F482257
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 821 | 268 | 818 | 298 |
Family's Representative Sequence
| Representative Sequence | 3300025908|Ga0207643_10126928|Ga0207643_101269281 |
| Length | 356 |
| Sequence | MSDELALNDEKFEPVATPAQTAKPAPADKWRARAHAAWKEIAGIFWLILAVLGFHSFIAKPFYIPSESMLPGLEVGDQLVVAKYAYGWSFISPTLPNPVAMWRDLVEHKPQESWGVQLPFIKGRLFGRMPERGDVVIVTPPGRNTDYIKRVIGLPGDRIEVRNGVVFINNVPVKRGPVHYVDLPDYGGVALTGQEYGTTCDIPGGLQGPANKHFCRLPLVRETLPNGRSFETVDLSRGAPGSDPNYYEGDNYGPTTVPADHVFLMGDNRERSADSRIALDQGGLGGPVPWEYIGGRAEFITFSKNGKATWNPLTLISSLTRSVTNTSPSAVTVPRSPVCNQPWASTVAAVAAGSSR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2599185354 | Sphingomonas sp. NFR15 | Isolate | Rhizoplane |
| 2 | 2751185897 | Sphingomonas panacis DCY99 | Isolate | Unclassified |
| 3 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 4 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 5 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 6 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 7 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 8 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 9 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 10 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 11 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 12 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 13 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 14 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 22 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 39 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 43 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 48 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 50 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 51 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 52 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 53 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 54 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 55 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 56 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 57 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 58 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 59 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 60 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 61 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 62 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 64 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 89 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 93 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 94 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 153 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 154 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 155 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 156 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 157 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 158 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 159 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 160 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 161 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 162 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 163 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 164 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 165 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 166 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 167 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 168 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 169 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 170 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 171 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 172 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 173 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 174 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 175 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 176 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 177 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 178 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 179 | 3300042120 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 | Metagenome | Rhizosphere |
| 180 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 181 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 182 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 183 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 184 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 185 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 186 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 187 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 188 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 189 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 190 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 191 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 192 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 193 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 194 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 195 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 223 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 224 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 225 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 226 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 227 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 228 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 229 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 230 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 231 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 232 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 233 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 234 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 235 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 236 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 237 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 238 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 239 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 240 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 241 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 242 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 243 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 244 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 245 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 246 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 247 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 248 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 251 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 252 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 253 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 254 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 255 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 256 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 257 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 258 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 260 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 261 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 262 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 263 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 264 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 265 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 266 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 267 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 268 | 8057101203 | Sphingomonas lycopersici MMSM20 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.51 |
| Metatranscriptomes | 0.12 |
| Isolates | 0.37 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.17 |
| Nodule | 0 |
| Rhizoplane | 8.4 |
| Rhizosphere | 86.24 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.19 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24741J21665_1000578 | 3300001915 | Bacteria | 11131 |
| 2 | JGI24741J21665_1001312 | 3300001915 | Bacteria | 7282 |
| 3 | JGI24740J21852_10002628 | 3300001979 | Bacteria | 8093 |
| 4 | JGI24740J21852_10011466 | 3300001979 | Bacteria | 3372 |
| 5 | JGI24740J21852_10026133 | 3300001979 | Bacteria | 1959 |
| 6 | JGI24740J21852_10039629 | 3300001979 | Bacteria | 1435 |
| 7 | JGI24740J21852_10064007 | 3300001979 | Bacteria | 1005 |
| 8 | JGI24739J22299_10006424 | 3300001989 | Bacteria | 4438 |
| 9 | JGI24739J22299_10006645 | 3300001989 | Bacteria | 4354 |
| 10 | JGI24737J22298_10002951 | 3300001990 | Bacteria | 6033 |
| 11 | JGI24737J22298_10003882 | 3300001990 | Bacteria | 5255 |
| 12 | JGI24737J22298_10009065 | 3300001990 | Bacteria | 3317 |
| 13 | JGI24735J21928_10004145 | 3300002067 | Bacteria | 4895 |
| 14 | JGI24735J21928_10034551 | 3300002067 | Bacteria | 1490 |
| 15 | JGI24738J21930_10013004 | 3300002075 | Bacteria | 1808 |
| 16 | JGI24738J21930_10023956 | 3300002075 | Bacteria | 1257 |
| 17 | JGI25165J46597_1000065 | 3300003214 | Bacteria | 199761 |
| 18 | JGI25153J46596_10000007 | 3300003215 | Bacteria | 377573 |
