ga0070674_100042844 Ga0070674_1000428444 101
259 3300005366 Ga0070659_100048222 Ga0070659_1000482222 101
260 3300005435 Ga0070714_100076400 Ga0070714_1000764002 101
261 3300005438 Ga0070701_10004017 Ga0070701_100040176 101
262 3300005441 Ga0070700_100531126 Ga0070700_1005311262 101
263 3300005441 Ga0070700_100546590 Ga0070700_1005465902 101
264 3300005441 Ga0070700_100665547 Ga0070700_1006655472 101
265 3300005441 Ga0070700_100676725 Ga0070700_1006767252 101
266 3300005441 Ga0070700_102008294 Ga0070700_1020082942 101
267 3300005445 Ga0070708_100497048 Ga0070708_1004970482 101
268 3300005455 Ga0070663_100314264 Ga0070663_1003142642 101
269 3300005455 Ga0070663_101472627 Ga0070663_1014726271 101
270 3300005456 Ga0070678_101474070 Ga0070678_1014740702 101
271 3300005457 Ga0070662_101147189 Ga0070662_1011471891 101
272 3300005467 Ga0070706_100789299 Ga0070706_1007892991 101
273 3300005468 Ga0070707_100328584 Ga0070707_1003285842 101
274 3300005471 Ga0070698_100359923 Ga0070698_1003599232 101
275 3300005518 Ga0070699_100260664 Ga0070699_1002606642 101
276 3300005518 Ga0070699_101377901 Ga0070699_1013779011 101
277 3300005530 Ga0070679_100269815 Ga0070679_1002698152 101
278 3300005536 Ga0070697_100061456 Ga0070697_1000614562 101
279 3300005536 Ga0070697_101024946 Ga0070697_1010249462 101
280 3300005539 Ga0068853_102198533 Ga0068853_1021985332 101
281 3300005546 Ga0070696_100111400 Ga0070696_1001114002 101
282 3300005546 Ga0070696_100602539 Ga0070696_1006025392 101
283 3300005547 Ga0070693_100176433 Ga0070693_1001764332 101
284 3300005547 Ga0070693_100352397 Ga0070693_1003523972 101
285 3300005548 Ga0070665_100047359 Ga0070665_1000473592 101
286 3300005548 Ga0070665_100837909 Ga0070665_1008379092 101
287 3300005549 Ga0070704_100091278 Ga0070704_1000912783 101
288 3300005549 Ga0070704_100317132 Ga0070704_1003171322 101
289 3300005563 Ga0068855_101470981 Ga0068855_1014709811 101
290 3300005563 Ga0068855_102374986 Ga0068855_1023749861 101
291 3300005563 Ga0068855_102589198 Ga0068855_1025891981 101
292 3300005577 Ga0068857_101275969 Ga0068857_1012759692 101
293 3300005615 Ga0070702_100594089 Ga0070702_1005940892 101
294 3300005615 Ga0070702_100709355 Ga0070702_1007093552 101
295 3300005617 Ga0068859_100324427 Ga0068859_1003244272 101
296 3300005617 Ga0068859_102584413 Ga0068859_1025844132 101
297 3300005843 Ga0068860_100797402 Ga0068860_1007974022 101
298 3300006175 Ga0070712_100082642 Ga0070712_1000826422 101
299 3300006178 Ga0075367_10314208 Ga0075367_103142082 101
300 3300006178 Ga0075367_10533413 Ga0075367_105334132 101
301 3300006195 Ga0075366_10045156 Ga0075366_100451562 101
302 3300006195 Ga0075366_10213676 Ga0075366_102136762 101
303 3300006195 Ga0075366_10242038 Ga0075366_102420382 101
304 3300006237 Ga0097621_100307001 Ga0097621_1003070012 101
305 3300006353 Ga0075370_10814016 Ga0075370_108140162 101
306 3300006914 Ga0075436_100030807 Ga0075436_1000308073 101
307 3300006931 Ga0097620_100324423 Ga0097620_1003244232 101
308 3300006931 Ga0097620_102584873 Ga0097620_1025848732 101
309 3300006948 Ga0099826_10000004 Ga0099826_10000004577 101
310 3300007076 Ga0075435_100298910 Ga0075435_1002989103 101
311 3300009011 Ga0105251_10061983 Ga0105251_100619833 101
312 3300009036 Ga0105244_10359606 Ga0105244_103596062 101
313 3300009093 Ga0105240_10155943 Ga0105240_101559434 101
314 3300009093 Ga0105240_10349152 Ga0105240_103491522 101
315 3300009094 Ga0111539_10103738 Ga0111539_101037383 101
316 3300009094 Ga0111539_11391977 Ga0111539_113919771 101
317 3300009098 Ga0105245_10892882 Ga0105245_108928822 101
318 3300009098 Ga0105245_11622096 Ga0105245_116220962 101
319 3300009098 Ga0105245_11850084 Ga0105245_118500842 101
320 3300009148 Ga0105243_10270576 Ga0105243_102705763 101
321 3300009148 Ga0105243_11937726 Ga0105243_119377261 101
322 3300009174 Ga0105241_10392849 Ga0105241_103928492 101
323 3300009176 Ga0105242_13266868 Ga0105242_132668681 101
324 3300009177 Ga0105248_10448199 Ga0105248_104481993 101
325 3300009545 Ga0105237_10499583 Ga0105237_104995832 101
326 3300009551 Ga0105238_10178772 Ga0105238_101787722 101
327 3300013100 Ga0157373_10357414 Ga0157373_103574142 101
328 3300013100 Ga0157373_10683726 Ga0157373_106837262 101
329 3300013102 Ga0157371_10746937 Ga0157371_107469372 101
330 3300013104 Ga0157370_10007010 Ga0157370_100070107 101
331 3300013296 Ga0157374_10675090 Ga0157374_106750902 101
332 3300013297 Ga0157378_10088875 Ga0157378_100888752 101
333 3300013297 Ga0157378_10121654 Ga0157378_101216542 101
334 3300013297 Ga0157378_10178140 Ga0157378_101781402 101
