F482257

General Info

Members Datasets Scaffolds Average Seq Length
821 268 818 298

Family's Representative Sequence

Representative Sequence 3300025908|Ga0207643_10126928|Ga0207643_101269281
Length 356
Sequence MSDELALNDEKFEPVATPAQTAKPAPADKWRARAHAAWKEIAGIFWLILAVLGFHSFIAKPFYIPSESMLPGLEVGDQLVVAKYAYGWSFISPTLPNPVAMWRDLVEHKPQESWGVQLPFIKGRLFGRMPERGDVVIVTPPGRNTDYIKRVIGLPGDRIEVRNGVVFINNVPVKRGPVHYVDLPDYGGVALTGQEYGTTCDIPGGLQGPANKHFCRLPLVRETLPNGRSFETVDLSRGAPGSDPNYYEGDNYGPTTVPADHVFLMGDNRERSADSRIALDQGGLGGPVPWEYIGGRAEFITFSKNGKATWNPLTLISSLTRSVTNTSPSAVTVPRSPVCNQPWASTVAAVAAGSSR

Samples

Sample ID Description Type Environment
1 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
2 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
10 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
11 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
12 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
13 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
61 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
94 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
99 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
101 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
153 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
154 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
155 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
156 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
157 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
158 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
159 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
160 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
161 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
162 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
163 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
164 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
165 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
166 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
167 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
168 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
169 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
170 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
171 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
172 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
173 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
174 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
175 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
176 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
177 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
178 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
179 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
180 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
181 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
182 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
183 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
184 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
185 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
186 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
187 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
188 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
189 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
190 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
191 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
192 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
193 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
194 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
195 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
196 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
197 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
198 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
199 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
200 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
201 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
202 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
203 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
204 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
205 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
206 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
207 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
208 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
209 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
210 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
211 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
212 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
213 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
214 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
215 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
216 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
217 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
218 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
219 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
220 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
221 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
222 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
223 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
224 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
225 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
226 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
227 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
228 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
229 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
230 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
231 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
232 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
233 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
234 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
235 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
236 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
237 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
238 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
239 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
240 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
241 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
242 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
243 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
244 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
245 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
246 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
247 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
248 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
249 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
250 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
251 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
252 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
253 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
254 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
255 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
256 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
257 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
258 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
259 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
260 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
261 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
262 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
263 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
264 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
265 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
266 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
267 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
268 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.51
Metatranscriptomes 0.12
Isolates 0.37