| 19 | Ga0055525_1000080 | 3300003759 | Bacteria | 164642 |
| 20 | Ga0055542_1000012 | 3300003762 | Bacteria | 391808 |
| 21 | Ga0055529_1000002 | 3300003763 | Bacteria | 537914 |
| 22 | Ga0055529_1000004 | 3300003763 | Bacteria | 433331 |
| 23 | Ga0070658_10000269 | 3300005327 | Bacteria | 45712 |
| 24 | Ga0070658_10005785 | 3300005327 | Bacteria | 10029 |
| 25 | Ga0070658_10014069 | 3300005327 | Bacteria | 6425 |
| 26 | Ga0070658_10023711 | 3300005327 | Bacteria | 4921 |
| 27 | Ga0070658_10033263 | 3300005327 | Bacteria | 4147 |
| 28 | Ga0070658_10058220 | 3300005327 | Bacteria | 3144 |
| 29 | Ga0070658_10077703 | 3300005327 | Bacteria | 2723 |
| 30 | Ga0070658_10112574 | 3300005327 | Bacteria | 2256 |
| 31 | Ga0070658_10432808 | 3300005327 | Bacteria | 1132 |
| 32 | Ga0070676_10222297 | 3300005328 | Bacteria | 1248 |
| 33 | Ga0070683_100014717 | 3300005329 | Bacteria | 6852 |
| 34 | Ga0070683_100033941 | 3300005329 | Bacteria | 4657 |
| 35 | Ga0070670_100017478 | 3300005331 | Bacteria | 6153 |
| 36 | Ga0070670_100034115 | 3300005331 | Bacteria | 4380 |
| 37 | Ga0070670_100046505 | 3300005331 | Bacteria | 3732 |
| 38 | Ga0070670_100061091 | 3300005331 | Bacteria | 3235 |
| 39 | Ga0070670_100071411 | 3300005331 | Bacteria | 2981 |
| 40 | Ga0070670_100453696 | 3300005331 | Bacteria | 1136 |
| 41 | Ga0070666_10000330 | 3300005335 | Bacteria | 29917 |
| 42 | Ga0070666_10002971 | 3300005335 | Bacteria | 10286 |
| 43 | Ga0070666_10088106 | 3300005335 | Bacteria | 2129 |
| 44 | Ga0070666_10090277 | 3300005335 | Bacteria | 2104 |
| 45 | Ga0070680_100001257 | 3300005336 | Bacteria | 18304 |
| 46 | Ga0070682_100065376 | 3300005337 | Bacteria | 2311 |
| 47 | Ga0070682_100230083 | 3300005337 | Bacteria | 1325 |
| 48 | Ga0068868_100072400 | 3300005338 | Bacteria | 2749 |
| 49 | Ga0070660_100000109 | 3300005339 | Bacteria | 50964 |
| 50 | Ga0070660_100011824 | 3300005339 | Bacteria | 6218 |
| 51 | Ga0070660_100027883 | 3300005339 | Bacteria | 4220 |
| 52 | Ga0070660_100029369 | 3300005339 | Bacteria | 4120 |
| 53 | Ga0070660_100031694 | 3300005339 | Bacteria | 3972 |
| 54 | Ga0070660_100055119 | 3300005339 | Bacteria | 3072 |
| 55 | Ga0070660_100377135 | 3300005339 | Bacteria | 1171 |
| 56 | Ga0070661_100000070 | 3300005344 | Bacteria | 82818 |
| 57 | Ga0070661_100039175 | 3300005344 | Bacteria | 3453 |
| 58 | Ga0070661_100041131 | 3300005344 | Bacteria | 3372 |
| 59 | Ga0070661_100057595 | 3300005344 | Bacteria | 2847 |
| 60 | Ga0070661_100180550 | 3300005344 | Bacteria | 1605 |
| 61 | Ga0070661_100214084 | 3300005344 | Bacteria | 1476 |
| 62 | Ga0070661_100338265 | 3300005344 | Bacteria | 1178 |
| 63 | Ga0070661_100359650 | 3300005344 | Bacteria | 1144 |
| 64 | Ga0070669_100039928 | 3300005353 | Bacteria | 3411 |
| 65 | Ga0070669_100241665 | 3300005353 | Bacteria | 1435 |
| 66 | Ga0070675_100022550 | 3300005354 | Bacteria | 5033 |
| 67 | Ga0070675_100137900 | 3300005354 | Bacteria | 2083 |
| 68 | Ga0070675_100249451 | 3300005354 | Bacteria | 1553 |
| 69 | Ga0070675_100417732 | 3300005354 | Bacteria | 1199 |
| 70 | Ga0070671_100002090 | 3300005355 | Bacteria | 15383 |
| 71 | Ga0070671_100005801 | 3300005355 | Bacteria | 9835 |
| 72 | Ga0070671_100010165 | 3300005355 | Bacteria | 7553 |
| 73 | Ga0070671_100013194 | 3300005355 | Bacteria | 6656 |
| 74 | Ga0070671_100015041 | 3300005355 | Bacteria | 6249 |
| 75 | Ga0070671_100024137 | 3300005355 | Bacteria | 4977 |
| 76 | Ga0070671_100040369 | 3300005355 | Bacteria | 3875 |
| 77 | Ga0070671_100079772 | 3300005355 | Bacteria | 2736 |
| 78 | Ga0070671_100102174 | 3300005355 | Bacteria | 2405 |
| 79 | Ga0070671_100255942 | 3300005355 | Bacteria | 1487 |
| 80 | Ga0070674_100002142 | 3300005356 | Bacteria | 10837 |
| 81 | Ga0070674_100049373 | 3300005356 | Bacteria | 2892 |
| 82 | Ga0070674_100177605 | 3300005356 | Bacteria | 1628 |
| 83 | Ga0070674_100179494 | 3300005356 | Bacteria | 1621 |
| 84 | Ga0070674_100316929 | 3300005356 | Bacteria | 1249 |
| 85 | Ga0070673_100000526 | 3300005364 | Bacteria | 20563 |
| 86 | Ga0070673_100049988 | 3300005364 | Bacteria | 3267 |
| 87 | Ga0070673_100075965 | 3300005364 | Bacteria | 2711 |
| 88 | Ga0070673_100100394 | 3300005364 | Bacteria | 2382 |
| 89 | Ga0070673_100243256 | 3300005364 | Bacteria | 1565 |
| 90 | Ga0070659_100000312 | 3300005366 | Bacteria | 37872 |
| 91 | Ga0070659_100033445 | 3300005366 | Bacteria | 3993 |
| 92 | Ga0070659_100037103 | 3300005366 | Bacteria | 3799 |
| 93 | Ga0070659_100045336 | 3300005366 | Bacteria | 3444 |
| 94 | Ga0070659_100081853 | 3300005366 | Bacteria | 2579 |
| 95 | Ga0070659_100083906 | 3300005366 | Bacteria | 2547 |
| 96 | Ga0070659_100090047 | 3300005366 | Bacteria | 2458 |
| 97 | Ga0070659_100105558 | 3300005366 | Bacteria | 2270 |
| 98 | Ga0070659_100192100 | 3300005366 | Bacteria | 1678 |
| 99 | Ga0070667_100013712 | 3300005367 | Bacteria | 6698 |
| 100 | Ga0070667_100056858 | 3300005367 | Bacteria | 3305 |
| 101 | Ga0070667_100483504 | 3300005367 | Bacteria | 1134 |
| 102 | Ga0070714_100221619 | 3300005435 | Bacteria | 1738 |
| 103 | Ga0070700_100116658 | 3300005441 | Bacteria | 1783 |
| 104 | Ga0070694_100061256 | 3300005444 | Bacteria | 2568 |
| 105 | Ga0070663_100008440 | 3300005455 | Bacteria | 6338 |
| 106 | Ga0070663_100042383 | 3300005455 | Bacteria | 3198 |
| 107 | Ga0070663_100046448 | 3300005455 | Bacteria | 3073 |
| 108 | Ga0070678_100001712 | 3300005456 | Bacteria | 11777 |
| 109 | Ga0070678_100013930 | 3300005456 | Bacteria | 5057 |
| 110 | Ga0070678_100026409 | 3300005456 | Bacteria | 3925 |
| 111 | Ga0070678_100030421 | 3300005456 | Bacteria | 3711 |
| 112 | Ga0070678_100055808 | 3300005456 | Bacteria | 2886 |
| 113 | Ga0070678_100088158 | 3300005456 | Bacteria | 2371 |
| 114 | Ga0070678_100148461 | 3300005456 | Bacteria | 1885 |
| 115 | Ga0070678_100531214 | 3300005456 | Bacteria | 1042 |
| 116 | Ga0070662_100000037 | 3300005457 | Bacteria | 76596 |
| 117 | Ga0070662_100008480 | 3300005457 | Bacteria | 6706 |
| 118 | Ga0070662_100020844 | 3300005457 | Bacteria | 4470 |
| 119 | Ga0070662_100031341 | 3300005457 | Bacteria | 3731 |
| 120 | Ga0070662_100107260 | 3300005457 | Bacteria | 2123 |
| 121 | Ga0070662_100109461 | 3300005457 | Bacteria | 2103 |
| 122 | Ga0070662_100175010 | 3300005457 | Bacteria | 1688 |
| 123 | Ga0070662_100447501 | 3300005457 | Bacteria | 1072 |
| 124 | Ga0070681_10074936 | 3300005458 | Bacteria | 3344 |
| 125 | Ga0070681_10172187 | 3300005458 | Bacteria | 2087 |
| 126 | Ga0070681_10179834 | 3300005458 | Bacteria | 2037 |
| 127 | Ga0070681_10302226 | 3300005458 | Bacteria | 1510 |
| 128 | Ga0068867_100010806 | 3300005459 | Bacteria | 6440 |
| 129 | Ga0070685_10059227 | 3300005466 | Bacteria | 2235 |
| 130 | Ga0070685_10070701 | 3300005466 | Bacteria | 2067 |
| 131 | Ga0070706_100137583 | 3300005467 | Bacteria | 2279 |
| 132 | Ga0070679_100041620 | 3300005530 | Bacteria | 4572 |
| 133 | Ga0070679_100168087 | 3300005530 | Bacteria | 2166 |
| 134 | Ga0070679_100368457 | 3300005530 | Bacteria | 1384 |
| 135 | Ga0070679_100510688 | 3300005530 | Bacteria | 1146 |
| 136 | Ga0068853_100000309 | 3300005539 | Bacteria | 34282 |
| 137 | Ga0068853_100037689 | 3300005539 | Bacteria | 4114 |
| 138 | Ga0068853_100238089 | 3300005539 | Bacteria | 1667 |
| 139 | Ga0070672_100047900 | 3300005543 | Bacteria | 3318 |
| 140 | Ga0070672_100085857 | 3300005543 | Bacteria | 2530 |
| 141 | Ga0070672_100085892 | 3300005543 | Bacteria | 2529 |
| 142 | Ga0070696_100036650 | 3300005546 | Bacteria | 3382 |
| 143 | Ga0070696_100132326 | 3300005546 | Bacteria | 1816 |
| 144 | Ga0070693_100009762 | 3300005547 | Bacteria | 4784 |
| 145 | Ga0070693_100131924 | 3300005547 | Bacteria | 1563 |
| 146 | Ga0070665_100000067 | 3300005548 | Bacteria | 204787 |
| 147 | Ga0070665_100021263 | 3300005548 | Bacteria | 6524 |
| 148 | Ga0070665_100049036 | 3300005548 | Bacteria | 4238 |
| 149 | Ga0070665_100062601 | 3300005548 | Bacteria | 3730 |
| 150 | Ga0070665_100226276 | 3300005548 | Bacteria | 1871 |
| 151 | Ga0070665_100347397 | 3300005548 | Bacteria | 1488 |
| 152 | Ga0068855_100004288 | 3300005563 | Bacteria | 17424 |
| 153 | Ga0068855_100025356 | 3300005563 | Bacteria | 7095 |
| 154 | Ga0068855_100132915 | 3300005563 | Bacteria | 2840 |
| 155 | Ga0068855_100136178 | 3300005563 | Bacteria | 2802 |
| 156 | Ga0070664_100000077 | 3300005564 | Bacteria | 62053 |
| 157 | Ga0070664_100011449 | 3300005564 | Bacteria | 7198 |
| 158 | Ga0070664_100023816 | 3300005564 | Bacteria | 5057 |
| 159 | Ga0070664_100053058 | 3300005564 | Bacteria | 3435 |
| 160 | Ga0070664_100055897 | 3300005564 | Bacteria | 3353 |
| 161 | Ga0070664_100132008 | 3300005564 | Bacteria | 2194 |
| 162 | Ga0070664_100138913 | 3300005564 | Bacteria | 2138 |
| 163 | Ga0070664_100172245 | 3300005564 | Bacteria | 1920 |
| 164 | Ga0070664_100224907 | 3300005564 | Bacteria | 1680 |
| 165 | Ga0070664_100234275 | 3300005564 | Bacteria | 1647 |
| 166 | Ga0070664_100295690 | 3300005564 | Bacteria | 1462 |
| 167 | Ga0070664_100302000 | 3300005564 | Bacteria | 1447 |
| 168 | Ga0070664_100324974 | 3300005564 | Bacteria | 1394 |
| 169 | Ga0068857_100000489 | 3300005577 | Bacteria | 28341 |
| 170 | Ga0068857_100039061 | 3300005577 | Bacteria | 4203 |