335 3300013308 Ga0157375_10089299 Ga0157375_100892992 101
336 3300014326 Ga0157380_10239314 Ga0157380_102393142 101
337 3300014326 Ga0157380_10747471 Ga0157380_107474712 101
338 3300014745 Ga0157377_11576684 Ga0157377_115766841 101
339 3300014969 Ga0157376_10065502 Ga0157376_100655022 101
340 3300014969 Ga0157376_11535964 Ga0157376_115359642 101
341 3300017792 Ga0163161_11168939 Ga0163161_111689391 101
342 3300020069 Ga0197907_10464694 Ga0197907_104646942 101
343 3300020070 Ga0206356_10209806 Ga0206356_102098062 101
344 3300020081 Ga0206354_10128724 Ga0206354_101287241 101
345 3300020082 Ga0206353_11396399 Ga0206353_113963992 101
346 3300020610 Ga0154015_1429522 Ga0154015_14295222 101
347 3300022467 Ga0224712_10000145 Ga0224712_100001453 101
348 3300025263 Ga0209565_1000103 Ga0209565_100010337 101
349 3300025263 Ga0209565_1009258 Ga0209565_10092582 101
350 3300025273 Ga0209673_1030242 Ga0209673_10302423 101
351 3300025291 Ga0209675_1001091 Ga0209675_100109112 101
352 3300025291 Ga0209675_1001094 Ga0209675_100109412 101
353 3300025292 Ga0209676_1000066 Ga0209676_100006641 101
354 3300025294 Ga0209025_1001357 Ga0209025_100135727 101
355 3300025294 Ga0209025_1002856 Ga0209025_100285616 101
356 3300025294 Ga0209025_1033381 Ga0209025_10333811 101
357 3300025295 Ga0209564_1002778 Ga0209564_100277812 101
358 3300025297 Ga0209758_1012665 Ga0209758_10126655 101
359 3300025298 Ga0209050_1083757 Ga0209050_10837572 101
360 3300025299 Ga0209256_1001633 Ga0209256_100163313 101
361 3300025299 Ga0209256_1003124 Ga0209256_100312410 101
362 3300025911 Ga0207654_10134864 Ga0207654_101348643 101
363 3300025913 Ga0207695_10386349 Ga0207695_103863491 101
364 3300025914 Ga0207671_10372449 Ga0207671_103724492 101
365 3300025915 Ga0207693_10146345 Ga0207693_101463452 101
366 3300025919 Ga0207657_10166266 Ga0207657_101662662 101
367 3300025921 Ga0207652_10307136 Ga0207652_103071362 101
368 3300025921 Ga0207652_10550916 Ga0207652_105509162 101
369 3300025922 Ga0207646_10141462 Ga0207646_101414622 101
370 3300025924 Ga0207694_11210418 Ga0207694_112104182 101
371 3300025924 Ga0207694_11589237 Ga0207694_115892372 101
372 3300025931 Ga0207644_10753183 Ga0207644_107531832 101
373 3300025932 Ga0207690_10036383 Ga0207690_100363834 101
374 3300025936 Ga0207670_10150638 Ga0207670_101506382 101
375 3300025937 Ga0207669_11328296 Ga0207669_113282961 101
376 3300025981 Ga0207640_10148107 Ga0207640_101481073 101
377 3300026023 Ga0207677_10029824 Ga0207677_100298243 101
378 3300026067 Ga0207678_10318762 Ga0207678_103187622 101
379 3300026075 Ga0207708_10273384 Ga0207708_102733842 101
380 3300026075 Ga0207708_11431851 Ga0207708_114318512 101
381 3300026088 Ga0207641_10221425 Ga0207641_102214252 101
382 3300026089 Ga0207648_11799275 Ga0207648_117992752 101
383 3300026118 Ga0207675_100370235 Ga0207675_1003702352 101
384 3300027424 Ga0209984_1029863 Ga0209984_10298632 101
385 3300027666 Ga0209282_1000015 Ga0209282_100001583 101
386 3300027682 Ga0209971_1016062 Ga0209971_10160622 101
387 3300027907 Ga0207428_10155634 Ga0207428_101556342 101
388 3300028379 Ga0268266_10129900 Ga0268266_101299002 101
389 3300028381 Ga0268264_10760381 Ga0268264_107603812 101
390 3300031239 Ga0265328_10000001 Ga0265328_1000000198 101
391 3300031250 Ga0265331_10059937 Ga0265331_100599372 101
392 3300031251 Ga0265327_10016776 Ga0265327_100167763 101
393 3300031507 Ga0307509_10000006 Ga0307509_10000006319 101
394 3300031548 Ga0307408_100337892 Ga0307408_1003378923 101
395 3300031548 Ga0307408_100503811 Ga0307408_1005038112 101
396 3300031665 Ga0316575_10313381 Ga0316575_103133811 101
397 3300031691 Ga0316579_10021079 Ga0316579_100210794 101
398 3300031691 Ga0316579_10433272 Ga0316579_104332722 101
399 3300031727 Ga0316576_10132191 Ga0316576_101321912 101
400 3300031728 Ga0316578_10003673 Ga0316578_100036735 101
401 3300031728 Ga0316578_10460919 Ga0316578_104609192 101
402 3300031730 Ga0307516_10935563 Ga0307516_109355632 101
403 3300031731 Ga0307405_11697123 Ga0307405_116971232 101
404 3300031733 Ga0316577_10003197 Ga0316577_100031975 101
405 3300031733 Ga0316577_10066378 Ga0316577_100663782 101
406 3300031852 Ga0307410_10390469 Ga0307410_103904692 101
407 3300031852 Ga0307410_10497892 Ga0307410_104978922 101
408 3300031901 Ga0307406_11649236 Ga0307406_116492362 101
409 3300031911 Ga0307412_10554742 Ga0307412_105547422 101
410 3300031911 Ga0307412_10823855 Ga0307412_108238552 101
411 3300032002 Ga0307416_100073914 Ga0307416_1000739142 101
412 3300032002 Ga0307416_100412554 Ga0307416_1004125542 101