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.17
Nodule 0
Rhizoplane 8.4
Rhizosphere 86.24
Stem 0
Stem Tuber 0
Unclassified 2.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1000578 3300001915 Bacteria 11131
2 JGI24741J21665_1001312 3300001915 Bacteria 7282
3 JGI24740J21852_10002628 3300001979 Bacteria 8093
4 JGI24740J21852_10011466 3300001979 Bacteria 3372
5 JGI24740J21852_10026133 3300001979 Bacteria 1959
6 JGI24740J21852_10039629 3300001979 Bacteria 1435
7 JGI24740J21852_10064007 3300001979 Bacteria 1005
8 JGI24739J22299_10006424 3300001989 Bacteria 4438
9 JGI24739J22299_10006645 3300001989 Bacteria 4354
10 JGI24737J22298_10002951 3300001990 Bacteria 6033
11 JGI24737J22298_10003882 3300001990 Bacteria 5255
12 JGI24737J22298_10009065 3300001990 Bacteria 3317
13 JGI24735J21928_10004145 3300002067 Bacteria 4895
14 JGI24735J21928_10034551 3300002067 Bacteria 1490
15 JGI24738J21930_10013004 3300002075 Bacteria 1808
16 JGI24738J21930_10023956 3300002075 Bacteria 1257
17 JGI25165J46597_1000065 3300003214 Bacteria 199761
18 JGI25153J46596_10000007 3300003215 Bacteria 377573
19 Ga0055525_1000080 3300003759 Bacteria 164642
20 Ga0055542_1000012 3300003762 Bacteria 391808
21 Ga0055529_1000002 3300003763 Bacteria 537914
22 Ga0055529_1000004 3300003763 Bacteria 433331
23 Ga0070658_10000269 3300005327 Bacteria 45712
24 Ga0070658_10005785 3300005327 Bacteria 10029
25 Ga0070658_10014069 3300005327 Bacteria 6425
26 Ga0070658_10023711 3300005327 Bacteria 4921
27 Ga0070658_10033263 3300005327 Bacteria 4147
28 Ga0070658_10058220 3300005327 Bacteria 3144
29 Ga0070658_10077703 3300005327 Bacteria 2723
30 Ga0070658_10112574 3300005327 Bacteria 2256
31 Ga0070658_10432808 3300005327 Bacteria 1132
32 Ga0070676_10222297 3300005328 Bacteria 1248
33 Ga0070683_100014717 3300005329 Bacteria 6852
34 Ga0070683_100033941 3300005329 Bacteria 4657
35 Ga0070670_100017478 3300005331 Bacteria 6153
36 Ga0070670_100034115 3300005331 Bacteria 4380
37 Ga0070670_100046505 3300005331 Bacteria 3732
38 Ga0070670_100061091 3300005331 Bacteria 3235
39 Ga0070670_100071411 3300005331 Bacteria 2981
40 Ga0070670_100453696 3300005331 Bacteria 1136
41 Ga0070666_10000330 3300005335 Bacteria 29917
42 Ga0070666_10002971 3300005335 Bacteria 10286
43 Ga0070666_10088106 3300005335 Bacteria 2129
44 Ga0070666_10090277 3300005335 Bacteria 2104
45 Ga0070680_100001257 3300005336 Bacteria 18304
46 Ga0070682_100065376 3300005337 Bacteria 2311
47 Ga0070682_100230083 3300005337 Bacteria 1325
48 Ga0068868_100072400 3300005338 Bacteria 2749
49 Ga0070660_100000109 3300005339 Bacteria 50964
50 Ga0070660_100011824 3300005339 Bacteria 6218
51 Ga0070660_100027883 3300005339 Bacteria 4220
52 Ga0070660_100029369 3300005339 Bacteria 4120
53 Ga0070660_100031694 3300005339 Bacteria 3972
54 Ga0070660_100055119 3300005339 Bacteria 3072
55 Ga0070660_100377135 3300005339 Bacteria 1171
56 Ga0070661_100000070 3300005344 Bacteria 82818
57 Ga0070661_100039175 3300005344 Bacteria 3453
58 Ga0070661_100041131 3300005344 Bacteria 3372
59 Ga0070661_100057595 3300005344 Bacteria 2847
60 Ga0070661_100180550 3300005344 Bacteria 1605
61 Ga0070661_100214084 3300005344 Bacteria 1476
62 Ga0070661_100338265 3300005344 Bacteria 1178
63 Ga0070661_100359650 3300005344 Bacteria 1144
64 Ga0070669_100039928 3300005353 Bacteria 3411
65 Ga0070669_100241665 3300005353 Bacteria 1435
66 Ga0070675_100022550 3300005354 Bacteria 5033
67 Ga0070675_100137900 3300005354 Bacteria 2083
68 Ga0070675_100249451 3300005354 Bacteria 1553
69 Ga0070675_100417732 3300005354 Bacteria 1199
70 Ga0070671_100002090 3300005355 Bacteria 15383
71 Ga0070671_100005801 3300005355 Bacteria 9835
72 Ga0070671_100010165 3300005355 Bacteria 7553
73 Ga0070671_100013194 3300005355 Bacteria 6656
74 Ga0070671_100015041 3300005355 Bacteria 6249
75 Ga0070671_100024137 3300005355 Bacteria 4977
76 Ga0070671_100040369 3300005355 Bacteria 3875
77 Ga0070671_100079772 3300005355 Bacteria 2736
78 Ga0070671_100102174 3300005355 Bacteria 2405
79 Ga0070671_100255942 3300005355 Bacteria 1487
80 Ga0070674_100002142 3300005356 Bacteria 10837
81 Ga0070674_100049373 3300005356 Bacteria 2892
82 Ga0070674_100177605 3300005356 Bacteria 1628
83 Ga0070674_100179494 3300005356 Bacteria 1621
84 Ga0070674_100316929 3300005356 Bacteria 1249
85 Ga0070673_100000526 3300005364 Bacteria 20563
86 Ga0070673_100049988 3300005364 Bacteria 3267
87 Ga0070673_100075965 3300005364 Bacteria 2711
88 Ga0070673_100100394 3300005364 Bacteria 2382
89 Ga0070673_100243256 3300005364 Bacteria 1565
90 Ga0070659_100000312 3300005366 Bacteria 37872
91 Ga0070659_100033445 3300005366 Bacteria 3993
92 Ga0070659_100037103 3300005366 Bacteria 3799
93 Ga0070659_100045336 3300005366 Bacteria 3444
94 Ga0070659_100081853 3300005366 Bacteria 2579
95 Ga0070659_100083906 3300005366 Bacteria 2547
96 Ga0070659_100090047 3300005366 Bacteria 2458
97 Ga0070659_100105558 3300005366 Bacteria 2270
98 Ga0070659_100192100 3300005366 Bacteria 1678
99 Ga0070667_100013712 3300005367 Bacteria 6698
100 Ga0070667_100056858 3300005367 Bacteria 3305
101 Ga0070667_100483504 3300005367 Bacteria 1134
102 Ga0070714_100221619 3300005435 Bacteria 1738
103 Ga0070700_100116658 3300005441 Bacteria 1783
104 Ga0070694_100061256 3300005444 Bacteria 2568
105 Ga0070663_100008440 3300005455 Bacteria 6338
106 Ga0070663_100042383 3300005455 Bacteria 3198
107 Ga0070663_100046448 3300005455 Bacteria 3073
108 Ga0070678_100001712 3300005456 Bacteria 11777
109 Ga0070678_100013930 3300005456 Bacteria 5057
110 Ga0070678_100026409 3300005456 Bacteria 3925
111 Ga0070678_100030421 3300005456 Bacteria 3711
112 Ga0070678_100055808 3300005456 Bacteria 2886
113 Ga0070678_100088158 3300005456 Bacteria 2371
114 Ga0070678_100148461 3300005456 Bacteria 1885
115 Ga0070678_100531214 3300005456 Bacteria 1042
116 Ga0070662_100000037 3300005457 Bacteria 76596
117 Ga0070662_100008480 3300005457 Bacteria 6706
118 Ga0070662_100020844 3300005457 Bacteria 4470
119 Ga0070662_100031341 3300005457 Bacteria 3731
120 Ga0070662_100107260 3300005457 Bacteria 2123
121 Ga0070662_100109461 3300005457 Bacteria 2103
122 Ga0070662_100175010 3300005457 Bacteria 1688
123 Ga0070662_100447501 3300005457 Bacteria 1072
124 Ga0070681_10074936 3300005458 Bacteria 3344
125 Ga0070681_10172187 3300005458 Bacteria 2087
126 Ga0070681_10179834 3300005458 Bacteria 2037
127 Ga0070681_10302226 3300005458 Bacteria 1510
128 Ga0068867_100010806 3300005459 Bacteria 6440
129 Ga0070685_10059227 3300005466 Bacteria 2235
130 Ga0070685_10070701 3300005466 Bacteria 2067
131 Ga0070706_100137583 3300005467 Bacteria 2279
132 Ga0070679_100041620 3300005530 Bacteria 4572
133 Ga0070679_100168087 3300005530 Bacteria 2166
134 Ga0070679_100368457 3300005530 Bacteria 1384
135 Ga0070679_100510688 3300005530 Bacteria 1146
136 Ga0068853_100000309 3300005539 Bacteria 34282
137 Ga0068853_100037689 3300005539 Bacteria 4114
138 Ga0068853_100238089 3300005539 Bacteria 1667
139 Ga0070672_100047900 3300005543 Bacteria 3318
140 Ga0070672_100085857 3300005543 Bacteria 2530
141 Ga0070672_100085892 3300005543 Bacteria 2529
142 Ga0070696_100036650 3300005546 Bacteria 3382
143 Ga0070696_100132326 3300005546 Bacteria 1816
144 Ga0070693_100009762 3300005547 Bacteria 4784
145 Ga0070693_100131924 3300005547 Bacteria 1563
146 Ga0070665_100000067 3300005548 Bacteria 204787
147 Ga0070665_100021263 3300005548 Bacteria 6524
148 Ga0070665_100049036 3300005548 Bacteria 4238
149 Ga0070665_100062601 3300005548 Bacteria 3730
150 Ga0070665_100226276 3300005548 Bacteria 1871
151 Ga0070665_100347397 3300005548 Bacteria 1488
152 Ga0068855_100004288 3300005563 Bacteria 17424
153 Ga0068855_100025356 3300005563 Bacteria 7095
154 Ga0068855_100132915 3300005563 Bacteria 2840
155 Ga0068855_100136178 3300005563 Bacteria 2802
156 Ga0070664_100000077 3300005564 Bacteria 62053
157 Ga0070664_100011449 3300005564 Bacteria 7198
158 Ga0070664_100023816 3300005564 Bacteria 5057
159 Ga0070664_100053058 3300005564 Bacteria 3435
160 Ga0070664_100055897 3300005564 Bacteria 3353
161 Ga0070664_100132008 3300005564 Bacteria 2194
162 Ga0070664_100138913 3300005564 Bacteria 2138
163 Ga0070664_100172245 3300005564 Bacteria 1920
164 Ga0070664_100224907 3300005564 Bacteria 1680
165 Ga0070664_100234275 3300005564 Bacteria 1647
166 Ga0070664_100295690 3300005564 Bacteria 1462
167 Ga0070664_100302000 3300005564 Bacteria 1447
168 Ga0070664_100324974 3300005564 Bacteria 1394
169 Ga0068857_100000489 3300005577 Bacteria 28341
170 Ga0068857_100039061 3300005577 Bacteria 4203
171 Ga0068857_100102317 3300005577 Bacteria 2571
172 Ga0068854_100028082 3300005578 Bacteria 3884
173 Ga0068854_100047615 3300005578 Bacteria 3056
174 Ga0068854_100094980 3300005578 Bacteria 2225
175 Ga0068854_100498957 3300005578 Bacteria 1025
176 Ga0068856_100000444 3300005614 Bacteria 45674
177 Ga0068856_100026683 3300005614 Bacteria 5633
178 Ga0068856_100067148 3300005614 Bacteria 3544
179 Ga0068856_100675248 3300005614 Bacteria 1054
180 Ga0068852_100000350 3300005616 Bacteria 31032
181 Ga0068852_100013451 3300005616 Bacteria 6265
182 Ga0068852_100030485 3300005616 Bacteria 4440
183 Ga0068852_100173855 3300005616 Bacteria 2021
184 Ga0068852_100257577 3300005616 Bacteria 1674
185 Ga0068852_100496465 3300005616 Bacteria 1215
186 Ga0068859_100086744 3300005617 Bacteria 3177
187 Ga0068859_100095345 3300005617 Bacteria 3028
188 Ga0068864_100001058 3300005618 Bacteria 23117
189 Ga0068864_100015861 3300005618 Bacteria 6268
190 Ga0068864_100017019 3300005618 Bacteria 6059
191 Ga0068864_100033561 3300005618 Bacteria 4363
192 Ga0068864_100038826 3300005618 Bacteria 4067
193 Ga0068866_10031671 3300005718 Bacteria 2550
194 Ga0068851_10013866 3300005834 Bacteria 3818
195 Ga0068851_10015118 3300005834 Bacteria 3674
196 Ga0068851_10019522 3300005834 Bacteria 3275
197 Ga0068851_10043978 3300005834 Bacteria 2253
198 Ga0068851_10113757 3300005834 Bacteria 1447
199 Ga0068863_100001894 3300005841 Bacteria 20763
200 Ga0068863_100015595 3300005841 Bacteria 7301
201 Ga0068863_100044982 3300005841 Bacteria 4189
202 Ga0068858_100000132 3300005842 Bacteria 77767
203 Ga0068858_100019414 3300005842 Bacteria 6356
204 Ga0068858_100225699 3300005842 Bacteria 1775
205 Ga0068862_100206171 3300005844 Bacteria 1774
206 Ga0075362_10115478 3300006177 Bacteria 1267
207 Ga0075366_10211493 3300006195 Bacteria 1181
208 Ga0097621_100112728 3300006237 Bacteria 2300
209 Ga0097621_100116346 3300006237 Bacteria 2264
210 Ga0097621_100152950 3300006237 Bacteria 1979
211 Ga0068871_100018077 3300006358 Bacteria 5350
212 Ga0068871_100118178 3300006358 Bacteria 2237
213 Ga0068871_100132682 3300006358 Bacteria 2113
214 Ga0068871_100588605 3300006358 Bacteria 1011
215 Ga0097620_100086740 3300006931 Bacteria 3177
216 Ga0097620_100095342 3300006931 Bacteria 3028
217 Ga0105240_10064049 3300009093 Bacteria 4570
218 Ga0111539_10061223 3300009094 Bacteria 4460
219 Ga0105245_10000680 3300009098 Bacteria 30727
220 Ga0105247_10288857 3300009101 Bacteria 1134
221 Ga0114129_10223981 3300009147 Bacteria 2536
222 Ga0105243_10000522 3300009148 Bacteria 39134
223 Ga0105241_10007202 3300009174 Bacteria 8186
224 Ga0105241_10123039 3300009174 Bacteria 2092
225 Ga0105242_10227480 3300009176 Bacteria 1670
226 Ga0105248_10000719 3300009177 Bacteria 37511
227 Ga0105248_10000862 3300009177 Bacteria 34132
228 Ga0105248_10007546 3300009177 Bacteria 11944
229 Ga0105248_10030585 3300009177 Bacteria 6013
230 Ga0105248_10039813 3300009177 Bacteria 5267
231 Ga0105248_10053309 3300009177 Bacteria 4539
232 Ga0105248_10096217 3300009177 Bacteria 3335
233 Ga0105248_10161249 3300009177 Bacteria 2529
234 Ga0105248_10833404 3300009177 Bacteria 1041
235 Ga0105237_10154576 3300009545 Bacteria 2291
236 Ga0105238_10025669 3300009551 Bacteria 6007
237 Ga0105238_10052947 3300009551 Bacteria 4079
238 Ga0105238_10087105 3300009551 Bacteria 3110
239 Ga0105238_10174147 3300009551 Bacteria 2128
240 Ga0105239_10027029 3300010375 Bacteria 6316
241 Ga0105246_10043892 3300011119 Bacteria 3036
242 Ga0105246_10093439 3300011119 Bacteria 2173
243 Ga0157373_10014974 3300013100 Bacteria 5675
244 Ga0157373_10034110 3300013100 Bacteria 3656
245 Ga0157373_10035475 3300013100 Bacteria 3580
246 Ga0157373_10065118 3300013100 Bacteria 2579
247 Ga0157373_10151099 3300013100 Bacteria 1633
248 Ga0157371_10000148 3300013102 Bacteria 101711
249 Ga0157371_10013911 3300013102 Bacteria 6095
250 Ga0157371_10023554 3300013102 Bacteria 4502
251 Ga0157371_10028512 3300013102 Bacteria 4042
252 Ga0157371_10060370 3300013102 Bacteria 2689
253 Ga0157371_10069090 3300013102 Bacteria 2501
254 Ga0157371_10091433 3300013102 Bacteria 2155
255 Ga0157371_10092679 3300013102 Bacteria 2140
256 Ga0157371_10140539 3300013102 Bacteria 1720
257 Ga0157371_10147816 3300013102 Bacteria 1675
258 Ga0157371_10161522 3300013102 Bacteria 1600
259 Ga0157370_10061299 3300013104 Bacteria 3570
260 Ga0157370_10071175 3300013104 Bacteria 3281
261 Ga0157370_10085127 3300013104 Bacteria 2970
262 Ga0157370_10112417 3300013104 Bacteria 2546
263 Ga0157370_10372834 3300013104 Bacteria 1315
264 Ga0157369_10082819 3300013105 Bacteria 3432
265 Ga0157369_10106711 3300013105 Bacteria 2980
266 Ga0157369_10127638 3300013105 Bacteria 2696
267 Ga0157369_10135686 3300013105 Bacteria 2606