| 171 | Ga0068857_100102317 | 3300005577 | Bacteria | 2571 |
| 172 | Ga0068854_100028082 | 3300005578 | Bacteria | 3884 |
| 173 | Ga0068854_100047615 | 3300005578 | Bacteria | 3056 |
| 174 | Ga0068854_100094980 | 3300005578 | Bacteria | 2225 |
| 175 | Ga0068854_100498957 | 3300005578 | Bacteria | 1025 |
| 176 | Ga0068856_100000444 | 3300005614 | Bacteria | 45674 |
| 177 | Ga0068856_100026683 | 3300005614 | Bacteria | 5633 |
| 178 | Ga0068856_100067148 | 3300005614 | Bacteria | 3544 |
| 179 | Ga0068856_100675248 | 3300005614 | Bacteria | 1054 |
| 180 | Ga0068852_100000350 | 3300005616 | Bacteria | 31032 |
| 181 | Ga0068852_100013451 | 3300005616 | Bacteria | 6265 |
| 182 | Ga0068852_100030485 | 3300005616 | Bacteria | 4440 |
| 183 | Ga0068852_100173855 | 3300005616 | Bacteria | 2021 |
| 184 | Ga0068852_100257577 | 3300005616 | Bacteria | 1674 |
| 185 | Ga0068852_100496465 | 3300005616 | Bacteria | 1215 |
| 186 | Ga0068859_100086744 | 3300005617 | Bacteria | 3177 |
| 187 | Ga0068859_100095345 | 3300005617 | Bacteria | 3028 |
| 188 | Ga0068864_100001058 | 3300005618 | Bacteria | 23117 |
| 189 | Ga0068864_100015861 | 3300005618 | Bacteria | 6268 |
| 190 | Ga0068864_100017019 | 3300005618 | Bacteria | 6059 |
| 191 | Ga0068864_100033561 | 3300005618 | Bacteria | 4363 |
| 192 | Ga0068864_100038826 | 3300005618 | Bacteria | 4067 |
| 193 | Ga0068866_10031671 | 3300005718 | Bacteria | 2550 |
| 194 | Ga0068851_10013866 | 3300005834 | Bacteria | 3818 |
| 195 | Ga0068851_10015118 | 3300005834 | Bacteria | 3674 |
| 196 | Ga0068851_10019522 | 3300005834 | Bacteria | 3275 |
| 197 | Ga0068851_10043978 | 3300005834 | Bacteria | 2253 |
| 198 | Ga0068851_10113757 | 3300005834 | Bacteria | 1447 |
| 199 | Ga0068863_100001894 | 3300005841 | Bacteria | 20763 |
| 200 | Ga0068863_100015595 | 3300005841 | Bacteria | 7301 |
| 201 | Ga0068863_100044982 | 3300005841 | Bacteria | 4189 |
| 202 | Ga0068858_100000132 | 3300005842 | Bacteria | 77767 |
| 203 | Ga0068858_100019414 | 3300005842 | Bacteria | 6356 |
| 204 | Ga0068858_100225699 | 3300005842 | Bacteria | 1775 |
| 205 | Ga0068862_100206171 | 3300005844 | Bacteria | 1774 |
| 206 | Ga0075362_10115478 | 3300006177 | Bacteria | 1267 |
| 207 | Ga0075366_10211493 | 3300006195 | Bacteria | 1181 |
| 208 | Ga0097621_100112728 | 3300006237 | Bacteria | 2300 |
| 209 | Ga0097621_100116346 | 3300006237 | Bacteria | 2264 |
| 210 | Ga0097621_100152950 | 3300006237 | Bacteria | 1979 |
| 211 | Ga0068871_100018077 | 3300006358 | Bacteria | 5350 |
| 212 | Ga0068871_100118178 | 3300006358 | Bacteria | 2237 |
| 213 | Ga0068871_100132682 | 3300006358 | Bacteria | 2113 |
| 214 | Ga0068871_100588605 | 3300006358 | Bacteria | 1011 |
| 215 | Ga0097620_100086740 | 3300006931 | Bacteria | 3177 |
| 216 | Ga0097620_100095342 | 3300006931 | Bacteria | 3028 |
| 217 | Ga0105240_10064049 | 3300009093 | Bacteria | 4570 |
| 218 | Ga0111539_10061223 | 3300009094 | Bacteria | 4460 |
| 219 | Ga0105245_10000680 | 3300009098 | Bacteria | 30727 |
| 220 | Ga0105247_10288857 | 3300009101 | Bacteria | 1134 |
| 221 | Ga0114129_10223981 | 3300009147 | Bacteria | 2536 |
| 222 | Ga0105243_10000522 | 3300009148 | Bacteria | 39134 |
| 223 | Ga0105241_10007202 | 3300009174 | Bacteria | 8186 |
| 224 | Ga0105241_10123039 | 3300009174 | Bacteria | 2092 |
| 225 | Ga0105242_10227480 | 3300009176 | Bacteria | 1670 |
| 226 | Ga0105248_10000719 | 3300009177 | Bacteria | 37511 |
| 227 | Ga0105248_10000862 | 3300009177 | Bacteria | 34132 |
| 228 | Ga0105248_10007546 | 3300009177 | Bacteria | 11944 |
| 229 | Ga0105248_10030585 | 3300009177 | Bacteria | 6013 |
| 230 | Ga0105248_10039813 | 3300009177 | Bacteria | 5267 |
| 231 | Ga0105248_10053309 | 3300009177 | Bacteria | 4539 |
| 232 | Ga0105248_10096217 | 3300009177 | Bacteria | 3335 |
| 233 | Ga0105248_10161249 | 3300009177 | Bacteria | 2529 |
| 234 | Ga0105248_10833404 | 3300009177 | Bacteria | 1041 |
| 235 | Ga0105237_10154576 | 3300009545 | Bacteria | 2291 |
| 236 | Ga0105238_10025669 | 3300009551 | Bacteria | 6007 |
| 237 | Ga0105238_10052947 | 3300009551 | Bacteria | 4079 |
| 238 | Ga0105238_10087105 | 3300009551 | Bacteria | 3110 |
| 239 | Ga0105238_10174147 | 3300009551 | Bacteria | 2128 |
| 240 | Ga0105239_10027029 | 3300010375 | Bacteria | 6316 |
| 241 | Ga0105246_10043892 | 3300011119 | Bacteria | 3036 |
| 242 | Ga0105246_10093439 | 3300011119 | Bacteria | 2173 |
| 243 | Ga0157373_10014974 | 3300013100 | Bacteria | 5675 |
| 244 | Ga0157373_10034110 | 3300013100 | Bacteria | 3656 |
| 245 | Ga0157373_10035475 | 3300013100 | Bacteria | 3580 |
| 246 | Ga0157373_10065118 | 3300013100 | Bacteria | 2579 |
| 247 | Ga0157373_10151099 | 3300013100 | Bacteria | 1633 |
| 248 | Ga0157371_10000148 | 3300013102 | Bacteria | 101711 |
| 249 | Ga0157371_10013911 | 3300013102 | Bacteria | 6095 |
| 250 | Ga0157371_10023554 | 3300013102 | Bacteria | 4502 |
| 251 | Ga0157371_10028512 | 3300013102 | Bacteria | 4042 |
| 252 | Ga0157371_10060370 | 3300013102 | Bacteria | 2689 |
| 253 | Ga0157371_10069090 | 3300013102 | Bacteria | 2501 |
| 254 | Ga0157371_10091433 | 3300013102 | Bacteria | 2155 |
| 255 | Ga0157371_10092679 | 3300013102 | Bacteria | 2140 |
| 256 | Ga0157371_10140539 | 3300013102 | Bacteria | 1720 |
| 257 | Ga0157371_10147816 | 3300013102 | Bacteria | 1675 |
| 258 | Ga0157371_10161522 | 3300013102 | Bacteria | 1600 |
| 259 | Ga0157370_10061299 | 3300013104 | Bacteria | 3570 |
| 260 | Ga0157370_10071175 | 3300013104 | Bacteria | 3281 |
| 261 | Ga0157370_10085127 | 3300013104 | Bacteria | 2970 |
| 262 | Ga0157370_10112417 | 3300013104 | Bacteria | 2546 |
| 263 | Ga0157370_10372834 | 3300013104 | Bacteria | 1315 |
| 264 | Ga0157369_10082819 | 3300013105 | Bacteria | 3432 |
| 265 | Ga0157369_10106711 | 3300013105 | Bacteria | 2980 |
| 266 | Ga0157369_10127638 | 3300013105 | Bacteria | 2696 |
| 267 | Ga0157369_10135686 | 3300013105 | Bacteria | 2606 |
| 268 | Ga0157374_10002253 | 3300013296 | Bacteria | 16246 |
| 269 | Ga0157374_10006457 | 3300013296 | Bacteria | 9956 |
| 270 | Ga0157374_10070272 | 3300013296 | Bacteria | 3299 |
| 271 | Ga0157374_10140437 | 3300013296 | Bacteria | 2344 |
| 272 | Ga0157374_10219268 | 3300013296 | Bacteria | 1866 |
| 273 | Ga0157374_10548682 | 3300013296 | Bacteria | 1163 |
| 274 | Ga0157378_10042205 | 3300013297 | Bacteria | 4048 |
| 275 | Ga0157378_10097810 | 3300013297 | Bacteria | 2675 |
| 276 | Ga0163162_10010319 | 3300013306 | Bacteria | 9078 |
| 277 | Ga0163162_10405206 | 3300013306 | Bacteria | 1496 |
| 278 | Ga0163162_10448352 | 3300013306 | Bacteria | 1422 |
| 279 | Ga0163162_10495130 | 3300013306 | Bacteria | 1353 |
| 280 | Ga0163162_10579082 | 3300013306 | Bacteria | 1249 |
| 281 | Ga0157372_10034866 | 3300013307 | Bacteria | 5537 |
| 282 | Ga0157375_10006249 | 3300013308 | Bacteria | 10375 |
| 283 | Ga0157375_10011554 | 3300013308 | Bacteria | 7799 |
| 284 | Ga0157375_10250951 | 3300013308 | Bacteria | 1930 |
| 285 | Ga0163163_10000123 | 3300014325 | Bacteria | 82366 |
| 286 | Ga0163163_10002706 | 3300014325 | Bacteria | 14968 |
| 287 | Ga0163163_10042407 | 3300014325 | Bacteria | 4456 |
| 288 | Ga0182008_10021494 | 3300014497 | Bacteria | 3313 |
| 289 | Ga0157377_10034241 | 3300014745 | Bacteria | 2778 |
| 290 | Ga0157379_10003612 | 3300014968 | Bacteria | 13127 |
| 291 | Ga0157379_10229701 | 3300014968 | Bacteria | 1682 |
| 292 | Ga0157376_10230628 | 3300014969 | Bacteria | 1720 |
| 293 | Ga0206353_11121746 | 3300020082 | Bacteria | 2311 |
| 294 | Ga0213876_10009352 | 3300021384 | Bacteria | 5278 |
| 295 | Ga0209674_105513 | 3300025226 | Bacteria | 1857 |
| 296 | Ga0209563_100058 | 3300025230 | Bacteria | 302571 |
| 297 | Ga0209677_103797 | 3300025253 | Bacteria | 4685 |
| 298 | Ga0209148_1000008 | 3300025254 | Bacteria | 1504371 |
| 299 | Ga0209233_1000107 | 3300025261 | Bacteria | 267399 |
| 300 | Ga0209233_1004527 | 3300025261 | Bacteria | 4714 |
| 301 | Ga0209455_1000002 | 3300025272 | Bacteria | 1505459 |
| 302 | Ga0209758_1000017 | 3300025297 | Bacteria | 754393 |
| 303 | Ga0207656_10000555 | 3300025321 | Bacteria | 12363 |
| 304 | Ga0207656_10008268 | 3300025321 | Bacteria | 3821 |
| 305 | Ga0207656_10011612 | 3300025321 | Bacteria | 3333 |
| 306 | Ga0207656_10038801 | 3300025321 | Bacteria | 2011 |
| 307 | Ga0207682_10047573 | 3300025893 | Bacteria | 1766 |
| 308 | Ga0207642_10004807 | 3300025899 | Bacteria | 4368 |
| 309 | Ga0207688_10006467 | 3300025901 | Bacteria | 6378 |
| 310 | Ga0207680_10001021 | 3300025903 | Bacteria | 13204 |
| 311 | Ga0207680_10008315 | 3300025903 | Bacteria | 5085 |
| 312 | Ga0207680_10035012 | 3300025903 | Bacteria | 2878 |
| 313 | Ga0207680_10078625 | 3300025903 | Bacteria | 2066 |
| 314 | Ga0207647_10017660 | 3300025904 | Bacteria | 4848 |
| 315 | Ga0207647_10019369 | 3300025904 | Bacteria | 4578 |
| 316 | Ga0207647_10030159 | 3300025904 | Bacteria | 3502 |
| 317 | Ga0207647_10043548 | 3300025904 | Bacteria | 2809 |
| 318 | Ga0207647_10049297 | 3300025904 | Bacteria | 2612 |
| 319 | Ga0207645_10047494 | 3300025907 | Bacteria | 2741 |
| 320 | Ga0207643_10126928 | 3300025908 | Bacteria | 1515 |
| 321 | Ga0207705_10000086 | 3300025909 | Bacteria | 116132 |
| 322 | Ga0207705_10000493 | 3300025909 | Bacteria | 33656 |