413 3300032002 Ga0307416_100961210 Ga0307416_1009612102 101
414 3300032005 Ga0307411_10247111 Ga0307411_102471112 101
415 3300032005 Ga0307411_10283443 Ga0307411_102834432 101
416 3300032005 Ga0307411_11525860 Ga0307411_115258601 101
417 3300032133 Ga0316583_10094013 Ga0316583_100940132 101
418 3300032137 Ga0316585_10064679 Ga0316585_100646792 101
419 3300032139 Ga0316580_10001189 Ga0316580_100011892 101
420 3300032168 Ga0316593_10000841 Ga0316593_100008415 101
421 3300032168 Ga0316593_10014809 Ga0316593_100148091 101
422 3300032168 Ga0316593_10113944 Ga0316593_101139441 101
423 3300033541 Ga0316596_1002972 Ga0316596_10029724 101
424 3300033541 Ga0316596_1147587 Ga0316596_11475872 101
425 3300035092 Ga0373952_0054415 Ga0373952_0054415_257_562 101
426 3300035171 Ga0373946_0198923 Ga0373946_0198923_472_777 101
427 3300035241 Ga0373961_0262207 Ga0373961_0262207_272_577 101
428 3300035398 Ga0316574_0007145 Ga0316574_0007145_1468_1773 101
429 3300035691 Ga0373931_0571738 Ga0373931_0571738_285_590 101
430 3300035691 Ga0373931_0941184 Ga0373931_0941184_123_428 101
431 3300035695 Ga0373927_0611853 Ga0373927_0611853_54_359 101
432 3300036647 Ga0316582_0048337 Ga0316582_0048337_1195_1500 101
433 3300036712 Ga0316584_0009967 Ga0316584_0009967_5016_5321 101
434 3300036712 Ga0316584_0030340 Ga0316584_0030340_691_996 101
435 3300037068 Ga0373925_1237187 Ga0373925_1237187_227_532 101
436 3300041443 Ga0451789_0341123 Ga0451789_0341123_176_481 101
437 3300041498 Ga0451841_0113566 Ga0451841_0113566_41_346 101
438 3300042876 Ga0451577_0120151 Ga0451577_0120151_1355_1660 101
439 3300044712 Ga0453684_0002102 Ga0453684_0002102_10914_11219 101
440 3300044712 Ga0453684_0560017 Ga0453684_0560017_858_1163 101
441 3300044712 Ga0453684_0598549 Ga0453684_0598549_857_1162 101
442 3300045051 Ga0451576_0002470 Ga0451576_0002470_27129_27434 101
443 3300046458 Ga0495591_163069 Ga0495591_163069_70_375 101
444 3300046474 Ga0495605_0033114 Ga0495605_0033114_606_911 101
445 3300046491 Ga0495584_0053684 Ga0495584_0053684_1039_1344 101
446 3300046500 Ga0495596_0018384 Ga0495596_0018384_835_1140 101
447 3300046501 Ga0495607_0064557 Ga0495607_0064557_1130_1435 101
448 3300046512 Ga0495610_0025039 Ga0495610_0025039_840_1145 101
449 3300046513 Ga0495616_0028541 Ga0495616_0028541_1757_2062 101
450 3300046522 Ga0495643_0490299 Ga0495643_0490299_189_494 101
451 3300046523 Ga0495644_0230437 Ga0495644_0230437_361_666 101
452 3300046525 Ga0495663_0387010 Ga0495663_0387010_158_463 101
453 3300046537 Ga0495598_0299586 Ga0495598_0299586_225_530 101
454 3300046538 Ga0495609_0024107 Ga0495609_0024107_1642_1947 101
455 3300046542 Ga0495597_0156006 Ga0495597_0156006_533_838 101
456 3300046665 Ga0495661_0151493 Ga0495661_0151493_693_998 101
457 3300046674 Ga0495588_0264213 Ga0495588_0264213_145_450 101
458 3300046692 Ga0495671_0028011 Ga0495671_0028011_1732_2037 101
459 3300046694 Ga0495649_0044015 Ga0495649_0044015_1291_1596 101
460 3300047317 Ga0495604_0407987 Ga0495604_0407987_212_517 101
461 3300047320 Ga0495672_0051319 Ga0495672_0051319_872_1177 101
462 3300047673 Ga0495593_0685051 Ga0495593_0685051_13_318 101
463 3300048903 Ga0496100_0156446 Ga0496100_0156446_798_1103 101
464 3300048904 Ga0496101_0065600 Ga0496101_0065600_907_1212 101
465 3300048904 Ga0496101_0108425 Ga0496101_0108425_1219_1524 101
466 3300048907 Ga0496104_0151061 Ga0496104_0151061_372_677 101
467 3300048908 Ga0496105_0303414 Ga0496105_0303414_903_1208 101
468 3300048916 Ga0496113_0213023 Ga0496113_0213023_684_989 101
469 3300048917 Ga0496114_0013659 Ga0496114_0013659_3768_4073 101
470 3300048917 Ga0496114_0332435 Ga0496114_0332435_166_471 101
471 3300048918 Ga0496115_0296072 Ga0496115_0296072_267_572 101
472 3300048919 Ga0496116_0048325 Ga0496116_0048325_1726_2031 101
473 3300048924 Ga0496121_0109730 Ga0496121_0109730_133_438 101
474 3300048925 Ga0496122_0058111 Ga0496122_0058111_950_1255 101
475 3300048926 Ga0496123_0071897 Ga0496123_0071897_1187_1492 101
476 3300048928 Ga0496125_0150802 Ga0496125_0150802_833_1138 101
477 3300048929 Ga0496126_0236833 Ga0496126_0236833_1047_1352 101
478 3300049518 Ga0501295_160906 Ga0501295_160906_15_320 101
479 3300049568 Ga0501031_0004430 Ga0501031_0004430_2859_3164 101
480 3300049568 Ga0501031_0110195 Ga0501031_0110195_1091_1396 101
481 3300049568 Ga0501031_0615755 Ga0501031_0615755_251_556 101
482 3300049569 Ga0501032_0001741 Ga0501032_0001741_14561_14866 101
483 3300049569 Ga0501032_0015048 Ga0501032_0015048_1174_1479 101
484 3300049569 Ga0501032_0318473 Ga0501032_0318473_62_367 101