268 Ga0157374_10002253 3300013296 Bacteria 16246
269 Ga0157374_10006457 3300013296 Bacteria 9956
270 Ga0157374_10070272 3300013296 Bacteria 3299
271 Ga0157374_10140437 3300013296 Bacteria 2344
272 Ga0157374_10219268 3300013296 Bacteria 1866
273 Ga0157374_10548682 3300013296 Bacteria 1163
274 Ga0157378_10042205 3300013297 Bacteria 4048
275 Ga0157378_10097810 3300013297 Bacteria 2675
276 Ga0163162_10010319 3300013306 Bacteria 9078
277 Ga0163162_10405206 3300013306 Bacteria 1496
278 Ga0163162_10448352 3300013306 Bacteria 1422
279 Ga0163162_10495130 3300013306 Bacteria 1353
280 Ga0163162_10579082 3300013306 Bacteria 1249
281 Ga0157372_10034866 3300013307 Bacteria 5537
282 Ga0157375_10006249 3300013308 Bacteria 10375
283 Ga0157375_10011554 3300013308 Bacteria 7799
284 Ga0157375_10250951 3300013308 Bacteria 1930
285 Ga0163163_10000123 3300014325 Bacteria 82366
286 Ga0163163_10002706 3300014325 Bacteria 14968
287 Ga0163163_10042407 3300014325 Bacteria 4456
288 Ga0182008_10021494 3300014497 Bacteria 3313
289 Ga0157377_10034241 3300014745 Bacteria 2778
290 Ga0157379_10003612 3300014968 Bacteria 13127
291 Ga0157379_10229701 3300014968 Bacteria 1682
292 Ga0157376_10230628 3300014969 Bacteria 1720
293 Ga0206353_11121746 3300020082 Bacteria 2311
294 Ga0213876_10009352 3300021384 Bacteria 5278
295 Ga0209674_105513 3300025226 Bacteria 1857
296 Ga0209563_100058 3300025230 Bacteria 302571
297 Ga0209677_103797 3300025253 Bacteria 4685
298 Ga0209148_1000008 3300025254 Bacteria 1504371
299 Ga0209233_1000107 3300025261 Bacteria 267399
300 Ga0209233_1004527 3300025261 Bacteria 4714
301 Ga0209455_1000002 3300025272 Bacteria 1505459
302 Ga0209758_1000017 3300025297 Bacteria 754393
303 Ga0207656_10000555 3300025321 Bacteria 12363
304 Ga0207656_10008268 3300025321 Bacteria 3821
305 Ga0207656_10011612 3300025321 Bacteria 3333
306 Ga0207656_10038801 3300025321 Bacteria 2011
307 Ga0207682_10047573 3300025893 Bacteria 1766
308 Ga0207642_10004807 3300025899 Bacteria 4368
309 Ga0207688_10006467 3300025901 Bacteria 6378
310 Ga0207680_10001021 3300025903 Bacteria 13204
311 Ga0207680_10008315 3300025903 Bacteria 5085
312 Ga0207680_10035012 3300025903 Bacteria 2878
313 Ga0207680_10078625 3300025903 Bacteria 2066
314 Ga0207647_10017660 3300025904 Bacteria 4848
315 Ga0207647_10019369 3300025904 Bacteria 4578
316 Ga0207647_10030159 3300025904 Bacteria 3502
317 Ga0207647_10043548 3300025904 Bacteria 2809
318 Ga0207647_10049297 3300025904 Bacteria 2612
319 Ga0207645_10047494 3300025907 Bacteria 2741
320 Ga0207643_10126928 3300025908 Bacteria 1515
321 Ga0207705_10000086 3300025909 Bacteria 116132
322 Ga0207705_10000493 3300025909 Bacteria 33656
323 Ga0207705_10000702 3300025909 Bacteria 27622
324 Ga0207705_10006514 3300025909 Bacteria 8651
325 Ga0207705_10035332 3300025909 Bacteria 3575
326 Ga0207705_10127925 3300025909 Bacteria 1889
327 Ga0207705_10153617 3300025909 Bacteria 1726
328 Ga0207705_10157488 3300025909 Bacteria 1704
329 Ga0207705_10311681 3300025909 Bacteria 1208
330 Ga0207654_10158445 3300025911 Bacteria 1460
331 Ga0207707_10017647 3300025912 Bacteria 6225
332 Ga0207707_10107496 3300025912 Bacteria 2439
333 Ga0207707_10387583 3300025912 Bacteria 1201
334 Ga0207695_10029219 3300025913 Bacteria 6098
335 Ga0207695_10597251 3300025913 Bacteria 985
336 Ga0207660_10000484 3300025917 Bacteria 26514
337 Ga0207660_10097667 3300025917 Bacteria 2189
338 Ga0207660_10334345 3300025917 Bacteria 1211
339 Ga0207660_10530421 3300025917 Bacteria 957
340 Ga0207657_10001020 3300025919 Bacteria 29724
341 Ga0207657_10005868 3300025919 Bacteria 12792
342 Ga0207657_10009843 3300025919 Bacteria 9575
343 Ga0207657_10017883 3300025919 Bacteria 6784
344 Ga0207657_10052428 3300025919 Bacteria 3540
345 Ga0207657_10072347 3300025919 Bacteria 2917
346 Ga0207657_10103533 3300025919 Bacteria 2359
347 Ga0207657_10174931 3300025919 Bacteria 1738
348 Ga0207657_10178342 3300025919 Bacteria 1718
349 Ga0207657_10198325 3300025919 Bacteria 1616
350 Ga0207657_10299024 3300025919 Bacteria 1275
351 Ga0207649_10000420 3300025920 Bacteria 31171
352 Ga0207649_10008010 3300025920 Bacteria 5750
353 Ga0207649_10036132 3300025920 Bacteria 2973
354 Ga0207649_10266938 3300025920 Bacteria 1239
355 Ga0207652_10000034 3300025921 Bacteria 138571
356 Ga0207652_10009794 3300025921 Bacteria 7714
357 Ga0207652_10069753 3300025921 Bacteria 3052
358 Ga0207681_10114876 3300025923 Bacteria 1965
359 Ga0207681_10206083 3300025923 Bacteria 1513
360 Ga0207694_10014265 3300025924 Bacteria 5992
361 Ga0207694_10208765 3300025924 Bacteria 1590
362 Ga0207650_10005864 3300025925 Bacteria 8386
363 Ga0207650_10036679 3300025925 Bacteria 3568
364 Ga0207650_10041114 3300025925 Bacteria 3386
365 Ga0207650_10049639 3300025925 Bacteria 3099
366 Ga0207650_10050942 3300025925 Bacteria 3063
367 Ga0207650_10156255 3300025925 Bacteria 1804
368 Ga0207650_10171230 3300025925 Bacteria 1726
369 Ga0207659_10058028 3300025926 Bacteria 2778
370 Ga0207659_10087041 3300025926 Bacteria 2325
371 Ga0207659_10218861 3300025926 Bacteria 1530
372 Ga0207659_10366304 3300025926 Bacteria 1199
373 Ga0207687_10000572 3300025927 Bacteria 24857
374 Ga0207687_10268920 3300025927 Bacteria 1362
375 Ga0207644_10000614 3300025931 Bacteria 22677
376 Ga0207644_10000747 3300025931 Bacteria 20633
377 Ga0207644_10006207 3300025931 Bacteria 7793
378 Ga0207644_10013631 3300025931 Bacteria 5424
379 Ga0207644_10015601 3300025931 Bacteria 5101
380 Ga0207644_10017567 3300025931 Bacteria 4835
381 Ga0207644_10051182 3300025931 Bacteria 2964
382 Ga0207644_10060288 3300025931 Bacteria 2745
383 Ga0207644_10363534 3300025931 Bacteria 1177
384 Ga0207690_10000413 3300025932 Bacteria 27940
385 Ga0207690_10012696 3300025932 Bacteria 5048
386 Ga0207690_10027771 3300025932 Bacteria 3579
387 Ga0207690_10061043 3300025932 Bacteria 2561
388 Ga0207690_10250263 3300025932 Bacteria 1368
389 Ga0207690_10362458 3300025932 Bacteria 1148
390 Ga0207690_10426109 3300025932 Bacteria 1062
391 Ga0207706_10000192 3300025933 Bacteria 68319
392 Ga0207706_10016273 3300025933 Bacteria 6718
393 Ga0207706_10040368 3300025933 Bacteria 4136
394 Ga0207706_10046530 3300025933 Bacteria 3841
395 Ga0207706_10068152 3300025933 Bacteria 3131
396 Ga0207706_10078243 3300025933 Bacteria 2908
397 Ga0207706_10078803 3300025933 Bacteria 2897
398 Ga0207706_10087222 3300025933 Bacteria 2744
399 Ga0207706_10087387 3300025933 Bacteria 2741
400 Ga0207709_10000109 3300025935 Bacteria 128086
401 Ga0207709_10130993 3300025935 Bacteria 1709
402 Ga0207669_10000359 3300025937 Bacteria 20721
403 Ga0207669_10001539 3300025937 Bacteria 9829
404 Ga0207669_10030009 3300025937 Bacteria 3016
405 Ga0207669_10030707 3300025937 Bacteria 2990
406 Ga0207669_10052570 3300025937 Bacteria 2448
407 Ga0207704_10015989 3300025938 Bacteria 3843
408 Ga0207691_10021942 3300025940 Bacteria 6024
409 Ga0207691_10031381 3300025940 Bacteria 4960
410 Ga0207691_10057234 3300025940 Bacteria 3549
411 Ga0207691_10151051 3300025940 Bacteria 2042
412 Ga0207691_10252389 3300025940 Bacteria 1522
413 Ga0207711_10000344 3300025941 Bacteria 49354
414 Ga0207711_10002038 3300025941 Bacteria 18270
415 Ga0207711_10006917 3300025941 Bacteria 9525
416 Ga0207711_10007240 3300025941 Bacteria 9299
417 Ga0207711_10011304 3300025941 Bacteria 7417
418 Ga0207711_10029005 3300025941 Bacteria 4663
419 Ga0207711_10031078 3300025941 Bacteria 4506
420 Ga0207711_10045504 3300025941 Bacteria 3750
421 Ga0207711_10062395 3300025941 Bacteria 3215
422 Ga0207689_10071034 3300025942 Bacteria 2860
423 Ga0207661_10005561 3300025944 Bacteria 8887
424 Ga0207661_10009979 3300025944 Bacteria 6823
425 Ga0207661_10045917 3300025944 Bacteria 3461
426 Ga0207661_10074814 3300025944 Bacteria 2777
427 Ga0207661_10342216 3300025944 Bacteria 1348
428 Ga0207679_10000347 3300025945 Bacteria 33719
429 Ga0207679_10001488 3300025945 Bacteria 14672
430 Ga0207679_10049190 3300025945 Bacteria 3074
431 Ga0207679_10066068 3300025945 Bacteria 2709
432 Ga0207679_10380766 3300025945 Bacteria 1237
433 Ga0207667_10000074 3300025949 Bacteria 171635
434 Ga0207667_10000850 3300025949 Bacteria 39399
435 Ga0207667_10049976 3300025949 Bacteria 4413
436 Ga0207667_10056357 3300025949 Bacteria 4129
437 Ga0207667_10092310 3300025949 Bacteria 3127
438 Ga0207667_10093131 3300025949 Bacteria 3112
439 Ga0207667_10205764 3300025949 Bacteria 2018
440 Ga0207651_10017897 3300025960 Bacteria 4200
441 Ga0207651_10020954 3300025960 Bacteria 3959
442 Ga0207651_10070728 3300025960 Bacteria 2470
443 Ga0207651_10162727 3300025960 Bacteria 1751
444 Ga0207651_10318509 3300025960 Bacteria 1299
445 Ga0207651_10400399 3300025960 Bacteria 1167
446 Ga0207640_10001242 3300025981 Bacteria 13887
447 Ga0207640_10016104 3300025981 Bacteria 4342
448 Ga0207640_10078101 3300025981 Bacteria 2252
449 Ga0207640_10149938 3300025981 Bacteria 1712
450 Ga0207640_10157226 3300025981 Bacteria 1677
451 Ga0207658_10005150 3300025986 Bacteria 9003
452 Ga0207658_10087862 3300025986 Bacteria 2401
453 Ga0207658_10091650 3300025986 Bacteria 2358
454 Ga0207658_10153378 3300025986 Bacteria 1879
455 Ga0207658_10292784 3300025986 Bacteria 1400
456 Ga0207677_10100638 3300026023 Bacteria 2126
457 Ga0207677_10137600 3300026023 Bacteria 1865
458 Ga0207703_10001668 3300026035 Bacteria 19967
459 Ga0207639_10000412 3300026041 Bacteria 29612
460 Ga0207639_10000923 3300026041 Bacteria 19909
461 Ga0207639_10130901 3300026041 Bacteria 2077
462 Ga0207678_10001315 3300026067 Bacteria 22977
463 Ga0207678_10001460 3300026067 Bacteria 21690
464 Ga0207678_10010383 3300026067 Bacteria 8176
465 Ga0207678_10012950 3300026067 Bacteria 7317
466 Ga0207678_10017638 3300026067 Bacteria 6266
467 Ga0207678_10032502 3300026067 Bacteria 4547
468 Ga0207678_10038145 3300026067 Bacteria 4176
469 Ga0207678_10396879 3300026067 Bacteria 1194
470 Ga0207708_10105923 3300026075 Bacteria 2180
471 Ga0207702_10001342 3300026078 Bacteria 24608
472 Ga0207702_10005023 3300026078 Bacteria 11624
473 Ga0207702_10044465 3300026078 Bacteria 3733
474 Ga0207702_10058235 3300026078 Bacteria 3287
475 Ga0207702_10351556 3300026078 Bacteria 1410
476 Ga0207641_10003063 3300026088 Bacteria 15070
477 Ga0207641_10005258 3300026088 Bacteria 11064
478 Ga0207641_10012388 3300026088 Bacteria 6996
479 Ga0207648_10002768 3300026089 Bacteria 18606
480 Ga0207648_10008437 3300026089 Bacteria 9982
481 Ga0207676_10001223 3300026095 Bacteria 19146
482 Ga0207676_10001683 3300026095 Bacteria 16306
483 Ga0207676_10202653 3300026095 Bacteria 1754
484 Ga0207676_10238605 3300026095 Bacteria 1629
485 Ga0207676_10251700 3300026095 Bacteria 1590
486 Ga0207676_10685116 3300026095 Bacteria 992
487 Ga0207674_10001507 3300026116 Bacteria 30052
488 Ga0207674_10003897 3300026116 Bacteria 18153
489 Ga0207674_10005996 3300026116 Bacteria 14381
490 Ga0207674_10016601 3300026116 Bacteria 8051
491 Ga0207674_10095577 3300026116 Bacteria 2957
492 Ga0207674_10179584 3300026116 Bacteria 2068
493 Ga0207683_10001189 3300026121 Bacteria 23565
494 Ga0207683_10015269 3300026121 Bacteria 6537
495 Ga0207683_10049845 3300026121 Bacteria 3666
496 Ga0207683_10080418 3300026121 Bacteria 2891
497 Ga0207683_10084215 3300026121 Bacteria 2826
498 Ga0207683_10128444 3300026121 Bacteria 2279
499 Ga0207698_10000542 3300026142 Bacteria 21912
500 Ga0207698_10000672 3300026142 Bacteria 19824
501 Ga0207698_10002456 3300026142 Bacteria 10985
502 Ga0207698_10008977 3300026142 Bacteria 6344
503 Ga0207698_10033462 3300026142 Bacteria 3735
504 Ga0207698_10241134 3300026142 Bacteria 1648
505 Ga0207698_10450582 3300026142 Bacteria 1242
506 Ga0207698_10482833 3300026142 Bacteria 1202
507 Ga0268266_10000002 3300028379 Bacteria 3059047
508 Ga0268266_10046045 3300028379 Bacteria 3734
509 Ga0268266_10166318 3300028379 Bacteria 1998
510 Ga0268266_10269385 3300028379 Bacteria 1580
511 Ga0268266_10389160 3300028379 Bacteria 1316
512 Ga0268265_10158063 3300028380 Bacteria 1921
513 Ga0268264_10092534 3300028381 Bacteria 2610
514 Ga0307517_10009682 3300028786 Bacteria 13624
515 Ga0307517_10040445 3300028786 Bacteria 5075
516 Ga0307513_10003398 3300031456 Bacteria 21628
517 Ga0307408_100243896 3300031548 Bacteria 1478
518 Ga0307508_10000356 3300031616 Bacteria 55624
519 Ga0307405_10021657 3300031731 Bacteria 3617
520 Ga0307405_10243486 3300031731 Bacteria 1333
521 Ga0307405_10352550 3300031731 Bacteria 1135
522 Ga0307413_10076619 3300031824 Bacteria 2126
523 Ga0307413_10098929 3300031824 Bacteria 1922
524 Ga0307413_10183478 3300031824 Bacteria 1495
525 Ga0307410_10035145 3300031852 Bacteria 3252
526 Ga0307410_10045915 3300031852 Bacteria 2912
527 Ga0307406_10092330 3300031901 Bacteria 2041
528 Ga0307407_10155856 3300031903 Bacteria 1489
529 Ga0307412_10176974 3300031911 Bacteria 1600
530 Ga0307409_100008827 3300031995 Bacteria 6147
531 Ga0307409_100248451 3300031995 Bacteria 1625
532 Ga0307416_100084089 3300032002 Bacteria 2702
533 Ga0307416_100149259 3300032002 Bacteria 2141
534 Ga0307416_100560135 3300032002 Bacteria 1217
535 Ga0307414_10098254 3300032004 Bacteria 2196
536 Ga0307414_10211466 3300032004 Bacteria 1585
537 Ga0307414_10241334 3300032004 Bacteria 1496
538 Ga0307411_10001313 3300032005 Bacteria 10000
539 Ga0307411_10254276 3300032005 Bacteria 1383