| 323 | Ga0207705_10000702 | 3300025909 | Bacteria | 27622 |
| 324 | Ga0207705_10006514 | 3300025909 | Bacteria | 8651 |
| 325 | Ga0207705_10035332 | 3300025909 | Bacteria | 3575 |
| 326 | Ga0207705_10127925 | 3300025909 | Bacteria | 1889 |
| 327 | Ga0207705_10153617 | 3300025909 | Bacteria | 1726 |
| 328 | Ga0207705_10157488 | 3300025909 | Bacteria | 1704 |
| 329 | Ga0207705_10311681 | 3300025909 | Bacteria | 1208 |
| 330 | Ga0207654_10158445 | 3300025911 | Bacteria | 1460 |
| 331 | Ga0207707_10017647 | 3300025912 | Bacteria | 6225 |
| 332 | Ga0207707_10107496 | 3300025912 | Bacteria | 2439 |
| 333 | Ga0207707_10387583 | 3300025912 | Bacteria | 1201 |
| 334 | Ga0207695_10029219 | 3300025913 | Bacteria | 6098 |
| 335 | Ga0207695_10597251 | 3300025913 | Bacteria | 985 |
| 336 | Ga0207660_10000484 | 3300025917 | Bacteria | 26514 |
| 337 | Ga0207660_10097667 | 3300025917 | Bacteria | 2189 |
| 338 | Ga0207660_10334345 | 3300025917 | Bacteria | 1211 |
| 339 | Ga0207660_10530421 | 3300025917 | Bacteria | 957 |
| 340 | Ga0207657_10001020 | 3300025919 | Bacteria | 29724 |
| 341 | Ga0207657_10005868 | 3300025919 | Bacteria | 12792 |
| 342 | Ga0207657_10009843 | 3300025919 | Bacteria | 9575 |
| 343 | Ga0207657_10017883 | 3300025919 | Bacteria | 6784 |
| 344 | Ga0207657_10052428 | 3300025919 | Bacteria | 3540 |
| 345 | Ga0207657_10072347 | 3300025919 | Bacteria | 2917 |
| 346 | Ga0207657_10103533 | 3300025919 | Bacteria | 2359 |
| 347 | Ga0207657_10174931 | 3300025919 | Bacteria | 1738 |
| 348 | Ga0207657_10178342 | 3300025919 | Bacteria | 1718 |
| 349 | Ga0207657_10198325 | 3300025919 | Bacteria | 1616 |
| 350 | Ga0207657_10299024 | 3300025919 | Bacteria | 1275 |
| 351 | Ga0207649_10000420 | 3300025920 | Bacteria | 31171 |
| 352 | Ga0207649_10008010 | 3300025920 | Bacteria | 5750 |
| 353 | Ga0207649_10036132 | 3300025920 | Bacteria | 2973 |
| 354 | Ga0207649_10266938 | 3300025920 | Bacteria | 1239 |
| 355 | Ga0207652_10000034 | 3300025921 | Bacteria | 138571 |
| 356 | Ga0207652_10009794 | 3300025921 | Bacteria | 7714 |
| 357 | Ga0207652_10069753 | 3300025921 | Bacteria | 3052 |
| 358 | Ga0207681_10114876 | 3300025923 | Bacteria | 1965 |
| 359 | Ga0207681_10206083 | 3300025923 | Bacteria | 1513 |
| 360 | Ga0207694_10014265 | 3300025924 | Bacteria | 5992 |
| 361 | Ga0207694_10208765 | 3300025924 | Bacteria | 1590 |
| 362 | Ga0207650_10005864 | 3300025925 | Bacteria | 8386 |
| 363 | Ga0207650_10036679 | 3300025925 | Bacteria | 3568 |
| 364 | Ga0207650_10041114 | 3300025925 | Bacteria | 3386 |
| 365 | Ga0207650_10049639 | 3300025925 | Bacteria | 3099 |
| 366 | Ga0207650_10050942 | 3300025925 | Bacteria | 3063 |
| 367 | Ga0207650_10156255 | 3300025925 | Bacteria | 1804 |
| 368 | Ga0207650_10171230 | 3300025925 | Bacteria | 1726 |
| 369 | Ga0207659_10058028 | 3300025926 | Bacteria | 2778 |
| 370 | Ga0207659_10087041 | 3300025926 | Bacteria | 2325 |
| 371 | Ga0207659_10218861 | 3300025926 | Bacteria | 1530 |
| 372 | Ga0207659_10366304 | 3300025926 | Bacteria | 1199 |
| 373 | Ga0207687_10000572 | 3300025927 | Bacteria | 24857 |
| 374 | Ga0207687_10268920 | 3300025927 | Bacteria | 1362 |
| 375 | Ga0207644_10000614 | 3300025931 | Bacteria | 22677 |
| 376 | Ga0207644_10000747 | 3300025931 | Bacteria | 20633 |
| 377 | Ga0207644_10006207 | 3300025931 | Bacteria | 7793 |
| 378 | Ga0207644_10013631 | 3300025931 | Bacteria | 5424 |
| 379 | Ga0207644_10015601 | 3300025931 | Bacteria | 5101 |
| 380 | Ga0207644_10017567 | 3300025931 | Bacteria | 4835 |
| 381 | Ga0207644_10051182 | 3300025931 | Bacteria | 2964 |
| 382 | Ga0207644_10060288 | 3300025931 | Bacteria | 2745 |
| 383 | Ga0207644_10363534 | 3300025931 | Bacteria | 1177 |
| 384 | Ga0207690_10000413 | 3300025932 | Bacteria | 27940 |
| 385 | Ga0207690_10012696 | 3300025932 | Bacteria | 5048 |
| 386 | Ga0207690_10027771 | 3300025932 | Bacteria | 3579 |
| 387 | Ga0207690_10061043 | 3300025932 | Bacteria | 2561 |
| 388 | Ga0207690_10250263 | 3300025932 | Bacteria | 1368 |
| 389 | Ga0207690_10362458 | 3300025932 | Bacteria | 1148 |
| 390 | Ga0207690_10426109 | 3300025932 | Bacteria | 1062 |
| 391 | Ga0207706_10000192 | 3300025933 | Bacteria | 68319 |
| 392 | Ga0207706_10016273 | 3300025933 | Bacteria | 6718 |
| 393 | Ga0207706_10040368 | 3300025933 | Bacteria | 4136 |
| 394 | Ga0207706_10046530 | 3300025933 | Bacteria | 3841 |
| 395 | Ga0207706_10068152 | 3300025933 | Bacteria | 3131 |
| 396 | Ga0207706_10078243 | 3300025933 | Bacteria | 2908 |
| 397 | Ga0207706_10078803 | 3300025933 | Bacteria | 2897 |
| 398 | Ga0207706_10087222 | 3300025933 | Bacteria | 2744 |
| 399 | Ga0207706_10087387 | 3300025933 | Bacteria | 2741 |
| 400 | Ga0207709_10000109 | 3300025935 | Bacteria | 128086 |
| 401 | Ga0207709_10130993 | 3300025935 | Bacteria | 1709 |
| 402 | Ga0207669_10000359 | 3300025937 | Bacteria | 20721 |
| 403 | Ga0207669_10001539 | 3300025937 | Bacteria | 9829 |
| 404 | Ga0207669_10030009 | 3300025937 | Bacteria | 3016 |
| 405 | Ga0207669_10030707 | 3300025937 | Bacteria | 2990 |
| 406 | Ga0207669_10052570 | 3300025937 | Bacteria | 2448 |
| 407 | Ga0207704_10015989 | 3300025938 | Bacteria | 3843 |
| 408 | Ga0207691_10021942 | 3300025940 | Bacteria | 6024 |
| 409 | Ga0207691_10031381 | 3300025940 | Bacteria | 4960 |
| 410 | Ga0207691_10057234 | 3300025940 | Bacteria | 3549 |
| 411 | Ga0207691_10151051 | 3300025940 | Bacteria | 2042 |
| 412 | Ga0207691_10252389 | 3300025940 | Bacteria | 1522 |
| 413 | Ga0207711_10000344 | 3300025941 | Bacteria | 49354 |
| 414 | Ga0207711_10002038 | 3300025941 | Bacteria | 18270 |
| 415 | Ga0207711_10006917 | 3300025941 | Bacteria | 9525 |
| 416 | Ga0207711_10007240 | 3300025941 | Bacteria | 9299 |
| 417 | Ga0207711_10011304 | 3300025941 | Bacteria | 7417 |
| 418 | Ga0207711_10029005 | 3300025941 | Bacteria | 4663 |
| 419 | Ga0207711_10031078 | 3300025941 | Bacteria | 4506 |
| 420 | Ga0207711_10045504 | 3300025941 | Bacteria | 3750 |
| 421 | Ga0207711_10062395 | 3300025941 | Bacteria | 3215 |
| 422 | Ga0207689_10071034 | 3300025942 | Bacteria | 2860 |
| 423 | Ga0207661_10005561 | 3300025944 | Bacteria | 8887 |
| 424 | Ga0207661_10009979 | 3300025944 | Bacteria | 6823 |
| 425 | Ga0207661_10045917 | 3300025944 | Bacteria | 3461 |
| 426 | Ga0207661_10074814 | 3300025944 | Bacteria | 2777 |
| 427 | Ga0207661_10342216 | 3300025944 | Bacteria | 1348 |
| 428 | Ga0207679_10000347 | 3300025945 | Bacteria | 33719 |
| 429 | Ga0207679_10001488 | 3300025945 | Bacteria | 14672 |
| 430 | Ga0207679_10049190 | 3300025945 | Bacteria | 3074 |
| 431 | Ga0207679_10066068 | 3300025945 | Bacteria | 2709 |
| 432 | Ga0207679_10380766 | 3300025945 | Bacteria | 1237 |
| 433 | Ga0207667_10000074 | 3300025949 | Bacteria | 171635 |
| 434 | Ga0207667_10000850 | 3300025949 | Bacteria | 39399 |
| 435 | Ga0207667_10049976 | 3300025949 | Bacteria | 4413 |
| 436 | Ga0207667_10056357 | 3300025949 | Bacteria | 4129 |
| 437 | Ga0207667_10092310 | 3300025949 | Bacteria | 3127 |
| 438 | Ga0207667_10093131 | 3300025949 | Bacteria | 3112 |
| 439 | Ga0207667_10205764 | 3300025949 | Bacteria | 2018 |
| 440 | Ga0207651_10017897 | 3300025960 | Bacteria | 4200 |
| 441 | Ga0207651_10020954 | 3300025960 | Bacteria | 3959 |
| 442 | Ga0207651_10070728 | 3300025960 | Bacteria | 2470 |
| 443 | Ga0207651_10162727 | 3300025960 | Bacteria | 1751 |
| 444 | Ga0207651_10318509 | 3300025960 | Bacteria | 1299 |
| 445 | Ga0207651_10400399 | 3300025960 | Bacteria | 1167 |
| 446 | Ga0207640_10001242 | 3300025981 | Bacteria | 13887 |
| 447 | Ga0207640_10016104 | 3300025981 | Bacteria | 4342 |
| 448 | Ga0207640_10078101 | 3300025981 | Bacteria | 2252 |
| 449 | Ga0207640_10149938 | 3300025981 | Bacteria | 1712 |
| 450 | Ga0207640_10157226 | 3300025981 | Bacteria | 1677 |
| 451 | Ga0207658_10005150 | 3300025986 | Bacteria | 9003 |
| 452 | Ga0207658_10087862 | 3300025986 | Bacteria | 2401 |
| 453 | Ga0207658_10091650 | 3300025986 | Bacteria | 2358 |
| 454 | Ga0207658_10153378 | 3300025986 | Bacteria | 1879 |
| 455 | Ga0207658_10292784 | 3300025986 | Bacteria | 1400 |
| 456 | Ga0207677_10100638 | 3300026023 | Bacteria | 2126 |
| 457 | Ga0207677_10137600 | 3300026023 | Bacteria | 1865 |
| 458 | Ga0207703_10001668 | 3300026035 | Bacteria | 19967 |
| 459 | Ga0207639_10000412 | 3300026041 | Bacteria | 29612 |
| 460 | Ga0207639_10000923 | 3300026041 | Bacteria | 19909 |
| 461 | Ga0207639_10130901 | 3300026041 | Bacteria | 2077 |
| 462 | Ga0207678_10001315 | 3300026067 | Bacteria | 22977 |
| 463 | Ga0207678_10001460 | 3300026067 | Bacteria | 21690 |
| 464 | Ga0207678_10010383 | 3300026067 | Bacteria | 8176 |
| 465 | Ga0207678_10012950 | 3300026067 | Bacteria | 7317 |
| 466 | Ga0207678_10017638 | 3300026067 | Bacteria | 6266 |
| 467 | Ga0207678_10032502 | 3300026067 | Bacteria | 4547 |
| 468 | Ga0207678_10038145 | 3300026067 | Bacteria | 4176 |
| 469 | Ga0207678_10396879 | 3300026067 | Bacteria | 1194 |
| 470 | Ga0207708_10105923 | 3300026075 | Bacteria | 2180 |
| 471 | Ga0207702_10001342 | 3300026078 | Bacteria | 24608 |
| 472 | Ga0207702_10005023 | 3300026078 | Bacteria | 11624 |
| 473 | Ga0207702_10044465 | 3300026078 | Bacteria | 3733 |
| 474 | Ga0207702_10058235 | 3300026078 | Bacteria | 3287 |