485 3300049570 Ga0501033_0000364 Ga0501033_0000364_14361_14666 101
486 3300049570 Ga0501033_0005262 Ga0501033_0005262_2541_2846 101
487 3300049570 Ga0501033_0006818 Ga0501033_0006818_2697_3002 101
488 3300049571 Ga0501034_0019811 Ga0501034_0019811_3936_4241 101
489 3300049571 Ga0501034_0222923 Ga0501034_0222923_1043_1348 101
490 3300049572 Ga0501036_0208777 Ga0501036_0208777_595_915 101
491 3300049572 Ga0501036_0270537 Ga0501036_0270537_1001_1306 101
492 3300049572 Ga0501036_0903900 Ga0501036_0903900_402_707 101
493 3300049573 Ga0501037_0000162 Ga0501037_0000162_47765_48070 101
494 3300049574 Ga0501038_0008423 Ga0501038_0008423_57_362 101
495 3300049574 Ga0501038_0011277 Ga0501038_0011277_4387_4692 101
496 3300049575 Ga0501039_0008915 Ga0501039_0008915_5242_5547 101
497 3300049576 Ga0501040_0023959 Ga0501040_0023959_1922_2227 101
498 3300049578 Ga0501042_0000536 Ga0501042_0000536_11809_12114 101
499 3300049579 Ga0501043_0003874 Ga0501043_0003874_8357_8662 101
500 3300049579 Ga0501043_0015184 Ga0501043_0015184_1451_1756 101
501 3300049579 Ga0501043_0021892 Ga0501043_0021892_563_868 101
502 3300049579 Ga0501043_0228914 Ga0501043_0228914_371_676 101
503 3300049580 Ga0501046_0006470 Ga0501046_0006470_2155_2460 101
504 3300049580 Ga0501046_0036301 Ga0501046_0036301_353_658 101
505 3300049581 Ga0501047_0034699 Ga0501047_0034699_2095_2400 101
506 3300049581 Ga0501047_0399516 Ga0501047_0399516_790_1095 101
507 3300049583 Ga0501067_0132629 Ga0501067_0132629_287_592 101
508 3300049584 Ga0501068_0039781 Ga0501068_0039781_948_1253 101
509 3300049586 Ga0501070_0024315 Ga0501070_0024315_4684_4989 101
510 3300049586 Ga0501070_0155438 Ga0501070_0155438_185_490 101
511 3300049587 Ga0501071_1151839 Ga0501071_1151839_145_450 101
512 3300049592 Ga0501076_0229878 Ga0501076_0229878_446_751 101
513 3300049592 Ga0501076_0819307 Ga0501076_0819307_155_460 101
514 3300049744 Ga0501083_0136365 Ga0501083_0136365_372_677 101
515 3300049766 Ga0501269_036219 Ga0501269_036219_151_456 101
516 3300049822 Ga0501035_0005055 Ga0501035_0005055_5584_5889 101
517 3300049822 Ga0501035_0131593 Ga0501035_0131593_613_918 101
518 3300049822 Ga0501035_0443245 Ga0501035_0443245_301_621 101
519 3300049822 Ga0501035_1437982 Ga0501035_1437982_137_442 101
520 3300049823 Ga0501044_0001481 Ga0501044_0001481_9567_9872 101
521 3300049823 Ga0501044_0003222 Ga0501044_0003222_9723_10028 101
522 3300049823 Ga0501044_0018325 Ga0501044_0018325_4940_5245 101
523 3300049823 Ga0501044_0024640 Ga0501044_0024640_4682_4987 101
524 3300049823 Ga0501044_0059334 Ga0501044_0059334_3351_3671 101
525 3300049823 Ga0501044_0457246 Ga0501044_0457246_712_1017 101
526 3300049823 Ga0501044_0548151 Ga0501044_0548151_492_797 101
527 3300049824 Ga0501045_0014729 Ga0501045_0014729_1507_1812 101
528 3300050493 nmdc:mga0k408_115321_c1 nmdc:mga0k408_115321_c1_1150_1455 101
529 3300050493 nmdc:mga0k408_17631_c1 nmdc:mga0k408_17631_c1_1456_1761 101
530 3300050493 nmdc:mga0k408_563343_c1 nmdc:mga0k408_563343_c1_10_315 101
531 3300050494 nmdc:mga06z11_259474_c1 nmdc:mga06z11_259474_c1_421_726 101
532 3300050511 nmdc:mga08y16_1374483_c1 nmdc:mga08y16_1374483_c1_177_482 101
533 3300050511 nmdc:mga08y16_299492_c1 nmdc:mga08y16_299492_c1_528_833 101
534 3300050513 nmdc:mga0rr50_131794_c1 nmdc:mga0rr50_131794_c1_170_475 101
535 3300050514 nmdc:mga08x19_745_c1 nmdc:mga08x19_745_c1_15598_15903 101
536 3300053156 Ga0500622_0000002 Ga0500622_0000002_572153_572458 101
537 3300059424 Ga0590075_150228 Ga0590075_150228_159_464 101
538 3300003792 Ga0055540_1037782 Ga0055540_10377822 102
539 3300005330 Ga0070690_101517588 Ga0070690_1015175881 102
540 3300005343 Ga0070687_100512500 Ga0070687_1005125002 102
541 3300005347 Ga0070668_100177100 Ga0070668_1001771002 102
542 3300005347 Ga0070668_100709277 Ga0070668_1007092771 102
543 3300005354 Ga0070675_102130979 Ga0070675_1021309791 102
544 3300005355 Ga0070671_101104056 Ga0070671_1011040562 102
545 3300005366 Ga0070659_101850324 Ga0070659_1018503242 102
546 3300005366 Ga0070659_102144090 Ga0070659_1021440901 102
547 3300005367 Ga0070667_100161863 Ga0070667_1001618632 102
548 3300005367 Ga0070667_100728202 Ga0070667_1007282021 102
549 3300005455 Ga0070663_100572439 Ga0070663_1005724392 102
550 3300005539 Ga0068853_100309228 Ga0068853_1003092282 102
551 3300005539 Ga0068853_100371845 Ga0068853_1003718452 102
552 3300005544 Ga0070686_100078123 Ga0070686_1000781232 102
553 3300005547 Ga0070693_101422821 Ga0070693_1014228212 102
554 3300005564 Ga0070664_101093534 Ga0070664_1010935342 102