540 Ga0307415_100016305 3300032126 Bacteria 4426
541 Ga0307415_100341727 3300032126 Bacteria 1256
542 Ga0373960_0040034 3300035121 Bacteria 1351
543 Ga0373942_0004964 3300035207 Bacteria 3085
544 Ga0373961_0025745 3300035241 Bacteria 1602
545 Ga0373931_0001320 3300035691 Bacteria 10617
546 Ga0395899_0000669 3300037312 Bacteria 34717
547 Ga0395899_0009002 3300037312 Bacteria 7675
548 Ga0395899_0014277 3300037312 Bacteria 6064
549 Ga0395899_0031627 3300037312 Bacteria 3977
550 Ga0395899_0041264 3300037312 Bacteria 3448
551 Ga0395899_0042526 3300037312 Bacteria 3392
552 Ga0395899_0042725 3300037312 Bacteria 3382
553 Ga0395899_0044505 3300037312 Bacteria 3307
554 Ga0395899_0045250 3300037312 Bacteria 3279
555 Ga0395899_0070866 3300037312 Bacteria 2551
556 Ga0395899_0281051 3300037312 Bacteria 1132
557 Ga0395899_0352505 3300037312 Bacteria 984
558 Ga0395900_0000308 3300037418 Bacteria 72664
559 Ga0395900_0001779 3300037418 Bacteria 24718
560 Ga0395900_0003085 3300037418 Bacteria 18103
561 Ga0395900_0008220 3300037418 Bacteria 10743
562 Ga0395900_0033740 3300037418 Bacteria 5267
563 Ga0395900_0036295 3300037418 Bacteria 5081
564 Ga0395900_0040236 3300037418 Bacteria 4817
565 Ga0395900_0062159 3300037418 Bacteria 3838
566 Ga0395900_0063223 3300037418 Bacteria 3804
567 Ga0395900_0106959 3300037418 Bacteria 2874
568 Ga0395900_0171260 3300037418 Bacteria 2210
569 Ga0395900_0184621 3300037418 Bacteria 2117
570 Ga0395900_0192970 3300037418 Bacteria 2065
571 Ga0395900_0201824 3300037418 Bacteria 2011
572 Ga0395900_0211619 3300037418 Bacteria 1957
573 Ga0395900_0327259 3300037418 Bacteria 1511
574 Ga0395900_0437944 3300037418 Bacteria 1265
575 Ga0395900_0499229 3300037418 Bacteria 1167
576 Ga0395900_0757776 3300037418 Bacteria 901
577 Ga0395898_0001096 3300037466 Bacteria 41791
578 Ga0395898_0019188 3300037466 Bacteria 6961
579 Ga0395898_0021270 3300037466 Bacteria 6579
580 Ga0395898_0052037 3300037466 Bacteria 4002
581 Ga0395898_0053594 3300037466 Bacteria 3939
582 Ga0395898_0065908 3300037466 Bacteria 3510
583 Ga0395898_0079198 3300037466 Bacteria 3170
584 Ga0395898_0233362 3300037466 Bacteria 1754
585 Ga0395898_0343906 3300037466 Bacteria 1422
586 Ga0395905_0000005 3300037471 Bacteria 557808
587 Ga0395905_0000104 3300037471 Bacteria 141965
588 Ga0395905_0004102 3300037471 Bacteria 15259
589 Ga0395905_0008459 3300037471 Bacteria 10149
590 Ga0395905_0013074 3300037471 Bacteria 7969
591 Ga0395905_0015364 3300037471 Bacteria 7276
592 Ga0395905_0023579 3300037471 Bacteria 5813
593 Ga0395905_0029447 3300037471 Bacteria 5172
594 Ga0395905_0036894 3300037471 Bacteria 4591
595 Ga0395905_0037718 3300037471 Bacteria 4535
596 Ga0395905_0058040 3300037471 Bacteria 3619
597 Ga0395905_0064094 3300037471 Bacteria 3438
598 Ga0395905_0071420 3300037471 Bacteria 3254
599 Ga0395905_0104119 3300037471 Bacteria 2664
600 Ga0395905_0107222 3300037471 Bacteria 2623
601 Ga0395905_0107854 3300037471 Bacteria 2614
602 Ga0395905_0135768 3300037471 Bacteria 2314
603 Ga0395905_0251626 3300037471 Bacteria 1650
604 Ga0395905_0281686 3300037471 Bacteria 1548
605 Ga0395905_0475173 3300037471 Bacteria 1149
606 Ga0395905_0578907 3300037471 Bacteria 1024
607 Ga0395901_0000782 3300038443 Bacteria 35570
608 Ga0395901_0020938 3300038443 Bacteria 6699
609 Ga0395901_0028743 3300038443 Bacteria 5720
610 Ga0395901_0053134 3300038443 Bacteria 4210
611 Ga0395901_0083434 3300038443 Bacteria 3340
612 Ga0395901_0085676 3300038443 Bacteria 3293
613 Ga0395901_0103175 3300038443 Bacteria 2992
614 Ga0395901_0117568 3300038443 Bacteria 2793
615 Ga0395901_0131734 3300038443 Bacteria 2627
616 Ga0395901_0167194 3300038443 Bacteria 2308
617 Ga0395901_0247424 3300038443 Bacteria 1858
618 Ga0395901_0251336 3300038443 Bacteria 1841
619 Ga0395901_0282216 3300038443 Bacteria 1725
620 Ga0395901_0341045 3300038443 Bacteria 1548
621 Ga0395901_0576660 3300038443 Bacteria 1137
622 Ga0436365_0881543 3300039437 Bacteria 7406
623 Ga0439448_0037801 3300042005 Bacteria 1552
624 Ga0439455_0015588 3300042012 Bacteria 1748
625 Ga0450917_001419 3300042120 Bacteria 1716
626 Ga0450905_000986 3300042142 Bacteria 3564
627 Ga0450889_000060 3300042144 Bacteria 9820
628 Ga0439458_0000590 3300042157 Bacteria 9358
629 Ga0439458_0007395 3300042157 Bacteria 2446
630 Ga0466969_0029974 3300044656 Bacteria 2774
631 Ga0466972_0077259 3300044658 Bacteria 1586
632 Ga0466966_0013413 3300044684 Bacteria 5424
633 Ga0466966_0031937 3300044684 Bacteria 3415
634 Ga0466961_0163269 3300044693 Bacteria 1388
635 Ga0466963_0028762 3300044694 Bacteria 3572
636 Ga0466963_0043158 3300044694 Bacteria 2963
637 Ga0466963_0047770 3300044694 Bacteria 2826
638 Ga0466963_0062754 3300044694 Bacteria 2485
639 Ga0466964_0027173 3300044706 Bacteria 2245
640 Ga0466971_0060097 3300044719 Bacteria 1718
641 Ga0466970_0061628 3300044765 Bacteria 2010
642 Ga0466970_0084406 3300044765 Bacteria 1719
643 Ga0466970_0242063 3300044765 Bacteria 1010
644 Ga0466957_0022875 3300044842 Bacteria 3690
645 Ga0466957_0039900 3300044842 Bacteria 2834
646 Ga0466957_0040546 3300044842 Bacteria 2812
647 Ga0466957_0054643 3300044842 Bacteria 2438
648 Ga0466957_0139265 3300044842 Bacteria 1562
649 Ga0466957_0160011 3300044842 Bacteria 1462
650 Ga0466959_0048801 3300045049 Bacteria 3111
651 Ga0466959_0161612 3300045049 Bacteria 1575
652 Ga0466958_0013804 3300045836 Bacteria 4605
653 Ga0466958_0028552 3300045836 Bacteria 3308
654 Ga0466958_0032340 3300045836 Bacteria 3112
655 Ga0466967_0006997 3300045976 Bacteria 8072
656 Ga0466967_0048466 3300045976 Bacteria 3710
657 Ga0466967_0057847 3300045976 Bacteria 3425
658 Ga0466967_0076838 3300045976 Bacteria 3004
659 Ga0466967_0088576 3300045976 Bacteria 2809
660 Ga0466967_0117662 3300045976 Bacteria 2450
661 Ga0466967_0128786 3300045976 Bacteria 2347
662 Ga0466967_0157070 3300045976 Bacteria 2131
663 Ga0495617_007659 3300046452 Bacteria 3739
664 Ga0495629_0050339 3300046459 Bacteria 2918
665 Ga0495650_0000535 3300046471 Bacteria 54750
666 Ga0495585_0020012 3300046492 Bacteria 3850
667 Ga0495596_0005441 3300046500 Bacteria 6015
668 Ga0495583_0003199 3300046506 Bacteria 12834
669 Ga0495583_0010010 3300046506 Bacteria 5587
670 Ga0495583_0019541 3300046506 Bacteria 3533
671 Ga0495583_0088651 3300046506 Bacteria 1335
672 Ga0495606_0000071 3300046507 Bacteria 175933
673 Ga0495606_0035134 3300046507 Bacteria 3430
674 Ga0495631_0011246 3300046518 Bacteria 4405
675 Ga0495631_0045058 3300046518 Bacteria 1942
676 Ga0495631_0077242 3300046518 Bacteria 1437
677 Ga0495643_0000732 3300046522 Bacteria 37427
678 Ga0495643_0001351 3300046522 Bacteria 23040
679 Ga0495643_0015744 3300046522 Bacteria 4460
680 Ga0495648_0000433 3300046524 Bacteria 45500
681 Ga0495648_0121628 3300046524 Bacteria 1402
682 Ga0495648_0130853 3300046524 Bacteria 1334
683 Ga0495663_0000282 3300046525 Bacteria 19400
684 Ga0495642_0001975 3300046528 Bacteria 8606
685 Ga0495642_0068810 3300046528 Bacteria 1478
686 Ga0495642_0078536 3300046528 Bacteria 1387
687 Ga0495587_0011414 3300046536 Bacteria 5631
688 Ga0495598_0004019 3300046537 Bacteria 3158
689 Ga0495598_0034026 3300046537 Bacteria 1450
690 Ga0495597_0008373 3300046542 Bacteria 5184
691 Ga0495633_0002247 3300046558 Bacteria 13823
692 Ga0495633_0108868 3300046558 Bacteria 1285
693 Ga0495668_0000098 3300046616 Bacteria 138553
694 Ga0495668_0034201 3300046616 Bacteria 2853
695 Ga0495668_0053335 3300046616 Bacteria 2235
696 Ga0495625_0000427 3300046660 Bacteria 63470
697 Ga0495625_0000860 3300046660 Bacteria 41288
698 Ga0495625_0060406 3300046660 Bacteria 2685
699 Ga0495625_0115557 3300046660 Bacteria 1831
700 Ga0495669_0000043 3300046684 Bacteria 86386
701 Ga0495669_0007885 3300046684 Bacteria 4468
702 Ga0495669_0009309 3300046684 Bacteria 4139
703 Ga0495669_0073756 3300046684 Bacteria 1559
704 Ga0495669_0074673 3300046684 Bacteria 1550
705 Ga0495670_0000071 3300046691 Bacteria 45180
706 Ga0495670_0102897 3300046691 Bacteria 1472
707 Ga0495600_0007622 3300046809 Bacteria 6631
708 Ga0495683_0015599 3300047323 Bacteria 3950
709 Ga0495683_0025405 3300047323 Bacteria 3036
710 Ga0495687_000597 3300047443 Bacteria 42130
711 Ga0495687_001875 3300047443 Bacteria 18189
712 Ga0495677_0003207 3300047445 Bacteria 6376
713 Ga0495677_0120182 3300047445 Bacteria 1002
714 Ga0495673_0085504 3300047469 Bacteria 1298
715 Ga0495681_0005160 3300047470 Bacteria 8790
716 Ga0495686_0000600 3300047472 Bacteria 50240
717 Ga0496100_0029988 3300048903 Bacteria 3369
718 Ga0496101_0010849 3300048904 Bacteria 6027
719 Ga0496101_0041590 3300048904 Bacteria 3278
720 Ga0496101_0082827 3300048904 Bacteria 2374
721 Ga0496101_0285753 3300048904 Bacteria 1290
722 Ga0496101_0371510 3300048904 Bacteria 1125
723 Ga0496102_0000092 3300048905 Bacteria 125879
724 Ga0496102_0060901 3300048905 Bacteria 3453
725 Ga0496103_0000101 3300048906 Bacteria 93679
726 Ga0496103_0051009 3300048906 Bacteria 2560
727 Ga0496103_0059631 3300048906 Bacteria 2371
728 Ga0496103_0090215 3300048906 Bacteria 1934
729 Ga0496104_0042934 3300048907 Bacteria 4246
730 Ga0496104_0137509 3300048907 Bacteria 2347
731 Ga0496104_0240695 3300048907 Bacteria 1722
732 Ga0496104_0625397 3300048907 Bacteria 986
733 Ga0496105_0006455 3300048908 Bacteria 9018
734 Ga0496106_0001313 3300048909 Bacteria 18647
735 Ga0496106_0016396 3300048909 Bacteria 5482
736 Ga0496106_0654186 3300048909 Bacteria 839
737 Ga0496107_0002900 3300048910 Bacteria 11331
738 Ga0496107_0003295 3300048910 Bacteria 10778
739 Ga0496107_0011494 3300048910 Bacteria 6167
740 Ga0496107_0092038 3300048910 Bacteria 2216
741 Ga0496108_0002906 3300048911 Bacteria 13765
742 Ga0496108_0003739 3300048911 Bacteria 12204
743 Ga0496108_0006177 3300048911 Bacteria 9691
744 Ga0496108_0054179 3300048911 Bacteria 3366
745 Ga0496109_0006553 3300048912 Bacteria 9799
746 Ga0496109_0013443 3300048912 Bacteria 7101
747 Ga0496109_0013577 3300048912 Bacteria 7073
748 Ga0496109_0067116 3300048912 Bacteria 3285
749 Ga0496109_0069377 3300048912 Bacteria 3232
750 Ga0496109_0183840 3300048912 Bacteria 1964
751 Ga0496109_0236653 3300048912 Bacteria 1718
752 Ga0496110_0008709 3300048913 Bacteria 8172
753 Ga0496110_0025175 3300048913 Bacteria 5083
754 Ga0496110_0033905 3300048913 Bacteria 4418
755 Ga0496110_0046307 3300048913 Bacteria 3805
756 Ga0496110_0118944 3300048913 Bacteria 2379
757 Ga0496110_0493540 3300048913 Bacteria 1115
758 Ga0496111_0000496 3300048914 Bacteria 20302
759 Ga0496111_0002376 3300048914 Bacteria 11340
760 Ga0496111_0008693 3300048914 Bacteria 6739
761 Ga0496111_0067683 3300048914 Bacteria 2594
762 Ga0496112_0000275 3300048915 Bacteria 33348
763 Ga0496112_0010745 3300048915 Bacteria 8325
764 Ga0496112_0040084 3300048915 Bacteria 4578
765 Ga0496112_0040418 3300048915 Bacteria 4559
766 Ga0496112_0050186 3300048915 Bacteria 4091
767 Ga0496112_0061899 3300048915 Bacteria 3690
768 Ga0496112_0147653 3300048915 Bacteria 2319
769 Ga0496112_0499608 3300048915 Bacteria 1152
770 Ga0496112_0697361 3300048915 Bacteria 943
771 Ga0496113_0005727 3300048916 Bacteria 7784
772 Ga0496113_0006279 3300048916 Bacteria 7514
773 Ga0496113_0010921 3300048916 Bacteria 6028
774 Ga0496113_0011965 3300048916 Bacteria 5816
775 Ga0496113_0047318 3300048916 Bacteria 3196
776 Ga0496113_0335835 3300048916 Bacteria 1212
777 Ga0496113_0606952 3300048916 Bacteria 876
778 Ga0496114_0000029 3300048917 Bacteria 175132
779 Ga0496114_0001189 3300048917 Bacteria 19687
780 Ga0496114_0003038 3300048917 Bacteria 12855
781 Ga0496114_0203216 3300048917 Bacteria 1736
782 Ga0496115_0000038 3300048918 Bacteria 125104
783 Ga0496115_0020881 3300048918 Bacteria 5054
784 Ga0496115_0031543 3300048918 Bacteria 4176
785 Ga0496116_0018815 3300048919 Bacteria 5307
786 Ga0496117_0000173 3300048920 Bacteria 133415
787 Ga0496118_0000131 3300048921 Bacteria 133116
788 Ga0496119_0017008 3300048922 Bacteria 5499
789 Ga0496120_0067331 3300048923 Bacteria 1979
790 Ga0496121_0000209 3300048924 Bacteria 129740
791 Ga0496121_0000652 3300048924 Bacteria 64960
792 Ga0496123_0020876 3300048926 Bacteria 5107
793 Ga0496124_0000166 3300048927 Bacteria 133634
794 Ga0496125_0001208 3300048928 Bacteria 38840
795 Ga0496126_0000222 3300048929 Bacteria 123936
796 Ga0501067_0030314 3300049583 Bacteria 3000
797 Ga0501067_0147758 3300049583 Bacteria 1309
798 Ga0501068_0052576 3300049584 Bacteria 2465
799 Ga0501068_0202444 3300049584 Bacteria 1259
800 Ga0501069_0195704 3300049585 Bacteria 1170
801 Ga0501209_038047 3300049656 Bacteria 1259
802 Ga0501242_006405 3300049674 Bacteria 1341
803 Ga0501263_006198 3300049760 Bacteria 1375
804 Ga0501268_004670 3300049765 Bacteria 1939
805 Ga0501268_022242 3300049765 Bacteria 1093
806 Ga0501273_006014 3300049770 Bacteria 1391
807 Ga0501283_011523 3300049779 Bacteria 1317
808 Ga0500610_0000147 3300053079 Bacteria 21141
809 Ga0495655_0009272 3300053083 Bacteria 1902
810 Ga0500595_002101 3300053119 Bacteria 10183
811 Ga0500642_0006122 3300053130 Bacteria 3938
812 Ga0500658_0004026 3300053134 Bacteria 5521
813 Ga0500568_0088168 3300053139 Bacteria 1172
814 Ga0500616_0032370 3300053153 Bacteria 2859
815 Ga0500619_016729 3300053154 Bacteria 2024
816 Ga0500636_0002292 3300053177 Bacteria 10615
817 Ga0500645_000267 3300053730 Bacteria 37622
818 Ga0500596_000434 3300053735 Bacteria 7732