| 475 | Ga0207702_10351556 | 3300026078 | Bacteria | 1410 |
| 476 | Ga0207641_10003063 | 3300026088 | Bacteria | 15070 |
| 477 | Ga0207641_10005258 | 3300026088 | Bacteria | 11064 |
| 478 | Ga0207641_10012388 | 3300026088 | Bacteria | 6996 |
| 479 | Ga0207648_10002768 | 3300026089 | Bacteria | 18606 |
| 480 | Ga0207648_10008437 | 3300026089 | Bacteria | 9982 |
| 481 | Ga0207676_10001223 | 3300026095 | Bacteria | 19146 |
| 482 | Ga0207676_10001683 | 3300026095 | Bacteria | 16306 |
| 483 | Ga0207676_10202653 | 3300026095 | Bacteria | 1754 |
| 484 | Ga0207676_10238605 | 3300026095 | Bacteria | 1629 |
| 485 | Ga0207676_10251700 | 3300026095 | Bacteria | 1590 |
| 486 | Ga0207676_10685116 | 3300026095 | Bacteria | 992 |
| 487 | Ga0207674_10001507 | 3300026116 | Bacteria | 30052 |
| 488 | Ga0207674_10003897 | 3300026116 | Bacteria | 18153 |
| 489 | Ga0207674_10005996 | 3300026116 | Bacteria | 14381 |
| 490 | Ga0207674_10016601 | 3300026116 | Bacteria | 8051 |
| 491 | Ga0207674_10095577 | 3300026116 | Bacteria | 2957 |
| 492 | Ga0207674_10179584 | 3300026116 | Bacteria | 2068 |
| 493 | Ga0207683_10001189 | 3300026121 | Bacteria | 23565 |
| 494 | Ga0207683_10015269 | 3300026121 | Bacteria | 6537 |
| 495 | Ga0207683_10049845 | 3300026121 | Bacteria | 3666 |
| 496 | Ga0207683_10080418 | 3300026121 | Bacteria | 2891 |
| 497 | Ga0207683_10084215 | 3300026121 | Bacteria | 2826 |
| 498 | Ga0207683_10128444 | 3300026121 | Bacteria | 2279 |
| 499 | Ga0207698_10000542 | 3300026142 | Bacteria | 21912 |
| 500 | Ga0207698_10000672 | 3300026142 | Bacteria | 19824 |
| 501 | Ga0207698_10002456 | 3300026142 | Bacteria | 10985 |
| 502 | Ga0207698_10008977 | 3300026142 | Bacteria | 6344 |
| 503 | Ga0207698_10033462 | 3300026142 | Bacteria | 3735 |
| 504 | Ga0207698_10241134 | 3300026142 | Bacteria | 1648 |
| 505 | Ga0207698_10450582 | 3300026142 | Bacteria | 1242 |
| 506 | Ga0207698_10482833 | 3300026142 | Bacteria | 1202 |
| 507 | Ga0268266_10000002 | 3300028379 | Bacteria | 3059047 |
| 508 | Ga0268266_10046045 | 3300028379 | Bacteria | 3734 |
| 509 | Ga0268266_10166318 | 3300028379 | Bacteria | 1998 |
| 510 | Ga0268266_10269385 | 3300028379 | Bacteria | 1580 |
| 511 | Ga0268266_10389160 | 3300028379 | Bacteria | 1316 |
| 512 | Ga0268265_10158063 | 3300028380 | Bacteria | 1921 |
| 513 | Ga0268264_10092534 | 3300028381 | Bacteria | 2610 |
| 514 | Ga0307517_10009682 | 3300028786 | Bacteria | 13624 |
| 515 | Ga0307517_10040445 | 3300028786 | Bacteria | 5075 |
| 516 | Ga0307513_10003398 | 3300031456 | Bacteria | 21628 |
| 517 | Ga0307408_100243896 | 3300031548 | Bacteria | 1478 |
| 518 | Ga0307508_10000356 | 3300031616 | Bacteria | 55624 |
| 519 | Ga0307405_10021657 | 3300031731 | Bacteria | 3617 |
| 520 | Ga0307405_10243486 | 3300031731 | Bacteria | 1333 |
| 521 | Ga0307405_10352550 | 3300031731 | Bacteria | 1135 |
| 522 | Ga0307413_10076619 | 3300031824 | Bacteria | 2126 |
| 523 | Ga0307413_10098929 | 3300031824 | Bacteria | 1922 |
| 524 | Ga0307413_10183478 | 3300031824 | Bacteria | 1495 |
| 525 | Ga0307410_10035145 | 3300031852 | Bacteria | 3252 |
| 526 | Ga0307410_10045915 | 3300031852 | Bacteria | 2912 |
| 527 | Ga0307406_10092330 | 3300031901 | Bacteria | 2041 |
| 528 | Ga0307407_10155856 | 3300031903 | Bacteria | 1489 |
| 529 | Ga0307412_10176974 | 3300031911 | Bacteria | 1600 |
| 530 | Ga0307409_100008827 | 3300031995 | Bacteria | 6147 |
| 531 | Ga0307409_100248451 | 3300031995 | Bacteria | 1625 |
| 532 | Ga0307416_100084089 | 3300032002 | Bacteria | 2702 |
| 533 | Ga0307416_100149259 | 3300032002 | Bacteria | 2141 |
| 534 | Ga0307416_100560135 | 3300032002 | Bacteria | 1217 |
| 535 | Ga0307414_10098254 | 3300032004 | Bacteria | 2196 |
| 536 | Ga0307414_10211466 | 3300032004 | Bacteria | 1585 |
| 537 | Ga0307414_10241334 | 3300032004 | Bacteria | 1496 |
| 538 | Ga0307411_10001313 | 3300032005 | Bacteria | 10000 |
| 539 | Ga0307411_10254276 | 3300032005 | Bacteria | 1383 |
| 540 | Ga0307415_100016305 | 3300032126 | Bacteria | 4426 |
| 541 | Ga0307415_100341727 | 3300032126 | Bacteria | 1256 |
| 542 | Ga0373960_0040034 | 3300035121 | Bacteria | 1351 |
| 543 | Ga0373942_0004964 | 3300035207 | Bacteria | 3085 |
| 544 | Ga0373961_0025745 | 3300035241 | Bacteria | 1602 |
| 545 | Ga0373931_0001320 | 3300035691 | Bacteria | 10617 |
| 546 | Ga0395899_0000669 | 3300037312 | Bacteria | 34717 |
| 547 | Ga0395899_0009002 | 3300037312 | Bacteria | 7675 |
| 548 | Ga0395899_0014277 | 3300037312 | Bacteria | 6064 |
| 549 | Ga0395899_0031627 | 3300037312 | Bacteria | 3977 |
| 550 | Ga0395899_0041264 | 3300037312 | Bacteria | 3448 |
| 551 | Ga0395899_0042526 | 3300037312 | Bacteria | 3392 |
| 552 | Ga0395899_0042725 | 3300037312 | Bacteria | 3382 |
| 553 | Ga0395899_0044505 | 3300037312 | Bacteria | 3307 |
| 554 | Ga0395899_0045250 | 3300037312 | Bacteria | 3279 |
| 555 | Ga0395899_0070866 | 3300037312 | Bacteria | 2551 |
| 556 | Ga0395899_0281051 | 3300037312 | Bacteria | 1132 |
| 557 | Ga0395899_0352505 | 3300037312 | Bacteria | 984 |
| 558 | Ga0395900_0000308 | 3300037418 | Bacteria | 72664 |
| 559 | Ga0395900_0001779 | 3300037418 | Bacteria | 24718 |
| 560 | Ga0395900_0003085 | 3300037418 | Bacteria | 18103 |
| 561 | Ga0395900_0008220 | 3300037418 | Bacteria | 10743 |
| 562 | Ga0395900_0033740 | 3300037418 | Bacteria | 5267 |
| 563 | Ga0395900_0036295 | 3300037418 | Bacteria | 5081 |
| 564 | Ga0395900_0040236 | 3300037418 | Bacteria | 4817 |
| 565 | Ga0395900_0062159 | 3300037418 | Bacteria | 3838 |
| 566 | Ga0395900_0063223 | 3300037418 | Bacteria | 3804 |
| 567 | Ga0395900_0106959 | 3300037418 | Bacteria | 2874 |
| 568 | Ga0395900_0171260 | 3300037418 | Bacteria | 2210 |
| 569 | Ga0395900_0184621 | 3300037418 | Bacteria | 2117 |
| 570 | Ga0395900_0192970 | 3300037418 | Bacteria | 2065 |
| 571 | Ga0395900_0201824 | 3300037418 | Bacteria | 2011 |
| 572 | Ga0395900_0211619 | 3300037418 | Bacteria | 1957 |
| 573 | Ga0395900_0327259 | 3300037418 | Bacteria | 1511 |
| 574 | Ga0395900_0437944 | 3300037418 | Bacteria | 1265 |
| 575 | Ga0395900_0499229 | 3300037418 | Bacteria | 1167 |
| 576 | Ga0395900_0757776 | 3300037418 | Bacteria | 901 |
| 577 | Ga0395898_0001096 | 3300037466 | Bacteria | 41791 |
| 578 | Ga0395898_0019188 | 3300037466 | Bacteria | 6961 |
| 579 | Ga0395898_0021270 | 3300037466 | Bacteria | 6579 |
| 580 | Ga0395898_0052037 | 3300037466 | Bacteria | 4002 |
| 581 | Ga0395898_0053594 | 3300037466 | Bacteria | 3939 |
| 582 | Ga0395898_0065908 | 3300037466 | Bacteria | 3510 |
| 583 | Ga0395898_0079198 | 3300037466 | Bacteria | 3170 |
| 584 | Ga0395898_0233362 | 3300037466 | Bacteria | 1754 |
| 585 | Ga0395898_0343906 | 3300037466 | Bacteria | 1422 |
| 586 | Ga0395905_0000005 | 3300037471 | Bacteria | 557808 |
| 587 | Ga0395905_0000104 | 3300037471 | Bacteria | 141965 |
| 588 | Ga0395905_0004102 | 3300037471 | Bacteria | 15259 |
| 589 | Ga0395905_0008459 | 3300037471 | Bacteria | 10149 |
| 590 | Ga0395905_0013074 | 3300037471 | Bacteria | 7969 |
| 591 | Ga0395905_0015364 | 3300037471 | Bacteria | 7276 |
| 592 | Ga0395905_0023579 | 3300037471 | Bacteria | 5813 |
| 593 | Ga0395905_0029447 | 3300037471 | Bacteria | 5172 |
| 594 | Ga0395905_0036894 | 3300037471 | Bacteria | 4591 |
| 595 | Ga0395905_0037718 | 3300037471 | Bacteria | 4535 |
| 596 | Ga0395905_0058040 | 3300037471 | Bacteria | 3619 |
| 597 | Ga0395905_0064094 | 3300037471 | Bacteria | 3438 |
| 598 | Ga0395905_0071420 | 3300037471 | Bacteria | 3254 |
| 599 | Ga0395905_0104119 | 3300037471 | Bacteria | 2664 |
| 600 | Ga0395905_0107222 | 3300037471 | Bacteria | 2623 |
| 601 | Ga0395905_0107854 | 3300037471 | Bacteria | 2614 |
| 602 | Ga0395905_0135768 | 3300037471 | Bacteria | 2314 |
| 603 | Ga0395905_0251626 | 3300037471 | Bacteria | 1650 |
| 604 | Ga0395905_0281686 | 3300037471 | Bacteria | 1548 |
| 605 | Ga0395905_0475173 | 3300037471 | Bacteria | 1149 |
| 606 | Ga0395905_0578907 | 3300037471 | Bacteria | 1024 |
| 607 | Ga0395901_0000782 | 3300038443 | Bacteria | 35570 |
| 608 | Ga0395901_0020938 | 3300038443 | Bacteria | 6699 |
| 609 | Ga0395901_0028743 | 3300038443 | Bacteria | 5720 |
| 610 | Ga0395901_0053134 | 3300038443 | Bacteria | 4210 |
| 611 | Ga0395901_0083434 | 3300038443 | Bacteria | 3340 |
| 612 | Ga0395901_0085676 | 3300038443 | Bacteria | 3293 |
| 613 | Ga0395901_0103175 | 3300038443 | Bacteria | 2992 |
| 614 | Ga0395901_0117568 | 3300038443 | Bacteria | 2793 |
| 615 | Ga0395901_0131734 | 3300038443 | Bacteria | 2627 |
| 616 | Ga0395901_0167194 | 3300038443 | Bacteria | 2308 |
| 617 | Ga0395901_0247424 | 3300038443 | Bacteria | 1858 |
| 618 | Ga0395901_0251336 | 3300038443 | Bacteria | 1841 |
| 619 | Ga0395901_0282216 | 3300038443 | Bacteria | 1725 |
| 620 | Ga0395901_0341045 | 3300038443 | Bacteria | 1548 |
| 621 | Ga0395901_0576660 | 3300038443 | Bacteria | 1137 |
| 622 | Ga0436365_0881543 | 3300039437 | Bacteria | 7406 |
| 623 | Ga0439448_0037801 | 3300042005 | Bacteria | 1552 |
| 624 | Ga0439455_0015588 | 3300042012 | Bacteria | 1748 |
| 625 | Ga0450917_001419 | 3300042120 | Bacteria | 1716 |
| 626 | Ga0450905_000986 | 3300042142 | Bacteria | 3564 |
| 627 | Ga0450889_000060 | 3300042144 | Bacteria | 9820 |
| 628 | Ga0439458_0000590 | 3300042157 | Bacteria | 9358 |