555 3300005614 Ga0068856_100433455 Ga0068856_1004334553 102
556 3300005616 Ga0068852_101219035 Ga0068852_1012190352 102
557 3300005617 Ga0068859_100424122 Ga0068859_1004241222 102
558 3300005719 Ga0068861_102539056 Ga0068861_1025390561 102
559 3300005840 Ga0068870_10321309 Ga0068870_103213092 102
560 3300005842 Ga0068858_100138949 Ga0068858_1001389492 102
561 3300005842 Ga0068858_100146546 Ga0068858_1001465465 102
562 3300005843 Ga0068860_100108335 Ga0068860_1001083355 102
563 3300005843 Ga0068860_100627273 Ga0068860_1006272732 102
564 3300005843 Ga0068860_101301383 Ga0068860_1013013832 102
565 3300006195 Ga0075366_10439493 Ga0075366_104394932 102
566 3300006931 Ga0097620_100424081 Ga0097620_1004240812 102
567 3300009093 Ga0105240_10022527 Ga0105240_100225278 102
568 3300009098 Ga0105245_10009298 Ga0105245_100092986 102
569 3300009174 Ga0105241_10121297 Ga0105241_101212972 102
570 3300009174 Ga0105241_10457142 Ga0105241_104571422 102
571 3300009177 Ga0105248_10765760 Ga0105248_107657602 102
572 3300009545 Ga0105237_10000548 Ga0105237_1000054847 102
573 3300009545 Ga0105237_11370077 Ga0105237_113700771 102
574 3300009545 Ga0105237_12555269 Ga0105237_125552692 102
575 3300009551 Ga0105238_10002440 Ga0105238_1000244010 102
576 3300009551 Ga0105238_10346624 Ga0105238_103466242 102
577 3300009553 Ga0105249_12392275 Ga0105249_123922752 102
578 3300010375 Ga0105239_10004988 Ga0105239_100049886 102
579 3300013100 Ga0157373_10184308 Ga0157373_101843083 102
580 3300013297 Ga0157378_11296523 Ga0157378_112965232 102
581 3300013306 Ga0163162_10807802 Ga0163162_108078022 102
582 3300013307 Ga0157372_11361023 Ga0157372_113610232 102
583 3300014325 Ga0163163_12799133 Ga0163163_127991332 102
584 3300015262 Ga0182007_10139649 Ga0182007_101396492 102
585 3300017792 Ga0163161_10223739 Ga0163161_102237392 102
586 3300025231 Ga0207427_100380 Ga0207427_1003808 102
587 3300025303 Ga0209051_1007477 Ga0209051_10074772 102
588 3300025912 Ga0207707_10298049 Ga0207707_102980492 102
589 3300025914 Ga0207671_10017015 Ga0207671_100170156 102
590 3300025920 Ga0207649_10358884 Ga0207649_103588842 102
591 3300025921 Ga0207652_10103276 Ga0207652_101032761 102
592 3300025924 Ga0207694_10072877 Ga0207694_100728773 102
593 3300025924 Ga0207694_11006571 Ga0207694_110065712 102
594 3300025927 Ga0207687_10010408 Ga0207687_100104082 102
595 3300025931 Ga0207644_10688900 Ga0207644_106889002 102
596 3300025936 Ga0207670_10436496 Ga0207670_104364962 102
597 3300025961 Ga0207712_11835665 Ga0207712_118356652 102
598 3300025986 Ga0207658_10268024 Ga0207658_102680241 102
599 3300026035 Ga0207703_10176633 Ga0207703_101766332 102
600 3300026041 Ga0207639_10510382 Ga0207639_105103822 102
601 3300026142 Ga0207698_10932457 Ga0207698_109324572 102
602 3300028379 Ga0268266_10450789 Ga0268266_104507892 102
603 3300028381 Ga0268264_10065291 Ga0268264_100652915 102
604 3300028381 Ga0268264_11032797 Ga0268264_110327971 102
605 3300028577 Ga0265318_10001257 Ga0265318_100012574 102
606 3300028794 Ga0307515_10046228 Ga0307515_100462284 102
607 3300031240 Ga0265320_10099794 Ga0265320_100997942 102
608 3300031241 Ga0265325_10332937 Ga0265325_103329372 102
609 3300031344 Ga0265316_10522256 Ga0265316_105222562 102
610 3300031344 Ga0265316_10863014 Ga0265316_108630141 102
611 3300031548 Ga0307408_100096742 Ga0307408_1000967422 102
612 3300031548 Ga0307408_100182250 Ga0307408_1001822502 102
613 3300031548 Ga0307408_100371790 Ga0307408_1003717902 102
614 3300031595 Ga0265313_10000482 Ga0265313_1000048232 102
615 3300031595 Ga0265313_10016122 Ga0265313_100161224 102
616 3300031711 Ga0265314_10019786 Ga0265314_100197863 102
617 3300031712 Ga0265342_10306756 Ga0265342_103067562 102
618 3300031731 Ga0307405_10043771 Ga0307405_100437714 102
619 3300031901 Ga0307406_11089325 Ga0307406_110893252 102
620 3300031911 Ga0307412_10101112 Ga0307412_101011122 102
621 3300031911 Ga0307412_10575971 Ga0307412_105759712 102
622 3300031995 Ga0307409_100028119 Ga0307409_1000281192 102
623 3300031995 Ga0307409_100750979 Ga0307409_1007509792 102
624 3300031995 Ga0307409_101754937 Ga0307409_1017549371 102
625 3300032002 Ga0307416_100001678 Ga0307416_10000167811 102
626 3300032005 Ga0307411_10259147 Ga0307411_102591472 102
627 3300032005 Ga0307411_11808285 Ga0307411_118082852 102
628 3300032126 Ga0307415_100002191 Ga0307415_1000021914 102
629 3300032126 Ga0307415_102567512 Ga0307415_1025675121 102
630 3300035242 Ga0373962_0017274 Ga0373962_0017274_62_379 102
631 3300037418 Ga0395900_0278896 Ga0395900_0278896_510_839 102