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005564 Ga0070664_100132008 Ga0070664_1001320082 254
2 3300005578 Ga0068854_100028082 Ga0068854_1000280825 254
3 3300005834 Ga0068851_10113757 Ga0068851_101137572 254
4 3300009551 Ga0105238_10174147 Ga0105238_101741472 254
5 3300001979 JGI24740J21852_10026133 JGI24740J21852_100261332 255
6 3300013104 Ga0157370_10061299 Ga0157370_100612994 255
7 3300025904 Ga0207647_10049297 Ga0207647_100492972 255
8 3300025911 Ga0207654_10158445 Ga0207654_101584451 255
9 3300025919 Ga0207657_10103533 Ga0207657_101035332 255
10 3300025920 Ga0207649_10036132 Ga0207649_100361323 255
11 3300025933 Ga0207706_10040368 Ga0207706_100403685 255
12 3300025944 Ga0207661_10342216 Ga0207661_103422162 255
13 3300025949 Ga0207667_10092310 Ga0207667_100923104 255
14 3300026067 Ga0207678_10032502 Ga0207678_100325022 255
15 3300026116 Ga0207674_10001507 Ga0207674_1000150726 255
16 3300031731 Ga0307405_10243486 Ga0307405_102434862 255
17 3300031731 Ga0307405_10352550 Ga0307405_103525501 255
18 3300032002 Ga0307416_100084089 Ga0307416_1000840892 255
19 3300032004 Ga0307414_10211466 Ga0307414_102114662 255
20 3300037418 Ga0395900_0757776 Ga0395900_0757776_16_783 255
21 3300044693 Ga0466961_0163269 Ga0466961_0163269_481_1278 255
22 3300048916 Ga0496113_0606952 Ga0496113_0606952_56_823 255
23 3300049674 Ga0501242_006405 Ga0501242_006405_165_932 255
24 3300053154 Ga0500619_016729 Ga0500619_016729_1103_1999 255
25 3300048909 Ga0496106_0654186 Ga0496106_0654186_17_790 257
26 3300049656 Ga0501209_038047 Ga0501209_038047_34_807 257
27 3300049760 Ga0501263_006198 Ga0501263_006198_145_918 257
28 3300049765 Ga0501268_004670 Ga0501268_004670_458_1231 257
29 3300049770 Ga0501273_006014 Ga0501273_006014_530_1303 257
30 3300049779 Ga0501283_011523 Ga0501283_011523_347_1120 257
31 3300013105 Ga0157369_10135686 Ga0157369_101356862 265
32 3300037471 Ga0395905_0251626 Ga0395905_0251626_42_902 265
33 3300038443 Ga0395901_0117568 Ga0395901_0117568_1647_2444 265
34 3300046507 Ga0495606_0035134 Ga0495606_0035134_1560_2564 267
35 3300026089 Ga0207648_10008437 Ga0207648_1000843713 268
36 3300046522 Ga0495643_0015744 Ga0495643_0015744_2133_3137 268
37 3300031824 Ga0307413_10183478 Ga0307413_101834782 269
38 3300053139 Ga0500568_0088168 Ga0500568_0088168_149_1105 269
39 3300053153 Ga0500616_0032370 Ga0500616_0032370_1739_2695 269
40 iso_pu_bacteria 2599185354 2600202223 269
41 iso_pu_bacteria 2751185897 2753766174 269
42 3300005353 Ga0070669_100039928 Ga0070669_1000399283 270
43 3300005441 Ga0070700_100116658 Ga0070700_1001166583 270
44 3300013104 Ga0157370_10112417 Ga0157370_101124174 270
45 3300025926 Ga0207659_10218861 Ga0207659_102188612 270
46 3300025940 Ga0207691_10151051 Ga0207691_101510512 270
47 3300025949 Ga0207667_10093131 Ga0207667_100931312 270
48 3300026075 Ga0207708_10105923 Ga0207708_101059232 270
49 3300046492 Ga0495585_0020012 Ga0495585_0020012_2435_3439 270
50 3300042005 Ga0439448_0037801 Ga0439448_0037801_215_1225 271
51 3300031911 Ga0307412_10176974 Ga0307412_101769742 272
52 iso_pu_bacteria 8057101203 8057101488 272
53 3300025926 Ga0207659_10087041 Ga0207659_100870412 273
54 3300037312 Ga0395899_0352505 Ga0395899_0352505_20_883 273
55 3300037418 Ga0395900_0171260 Ga0395900_0171260_176_1039 273
56 3300038443 Ga0395901_0083434 Ga0395901_0083434_1444_2307 273
57 3300005548 Ga0070665_100000067 Ga0070665_1000000675 274
58 3300009094 Ga0111539_10061223 Ga0111539_100612231 274
59 3300025908 Ga0207643_10126928 Ga0207643_101269281 274
60 3300028379 Ga0268266_10000002 Ga0268266_1000000279 274
61 3300003214 JGI25165J46597_1000065 JGI25165J46597_100006578 275
62 3300005339 Ga0070660_100377135 Ga0070660_1003771351 275
63 3300005366 Ga0070659_100090047 Ga0070659_1000900472 275
64 3300005444 Ga0070694_100061256 Ga0070694_1000612563 275
65 3300005467 Ga0070706_100137583 Ga0070706_1001375832 275
66 3300005546 Ga0070696_100036650 Ga0070696_1000366502 275
67 3300025261 Ga0209233_1000107 Ga0209233_1000107130 275
68 3300025912 Ga0207707_10387583 Ga0207707_103875832 275
69 3300025917 Ga0207660_10530421 Ga0207660_105304211 275
70 3300025919 Ga0207657_10299024 Ga0207657_102990241 275
71 3300025932 Ga0207690_10362458 Ga0207690_103624582 275
72 3300025935 Ga0207709_10130993 Ga0207709_101309932 275
73 3300037471 Ga0395905_0578907 Ga0395905_0578907_74_952 275
74 3300042120 Ga0450917_001419 Ga0450917_001419_235_1122 275
75 3300042142 Ga0450905_000986 Ga0450905_000986_1673_2560 275
76 3300042144 Ga0450889_000060 Ga0450889_000060_1300_2187 275
77 3300046660 Ga0495625_0000860 Ga0495625_0000860_36137_37093 275
78 3300047472 Ga0495686_0000600 Ga0495686_0000600_45994_46947 275
79 3300053134 Ga0500658_0004026 Ga0500658_0004026_4233_5183 275
80 3300005354 Ga0070675_100137900 Ga0070675_1001379001 276
81 3300005366 Ga0070659_100192100 Ga0070659_1001921002 276
82 3300005563 Ga0068855_100136178 Ga0068855_1001361782 276
83 3300013100 Ga0157373_10151099 Ga0157373_101510992 276
84 3300025904 Ga0207647_10019369 Ga0207647_100193695 276
85 3300025925 Ga0207650_10036679 Ga0207650_100366792 276
86 3300025933 Ga0207706_10087222 Ga0207706_100872224 276
87 3300046506 Ga0495583_0019541 Ga0495583_0019541_909_1910 276
88 3300046518 Ga0495631_0077242 Ga0495631_0077242_81_1082 276
89 3300046524 Ga0495648_0000433 Ga0495648_0000433_31413_32414 276
90 3300046524 Ga0495648_0121628 Ga0495648_0121628_385_1386 276
91 3300046525 Ga0495663_0000282 Ga0495663_0000282_257_1258 276
92 3300046660 Ga0495625_0060406 Ga0495625_0060406_491_1492 276
93 3300047323 Ga0495683_0015599 Ga0495683_0015599_408_1409 276
94 3300047470 Ga0495681_0005160 Ga0495681_0005160_7288_8289 276
95 3300048907 Ga0496104_0625397 Ga0496104_0625397_73_918 276
96 3300048912 Ga0496109_0236653 Ga0496109_0236653_181_1182 276
97 3300048915 Ga0496112_0499608 Ga0496112_0499608_65_1066 276
98 3300048916 Ga0496113_0047318 Ga0496113_0047318_874_1875 276
99 3300048926 Ga0496123_0020876 Ga0496123_0020876_3280_4281 276
100 3300048928 Ga0496125_0001208 Ga0496125_0001208_3287_4288 276
101 3300053130 Ga0500642_0006122 Ga0500642_0006122_516_1517 276
102 3300003215 JGI25153J46596_10000007 JGI25153J46596_1000000751 277
103 3300003759 Ga0055525_1000080 Ga0055525_100008070 277
104 3300003762 Ga0055542_1000012 Ga0055542_1000012230 277
105 3300003763 Ga0055529_1000002 Ga0055529_1000002146 277
106 3300003763 Ga0055529_1000004 Ga0055529_1000004373 277
107 3300005328 Ga0070676_10222297 Ga0070676_102222971 277
108 3300005356 Ga0070674_100002142 Ga0070674_1000021428 277
109 3300005356 Ga0070674_100049373 Ga0070674_1000493733 277
110 3300005356 Ga0070674_100177605 Ga0070674_1001776052 277
111 3300005364 Ga0070673_100049988 Ga0070673_1000499883 277
112 3300005456 Ga0070678_100001712 Ga0070678_1000017128 277
113 3300005457 Ga0070662_100109461 Ga0070662_1001094612 277
114 3300005459 Ga0068867_100010806 Ga0068867_1000108066 277
115 3300005548 Ga0070665_100021263 Ga0070665_1000212634 277
116 3300006237 Ga0097621_100116346 Ga0097621_1001163462 277
117 3300009148 Ga0105243_10000522 Ga0105243_1000052234 277
118 3300009176 Ga0105242_10227480 Ga0105242_102274801 277
119 3300011119 Ga0105246_10043892 Ga0105246_100438924 277
120 3300013296 Ga0157374_10070272 Ga0157374_100702722 277
121 3300025226 Ga0209674_105513 Ga0209674_1055132 277
122 3300025230 Ga0209563_100058 Ga0209563_100058191 277
123 3300025253 Ga0209677_103797 Ga0209677_1037974 277
124 3300025254 Ga0209148_1000008 Ga0209148_1000008864 277
125 3300025261 Ga0209233_1004527 Ga0209233_10045273 277
126 3300025272 Ga0209455_1000002 Ga0209455_1000002561 277
127 3300025297 Ga0209758_1000017 Ga0209758_100001752 277
128 3300025920 Ga0207649_10266938 Ga0207649_102669382 277
129 3300025935 Ga0207709_10000109 Ga0207709_1000010977 277
130 3300025937 Ga0207669_10000359 Ga0207669_100003594 277
131 3300025937 Ga0207669_10001539 Ga0207669_100015394 277
132 3300025938 Ga0207704_10015989 Ga0207704_100159892 277
133 3300026121 Ga0207683_10001189 Ga0207683_1000118917 277
134 3300028786 Ga0307517_10040445 Ga0307517_100404455 277
135 3300031456 Ga0307513_10003398 Ga0307513_1000339817 277
136 3300045049 Ga0466959_0161612 Ga0466959_0161612_276_1133 277
137 3300046452 Ga0495617_007659 Ga0495617_007659_290_1294 277
138 3300046459 Ga0495629_0050339 Ga0495629_0050339_323_1327 277
139 3300046471 Ga0495650_0000535 Ga0495650_0000535_3759_4763 277
140 3300046500 Ga0495596_0005441 Ga0495596_0005441_3679_4683 277
141 3300046506 Ga0495583_0003199 Ga0495583_0003199_8561_9565 277
142 3300046506 Ga0495583_0010010 Ga0495583_0010010_4142_5146 277
143 3300046507 Ga0495606_0000071 Ga0495606_0000071_45474_46478 277
144 3300046518 Ga0495631_0011246 Ga0495631_0011246_731_1741 277
145 3300046518 Ga0495631_0045058 Ga0495631_0045058_21_1025 277
146 3300046522 Ga0495643_0000732 Ga0495643_0000732_34867_35871 277
147 3300046522 Ga0495643_0001351 Ga0495643_0001351_517_1521 277
148 3300046524 Ga0495648_0130853 Ga0495648_0130853_21_1025 277
149 3300046528 Ga0495642_0001975 Ga0495642_0001975_7311_8315 277
150 3300046536 Ga0495587_0011414 Ga0495587_0011414_4003_5007 277
151 3300046542 Ga0495597_0008373 Ga0495597_0008373_954_1958 277
152 3300046558 Ga0495633_0002247 Ga0495633_0002247_3331_4341 277
153 3300046616 Ga0495668_0000098 Ga0495668_0000098_3757_4761 277
154 3300046616 Ga0495668_0034201 Ga0495668_0034201_522_1526 277
155 3300046660 Ga0495625_0000427 Ga0495625_0000427_61909_62913 277
156 3300046660 Ga0495625_0115557 Ga0495625_0115557_802_1806 277
157 3300046684 Ga0495669_0000043 Ga0495669_0000043_82108_83112 277
158 3300046691 Ga0495670_0102897 Ga0495670_0102897_172_1182 277
159 3300046809 Ga0495600_0007622 Ga0495600_0007622_2222_3226 277
160 3300047323 Ga0495683_0025405 Ga0495683_0025405_521_1525 277
161 3300047443 Ga0495687_000597 Ga0495687_000597_3256_4260 277
162 3300047443 Ga0495687_001875 Ga0495687_001875_13861_14865 277
163 3300047445 Ga0495677_0003207 Ga0495677_0003207_524_1528 277
164 3300047469 Ga0495673_0085504 Ga0495673_0085504_27_1031 277
165 3300048904 Ga0496101_0082827 Ga0496101_0082827_370_1377 277
166 3300048905 Ga0496102_0000092 Ga0496102_0000092_5374_6381 277
167 3300048906 Ga0496103_0000101 Ga0496103_0000101_3489_4496 277
168 3300048907 Ga0496104_0042934 Ga0496104_0042934_1027_2034 277
169 3300048908 Ga0496105_0006455 Ga0496105_0006455_3022_4029 277
170 3300048913 Ga0496110_0008709 Ga0496110_0008709_3884_4891 277
171 3300048914 Ga0496111_0008693 Ga0496111_0008693_511_1518 277
172 3300048917 Ga0496114_0001189 Ga0496114_0001189_17932_18939 277
173 3300048918 Ga0496115_0000038 Ga0496115_0000038_120831_121838 277
174 3300048919 Ga0496116_0018815 Ga0496116_0018815_3813_4820 277
175 3300048920 Ga0496117_0000173 Ga0496117_0000173_128915_129922 277
176 3300048921 Ga0496118_0000131 Ga0496118_0000131_3327_4334 277
177 3300048922 Ga0496119_0017008 Ga0496119_0017008_1398_2405 277
178 3300048923 Ga0496120_0067331 Ga0496120_0067331_646_1653 277
179 3300048924 Ga0496121_0000209 Ga0496121_0000209_3305_4312 277
180 3300048927 Ga0496124_0000166 Ga0496124_0000166_3495_4502 277
181 3300048929 Ga0496126_0000222 Ga0496126_0000222_119605_120612 277
182 3300053079 Ga0500610_0000147 Ga0500610_0000147_16817_17821 277
183 3300053119 Ga0500595_002101 Ga0500595_002101_3685_4689 277
184 3300053177 Ga0500636_0002292 Ga0500636_0002292_3342_4346 277
185 3300053730 Ga0500645_000267 Ga0500645_000267_33298_34302 277
186 3300001915 JGI24741J21665_1001312 JGI24741J21665_10013122 278
187 3300001979 JGI24740J21852_10002628 JGI24740J21852_100026287 278
188 3300001990 JGI24737J22298_10002951 JGI24737J22298_100029516 278
189 3300005339 Ga0070660_100027883 Ga0070660_1000278833 278
190 3300005344 Ga0070661_100039175 Ga0070661_1000391752 278
191 3300005366 Ga0070659_100037103 Ga0070659_1000371033 278
192 3300005455 Ga0070663_100008440 Ga0070663_1000084406 278
193 3300005530 Ga0070679_100168087 Ga0070679_1001680872 278
194 3300005564 Ga0070664_100172245 Ga0070664_1001722452 278
195 3300005834 Ga0068851_10015118 Ga0068851_100151183 278
196 3300005842 Ga0068858_100000132 Ga0068858_10000013216 278
197 3300009098 Ga0105245_10000680 Ga0105245_1000068012 278
198 3300009174 Ga0105241_10007202 Ga0105241_100072027 278
199 3300009545 Ga0105237_10154576 Ga0105237_101545761 278
200 3300009551 Ga0105238_10025669 Ga0105238_100256693 278
201 3300013102 Ga0157371_10000148 Ga0157371_1000014865 278
202 3300013296 Ga0157374_10140437 Ga0157374_101404373 278
203 3300013297 Ga0157378_10097810 Ga0157378_100978103 278
204 3300013306 Ga0163162_10495130 Ga0163162_104951302 278
205 3300025321 Ga0207656_10000555 Ga0207656_1000055514 278
206 3300025909 Ga0207705_10000702 Ga0207705_100007028 278
207 3300025913 Ga0207695_10029219 Ga0207695_100292193 278
208 3300025919 Ga0207657_10005868 Ga0207657_100058689 278
209 3300025920 Ga0207649_10008010 Ga0207649_100080105 278
210 3300025921 Ga0207652_10069753 Ga0207652_100697532 278
211 3300025924 Ga0207694_10014265 Ga0207694_100142656 278
212 3300025927 Ga0207687_10000572 Ga0207687_1000057212 278
213 3300025932 Ga0207690_10012696 Ga0207690_100126963 278
214 3300025932 Ga0207690_10027771 Ga0207690_100277713 278
215 3300025949 Ga0207667_10000074 Ga0207667_1000007410 278
216 3300025981 Ga0207640_10001242 Ga0207640_100012422 278
217 3300026035 Ga0207703_10001668 Ga0207703_1000166816 278
218 3300026041 Ga0207639_10130901 Ga0207639_101309012 278
219 3300026067 Ga0207678_10010383 Ga0207678_100103839 278
220 3300026078 Ga0207702_10001342 Ga0207702_100013428 278
221 3300026116 Ga0207674_10016601 Ga0207674_100166017 278
222 3300026142 Ga0207698_10002456 Ga0207698_1000245612 278
223 3300031616 Ga0307508_10000356 Ga0307508_1000035622 278
224 3300037418 Ga0395900_0062159 Ga0395900_0062159_2515_3417 278
225 3300044694 Ga0466963_0062754 Ga0466963_0062754_1063_1923 278
226 3300044842 Ga0466957_0160011 Ga0466957_0160011_285_1145 278
227 3300045976 Ga0466967_0128786 Ga0466967_0128786_133_993 278
228 3300048924 Ga0496121_0000652 Ga0496121_0000652_3793_4752 278
229 3300053735 Ga0500596_000434 Ga0500596_000434_480_1502 278
230 3300005354 Ga0070675_100417732 Ga0070675_1004177321 279
231 3300005457 Ga0070662_100008480 Ga0070662_1000084804 279
232 3300013297 Ga0157378_10042205 Ga0157378_100422053 279
233 3300025926 Ga0207659_10366304 Ga0207659_103663042 279
234 3300025933 Ga0207706_10016273 Ga0207706_100162737 279
235 3300028786 Ga0307517_10009682 Ga0307517_100096826 279
236 3300005331 Ga0070670_100034115 Ga0070670_1000341152 280
237 3300005335 Ga0070666_10002971 Ga0070666_100029717 280
238 3300005338 Ga0068868_100072400 Ga0068868_1000724004 280
239 3300005354 Ga0070675_100022550 Ga0070675_1000225502 280
240 3300005355 Ga0070671_100079772 Ga0070671_1000797723 280
241 3300005364 Ga0070673_100000526 Ga0070673_1000005264 280
242 3300005367 Ga0070667_100013712 Ga0070667_1000137126 280
243 3300005456 Ga0070678_100026409 Ga0070678_1000264095 280
244 3300005457 Ga0070662_100031341 Ga0070662_1000313414 280
245 3300005466 Ga0070685_10059227 Ga0070685_100592273 280
246 3300005548 Ga0070665_100062601 Ga0070665_1000626015 280
247 3300005564 Ga0070664_100055897 Ga0070664_1000558974 280
248 3300005616 Ga0068852_100257577 Ga0068852_1002575772 280
249 3300005618 Ga0068864_100038826 Ga0068864_1000388264 280
250 3300005842 Ga0068858_100019414 Ga0068858_1000194146 280
251 3300006358 Ga0068871_100018077 Ga0068871_1000180776 280
252 3300009101 Ga0105247_10288857 Ga0105247_102888572 280
253 3300009177 Ga0105248_10053309 Ga0105248_100533092 280
254 3300013102 Ga0157371_10028512 Ga0157371_100285124 280
255 3300013296 Ga0157374_10002253 Ga0157374_100022535 280
256 3300013306 Ga0163162_10010319 Ga0163162_100103194 280
257 3300013308 Ga0157375_10011554 Ga0157375_100115545 280
258 3300014325 Ga0163163_10002706 Ga0163163_100027063 280
259 3300025903 Ga0207680_10008315 Ga0207680_100083154 280
260 3300025925 Ga0207650_10005864 Ga0207650_100058649 280
261 3300025931 Ga0207644_10000614 Ga0207644_1000061423 280
262 3300025933 Ga0207706_10078803 Ga0207706_100788034 280
263 3300025940 Ga0207691_10021942 Ga0207691_100219426 280
264 3300025941 Ga0207711_10011304 Ga0207711_100113046 280
265 3300025945 Ga0207679_10049190 Ga0207679_100491903 280
266 3300025960 Ga0207651_10020954 Ga0207651_100209542 280
267 3300025986 Ga0207658_10153378 Ga0207658_101533782 280
268 3300026023 Ga0207677_10100638 Ga0207677_101006382 280
269 3300026088 Ga0207641_10003063 Ga0207641_100030634 280
270 3300026095 Ga0207676_10001223 Ga0207676_1000122322 280
271 3300026121 Ga0207683_10049845 Ga0207683_100498454 280
272 3300026142 Ga0207698_10241134 Ga0207698_102411342 280
273 3300028379 Ga0268266_10046045 Ga0268266_100460454 280
274 3300042012 Ga0439455_0015588 Ga0439455_0015588_535_1425 280