| 629 | Ga0439458_0007395 | 3300042157 | Bacteria | 2446 |
| 630 | Ga0466969_0029974 | 3300044656 | Bacteria | 2774 |
| 631 | Ga0466972_0077259 | 3300044658 | Bacteria | 1586 |
| 632 | Ga0466966_0013413 | 3300044684 | Bacteria | 5424 |
| 633 | Ga0466966_0031937 | 3300044684 | Bacteria | 3415 |
| 634 | Ga0466961_0163269 | 3300044693 | Bacteria | 1388 |
| 635 | Ga0466963_0028762 | 3300044694 | Bacteria | 3572 |
| 636 | Ga0466963_0043158 | 3300044694 | Bacteria | 2963 |
| 637 | Ga0466963_0047770 | 3300044694 | Bacteria | 2826 |
| 638 | Ga0466963_0062754 | 3300044694 | Bacteria | 2485 |
| 639 | Ga0466964_0027173 | 3300044706 | Bacteria | 2245 |
| 640 | Ga0466971_0060097 | 3300044719 | Bacteria | 1718 |
| 641 | Ga0466970_0061628 | 3300044765 | Bacteria | 2010 |
| 642 | Ga0466970_0084406 | 3300044765 | Bacteria | 1719 |
| 643 | Ga0466970_0242063 | 3300044765 | Bacteria | 1010 |
| 644 | Ga0466957_0022875 | 3300044842 | Bacteria | 3690 |
| 645 | Ga0466957_0039900 | 3300044842 | Bacteria | 2834 |
| 646 | Ga0466957_0040546 | 3300044842 | Bacteria | 2812 |
| 647 | Ga0466957_0054643 | 3300044842 | Bacteria | 2438 |
| 648 | Ga0466957_0139265 | 3300044842 | Bacteria | 1562 |
| 649 | Ga0466957_0160011 | 3300044842 | Bacteria | 1462 |
| 650 | Ga0466959_0048801 | 3300045049 | Bacteria | 3111 |
| 651 | Ga0466959_0161612 | 3300045049 | Bacteria | 1575 |
| 652 | Ga0466958_0013804 | 3300045836 | Bacteria | 4605 |
| 653 | Ga0466958_0028552 | 3300045836 | Bacteria | 3308 |
| 654 | Ga0466958_0032340 | 3300045836 | Bacteria | 3112 |
| 655 | Ga0466967_0006997 | 3300045976 | Bacteria | 8072 |
| 656 | Ga0466967_0048466 | 3300045976 | Bacteria | 3710 |
| 657 | Ga0466967_0057847 | 3300045976 | Bacteria | 3425 |
| 658 | Ga0466967_0076838 | 3300045976 | Bacteria | 3004 |
| 659 | Ga0466967_0088576 | 3300045976 | Bacteria | 2809 |
| 660 | Ga0466967_0117662 | 3300045976 | Bacteria | 2450 |
| 661 | Ga0466967_0128786 | 3300045976 | Bacteria | 2347 |
| 662 | Ga0466967_0157070 | 3300045976 | Bacteria | 2131 |
| 663 | Ga0495617_007659 | 3300046452 | Bacteria | 3739 |
| 664 | Ga0495629_0050339 | 3300046459 | Bacteria | 2918 |
| 665 | Ga0495650_0000535 | 3300046471 | Bacteria | 54750 |
| 666 | Ga0495585_0020012 | 3300046492 | Bacteria | 3850 |
| 667 | Ga0495596_0005441 | 3300046500 | Bacteria | 6015 |
| 668 | Ga0495583_0003199 | 3300046506 | Bacteria | 12834 |
| 669 | Ga0495583_0010010 | 3300046506 | Bacteria | 5587 |
| 670 | Ga0495583_0019541 | 3300046506 | Bacteria | 3533 |
| 671 | Ga0495583_0088651 | 3300046506 | Bacteria | 1335 |
| 672 | Ga0495606_0000071 | 3300046507 | Bacteria | 175933 |
| 673 | Ga0495606_0035134 | 3300046507 | Bacteria | 3430 |
| 674 | Ga0495631_0011246 | 3300046518 | Bacteria | 4405 |
| 675 | Ga0495631_0045058 | 3300046518 | Bacteria | 1942 |
| 676 | Ga0495631_0077242 | 3300046518 | Bacteria | 1437 |
| 677 | Ga0495643_0000732 | 3300046522 | Bacteria | 37427 |
| 678 | Ga0495643_0001351 | 3300046522 | Bacteria | 23040 |
| 679 | Ga0495643_0015744 | 3300046522 | Bacteria | 4460 |
| 680 | Ga0495648_0000433 | 3300046524 | Bacteria | 45500 |
| 681 | Ga0495648_0121628 | 3300046524 | Bacteria | 1402 |
| 682 | Ga0495648_0130853 | 3300046524 | Bacteria | 1334 |
| 683 | Ga0495663_0000282 | 3300046525 | Bacteria | 19400 |
| 684 | Ga0495642_0001975 | 3300046528 | Bacteria | 8606 |
| 685 | Ga0495642_0068810 | 3300046528 | Bacteria | 1478 |
| 686 | Ga0495642_0078536 | 3300046528 | Bacteria | 1387 |
| 687 | Ga0495587_0011414 | 3300046536 | Bacteria | 5631 |
| 688 | Ga0495598_0004019 | 3300046537 | Bacteria | 3158 |
| 689 | Ga0495598_0034026 | 3300046537 | Bacteria | 1450 |
| 690 | Ga0495597_0008373 | 3300046542 | Bacteria | 5184 |
| 691 | Ga0495633_0002247 | 3300046558 | Bacteria | 13823 |
| 692 | Ga0495633_0108868 | 3300046558 | Bacteria | 1285 |
| 693 | Ga0495668_0000098 | 3300046616 | Bacteria | 138553 |
| 694 | Ga0495668_0034201 | 3300046616 | Bacteria | 2853 |
| 695 | Ga0495668_0053335 | 3300046616 | Bacteria | 2235 |
| 696 | Ga0495625_0000427 | 3300046660 | Bacteria | 63470 |
| 697 | Ga0495625_0000860 | 3300046660 | Bacteria | 41288 |
| 698 | Ga0495625_0060406 | 3300046660 | Bacteria | 2685 |
| 699 | Ga0495625_0115557 | 3300046660 | Bacteria | 1831 |
| 700 | Ga0495669_0000043 | 3300046684 | Bacteria | 86386 |
| 701 | Ga0495669_0007885 | 3300046684 | Bacteria | 4468 |
| 702 | Ga0495669_0009309 | 3300046684 | Bacteria | 4139 |
| 703 | Ga0495669_0073756 | 3300046684 | Bacteria | 1559 |
| 704 | Ga0495669_0074673 | 3300046684 | Bacteria | 1550 |
| 705 | Ga0495670_0000071 | 3300046691 | Bacteria | 45180 |
| 706 | Ga0495670_0102897 | 3300046691 | Bacteria | 1472 |
| 707 | Ga0495600_0007622 | 3300046809 | Bacteria | 6631 |
| 708 | Ga0495683_0015599 | 3300047323 | Bacteria | 3950 |
| 709 | Ga0495683_0025405 | 3300047323 | Bacteria | 3036 |
| 710 | Ga0495687_000597 | 3300047443 | Bacteria | 42130 |
| 711 | Ga0495687_001875 | 3300047443 | Bacteria | 18189 |
| 712 | Ga0495677_0003207 | 3300047445 | Bacteria | 6376 |
| 713 | Ga0495677_0120182 | 3300047445 | Bacteria | 1002 |
| 714 | Ga0495673_0085504 | 3300047469 | Bacteria | 1298 |
| 715 | Ga0495681_0005160 | 3300047470 | Bacteria | 8790 |
| 716 | Ga0495686_0000600 | 3300047472 | Bacteria | 50240 |
| 717 | Ga0496100_0029988 | 3300048903 | Bacteria | 3369 |
| 718 | Ga0496101_0010849 | 3300048904 | Bacteria | 6027 |
| 719 | Ga0496101_0041590 | 3300048904 | Bacteria | 3278 |
| 720 | Ga0496101_0082827 | 3300048904 | Bacteria | 2374 |
| 721 | Ga0496101_0285753 | 3300048904 | Bacteria | 1290 |
| 722 | Ga0496101_0371510 | 3300048904 | Bacteria | 1125 |
| 723 | Ga0496102_0000092 | 3300048905 | Bacteria | 125879 |
| 724 | Ga0496102_0060901 | 3300048905 | Bacteria | 3453 |
| 725 | Ga0496103_0000101 | 3300048906 | Bacteria | 93679 |
| 726 | Ga0496103_0051009 | 3300048906 | Bacteria | 2560 |
| 727 | Ga0496103_0059631 | 3300048906 | Bacteria | 2371 |
| 728 | Ga0496103_0090215 | 3300048906 | Bacteria | 1934 |
| 729 | Ga0496104_0042934 | 3300048907 | Bacteria | 4246 |
| 730 | Ga0496104_0137509 | 3300048907 | Bacteria | 2347 |
| 731 | Ga0496104_0240695 | 3300048907 | Bacteria | 1722 |
| 732 | Ga0496104_0625397 | 3300048907 | Bacteria | 986 |
| 733 | Ga0496105_0006455 | 3300048908 | Bacteria | 9018 |
| 734 | Ga0496106_0001313 | 3300048909 | Bacteria | 18647 |
| 735 | Ga0496106_0016396 | 3300048909 | Bacteria | 5482 |
| 736 | Ga0496106_0654186 | 3300048909 | Bacteria | 839 |
| 737 | Ga0496107_0002900 | 3300048910 | Bacteria | 11331 |
| 738 | Ga0496107_0003295 | 3300048910 | Bacteria | 10778 |
| 739 | Ga0496107_0011494 | 3300048910 | Bacteria | 6167 |
| 740 | Ga0496107_0092038 | 3300048910 | Bacteria | 2216 |
| 741 | Ga0496108_0002906 | 3300048911 | Bacteria | 13765 |
| 742 | Ga0496108_0003739 | 3300048911 | Bacteria | 12204 |
| 743 | Ga0496108_0006177 | 3300048911 | Bacteria | 9691 |
| 744 | Ga0496108_0054179 | 3300048911 | Bacteria | 3366 |
| 745 | Ga0496109_0006553 | 3300048912 | Bacteria | 9799 |
| 746 | Ga0496109_0013443 | 3300048912 | Bacteria | 7101 |
| 747 | Ga0496109_0013577 | 3300048912 | Bacteria | 7073 |
| 748 | Ga0496109_0067116 | 3300048912 | Bacteria | 3285 |
| 749 | Ga0496109_0069377 | 3300048912 | Bacteria | 3232 |
| 750 | Ga0496109_0183840 | 3300048912 | Bacteria | 1964 |
| 751 | Ga0496109_0236653 | 3300048912 | Bacteria | 1718 |
| 752 | Ga0496110_0008709 | 3300048913 | Bacteria | 8172 |
| 753 | Ga0496110_0025175 | 3300048913 | Bacteria | 5083 |
| 754 | Ga0496110_0033905 | 3300048913 | Bacteria | 4418 |
| 755 | Ga0496110_0046307 | 3300048913 | Bacteria | 3805 |
| 756 | Ga0496110_0118944 | 3300048913 | Bacteria | 2379 |
| 757 | Ga0496110_0493540 | 3300048913 | Bacteria | 1115 |
| 758 | Ga0496111_0000496 | 3300048914 | Bacteria | 20302 |
| 759 | Ga0496111_0002376 | 3300048914 | Bacteria | 11340 |
| 760 | Ga0496111_0008693 | 3300048914 | Bacteria | 6739 |
| 761 | Ga0496111_0067683 | 3300048914 | Bacteria | 2594 |
| 762 | Ga0496112_0000275 | 3300048915 | Bacteria | 33348 |
| 763 | Ga0496112_0010745 | 3300048915 | Bacteria | 8325 |
| 764 | Ga0496112_0040084 | 3300048915 | Bacteria | 4578 |
| 765 | Ga0496112_0040418 | 3300048915 | Bacteria | 4559 |
| 766 | Ga0496112_0050186 | 3300048915 | Bacteria | 4091 |
| 767 | Ga0496112_0061899 | 3300048915 | Bacteria | 3690 |
| 768 | Ga0496112_0147653 | 3300048915 | Bacteria | 2319 |
| 769 | Ga0496112_0499608 | 3300048915 | Bacteria | 1152 |
| 770 | Ga0496112_0697361 | 3300048915 | Bacteria | 943 |
| 771 | Ga0496113_0005727 | 3300048916 | Bacteria | 7784 |
| 772 | Ga0496113_0006279 | 3300048916 | Bacteria | 7514 |
| 773 | Ga0496113_0010921 | 3300048916 | Bacteria | 6028 |
| 774 | Ga0496113_0011965 | 3300048916 | Bacteria | 5816 |
| 775 | Ga0496113_0047318 | 3300048916 | Bacteria | 3196 |
| 776 | Ga0496113_0335835 | 3300048916 | Bacteria | 1212 |
| 777 | Ga0496113_0606952 | 3300048916 | Bacteria | 876 |
| 778 | Ga0496114_0000029 | 3300048917 | Bacteria | 175132 |
| 779 | Ga0496114_0001189 | 3300048917 | Bacteria | 19687 |
| 780 | Ga0496114_0003038 | 3300048917 | Bacteria | 12855 |
| 781 | Ga0496114_0203216 | 3300048917 | Bacteria | 1736 |
| 782 | Ga0496115_0000038 | 3300048918 | Bacteria | 125104 |
| 783 | Ga0496115_0020881 | 3300048918 | Bacteria | 5054 |