632 3300037418 Ga0395900_0629401 Ga0395900_0629401_88_417 102
633 3300038443 Ga0395901_0011265 Ga0395901_0011265_748_1065 102
634 3300038443 Ga0395901_0739167 Ga0395901_0739167_477_806 102
635 3300041509 Ga0451843_0038411 Ga0451843_0038411_185_502 102
636 3300042011 Ga0439454_105206 Ga0439454_105206_40_357 102
637 3300042157 Ga0439458_0142971 Ga0439458_0142971_81_398 102
638 3300045051 Ga0451576_0082681 Ga0451576_0082681_2562_2879 102
639 3300048903 Ga0496100_0805931 Ga0496100_0805931_407_718 102
640 3300048904 Ga0496101_1033129 Ga0496101_1033129_65_376 102
641 3300048907 Ga0496104_1003720 Ga0496104_1003720_11_322 102
642 3300048911 Ga0496108_0641109 Ga0496108_0641109_43_354 102
643 3300048912 Ga0496109_0237498 Ga0496109_0237498_877_1188 102
644 3300048921 Ga0496118_0079995 Ga0496118_0079995_356_664 102
645 3300048924 Ga0496121_0161311 Ga0496121_0161311_833_1147 102
646 3300048927 Ga0496124_0001201 Ga0496124_0001201_22625_22939 102
647 3300048928 Ga0496125_0141105 Ga0496125_0141105_870_1184 102
648 3300049515 Ga0501292_005367 Ga0501292_005367_1258_1575 102
649 3300049517 Ga0501294_005096 Ga0501294_005096_211_528 102
650 3300049649 Ga0501198_000011 Ga0501198_000011_59706_60017 102
651 3300049654 Ga0501207_057861 Ga0501207_057861_294_611 102
652 3300049662 Ga0501222_000022 Ga0501222_000022_59896_60207 102
653 3300049662 Ga0501222_048286 Ga0501222_048286_164_481 102
654 3300049759 Ga0501262_012033 Ga0501262_012033_584_901 102
655 3300049777 Ga0501281_03705 Ga0501281_03705_216_533 102
656 3300050489 nmdc:mga03683_178041_c1 nmdc:mga03683_178041_c1_218_544 102
657 3300050496 nmdc:mga07m45_295151_c1 nmdc:mga07m45_295151_c1_83_391 102
658 3300059421 Ga0590071_001070 Ga0590071_001070_2183_2491 102
659 3300059503 Ga0587080_087219 Ga0587080_087219_99_416 102
660 3300059505 Ga0587083_0068047 Ga0587083_0068047_114_431 102
661 3300059643 Ga0587072_096855 Ga0587072_096855_208_525 102
662 3300001915 JGI24741J21665_1000152 JGI24741J21665_10001525 103
663 3300001979 JGI24740J21852_10000682 JGI24740J21852_100006823 103
664 3300001979 JGI24740J21852_10005259 JGI24740J21852_100052595 103
665 3300002705 JGI25156J39149_1005831 JGI25156J39149_10058312 103
666 3300002705 JGI25156J39149_1009597 JGI25156J39149_10095974 103
667 3300002738 JGI25154J39366_1001844 JGI25154J39366_10018443 103
668 3300002741 JGI25157J39369_1008788 JGI25157J39369_10087882 103
669 3300003479 Ga0006556J51387_1039703 Ga0006556J51387_10397032 103
670 3300003751 Ga0055538_1004147 Ga0055538_10041473 103
671 3300003751 Ga0055538_1007419 Ga0055538_10074192 103
672 3300003752 Ga0055539_1000095 Ga0055539_10000955 103
673 3300003752 Ga0055539_1027922 Ga0055539_10279222 103
674 3300003756 Ga0055533_1004171 Ga0055533_10041712 103
675 3300003756 Ga0055533_1011122 Ga0055533_10111222 103
676 3300003758 Ga0055532_1000058 Ga0055532_100005859 103
677 3300003759 Ga0055525_1000379 Ga0055525_100037924 103
678 3300003759 Ga0055525_1016883 Ga0055525_10168832 103
679 3300003760 Ga0055527_1001095 Ga0055527_10010954 103
680 3300003761 Ga0055535_1000041 Ga0055535_100004159 103
681 3300003762 Ga0055542_1002640 Ga0055542_10026403 103
682 3300003762 Ga0055542_1021709 Ga0055542_10217092 103
683 3300003763 Ga0055529_1000077 Ga0055529_1000077101 103
684 3300003841 Ga0055541_1000265 Ga0055541_100026513 103
685 3300003841 Ga0055541_1009075 Ga0055541_10090752 103
686 3300005344 Ga0070661_100000193 Ga0070661_10000019344 103
687 3300005347 Ga0070668_100991062 Ga0070668_1009910622 103
688 3300005356 Ga0070674_100772253 Ga0070674_1007722531 103
689 3300005366 Ga0070659_100001577 Ga0070659_10000157714 103
690 3300005367 Ga0070667_100012161 Ga0070667_1000121616 103
691 3300005455 Ga0070663_100000025 Ga0070663_10000002565 103
692 3300005455 Ga0070663_100552618 Ga0070663_1005526182 103
693 3300005564 Ga0070664_100000020 Ga0070664_10000002083 103
694 3300005578 Ga0068854_100000251 Ga0068854_1000002513 103
695 3300005614 Ga0068856_100000094 Ga0068856_10000009424 103
696 3300005616 Ga0068852_100104238 Ga0068852_1001042382 103
697 3300005617 Ga0068859_102320549 Ga0068859_1023205492 103
698 3300005843 Ga0068860_101383753 Ga0068860_1013837532 103
699 3300006195 Ga0075366_10166536 Ga0075366_101665362 103
700 3300006195 Ga0075366_10752613 Ga0075366_107526132 103
701 3300006353 Ga0075370_10009133 Ga0075370_100091334 103
702 3300006881 Ga0068865_100208989 Ga0068865_1002089893 103
703 3300006931 Ga0097620_102320710 Ga0097620_1023207102 103
704 3300009093 Ga0105240_10027802 Ga0105240_100278025 103
705 3300009174 Ga0105241_12183422 Ga0105241_121834221 103