275 3300042157 Ga0439458_0007395 Ga0439458_0007395_556_1446 280
276 3300044842 Ga0466957_0054643 Ga0466957_0054643_217_1107 280
277 3300048906 Ga0496103_0059631 Ga0496103_0059631_635_1483 280
278 3300048911 Ga0496108_0002906 Ga0496108_0002906_940_1788 280
279 3300048912 Ga0496109_0006553 Ga0496109_0006553_957_1805 280
280 3300048913 Ga0496110_0033905 Ga0496110_0033905_3279_4127 280
281 3300048914 Ga0496111_0002376 Ga0496111_0002376_987_1835 280
282 3300048915 Ga0496112_0061899 Ga0496112_0061899_738_1586 280
283 3300048916 Ga0496113_0011965 Ga0496113_0011965_2230_3078 280
284 3300048917 Ga0496114_0203216 Ga0496114_0203216_716_1564 280
285 3300005354 Ga0070675_100249451 Ga0070675_1002494512 281
286 3300005543 Ga0070672_100047900 Ga0070672_1000479004 281
287 3300025925 Ga0207650_10156255 Ga0207650_101562552 281
288 3300025940 Ga0207691_10031381 Ga0207691_100313815 281
289 3300032004 Ga0307414_10241334 Ga0307414_102413341 281
290 3300032005 Ga0307411_10254276 Ga0307411_102542762 281
291 3300037418 Ga0395900_0106959 Ga0395900_0106959_978_1868 281
292 3300037466 Ga0395898_0019188 Ga0395898_0019188_294_1184 281
293 3300037471 Ga0395905_0071420 Ga0395905_0071420_535_1425 281
294 3300038443 Ga0395901_0028743 Ga0395901_0028743_3305_4195 281
295 3300042157 Ga0439458_0000590 Ga0439458_0000590_3423_4274 281
296 3300048913 Ga0496110_0493540 Ga0496110_0493540_234_1085 281
297 3300031995 Ga0307409_100248451 Ga0307409_1002484512 282
298 3300037418 Ga0395900_0327259 Ga0395900_0327259_18_908 282
299 3300037471 Ga0395905_0064094 Ga0395905_0064094_221_1111 282
300 3300037471 Ga0395905_0135768 Ga0395905_0135768_1008_1862 282
301 3300038443 Ga0395901_0053134 Ga0395901_0053134_2099_2989 282
302 3300046537 Ga0495598_0034026 Ga0495598_0034026_216_1151 282
303 3300031852 Ga0307410_10045915 Ga0307410_100459152 283
304 3300031901 Ga0307406_10092330 Ga0307406_100923302 283
305 3300044656 Ga0466969_0029974 Ga0466969_0029974_236_1096 283
306 3300044684 Ga0466966_0013413 Ga0466966_0013413_2667_3527 283
307 3300005355 Ga0070671_100040369 Ga0070671_1000403692 284
308 3300005548 Ga0070665_100049036 Ga0070665_1000490364 284
309 3300006358 Ga0068871_100118178 Ga0068871_1001181782 284
310 3300009177 Ga0105248_10007546 Ga0105248_100075466 284
311 3300025931 Ga0207644_10017567 Ga0207644_100175677 284
312 3300025933 Ga0207706_10068152 Ga0207706_100681522 284
313 3300025941 Ga0207711_10006917 Ga0207711_100069177 284
314 3300028379 Ga0268266_10166318 Ga0268266_101663183 284
315 3300037418 Ga0395900_0036295 Ga0395900_0036295_3042_3917 284
316 3300037471 Ga0395905_0058040 Ga0395905_0058040_755_1630 284
317 3300048903 Ga0496100_0029988 Ga0496100_0029988_996_1940 284
318 3300048904 Ga0496101_0010849 Ga0496101_0010849_3438_4382 284
319 3300048910 Ga0496107_0002900 Ga0496107_0002900_4835_5779 284
320 3300048917 Ga0496114_0003038 Ga0496114_0003038_11516_12460 284
321 3300048918 Ga0496115_0020881 Ga0496115_0020881_3685_4629 284
322 3300005578 Ga0068854_100498957 Ga0068854_1004989572 285
323 3300025981 Ga0207640_10157226 Ga0207640_101572261 285
324 3300037312 Ga0395899_0070866 Ga0395899_0070866_1365_2243 285
325 3300013100 Ga0157373_10035475 Ga0157373_100354756 286
326 3300031548 Ga0307408_100243896 Ga0307408_1002438962 286
327 3300031824 Ga0307413_10076619 Ga0307413_100766192 286
328 3300031852 Ga0307410_10035145 Ga0307410_100351453 286
329 3300031903 Ga0307407_10155856 Ga0307407_101558562 286
330 3300031995 Ga0307409_100008827 Ga0307409_1000088273 286
331 3300032004 Ga0307414_10098254 Ga0307414_100982543 286
332 3300032005 Ga0307411_10001313 Ga0307411_100013137 286
333 3300032126 Ga0307415_100341727 Ga0307415_1003417272 286
334 3300005331 Ga0070670_100017478 Ga0070670_1000174784 287
335 3300005456 Ga0070678_100055808 Ga0070678_1000558082 287
336 3300005457 Ga0070662_100175010 Ga0070662_1001750102 287
337 3300005564 Ga0070664_100234275 Ga0070664_1002342751 287
338 3300005618 Ga0068864_100017019 Ga0068864_1000170195 287
339 3300013100 Ga0157373_10034110 Ga0157373_100341105 287
340 3300013296 Ga0157374_10006457 Ga0157374_100064573 287
341 3300013306 Ga0163162_10579082 Ga0163162_105790822 287
342 3300026095 Ga0207676_10202653 Ga0207676_102026533 287
343 3300026121 Ga0207683_10080418 Ga0207683_100804182 287
344 3300044694 Ga0466963_0043158 Ga0466963_0043158_1300_2166 287
345 3300044842 Ga0466957_0040546 Ga0466957_0040546_50_916 287
346 3300045836 Ga0466958_0028552 Ga0466958_0028552_1768_2634 287
347 3300045976 Ga0466967_0006997 Ga0466967_0006997_3221_4087 287
348 3300005331 Ga0070670_100046505 Ga0070670_1000465056 288
349 3300005335 Ga0070666_10088106 Ga0070666_100881063 288
350 3300005335 Ga0070666_10090277 Ga0070666_100902772 288
351 3300005337 Ga0070682_100230083 Ga0070682_1002300832 288
352 3300005339 Ga0070660_100031694 Ga0070660_1000316945 288
353 3300005344 Ga0070661_100180550 Ga0070661_1001805502 288
354 3300005344 Ga0070661_100338265 Ga0070661_1003382651 288
355 3300005353 Ga0070669_100241665 Ga0070669_1002416652 288
356 3300005355 Ga0070671_100102174 Ga0070671_1001021741 288
357 3300005356 Ga0070674_100179494 Ga0070674_1001794942 288
358 3300005356 Ga0070674_100316929 Ga0070674_1003169292 288
359 3300005364 Ga0070673_100100394 Ga0070673_1001003942 288
360 3300005366 Ga0070659_100033445 Ga0070659_1000334452 288
361 3300005367 Ga0070667_100056858 Ga0070667_1000568583 288
362 3300005367 Ga0070667_100483504 Ga0070667_1004835042 288
363 3300005456 Ga0070678_100088158 Ga0070678_1000881582 288
364 3300005456 Ga0070678_100148461 Ga0070678_1001484613 288
365 3300005457 Ga0070662_100107260 Ga0070662_1001072602 288
366 3300005466 Ga0070685_10070701 Ga0070685_100707012 288
367 3300005842 Ga0068858_100225699 Ga0068858_1002256992 288
368 3300006358 Ga0068871_100132682 Ga0068871_1001326821 288
369 3300025903 Ga0207680_10035012 Ga0207680_100350123 288
370 3300025931 Ga0207644_10051182 Ga0207644_100511822 288
371 3300025937 Ga0207669_10030009 Ga0207669_100300092 288
372 3300025940 Ga0207691_10252389 Ga0207691_102523892 288
373 3300025941 Ga0207711_10007240 Ga0207711_100072406 288
374 3300025960 Ga0207651_10017897 Ga0207651_100178972 288
375 3300025986 Ga0207658_10091650 Ga0207658_100916502 288
376 3300026023 Ga0207677_10137600 Ga0207677_101376002 288
377 3300026121 Ga0207683_10128444 Ga0207683_101284443 288
378 3300028379 Ga0268266_10269385 Ga0268266_102693852 288
379 3300037471 Ga0395905_0104119 Ga0395905_0104119_270_1142 288
380 3300044842 Ga0466957_0039900 Ga0466957_0039900_46_942 288
381 3300045836 Ga0466958_0032340 Ga0466958_0032340_41_937 288
382 3300005331 Ga0070670_100453696 Ga0070670_1004536962 289
383 3300005344 Ga0070661_100214084 Ga0070661_1002140842 289
384 3300005355 Ga0070671_100002090 Ga0070671_1000020906 289
385 3300005364 Ga0070673_100243256 Ga0070673_1002432562 289
386 3300005543 Ga0070672_100085892 Ga0070672_1000858922 289
387 3300005548 Ga0070665_100347397 Ga0070665_1003473972 289
388 3300005564 Ga0070664_100053058 Ga0070664_1000530582 289
389 3300005564 Ga0070664_100295690 Ga0070664_1002956901 289
390 3300005564 Ga0070664_100324974 Ga0070664_1003249742 289
391 3300005578 Ga0068854_100047615 Ga0068854_1000476153 289
392 3300005618 Ga0068864_100015861 Ga0068864_1000158612 289
393 3300005718 Ga0068866_10031671 Ga0068866_100316712 289
394 3300005841 Ga0068863_100044982 Ga0068863_1000449822 289
395 3300006237 Ga0097621_100112728 Ga0097621_1001127283 289
396 3300009147 Ga0114129_10223981 Ga0114129_102239813 289
397 3300009177 Ga0105248_10039813 Ga0105248_100398136 289
398 3300009177 Ga0105248_10833404 Ga0105248_108334042 289
399 3300011119 Ga0105246_10093439 Ga0105246_100934392 289
400 3300013102 Ga0157371_10060370 Ga0157371_100603703 289
401 3300013102 Ga0157371_10161522 Ga0157371_101615222 289
402 3300013296 Ga0157374_10219268 Ga0157374_102192681 289
403 3300013306 Ga0163162_10405206 Ga0163162_104052062 289
404 3300013306 Ga0163162_10448352 Ga0163162_104483522 289
405 3300013308 Ga0157375_10006249 Ga0157375_1000624911 289
406 3300013308 Ga0157375_10250951 Ga0157375_102509512 289
407 3300014745 Ga0157377_10034241 Ga0157377_100342412 289
408 3300014969 Ga0157376_10230628 Ga0157376_102306282 289
409 3300025899 Ga0207642_10004807 Ga0207642_100048072 289
410 3300025901 Ga0207688_10006467 Ga0207688_100064672 289
411 3300025907 Ga0207645_10047494 Ga0207645_100474944 289
412 3300025919 Ga0207657_10198325 Ga0207657_101983251 289
413 3300025923 Ga0207681_10114876 Ga0207681_101148762 289
414 3300025925 Ga0207650_10041114 Ga0207650_100411143 289
415 3300025925 Ga0207650_10049639 Ga0207650_100496391 289
416 3300025927 Ga0207687_10268920 Ga0207687_102689202 289
417 3300025931 Ga0207644_10000747 Ga0207644_100007478 289
418 3300025933 Ga0207706_10087387 Ga0207706_100873871 289
419 3300025937 Ga0207669_10052570 Ga0207669_100525702 289
420 3300025940 Ga0207691_10057234 Ga0207691_100572343 289
421 3300025941 Ga0207711_10029005 Ga0207711_100290056 289
422 3300025942 Ga0207689_10071034 Ga0207689_100710342 289
423 3300025945 Ga0207679_10001488 Ga0207679_100014886 289
424 3300025960 Ga0207651_10162727 Ga0207651_101627272 289
425 3300025960 Ga0207651_10400399 Ga0207651_104003992 289
426 3300025986 Ga0207658_10292784 Ga0207658_102927842 289
427 3300026067 Ga0207678_10038145 Ga0207678_100381454 289
428 3300026089 Ga0207648_10002768 Ga0207648_100027684 289
429 3300026095 Ga0207676_10238605 Ga0207676_102386051 289
430 3300026121 Ga0207683_10084215 Ga0207683_100842153 289
431 3300031824 Ga0307413_10098929 Ga0307413_100989292 289
432 3300032002 Ga0307416_100149259 Ga0307416_1001492592 289
433 3300037312 Ga0395899_0042526 Ga0395899_0042526_294_1169 289
434 3300037471 Ga0395905_0000104 Ga0395905_0000104_98670_99545 289
435 3300037471 Ga0395905_0281686 Ga0395905_0281686_42_917 289
436 3300038443 Ga0395901_0576660 Ga0395901_0576660_59_934 289
437 3300044658 Ga0466972_0077259 Ga0466972_0077259_673_1548 289
438 3300044684 Ga0466966_0031937 Ga0466966_0031937_292_1188 289
439 3300044765 Ga0466970_0061628 Ga0466970_0061628_359_1255 289
440 3300044765 Ga0466970_0084406 Ga0466970_0084406_786_1685 289
441 3300044765 Ga0466970_0242063 Ga0466970_0242063_77_976 289
442 3300044842 Ga0466957_0022875 Ga0466957_0022875_2127_3026 289
443 3300045836 Ga0466958_0013804 Ga0466958_0013804_2992_3891 289
444 3300046506 Ga0495583_0088651 Ga0495583_0088651_337_1212 289
445 3300046616 Ga0495668_0053335 Ga0495668_0053335_1147_2022 289
446 3300046684 Ga0495669_0007885 Ga0495669_0007885_1879_2754 289
447 3300046684 Ga0495669_0009309 Ga0495669_0009309_1643_2518 289
448 3300046684 Ga0495669_0074673 Ga0495669_0074673_110_985 289
449 3300048906 Ga0496103_0090215 Ga0496103_0090215_901_1776 289
450 3300048911 Ga0496108_0003739 Ga0496108_0003739_7647_8522 289
451 3300048911 Ga0496108_0006177 Ga0496108_0006177_5411_6286 289
452 3300048912 Ga0496109_0013577 Ga0496109_0013577_3231_4106 289
453 3300048913 Ga0496110_0046307 Ga0496110_0046307_1944_2819 289
454 3300048915 Ga0496112_0010745 Ga0496112_0010745_6596_7471 289
455 3300048915 Ga0496112_0050186 Ga0496112_0050186_2237_3112 289
456 3300048916 Ga0496113_0006279 Ga0496113_0006279_2991_3866 289
457 3300048916 Ga0496113_0335835 Ga0496113_0335835_53_928 289
458 3300048917 Ga0496114_0000029 Ga0496114_0000029_32154_33023 289
459 3300049765 Ga0501268_022242 Ga0501268_022242_198_1070 289
460 3300053083 Ga0495655_0009272 Ga0495655_0009272_294_1169 289
461 3300001990 JGI24737J22298_10003882 JGI24737J22298_100038825 290
462 3300002067 JGI24735J21928_10034551 JGI24735J21928_100345512 290
463 3300002075 JGI24738J21930_10023956 JGI24738J21930_100239562 290
464 3300005327 Ga0070658_10005785 Ga0070658_100057853 290
465 3300005327 Ga0070658_10058220 Ga0070658_100582203 290
466 3300005327 Ga0070658_10432808 Ga0070658_104328082 290
467 3300005329 Ga0070683_100014717 Ga0070683_1000147176 290
468 3300005331 Ga0070670_100061091 Ga0070670_1000610914 290
469 3300005336 Ga0070680_100001257 Ga0070680_1000012575 290
470 3300005339 Ga0070660_100011824 Ga0070660_1000118246 290
471 3300005339 Ga0070660_100029369 Ga0070660_1000293694 290
472 3300005344 Ga0070661_100041131 Ga0070661_1000411314 290
473 3300005344 Ga0070661_100057595 Ga0070661_1000575954 290
474 3300005355 Ga0070671_100010165 Ga0070671_1000101657 290
475 3300005355 Ga0070671_100013194 Ga0070671_1000131946 290
476 3300005355 Ga0070671_100015041 Ga0070671_1000150413 290
477 3300005355 Ga0070671_100024137 Ga0070671_1000241372 290
478 3300005355 Ga0070671_100255942 Ga0070671_1002559422 290
479 3300005364 Ga0070673_100075965 Ga0070673_1000759651 290
480 3300005366 Ga0070659_100081853 Ga0070659_1000818533 290
481 3300005366 Ga0070659_100105558 Ga0070659_1001055583 290
482 3300005455 Ga0070663_100042383 Ga0070663_1000423834 290
483 3300005455 Ga0070663_100046448 Ga0070663_1000464482 290
484 3300005456 Ga0070678_100013930 Ga0070678_1000139304 290
485 3300005456 Ga0070678_100030421 Ga0070678_1000304215 290
486 3300005457 Ga0070662_100020844 Ga0070662_1000208444 290
487 3300005457 Ga0070662_100447501 Ga0070662_1004475012 290
488 3300005458 Ga0070681_10179834 Ga0070681_101798342 290
489 3300005458 Ga0070681_10302226 Ga0070681_103022262 290
490 3300005530 Ga0070679_100041620 Ga0070679_1000416202 290
491 3300005530 Ga0070679_100368457 Ga0070679_1003684572 290
492 3300005530 Ga0070679_100510688 Ga0070679_1005106882 290
493 3300005546 Ga0070696_100132326 Ga0070696_1001323263 290
494 3300005547 Ga0070693_100131924 Ga0070693_1001319242 290
495 3300005563 Ga0068855_100025356 Ga0068855_1000253566 290
496 3300005564 Ga0070664_100023816 Ga0070664_1000238163 290
497 3300005564 Ga0070664_100138913 Ga0070664_1001389132 290
498 3300005564 Ga0070664_100224907 Ga0070664_1002249072 290
499 3300005577 Ga0068857_100000489 Ga0068857_10000048917 290
500 3300005577 Ga0068857_100039061 Ga0068857_1000390613 290
501 3300005578 Ga0068854_100094980 Ga0068854_1000949802 290
502 3300005614 Ga0068856_100026683 Ga0068856_1000266832 290
503 3300005614 Ga0068856_100067148 Ga0068856_1000671485 290
504 3300005616 Ga0068852_100030485 Ga0068852_1000304854 290
505 3300005617 Ga0068859_100095345 Ga0068859_1000953454 290
506 3300005618 Ga0068864_100033561 Ga0068864_1000335612 290
507 3300005834 Ga0068851_10043978 Ga0068851_100439783 290
508 3300005841 Ga0068863_100001894 Ga0068863_10000189414 290
509 3300005841 Ga0068863_100015595 Ga0068863_1000155953 290
510 3300005844 Ga0068862_100206171 Ga0068862_1002061711 290
511 3300006195 Ga0075366_10211493 Ga0075366_102114931 290
512 3300006237 Ga0097621_100152950 Ga0097621_1001529502 290
513 3300006358 Ga0068871_100588605 Ga0068871_1005886051 290
514 3300006931 Ga0097620_100095342 Ga0097620_1000953424 290
515 3300009177 Ga0105248_10096217 Ga0105248_100962174 290
516 3300009177 Ga0105248_10161249 Ga0105248_101612493 290
517 3300013100 Ga0157373_10065118 Ga0157373_100651183 290
518 3300013102 Ga0157371_10069090 Ga0157371_100690903 290
519 3300013102 Ga0157371_10092679 Ga0157371_100926792 290
520 3300013102 Ga0157371_10140539 Ga0157371_101405392 290
521 3300013296 Ga0157374_10548682 Ga0157374_105486822 290
522 3300014497 Ga0182008_10021494 Ga0182008_100214943 290
523 3300014968 Ga0157379_10003612 Ga0157379_1000361216 290
524 3300020082 Ga0206353_11121746 Ga0206353_111217462 290
525 3300021384 Ga0213876_10009352 Ga0213876_100093526 290
526 3300025321 Ga0207656_10038801 Ga0207656_100388011 290
527 3300025893 Ga0207682_10047573 Ga0207682_100475732 290
528 3300025903 Ga0207680_10078625 Ga0207680_100786252 290
529 3300025904 Ga0207647_10043548 Ga0207647_100435482 290
530 3300025909 Ga0207705_10000493 Ga0207705_1000049320 290
531 3300025909 Ga0207705_10006514 Ga0207705_100065148 290
532 3300025909 Ga0207705_10035332 Ga0207705_100353326 290
533 3300025912 Ga0207707_10107496 Ga0207707_101074962 290
534 3300025917 Ga0207660_10097667 Ga0207660_100976672 290
535 3300025917 Ga0207660_10334345 Ga0207660_103343452 290
536 3300025919 Ga0207657_10009843 Ga0207657_100098433 290
537 3300025919 Ga0207657_10017883 Ga0207657_100178834 290
538 3300025919 Ga0207657_10178342 Ga0207657_101783422 290
539 3300025921 Ga0207652_10000034 Ga0207652_10000034132 290
540 3300025923 Ga0207681_10206083 Ga0207681_102060832 290
541 3300025925 Ga0207650_10050942 Ga0207650_100509423 290
542 3300025926 Ga0207659_10058028 Ga0207659_100580282 290
543 3300025931 Ga0207644_10006207 Ga0207644_1000620710 290
544 3300025931 Ga0207644_10015601 Ga0207644_100156014 290
545 3300025931 Ga0207644_10060288 Ga0207644_100602882 290
546 3300025931 Ga0207644_10363534 Ga0207644_103635342 290
547 3300025932 Ga0207690_10061043 Ga0207690_100610433 290
548 3300025932 Ga0207690_10426109 Ga0207690_104261092 290
549 3300025933 Ga0207706_10046530 Ga0207706_100465303 290
550 3300025937 Ga0207669_10030707 Ga0207669_100307074 290