| 784 | Ga0496115_0031543 | 3300048918 | Bacteria | 4176 |
| 785 | Ga0496116_0018815 | 3300048919 | Bacteria | 5307 |
| 786 | Ga0496117_0000173 | 3300048920 | Bacteria | 133415 |
| 787 | Ga0496118_0000131 | 3300048921 | Bacteria | 133116 |
| 788 | Ga0496119_0017008 | 3300048922 | Bacteria | 5499 |
| 789 | Ga0496120_0067331 | 3300048923 | Bacteria | 1979 |
| 790 | Ga0496121_0000209 | 3300048924 | Bacteria | 129740 |
| 791 | Ga0496121_0000652 | 3300048924 | Bacteria | 64960 |
| 792 | Ga0496123_0020876 | 3300048926 | Bacteria | 5107 |
| 793 | Ga0496124_0000166 | 3300048927 | Bacteria | 133634 |
| 794 | Ga0496125_0001208 | 3300048928 | Bacteria | 38840 |
| 795 | Ga0496126_0000222 | 3300048929 | Bacteria | 123936 |
| 796 | Ga0501067_0030314 | 3300049583 | Bacteria | 3000 |
| 797 | Ga0501067_0147758 | 3300049583 | Bacteria | 1309 |
| 798 | Ga0501068_0052576 | 3300049584 | Bacteria | 2465 |
| 799 | Ga0501068_0202444 | 3300049584 | Bacteria | 1259 |
| 800 | Ga0501069_0195704 | 3300049585 | Bacteria | 1170 |
| 801 | Ga0501209_038047 | 3300049656 | Bacteria | 1259 |
| 802 | Ga0501242_006405 | 3300049674 | Bacteria | 1341 |
| 803 | Ga0501263_006198 | 3300049760 | Bacteria | 1375 |
| 804 | Ga0501268_004670 | 3300049765 | Bacteria | 1939 |
| 805 | Ga0501268_022242 | 3300049765 | Bacteria | 1093 |
| 806 | Ga0501273_006014 | 3300049770 | Bacteria | 1391 |
| 807 | Ga0501283_011523 | 3300049779 | Bacteria | 1317 |
| 808 | Ga0500610_0000147 | 3300053079 | Bacteria | 21141 |
| 809 | Ga0495655_0009272 | 3300053083 | Bacteria | 1902 |
| 810 | Ga0500595_002101 | 3300053119 | Bacteria | 10183 |
| 811 | Ga0500642_0006122 | 3300053130 | Bacteria | 3938 |
| 812 | Ga0500658_0004026 | 3300053134 | Bacteria | 5521 |
| 813 | Ga0500568_0088168 | 3300053139 | Bacteria | 1172 |
| 814 | Ga0500616_0032370 | 3300053153 | Bacteria | 2859 |
| 815 | Ga0500619_016729 | 3300053154 | Bacteria | 2024 |
| 816 | Ga0500636_0002292 | 3300053177 | Bacteria | 10615 |
| 817 | Ga0500645_000267 | 3300053730 | Bacteria | 37622 |
| 818 | Ga0500596_000434 | 3300053735 | Bacteria | 7732 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005564 | Ga0070664_100132008 | Ga0070664_1001320082 | 254 |
| 2 | 3300005578 | Ga0068854_100028082 | Ga0068854_1000280825 | 254 |
| 3 | 3300005834 | Ga0068851_10113757 | Ga0068851_101137572 | 254 |
| 4 | 3300009551 | Ga0105238_10174147 | Ga0105238_101741472 | 254 |
| 5 | 3300001979 | JGI24740J21852_10026133 | JGI24740J21852_100261332 | 255 |
| 6 | 3300013104 | Ga0157370_10061299 | Ga0157370_100612994 | 255 |
| 7 | 3300025904 | Ga0207647_10049297 | Ga0207647_100492972 | 255 |
| 8 | 3300025911 | Ga0207654_10158445 | Ga0207654_101584451 | 255 |
| 9 | 3300025919 | Ga0207657_10103533 | Ga0207657_101035332 | 255 |
| 10 | 3300025920 | Ga0207649_10036132 | Ga0207649_100361323 | 255 |
| 11 | 3300025933 | Ga0207706_10040368 | Ga0207706_100403685 | 255 |
| 12 | 3300025944 | Ga0207661_10342216 | Ga0207661_103422162 | 255 |
| 13 | 3300025949 | Ga0207667_10092310 | Ga0207667_100923104 | 255 |
| 14 | 3300026067 | Ga0207678_10032502 | Ga0207678_100325022 | 255 |
| 15 | 3300026116 | Ga0207674_10001507 | Ga0207674_1000150726 | 255 |
| 16 | 3300031731 | Ga0307405_10243486 | Ga0307405_102434862 | 255 |
| 17 | 3300031731 | Ga0307405_10352550 | Ga0307405_103525501 | 255 |
| 18 | 3300032002 | Ga0307416_100084089 | Ga0307416_1000840892 | 255 |
| 19 | 3300032004 | Ga0307414_10211466 | Ga0307414_102114662 | 255 |
| 20 | 3300037418 | Ga0395900_0757776 | Ga0395900_0757776_16_783 | 255 |
| 21 | 3300044693 | Ga0466961_0163269 | Ga0466961_0163269_481_1278 | 255 |
| 22 | 3300048916 | Ga0496113_0606952 | Ga0496113_0606952_56_823 | 255 |
| 23 | 3300049674 | Ga0501242_006405 | Ga0501242_006405_165_932 | 255 |
| 24 | 3300053154 | Ga0500619_016729 | Ga0500619_016729_1103_1999 | 255 |
| 25 | 3300048909 | Ga0496106_0654186 | Ga0496106_0654186_17_790 | 257 |
| 26 | 3300049656 | Ga0501209_038047 | Ga0501209_038047_34_807 | 257 |
| 27 | 3300049760 | Ga0501263_006198 | Ga0501263_006198_145_918 | 257 |
| 28 | 3300049765 | Ga0501268_004670 | Ga0501268_004670_458_1231 | 257 |
| 29 | 3300049770 | Ga0501273_006014 | Ga0501273_006014_530_1303 | 257 |
| 30 | 3300049779 | Ga0501283_011523 | Ga0501283_011523_347_1120 | 257 |
| 31 | 3300013105 | Ga0157369_10135686 | Ga0157369_101356862 | 265 |
| 32 | 3300037471 | Ga0395905_0251626 | Ga0395905_0251626_42_902 | 265 |
| 33 | 3300038443 | Ga0395901_0117568 | Ga0395901_0117568_1647_2444 | 265 |
| 34 | 3300046507 | Ga0495606_0035134 | Ga0495606_0035134_1560_2564 | 267 |
| 35 | 3300026089 | Ga0207648_10008437 | Ga0207648_1000843713 | 268 |
| 36 | 3300046522 | Ga0495643_0015744 | Ga0495643_0015744_2133_3137 | 268 |
| 37 | 3300031824 | Ga0307413_10183478 | Ga0307413_101834782 | 269 |
| 38 | 3300053139 | Ga0500568_0088168 | Ga0500568_0088168_149_1105 | 269 |
| 39 | 3300053153 | Ga0500616_0032370 | Ga0500616_0032370_1739_2695 | 269 |
| 40 | iso_pu_bacteria | 2599185354 | 2600202223 | 269 |
| 41 | iso_pu_bacteria | 2751185897 | 2753766174 | 269 |
| 42 | 3300005353 | Ga0070669_100039928 | Ga0070669_1000399283 | 270 |
| 43 | 3300005441 | Ga0070700_100116658 | Ga0070700_1001166583 | 270 |
| 44 | 3300013104 | Ga0157370_10112417 | Ga0157370_101124174 | 270 |
| 45 | 3300025926 | Ga0207659_10218861 | Ga0207659_102188612 | 270 |
| 46 | 3300025940 | Ga0207691_10151051 | Ga0207691_101510512 | 270 |
| 47 | 3300025949 | Ga0207667_10093131 | Ga0207667_100931312 | 270 |
| 48 | 3300026075 | Ga0207708_10105923 | Ga0207708_101059232 | 270 |
| 49 | 3300046492 | Ga0495585_0020012 | Ga0495585_0020012_2435_3439 | 270 |
| 50 | 3300042005 | Ga0439448_0037801 | Ga0439448_0037801_215_1225 | 271 |
| 51 | 3300031911 | Ga0307412_10176974 | Ga0307412_101769742 | 272 |
| 52 | iso_pu_bacteria | 8057101203 | 8057101488 | 272 |
| 53 | 3300025926 | Ga0207659_10087041 | Ga0207659_100870412 | 273 |
| 54 | 3300037312 | Ga0395899_0352505 | Ga0395899_0352505_20_883 | 273 |
| 55 | 3300037418 | Ga0395900_0171260 | Ga0395900_0171260_176_1039 | 273 |
| 56 | 3300038443 | Ga0395901_0083434 | Ga0395901_0083434_1444_2307 | 273 |
| 57 | 3300005548 | Ga0070665_100000067 | Ga0070665_1000000675 | 274 |
| 58 | 3300009094 | Ga0111539_10061223 | Ga0111539_100612231 | 274 |
| 59 | 3300025908 | Ga0207643_10126928 | Ga0207643_101269281 | 274 |
| 60 | 3300028379 | Ga0268266_10000002 | Ga0268266_1000000279 | 274 |
| 61 | 3300003214 | JGI25165J46597_1000065 | JGI25165J46597_100006578 | 275 |
| 62 | 3300005339 | Ga0070660_100377135 | Ga0070660_1003771351 | 275 |
| 63 | 3300005366 | Ga0070659_100090047 | Ga0070659_1000900472 | 275 |
| 64 | 3300005444 | Ga0070694_100061256 | Ga0070694_1000612563 | 275 |
| 65 | 3300005467 | Ga0070706_100137583 | Ga0070706_1001375832 | 275 |
| 66 | 3300005546 | Ga0070696_100036650 | Ga0070696_1000366502 | 275 |
| 67 | 3300025261 | Ga0209233_1000107 | Ga0209233_1000107130 | 275 |
| 68 | 3300025912 | Ga0207707_10387583 | Ga0207707_103875832 | 275 |
| 69 | 3300025917 | Ga0207660_10530421 | Ga0207660_105304211 | 275 |
| 70 | 3300025919 | Ga0207657_10299024 | Ga0207657_102990241 | 275 |
| 71 | 3300025932 | Ga0207690_10362458 | Ga0207690_103624582 | 275 |
| 72 | 3300025935 | Ga0207709_10130993 | Ga0207709_101309932 | 275 |
| 73 | 3300037471 | Ga0395905_0578907 | Ga0395905_0578907_74_952 | 275 |
| 74 | 3300042120 | Ga0450917_001419 | Ga0450917_001419_235_1122 | 275 |
| 75 | 3300042142 | Ga0450905_000986 | Ga0450905_000986_1673_2560 | 275 |
| 76 | 3300042144 | Ga0450889_000060 | Ga0450889_000060_1300_2187 | 275 |
| 77 | 3300046660 | Ga0495625_0000860 | Ga0495625_0000860_36137_37093 | 275 |
| 78 | 3300047472 | Ga0495686_0000600 | Ga0495686_0000600_45994_46947 | 275 |
| 79 | 3300053134 | Ga0500658_0004026 | Ga0500658_0004026_4233_5183 | 275 |
| 80 | 3300005354 | Ga0070675_100137900 | Ga0070675_1001379001 | 276 |
| 81 | 3300005366 | Ga0070659_100192100 | Ga0070659_1001921002 | 276 |
| 82 | 3300005563 | Ga0068855_100136178 | Ga0068855_1001361782 | 276 |
| 83 | 3300013100 | Ga0157373_10151099 | Ga0157373_101510992 | 276 |
| 84 | 3300025904 | Ga0207647_10019369 | Ga0207647_100193695 | 276 |
| 85 | 3300025925 | Ga0207650_10036679 | Ga0207650_100366792 | 276 |
| 86 | 3300025933 | Ga0207706_10087222 | Ga0207706_100872224 | 276 |
| 87 | 3300046506 | Ga0495583_0019541 | Ga0495583_0019541_909_1910 | 276 |
| 88 | 3300046518 | Ga0495631_0077242 | Ga0495631_0077242_81_1082 | 276 |
| 89 | 3300046524 | Ga0495648_0000433 | Ga0495648_0000433_31413_32414 | 276 |
| 90 | 3300046524 | Ga0495648_0121628 | Ga0495648_0121628_385_1386 | 276 |
| 91 | 3300046525 | Ga0495663_0000282 | Ga0495663_0000282_257_1258 | 276 |
| 92 | 3300046660 | Ga0495625_0060406 | Ga0495625_0060406_491_1492 | 276 |
| 93 | 3300047323 | Ga0495683_0015599 | Ga0495683_0015599_408_1409 | 276 |
| 94 | 3300047470 | Ga0495681_0005160 | Ga0495681_0005160_7288_8289 | 276 |
| 95 | 3300048907 | Ga0496104_0625397 | Ga0496104_0625397_73_918 | 276 |
| 96 | 3300048912 | Ga0496109_0236653 | Ga0496109_0236653_181_1182 | 276 |
| 97 | 3300048915 | Ga0496112_0499608 | Ga0496112_0499608_65_1066 | 276 |
| 98 | 3300048916 | Ga0496113_0047318 | Ga0496113_0047318_874_1875 | 276 |
| 99 | 3300048926 | Ga0496123_0020876 | Ga0496123_0020876_3280_4281 | 276 |