706 3300012492 Ga0157335_1027327 Ga0157335_10273271 103
707 3300013100 Ga0157373_10015843 Ga0157373_100158432 103
708 3300013102 Ga0157371_10000082 Ga0157371_1000008244 103
709 3300013104 Ga0157370_10000423 Ga0157370_100004237 103
710 3300013105 Ga0157369_10040287 Ga0157369_100402872 103
711 3300013307 Ga0157372_10001447 Ga0157372_1000144722 103
712 3300014969 Ga0157376_11072771 Ga0157376_110727712 103
713 3300014969 Ga0157376_12149917 Ga0157376_121499171 103
714 3300015261 Ga0182006_1001223 Ga0182006_100122314 103
715 3300015261 Ga0182006_1084575 Ga0182006_10845752 103
716 3300015265 Ga0182005_1051097 Ga0182005_10510972 103
717 3300020077 Ga0206351_10301891 Ga0206351_103018912 103
718 3300020080 Ga0206350_11251963 Ga0206350_112519632 103
719 3300020610 Ga0154015_1262301 Ga0154015_126230130 103
720 3300025224 Ga0209784_100055 Ga0209784_10005597 103
721 3300025224 Ga0209784_100213 Ga0209784_10021329 103
722 3300025224 Ga0209784_100714 Ga0209784_1007142 103
723 3300025225 Ga0209566_100002 Ga0209566_1000022456 103
724 3300025225 Ga0209566_100386 Ga0209566_10038621 103
725 3300025225 Ga0209566_100695 Ga0209566_1006959 103
726 3300025226 Ga0209674_100090 Ga0209674_10009088 103
727 3300025226 Ga0209674_100213 Ga0209674_1002135 103
728 3300025228 Ga0209672_100126 Ga0209672_10012614 103
729 3300025228 Ga0209672_100690 Ga0209672_1006905 103
730 3300025229 Ga0209147_100002 Ga0209147_100002835 103
731 3300025230 Ga0209563_100095 Ga0209563_10009574 103
732 3300025230 Ga0209563_116947 Ga0209563_1169472 103
733 3300025242 Ga0209258_100002 Ga0209258_100002835 103
734 3300025246 Ga0209646_1000019 Ga0209646_1000019404 103
735 3300025250 Ga0209026_1004707 Ga0209026_10047072 103
736 3300025253 Ga0209677_100069 Ga0209677_10006955 103
737 3300025253 Ga0209677_102741 Ga0209677_1027412 103
738 3300025254 Ga0209148_1000330 Ga0209148_100033015 103
739 3300025254 Ga0209148_1001723 Ga0209148_10017238 103
740 3300025256 Ga0209759_1002810 Ga0209759_10028102 103
741 3300025256 Ga0209759_1007390 Ga0209759_10073905 103
742 3300025272 Ga0209455_1000009 Ga0209455_1000009717 103
743 3300025904 Ga0207647_10053616 Ga0207647_100536162 103
744 3300025913 Ga0207695_10000464 Ga0207695_1000046458 103
745 3300025920 Ga0207649_10000065 Ga0207649_1000006552 103
746 3300025932 Ga0207690_10001437 Ga0207690_1000143713 103
747 3300025938 Ga0207704_10257559 Ga0207704_102575592 103
748 3300025940 Ga0207691_10124826 Ga0207691_101248261 103
749 3300025945 Ga0207679_10000028 Ga0207679_1000002843 103
750 3300025972 Ga0207668_10283686 Ga0207668_102836862 103
751 3300025981 Ga0207640_10000250 Ga0207640_1000025037 103
752 3300025986 Ga0207658_10007151 Ga0207658_100071512 103
753 3300026067 Ga0207678_10000376 Ga0207678_100003762 103
754 3300026067 Ga0207678_10247902 Ga0207678_102479022 103
755 3300026078 Ga0207702_10000046 Ga0207702_10000046132 103
756 3300026116 Ga0207674_10025675 Ga0207674_100256753 103
757 3300026118 Ga0207675_100253113 Ga0207675_1002531132 103
758 3300026142 Ga0207698_10048794 Ga0207698_100487943 103
759 3300028794 Ga0307515_10262900 Ga0307515_102629002 103
760 3300031239 Ga0265328_10022673 Ga0265328_100226732 103
761 3300031251 Ga0265327_10000235 Ga0265327_1000023527 103
762 3300031344 Ga0265316_10069121 Ga0265316_100691214 103
763 3300031344 Ga0265316_10391567 Ga0265316_103915672 103
764 3300031507 Ga0307509_10536956 Ga0307509_105369561 103
765 3300031507 Ga0307509_10600405 Ga0307509_106004051 103
766 3300031548 Ga0307408_100047223 Ga0307408_1000472235 103
767 3300031616 Ga0307508_10030541 Ga0307508_100305414 103
768 3300031711 Ga0265314_10331643 Ga0265314_103316431 103
769 3300031731 Ga0307405_10015558 Ga0307405_100155583 103
770 3300031824 Ga0307413_11029252 Ga0307413_110292522 103
771 3300031852 Ga0307410_10002755 Ga0307410_100027552 103
772 3300031901 Ga0307406_10027397 Ga0307406_100273972 103
773 3300031903 Ga0307407_10347356 Ga0307407_103473562 103
774 3300031911 Ga0307412_10011261 Ga0307412_100112615 103
775 3300031995 Ga0307409_100003730 Ga0307409_1000037305 103
776 3300032002 Ga0307416_100051722 Ga0307416_1000517222 103
777 3300032005 Ga0307411_10018945 Ga0307411_100189455 103
778 3300032126 Ga0307415_100003681 Ga0307415_1000036813 103
779 3300037312 Ga0395899_0262448 Ga0395899_0262448_193_504 103
780 3300037418 Ga0395900_0098953 Ga0395900_0098953_1668_1979 103
781 3300037466 Ga0395898_0808129 Ga0395898_0808129_278_589 103
782 3300037471 Ga0395905_0004037 Ga0395905_0004037_5468_5782 103
783 3300037471 Ga0395905_0048304 Ga0395905_0048304_410_721 103
784 3300038443 Ga0395901_1010479 Ga0395901_1010479_250_564 103