551 3300025941 Ga0207711_10031078 Ga0207711_100310783 290
552 3300025941 Ga0207711_10045504 Ga0207711_100455045 290
553 3300025941 Ga0207711_10062395 Ga0207711_100623954 290
554 3300025944 Ga0207661_10009979 Ga0207661_100099794 290
555 3300025945 Ga0207679_10066068 Ga0207679_100660684 290
556 3300025945 Ga0207679_10380766 Ga0207679_103807662 290
557 3300025949 Ga0207667_10049976 Ga0207667_100499764 290
558 3300025960 Ga0207651_10070728 Ga0207651_100707283 290
559 3300025960 Ga0207651_10318509 Ga0207651_103185091 290
560 3300025981 Ga0207640_10078101 Ga0207640_100781012 290
561 3300025981 Ga0207640_10149938 Ga0207640_101499382 290
562 3300025986 Ga0207658_10087862 Ga0207658_100878622 290
563 3300026067 Ga0207678_10012950 Ga0207678_100129504 290
564 3300026067 Ga0207678_10017638 Ga0207678_100176384 290
565 3300026067 Ga0207678_10396879 Ga0207678_103968792 290
566 3300026078 Ga0207702_10044465 Ga0207702_100444652 290
567 3300026078 Ga0207702_10058235 Ga0207702_100582352 290
568 3300026088 Ga0207641_10005258 Ga0207641_1000525814 290
569 3300026088 Ga0207641_10012388 Ga0207641_100123887 290
570 3300026095 Ga0207676_10251700 Ga0207676_102517002 290
571 3300026095 Ga0207676_10685116 Ga0207676_106851161 290
572 3300026116 Ga0207674_10003897 Ga0207674_100038974 290
573 3300026116 Ga0207674_10005996 Ga0207674_100059966 290
574 3300026116 Ga0207674_10179584 Ga0207674_101795843 290
575 3300026121 Ga0207683_10015269 Ga0207683_100152696 290
576 3300026142 Ga0207698_10000672 Ga0207698_100006727 290
577 3300028380 Ga0268265_10158063 Ga0268265_101580631 290
578 3300028381 Ga0268264_10092534 Ga0268264_100925344 290
579 3300031731 Ga0307405_10021657 Ga0307405_100216574 290
580 3300032002 Ga0307416_100560135 Ga0307416_1005601351 290
581 3300032126 Ga0307415_100016305 Ga0307415_1000163052 290
582 3300037312 Ga0395899_0000669 Ga0395899_0000669_2189_3067 290
583 3300037312 Ga0395899_0031627 Ga0395899_0031627_2296_3174 290
584 3300037312 Ga0395899_0042725 Ga0395899_0042725_1228_2112 290
585 3300037418 Ga0395900_0000308 Ga0395900_0000308_9866_10744 290
586 3300037418 Ga0395900_0001779 Ga0395900_0001779_3581_4459 290
587 3300037418 Ga0395900_0003085 Ga0395900_0003085_1956_2840 290
588 3300037418 Ga0395900_0437944 Ga0395900_0437944_84_962 290
589 3300037466 Ga0395898_0001096 Ga0395898_0001096_11181_12059 290
590 3300037466 Ga0395898_0052037 Ga0395898_0052037_224_1102 290
591 3300037466 Ga0395898_0079198 Ga0395898_0079198_1016_1900 290
592 3300037471 Ga0395905_0000005 Ga0395905_0000005_483639_484517 290
593 3300037471 Ga0395905_0004102 Ga0395905_0004102_2990_3868 290
594 3300037471 Ga0395905_0008459 Ga0395905_0008459_1489_2367 290
595 3300037471 Ga0395905_0015364 Ga0395905_0015364_5332_6210 290
596 3300037471 Ga0395905_0036894 Ga0395905_0036894_199_1077 290
597 3300037471 Ga0395905_0037718 Ga0395905_0037718_1271_2155 290
598 3300037471 Ga0395905_0107222 Ga0395905_0107222_323_1204 290
599 3300038443 Ga0395901_0020938 Ga0395901_0020938_684_1562 290
600 3300038443 Ga0395901_0085676 Ga0395901_0085676_1139_2023 290
601 3300038443 Ga0395901_0167194 Ga0395901_0167194_165_1043 290
602 3300038443 Ga0395901_0282216 Ga0395901_0282216_387_1265 290
603 3300038443 Ga0395901_0341045 Ga0395901_0341045_463_1344 290
604 3300046537 Ga0495598_0004019 Ga0495598_0004019_1195_2073 290
605 3300046558 Ga0495633_0108868 Ga0495633_0108868_245_1123 290
606 3300046684 Ga0495669_0073756 Ga0495669_0073756_396_1274 290
607 3300046691 Ga0495670_0000071 Ga0495670_0000071_34749_35627 290
608 3300047445 Ga0495677_0120182 Ga0495677_0120182_63_950 290
609 3300048904 Ga0496101_0285753 Ga0496101_0285753_216_1094 290
610 3300048905 Ga0496102_0060901 Ga0496102_0060901_2164_3042 290
611 3300048906 Ga0496103_0051009 Ga0496103_0051009_216_1094 290
612 3300048907 Ga0496104_0240695 Ga0496104_0240695_384_1262 290
613 3300048909 Ga0496106_0016396 Ga0496106_0016396_4078_4956 290
614 3300048910 Ga0496107_0092038 Ga0496107_0092038_685_1563 290
615 3300048912 Ga0496109_0067116 Ga0496109_0067116_355_1233 290
616 3300048912 Ga0496109_0183840 Ga0496109_0183840_740_1627 290
617 3300048914 Ga0496111_0067683 Ga0496111_0067683_910_1788 290
618 3300048915 Ga0496112_0040084 Ga0496112_0040084_3636_4514 290
619 3300048915 Ga0496112_0147653 Ga0496112_0147653_273_1151 290
620 3300048916 Ga0496113_0005727 Ga0496113_0005727_3876_4754 290
621 3300049583 Ga0501067_0030314 Ga0501067_0030314_1640_2533 290
622 3300049583 Ga0501067_0147758 Ga0501067_0147758_344_1222 290
623 3300049584 Ga0501068_0202444 Ga0501068_0202444_216_1109 290
624 3300049585 Ga0501069_0195704 Ga0501069_0195704_113_1006 290
625 3300001979 JGI24740J21852_10064007 JGI24740J21852_100640071 291
626 3300005327 Ga0070658_10014069 Ga0070658_100140696 291
627 3300005327 Ga0070658_10033263 Ga0070658_100332632 291
628 3300005327 Ga0070658_10077703 Ga0070658_100777032 291
629 3300005339 Ga0070660_100055119 Ga0070660_1000551194 291
630 3300005366 Ga0070659_100083906 Ga0070659_1000839063 291
631 3300005435 Ga0070714_100221619 Ga0070714_1002216192 291
632 3300005458 Ga0070681_10172187 Ga0070681_101721871 291
633 3300005543 Ga0070672_100085857 Ga0070672_1000858572 291
634 3300005564 Ga0070664_100011449 Ga0070664_1000114498 291
635 3300005614 Ga0068856_100675248 Ga0068856_1006752481 291
636 3300005616 Ga0068852_100496465 Ga0068852_1004964652 291
637 3300005617 Ga0068859_100086744 Ga0068859_1000867444 291
638 3300005618 Ga0068864_100001058 Ga0068864_10000105822 291
639 3300006177 Ga0075362_10115478 Ga0075362_101154782 291
640 3300006931 Ga0097620_100086740 Ga0097620_1000867405 291
641 3300009177 Ga0105248_10000862 Ga0105248_1000086221 291
642 3300009177 Ga0105248_10030585 Ga0105248_100305852 291
643 3300013102 Ga0157371_10013911 Ga0157371_100139114 291
644 3300013104 Ga0157370_10085127 Ga0157370_100851272 291
645 3300013104 Ga0157370_10372834 Ga0157370_103728342 291
646 3300013105 Ga0157369_10082819 Ga0157369_100828193 291
647 3300014325 Ga0163163_10042407 Ga0163163_100424072 291
648 3300014968 Ga0157379_10229701 Ga0157379_102297012 291
649 3300025909 Ga0207705_10153617 Ga0207705_101536172 291
650 3300025909 Ga0207705_10311681 Ga0207705_103116812 291
651 3300025919 Ga0207657_10174931 Ga0207657_101749312 291
652 3300025932 Ga0207690_10250263 Ga0207690_102502632 291
653 3300025941 Ga0207711_10000344 Ga0207711_1000034425 291
654 3300025944 Ga0207661_10005561 Ga0207661_1000556111 291
655 3300026078 Ga0207702_10351556 Ga0207702_103515562 291
656 3300026095 Ga0207676_10001683 Ga0207676_1000168320 291
657 3300026142 Ga0207698_10482833 Ga0207698_104828332 291
658 3300037312 Ga0395899_0041264 Ga0395899_0041264_65_946 291
659 3300037312 Ga0395899_0045250 Ga0395899_0045250_1111_2049 291
660 3300037312 Ga0395899_0281051 Ga0395899_0281051_139_1032 291
661 3300037418 Ga0395900_0040236 Ga0395900_0040236_1832_2713 291
662 3300037418 Ga0395900_0063223 Ga0395900_0063223_2030_2911 291
663 3300037418 Ga0395900_0184621 Ga0395900_0184621_1135_2016 291
664 3300037418 Ga0395900_0192970 Ga0395900_0192970_1151_2044 291
665 3300037418 Ga0395900_0201824 Ga0395900_0201824_848_1729 291
666 3300037418 Ga0395900_0211619 Ga0395900_0211619_256_1137 291
667 3300037418 Ga0395900_0499229 Ga0395900_0499229_50_931 291
668 3300037466 Ga0395898_0053594 Ga0395898_0053594_799_1737 291
669 3300037466 Ga0395898_0233362 Ga0395898_0233362_438_1319 291
670 3300037466 Ga0395898_0343906 Ga0395898_0343906_413_1294 291
671 3300037471 Ga0395905_0013074 Ga0395905_0013074_1149_2030 291
672 3300037471 Ga0395905_0029447 Ga0395905_0029447_1384_2277 291
673 3300037471 Ga0395905_0107854 Ga0395905_0107854_225_1106 291
674 3300037471 Ga0395905_0475173 Ga0395905_0475173_61_942 291
675 3300038443 Ga0395901_0131734 Ga0395901_0131734_113_1006 291
676 3300038443 Ga0395901_0247424 Ga0395901_0247424_237_1130 291
677 3300038443 Ga0395901_0251336 Ga0395901_0251336_134_1015 291
678 3300039437 Ga0436365_0881543 Ga0436365_0881543_5176_6057 291
679 3300044719 Ga0466971_0060097 Ga0466971_0060097_192_1073 291
680 3300044842 Ga0466957_0139265 Ga0466957_0139265_587_1468 291
681 3300045049 Ga0466959_0048801 Ga0466959_0048801_1616_2497 291
682 3300045976 Ga0466967_0117662 Ga0466967_0117662_125_1006 291
683 3300045976 Ga0466967_0157070 Ga0466967_0157070_1168_2058 291
684 3300046528 Ga0495642_0068810 Ga0495642_0068810_290_1171 291
685 3300046528 Ga0495642_0078536 Ga0495642_0078536_89_982 291
686 3300048904 Ga0496101_0041590 Ga0496101_0041590_265_1146 291
687 3300048904 Ga0496101_0371510 Ga0496101_0371510_106_987 291
688 3300048907 Ga0496104_0137509 Ga0496104_0137509_803_1684 291
689 3300048909 Ga0496106_0001313 Ga0496106_0001313_14398_15279 291
690 3300048910 Ga0496107_0003295 Ga0496107_0003295_3910_4791 291
691 3300048910 Ga0496107_0011494 Ga0496107_0011494_1507_2388 291
692 3300048911 Ga0496108_0054179 Ga0496108_0054179_114_995 291
693 3300048912 Ga0496109_0013443 Ga0496109_0013443_4647_5528 291
694 3300048912 Ga0496109_0069377 Ga0496109_0069377_111_992 291
695 3300048913 Ga0496110_0025175 Ga0496110_0025175_2359_3240 291
696 3300048913 Ga0496110_0118944 Ga0496110_0118944_420_1301 291
697 3300048914 Ga0496111_0000496 Ga0496111_0000496_6830_7711 291
698 3300048915 Ga0496112_0000275 Ga0496112_0000275_3989_4870 291
699 3300048915 Ga0496112_0040418 Ga0496112_0040418_2193_3074 291
700 3300048915 Ga0496112_0697361 Ga0496112_0697361_20_901 291
701 3300048916 Ga0496113_0010921 Ga0496113_0010921_1499_2380 291
702 3300048918 Ga0496115_0031543 Ga0496115_0031543_1476_2357 291
703 3300049584 Ga0501068_0052576 Ga0501068_0052576_1098_1979 291
704 3300001915 JGI24741J21665_1000578 JGI24741J21665_10005782 292
705 3300001979 JGI24740J21852_10011466 JGI24740J21852_100114664 292
706 3300001979 JGI24740J21852_10039629 JGI24740J21852_100396291 292
707 3300001989 JGI24739J22299_10006424 JGI24739J22299_100064245 292
708 3300001989 JGI24739J22299_10006645 JGI24739J22299_100066452 292
709 3300001990 JGI24737J22298_10009065 JGI24737J22298_100090654 292
710 3300002067 JGI24735J21928_10004145 JGI24735J21928_100041455 292
711 3300002075 JGI24738J21930_10013004 JGI24738J21930_100130042 292
712 3300005327 Ga0070658_10000269 Ga0070658_1000026925 292
713 3300005327 Ga0070658_10023711 Ga0070658_100237118 292
714 3300005327 Ga0070658_10112574 Ga0070658_101125742 292
715 3300005329 Ga0070683_100033941 Ga0070683_1000339417 292
716 3300005331 Ga0070670_100071411 Ga0070670_1000714114 292
717 3300005335 Ga0070666_10000330 Ga0070666_100003308 292
718 3300005337 Ga0070682_100065376 Ga0070682_1000653762 292
719 3300005339 Ga0070660_100000109 Ga0070660_10000010924 292
720 3300005344 Ga0070661_100000070 Ga0070661_10000007065 292
721 3300005344 Ga0070661_100359650 Ga0070661_1003596502 292
722 3300005355 Ga0070671_100005801 Ga0070671_1000058017 292
723 3300005366 Ga0070659_100000312 Ga0070659_10000031215 292
724 3300005366 Ga0070659_100045336 Ga0070659_1000453363 292
725 3300005456 Ga0070678_100531214 Ga0070678_1005312141 292
726 3300005457 Ga0070662_100000037 Ga0070662_10000003755 292
727 3300005458 Ga0070681_10074936 Ga0070681_100749362 292
728 3300005539 Ga0068853_100000309 Ga0068853_10000030925 292
729 3300005539 Ga0068853_100037689 Ga0068853_1000376896 292
730 3300005539 Ga0068853_100238089 Ga0068853_1002380893 292
731 3300005547 Ga0070693_100009762 Ga0070693_1000097622 292
732 3300005548 Ga0070665_100226276 Ga0070665_1002262762 292
733 3300005563 Ga0068855_100004288 Ga0068855_10000428816 292
734 3300005563 Ga0068855_100132915 Ga0068855_1001329152 292
735 3300005564 Ga0070664_100000077 Ga0070664_10000007725 292
736 3300005564 Ga0070664_100302000 Ga0070664_1003020002 292
737 3300005577 Ga0068857_100102317 Ga0068857_1001023172 292
738 3300005614 Ga0068856_100000444 Ga0068856_10000044425 292
739 3300005616 Ga0068852_100000350 Ga0068852_10000035017 292
740 3300005616 Ga0068852_100013451 Ga0068852_1000134514 292
741 3300005616 Ga0068852_100173855 Ga0068852_1001738554 292
742 3300005834 Ga0068851_10013866 Ga0068851_100138665 292
743 3300005834 Ga0068851_10019522 Ga0068851_100195223 292
744 3300009093 Ga0105240_10064049 Ga0105240_100640495 292
745 3300009174 Ga0105241_10123039 Ga0105241_101230394 292
746 3300009177 Ga0105248_10000719 Ga0105248_1000071926 292
747 3300009551 Ga0105238_10052947 Ga0105238_100529473 292
748 3300009551 Ga0105238_10087105 Ga0105238_100871052 292
749 3300010375 Ga0105239_10027029 Ga0105239_100270297 292
750 3300013100 Ga0157373_10014974 Ga0157373_100149742 292
751 3300013102 Ga0157371_10023554 Ga0157371_100235542 292
752 3300013102 Ga0157371_10091433 Ga0157371_100914332 292
753 3300013102 Ga0157371_10147816 Ga0157371_101478162 292
754 3300013104 Ga0157370_10071175 Ga0157370_100711753 292
755 3300013105 Ga0157369_10106711 Ga0157369_101067113 292
756 3300013105 Ga0157369_10127638 Ga0157369_101276383 292
757 3300013307 Ga0157372_10034866 Ga0157372_100348662 292
758 3300014325 Ga0163163_10000123 Ga0163163_1000012365 292
759 3300025321 Ga0207656_10008268 Ga0207656_100082682 292
760 3300025321 Ga0207656_10011612 Ga0207656_100116123 292
761 3300025903 Ga0207680_10001021 Ga0207680_100010219 292
762 3300025904 Ga0207647_10017660 Ga0207647_100176602 292
763 3300025904 Ga0207647_10030159 Ga0207647_100301593 292
764 3300025909 Ga0207705_10000086 Ga0207705_1000008626 292
765 3300025909 Ga0207705_10127925 Ga0207705_101279252 292
766 3300025909 Ga0207705_10157488 Ga0207705_101574882 292
767 3300025912 Ga0207707_10017647 Ga0207707_100176477 292
768 3300025913 Ga0207695_10597251 Ga0207695_105972511 292
769 3300025917 Ga0207660_10000484 Ga0207660_1000048417 292
770 3300025919 Ga0207657_10001020 Ga0207657_100010207 292
771 3300025919 Ga0207657_10052428 Ga0207657_100524283 292
772 3300025919 Ga0207657_10072347 Ga0207657_100723472 292
773 3300025920 Ga0207649_10000420 Ga0207649_1000042019 292
774 3300025921 Ga0207652_10009794 Ga0207652_100097945 292
775 3300025924 Ga0207694_10208765 Ga0207694_102087652 292
776 3300025925 Ga0207650_10171230 Ga0207650_101712302 292
777 3300025931 Ga0207644_10013631 Ga0207644_100136312 292
778 3300025932 Ga0207690_10000413 Ga0207690_1000041325 292
779 3300025933 Ga0207706_10000192 Ga0207706_1000019244 292
780 3300025933 Ga0207706_10078243 Ga0207706_100782434 292
781 3300025941 Ga0207711_10002038 Ga0207711_100020385 292
782 3300025944 Ga0207661_10045917 Ga0207661_100459175 292
783 3300025944 Ga0207661_10074814 Ga0207661_100748144 292
784 3300025945 Ga0207679_10000347 Ga0207679_100003479 292
785 3300025949 Ga0207667_10000850 Ga0207667_1000085020 292
786 3300025949 Ga0207667_10056357 Ga0207667_100563572 292
787 3300025949 Ga0207667_10205764 Ga0207667_102057642 292
788 3300025981 Ga0207640_10016104 Ga0207640_100161045 292
789 3300025986 Ga0207658_10005150 Ga0207658_100051508 292
790 3300026041 Ga0207639_10000412 Ga0207639_100004123 292
791 3300026041 Ga0207639_10000923 Ga0207639_1000092310 292
792 3300026067 Ga0207678_10001315 Ga0207678_100013153 292
793 3300026067 Ga0207678_10001460 Ga0207678_100014607 292
794 3300026078 Ga0207702_10005023 Ga0207702_100050236 292
795 3300026116 Ga0207674_10095577 Ga0207674_100955772 292
796 3300026142 Ga0207698_10000542 Ga0207698_1000054214 292
797 3300026142 Ga0207698_10008977 Ga0207698_100089774 292
798 3300026142 Ga0207698_10033462 Ga0207698_100334622 292
799 3300026142 Ga0207698_10450582 Ga0207698_104505821 292
800 3300028379 Ga0268266_10389160 Ga0268266_103891602 292
801 3300035121 Ga0373960_0040034 Ga0373960_0040034_76_969 292
802 3300035207 Ga0373942_0004964 Ga0373942_0004964_1763_2656 292
803 3300035241 Ga0373961_0025745 Ga0373961_0025745_423_1316 292
804 3300035691 Ga0373931_0001320 Ga0373931_0001320_5005_5898 292
805 3300037312 Ga0395899_0009002 Ga0395899_0009002_841_1725 292
806 3300037312 Ga0395899_0014277 Ga0395899_0014277_3413_4297 292
807 3300037312 Ga0395899_0044505 Ga0395899_0044505_307_1191 292
808 3300037418 Ga0395900_0008220 Ga0395900_0008220_8703_9587 292
809 3300037418 Ga0395900_0033740 Ga0395900_0033740_2473_3357 292
810 3300037466 Ga0395898_0021270 Ga0395898_0021270_3063_3947 292
811 3300037466 Ga0395898_0065908 Ga0395898_0065908_1369_2253 292
812 3300037471 Ga0395905_0023579 Ga0395905_0023579_1860_2744 292
813 3300038443 Ga0395901_0000782 Ga0395901_0000782_7207_8091 292
814 3300038443 Ga0395901_0103175 Ga0395901_0103175_357_1241 292
815 3300044694 Ga0466963_0028762 Ga0466963_0028762_1433_2326 292
816 3300044694 Ga0466963_0047770 Ga0466963_0047770_1576_2460 292
817 3300044706 Ga0466964_0027173 Ga0466964_0027173_1239_2123 292
818 3300045976 Ga0466967_0048466 Ga0466967_0048466_1919_2803 292
819 3300045976 Ga0466967_0057847 Ga0466967_0057847_2340_3233 292
820 3300045976 Ga0466967_0076838 Ga0466967_0076838_978_1862 292
821 3300045976 Ga0466967_0088576 Ga0466967_0088576_188_1072 292

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10502

Peptidase_S26

Signal peptidase, peptidase S26

37

302

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
4n31-assembly1.cif.gz_B structure and activity of streptococcus pyogenes sipa: a signal peptidase homologue essential for pilus polymerisation 0.7683 53 269
4n31-assembly1.cif.gz_A structure and activity of streptococcus pyogenes sipa: a signal peptidase homologue essential for pilus polymerisation 0.7377 53 258
4n31-assembly1.cif.gz_B structure and activity of streptococcus pyogenes sipa: a signal peptidase homologue essential for pilus polymerisation 0.7374 53 269
4k8w-assembly1.cif.gz_A-2 an arm-swapped dimer of the s. pyogenes pilin specific assembly factor sipa 0.7321 90 256
4k8w-assembly1.cif.gz_A-2 an arm-swapped dimer of the s. pyogenes pilin specific assembly factor sipa 0.6567 90 256
ID Description Score Start End Superfamily
1kn9D01 Mainly Beta;Ribbon;Umud Fragment, subunit A;Umud Fragment, subunit A 0.7973 48 266 2.10.109.10
4n31B00 Mainly Beta;Ribbon;Umud Fragment, subunit A;Umud Fragment, subunit A 0.7683 53 269 2.10.109.10
2wweA01 Alpha Beta;2-Layer Sandwich;PX Domain;Phox-like domain 0.7501 186 203 3.30.1520.10
1b12C01 Mainly Beta;Ribbon;Umud Fragment, subunit A;Umud Fragment, subunit A 0.7429 52 281 2.10.109.10
4n31B00 Mainly Beta;Ribbon;Umud Fragment, subunit A;Umud Fragment, subunit A 0.7374 53 269 2.10.109.10
ID Description Score Start End GO Terms
AF-A0A7Y0G9E4-F1-model_v4 Signal peptidase I (EC 3.4.21.89) 0.9182 39 284 GO:0004252
GO:0006465
GO:0016020
AF-A0A7G9L5Y1-F1-model_v4 Signal peptidase I (EC 3.4.21.89) 0.9046 45 290 GO:0004252
GO:0006465
GO:0016020
AF-A0A844ZJJ1-F1-model_v4 Signal peptidase I (EC 3.4.21.89) 0.8995 39 284 GO:0004252
GO:0006465
GO:0016020
AF-A0A7W5S895-F1-model_v4 Signal peptidase I (EC 3.4.21.89) 0.8964 33 286 GO:0004252
GO:0006465
GO:0016020
AF-A0A7Y1XGL1-F1-model_v4 deleted 0.891 25 284

Feature Viewer

pLDDT pTM Quality
78.54 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map