785 3300039447 Ga0436361_1095639 Ga0436361_1095639_23_343 103
786 3300041511 Ga0451855_0517695 Ga0451855_0517695_302_622 103
787 3300042438 Ga0439459_0215021 Ga0439459_0215021_119_430 103
788 3300042876 Ga0451577_0025902 Ga0451577_0025902_799_1134 103
789 3300042876 Ga0451577_0143177 Ga0451577_0143177_364_678 103
790 3300044673 Ga0453683_1021694 Ga0453683_1021694_41_352 103
791 3300044712 Ga0453684_0003300 Ga0453684_0003300_17963_18274 103
792 3300044712 Ga0453684_0006085 Ga0453684_0006085_10362_10673 103
793 3300044712 Ga0453684_0745325 Ga0453684_0745325_298_612 103
794 3300044712 Ga0453684_0777818 Ga0453684_0777818_46_357 103
795 3300045051 Ga0451576_0683500 Ga0451576_0683500_370_681 103
796 3300046675 Ga0495657_0399939 Ga0495657_0399939_174_500 103
797 3300048912 Ga0496109_0310644 Ga0496109_0310644_393_704 103
798 3300048912 Ga0496109_0631824 Ga0496109_0631824_277_591 103
799 3300048913 Ga0496110_0322106 Ga0496110_0322106_960_1271 103
800 3300048914 Ga0496111_0734245 Ga0496111_0734245_302_616 103
801 3300049160 Ga0501304_028359 Ga0501304_028359_225_536 103
802 3300049513 Ga0501290_005019 Ga0501290_005019_300_611 103
803 3300049569 Ga0501032_0040636 Ga0501032_0040636_633_974 103
804 3300049576 Ga0501040_0394221 Ga0501040_0394221_219_539 103
805 3300049579 Ga0501043_1076067 Ga0501043_1076067_185_505 103
806 3300049588 Ga0501072_0924082 Ga0501072_0924082_314_634 103
807 3300049592 Ga0501076_0573202 Ga0501076_0573202_149_469 103
808 3300049666 Ga0501228_003345 Ga0501228_003345_288_599 103
809 3300050493 nmdc:mga0k408_148325_c1 nmdc:mga0k408_148325_c1_324_653 103
810 3300050493 nmdc:mga0k408_172752_c1 nmdc:mga0k408_172752_c1_186_497 103
811 3300050496 nmdc:mga07m45_10321_c1 nmdc:mga07m45_10321_c1_765_1076 103
812 3300059505 Ga0587083_0124428 Ga0587083_0124428_104_415 103
813 3300059508 Ga0587088_125521 Ga0587088_125521_258_569 103
814 3300059511 Ga0587091_139457 Ga0587091_139457_44_355 103
815 3300059604 Ga0587098_055952 Ga0587098_055952_244_555 103
816 3300059640 Ga0587067_091675 Ga0587067_091675_269_580 103
817 3300059641 Ga0587068_091984 Ga0587068_091984_262_573 103
818 3300059643 Ga0587072_087172 Ga0587072_087172_113_424 103
819 3300059645 Ga0587076_117715 Ga0587076_117715_256_567 103
820 3300059650 Ga0587104_016271 Ga0587104_016271_226_537 103
821 3300059652 Ga0587107_083582 Ga0587107_083582_237_548 103

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00420

Oxidored_q2

NADH-ubiquinone/plastoquinone oxidoreductase chain 4L

18

113

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7a24-assembly1.cif.gz_K assembly intermediate of the plant mitochondrial complex i 0.9275 5 88
7qso-assembly1.cif.gz_K bovine complex i in lipid nanodisc, state 3 (slack) 0.9245 10 88
6x89-assembly1.cif.gz_4L vigna radiata mitochondrial complex i* 0.92 4 88
7ar7-assembly1.cif.gz_K cryo-em structure of arabidopsis thaliana complex-i (open conformation) 0.913 4 88
7zmh-assembly1.cif.gz_L cryoem structure of mitochondrial complex i from chaetomium thermophilum (state 1) - membrane arm 0.9104 12 95
ID Description Score Start End Superfamily
af_A0A2P2CLH7_4_99_1.10.287.3510 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9278 9 96 1.10.287.3510
af_A0A3B6U9Q8_4_99_1.10.287.3510 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9168 9 96 1.10.287.3510
af_Q6R9N1_4_99_1.10.287.3510 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9034 9 96 1.10.287.3510
af_P18934_2_96_1.10.287.3510 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8914 5 99 1.10.287.3510
af_P18934_2_96_1.10.287.3510 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.866 5 99 1.10.287.3510
ID Description Score Start End GO Terms
AF-A0A368F7W0-F1-model_v4 NADH-ubiquinone oxidoreductase chain 4L (NADH dehydrogenase subunit 4L) (NADH dehydrogenase subunit 5) (NADH-ubiquinone oxidoreductase chain 5) 0.9548 11 88 GO:0003954
GO:0008137
GO:0015990
GO:0016020
GO:0042773
AF-A0A1E4AVB3-F1-model_v4 NADH-quinone oxidoreductase subunit K 0.9483 4 80 GO:0016651
GO:0030964
GO:0042773
AF-A0A0U1XJ79-F1-model_v4 NADH-ubiquinone oxidoreductase chain 4L (NADH dehydrogenase subunit 4L) 0.9467 9 91 GO:0005739
GO:0016020
AF-A0A367IZW3-F1-model_v4 NADH dehydrogenase subunit 4 0.9459 6 95 GO:0003954
GO:0008137
GO:0015990
GO:0016020
GO:0042773
GO:0048039
AF-A0A7Z9I686-F1-model_v4 NADH-quinone oxidoreductase subunit NuoK (EC 1.6.5.11) 0.9419 1 67 GO:0016651
GO:0030964
GO:0042773

Feature Viewer

pLDDT pTM Quality
93.72 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map