| 100 | 3300048928 | Ga0496125_0001208 | Ga0496125_0001208_3287_4288 | 276 |
| 101 | 3300053130 | Ga0500642_0006122 | Ga0500642_0006122_516_1517 | 276 |
| 102 | 3300003215 | JGI25153J46596_10000007 | JGI25153J46596_1000000751 | 277 |
| 103 | 3300003759 | Ga0055525_1000080 | Ga0055525_100008070 | 277 |
| 104 | 3300003762 | Ga0055542_1000012 | Ga0055542_1000012230 | 277 |
| 105 | 3300003763 | Ga0055529_1000002 | Ga0055529_1000002146 | 277 |
| 106 | 3300003763 | Ga0055529_1000004 | Ga0055529_1000004373 | 277 |
| 107 | 3300005328 | Ga0070676_10222297 | Ga0070676_102222971 | 277 |
| 108 | 3300005356 | Ga0070674_100002142 | Ga0070674_1000021428 | 277 |
| 109 | 3300005356 | Ga0070674_100049373 | Ga0070674_1000493733 | 277 |
| 110 | 3300005356 | Ga0070674_100177605 | Ga0070674_1001776052 | 277 |
| 111 | 3300005364 | Ga0070673_100049988 | Ga0070673_1000499883 | 277 |
| 112 | 3300005456 | Ga0070678_100001712 | Ga0070678_1000017128 | 277 |
| 113 | 3300005457 | Ga0070662_100109461 | Ga0070662_1001094612 | 277 |
| 114 | 3300005459 | Ga0068867_100010806 | Ga0068867_1000108066 | 277 |
| 115 | 3300005548 | Ga0070665_100021263 | Ga0070665_1000212634 | 277 |
| 116 | 3300006237 | Ga0097621_100116346 | Ga0097621_1001163462 | 277 |
| 117 | 3300009148 | Ga0105243_10000522 | Ga0105243_1000052234 | 277 |
| 118 | 3300009176 | Ga0105242_10227480 | Ga0105242_102274801 | 277 |
| 119 | 3300011119 | Ga0105246_10043892 | Ga0105246_100438924 | 277 |
| 120 | 3300013296 | Ga0157374_10070272 | Ga0157374_100702722 | 277 |
| 121 | 3300025226 | Ga0209674_105513 | Ga0209674_1055132 | 277 |
| 122 | 3300025230 | Ga0209563_100058 | Ga0209563_100058191 | 277 |
| 123 | 3300025253 | Ga0209677_103797 | Ga0209677_1037974 | 277 |
| 124 | 3300025254 | Ga0209148_1000008 | Ga0209148_1000008864 | 277 |
| 125 | 3300025261 | Ga0209233_1004527 | Ga0209233_10045273 | 277 |
| 126 | 3300025272 | Ga0209455_1000002 | Ga0209455_1000002561 | 277 |
| 127 | 3300025297 | Ga0209758_1000017 | Ga0209758_100001752 | 277 |
| 128 | 3300025920 | Ga0207649_10266938 | Ga0207649_102669382 | 277 |
| 129 | 3300025935 | Ga0207709_10000109 | Ga0207709_1000010977 | 277 |
| 130 | 3300025937 | Ga0207669_10000359 | Ga0207669_100003594 | 277 |
| 131 | 3300025937 | Ga0207669_10001539 | Ga0207669_100015394 | 277 |
| 132 | 3300025938 | Ga0207704_10015989 | Ga0207704_100159892 | 277 |
| 133 | 3300026121 | Ga0207683_10001189 | Ga0207683_1000118917 | 277 |
| 134 | 3300028786 | Ga0307517_10040445 | Ga0307517_100404455 | 277 |
| 135 | 3300031456 | Ga0307513_10003398 | Ga0307513_1000339817 | 277 |
| 136 | 3300045049 | Ga0466959_0161612 | Ga0466959_0161612_276_1133 | 277 |
| 137 | 3300046452 | Ga0495617_007659 | Ga0495617_007659_290_1294 | 277 |
| 138 | 3300046459 | Ga0495629_0050339 | Ga0495629_0050339_323_1327 | 277 |
| 139 | 3300046471 | Ga0495650_0000535 | Ga0495650_0000535_3759_4763 | 277 |
| 140 | 3300046500 | Ga0495596_0005441 | Ga0495596_0005441_3679_4683 | 277 |
| 141 | 3300046506 | Ga0495583_0003199 | Ga0495583_0003199_8561_9565 | 277 |
| 142 | 3300046506 | Ga0495583_0010010 | Ga0495583_0010010_4142_5146 | 277 |
| 143 | 3300046507 | Ga0495606_0000071 | Ga0495606_0000071_45474_46478 | 277 |
| 144 | 3300046518 | Ga0495631_0011246 | Ga0495631_0011246_731_1741 | 277 |
| 145 | 3300046518 | Ga0495631_0045058 | Ga0495631_0045058_21_1025 | 277 |
| 146 | 3300046522 | Ga0495643_0000732 | Ga0495643_0000732_34867_35871 | 277 |
| 147 | 3300046522 | Ga0495643_0001351 | Ga0495643_0001351_517_1521 | 277 |
| 148 | 3300046524 | Ga0495648_0130853 | Ga0495648_0130853_21_1025 | 277 |
| 149 | 3300046528 | Ga0495642_0001975 | Ga0495642_0001975_7311_8315 | 277 |
| 150 | 3300046536 | Ga0495587_0011414 | Ga0495587_0011414_4003_5007 | 277 |
| 151 | 3300046542 | Ga0495597_0008373 | Ga0495597_0008373_954_1958 | 277 |
| 152 | 3300046558 | Ga0495633_0002247 | Ga0495633_0002247_3331_4341 | 277 |
| 153 | 3300046616 | Ga0495668_0000098 | Ga0495668_0000098_3757_4761 | 277 |
| 154 | 3300046616 | Ga0495668_0034201 | Ga0495668_0034201_522_1526 | 277 |
| 155 | 3300046660 | Ga0495625_0000427 | Ga0495625_0000427_61909_62913 | 277 |
| 156 | 3300046660 | Ga0495625_0115557 | Ga0495625_0115557_802_1806 | 277 |
| 157 | 3300046684 | Ga0495669_0000043 | Ga0495669_0000043_82108_83112 | 277 |
| 158 | 3300046691 | Ga0495670_0102897 | Ga0495670_0102897_172_1182 | 277 |
| 159 | 3300046809 | Ga0495600_0007622 | Ga0495600_0007622_2222_3226 | 277 |
| 160 | 3300047323 | Ga0495683_0025405 | Ga0495683_0025405_521_1525 | 277 |
| 161 | 3300047443 | Ga0495687_000597 | Ga0495687_000597_3256_4260 | 277 |
| 162 | 3300047443 | Ga0495687_001875 | Ga0495687_001875_13861_14865 | 277 |
| 163 | 3300047445 | Ga0495677_0003207 | Ga0495677_0003207_524_1528 | 277 |
| 164 | 3300047469 | Ga0495673_0085504 | Ga0495673_0085504_27_1031 | 277 |
| 165 | 3300048904 | Ga0496101_0082827 | Ga0496101_0082827_370_1377 | 277 |
| 166 | 3300048905 | Ga0496102_0000092 | Ga0496102_0000092_5374_6381 | 277 |
| 167 | 3300048906 | Ga0496103_0000101 | Ga0496103_0000101_3489_4496 | 277 |
| 168 | 3300048907 | Ga0496104_0042934 | Ga0496104_0042934_1027_2034 | 277 |
| 169 | 3300048908 | Ga0496105_0006455 | Ga0496105_0006455_3022_4029 | 277 |
| 170 | 3300048913 | Ga0496110_0008709 | Ga0496110_0008709_3884_4891 | 277 |
| 171 | 3300048914 | Ga0496111_0008693 | Ga0496111_0008693_511_1518 | 277 |
| 172 | 3300048917 | Ga0496114_0001189 | Ga0496114_0001189_17932_18939 | 277 |
| 173 | 3300048918 | Ga0496115_0000038 | Ga0496115_0000038_120831_121838 | 277 |
| 174 | 3300048919 | Ga0496116_0018815 | Ga0496116_0018815_3813_4820 | 277 |
| 175 | 3300048920 | Ga0496117_0000173 | Ga0496117_0000173_128915_129922 | 277 |
| 176 | 3300048921 | Ga0496118_0000131 | Ga0496118_0000131_3327_4334 | 277 |
| 177 | 3300048922 | Ga0496119_0017008 | Ga0496119_0017008_1398_2405 | 277 |
| 178 | 3300048923 | Ga0496120_0067331 | Ga0496120_0067331_646_1653 | 277 |
| 179 | 3300048924 | Ga0496121_0000209 | Ga0496121_0000209_3305_4312 | 277 |
| 180 | 3300048927 | Ga0496124_0000166 | Ga0496124_0000166_3495_4502 | 277 |
| 181 | 3300048929 | Ga0496126_0000222 | Ga0496126_0000222_119605_120612 | 277 |
| 182 | 3300053079 | Ga0500610_0000147 | Ga0500610_0000147_16817_17821 | 277 |
| 183 | 3300053119 | Ga0500595_002101 | Ga0500595_002101_3685_4689 | 277 |
| 184 | 3300053177 | Ga0500636_0002292 | Ga0500636_0002292_3342_4346 | 277 |
| 185 | 3300053730 | Ga0500645_000267 | Ga0500645_000267_33298_34302 | 277 |
| 186 | 3300001915 | JGI24741J21665_1001312 | JGI24741J21665_10013122 | 278 |
| 187 | 3300001979 | JGI24740J21852_10002628 | JGI24740J21852_100026287 | 278 |
| 188 | 3300001990 | JGI24737J22298_10002951 | JGI24737J22298_100029516 | 278 |
| 189 | 3300005339 | Ga0070660_100027883 | Ga0070660_1000278833 | 278 |
| 190 | 3300005344 | Ga0070661_100039175 | Ga0070661_1000391752 | 278 |
| 191 | 3300005366 | Ga0070659_100037103 | Ga0070659_1000371033 | 278 |
| 192 | 3300005455 | Ga0070663_100008440 | Ga0070663_1000084406 | 278 |
| 193 | 3300005530 | Ga0070679_100168087 | Ga0070679_1001680872 | 278 |
| 194 | 3300005564 | Ga0070664_100172245 | Ga0070664_1001722452 | 278 |
| 195 | 3300005834 | Ga0068851_10015118 | Ga0068851_100151183 | 278 |
| 196 | 3300005842 | Ga0068858_100000132 | Ga0068858_10000013216 | 278 |
| 197 | 3300009098 | Ga0105245_10000680 | Ga0105245_1000068012 | 278 |
| 198 | 3300009174 | Ga0105241_10007202 | Ga0105241_100072027 | 278 |
| 199 | 3300009545 | Ga0105237_10154576 | Ga0105237_101545761 | 278 |
| 200 | 3300009551 | Ga0105238_10025669 | Ga0105238_100256693 | 278 |
| 201 | 3300013102 | Ga0157371_10000148 | Ga0157371_1000014865 | 278 |
| 202 | 3300013296 | Ga0157374_10140437 | Ga0157374_101404373 | 278 |
| 203 | 3300013297 | Ga0157378_10097810 | Ga0157378_100978103 | 278 |
| 204 | 3300013306 | Ga0163162_10495130 | Ga0163162_104951302 | 278 |
| 205 | 3300025321 | Ga0207656_10000555 | Ga0207656_1000055514 | 278 |
| 206 | 3300025909 | Ga0207705_10000702 | Ga0207705_100007028 | 278 |
| 207 | 3300025913 | Ga0207695_10029219 | Ga0207695_100292193 | 278 |
| 208 | 3300025919 | Ga0207657_10005868 | Ga0207657_100058689 | 278 |
| 209 | 3300025920 | Ga0207649_10008010 | Ga0207649_100080105 | 278 |
| 210 | 3300025921 | Ga0207652_10069753 | Ga0207652_100697532 | 278 |
| 211 | 3300025924 | Ga0207694_10014265 | Ga0207694_100142656 | 278 |
| 212 | 3300025927 | Ga0207687_10000572 | Ga0207687_1000057212 | 278 |
| 213 | 3300025932 | Ga0207690_10012696 | Ga0207690_100126963 | 278 |
| 214 | 3300025932 | Ga0207690_10027771 | Ga0207690_100277713 | 278 |
| 215 | 3300025949 | Ga0207667_10000074 | Ga0207667_1000007410 | 278 |
| 216 | 3300025981 | Ga0207640_10001242 | Ga0207640_100012422 | 278 |
| 217 | 3300026035 | Ga0207703_10001668 | Ga0207703_1000166816 | 278 |
| 218 | 3300026041 | Ga0207639_10130901 | Ga0207639_101309012 | 278 |
| 219 | 3300026067 | Ga0207678_10010383 | Ga0207678_100103839 | 278 |
| 220 | 3300026078 | Ga0207702_10001342 | Ga0207702_100013428 | 278 |
| 221 | 3300026116 | Ga0207674_10016601 | Ga0207674_100166017 | 278 |
| 222 | 3300026142 | Ga0207698_10002456 | Ga0207698_1000245612 | 278 |
| 223 | 3300031616 | Ga0307508_10000356 | Ga0307508_1000035622 | 278 |
| 224 | 3300037418 | Ga0395900_0062159 | Ga0395900_0062159_2515_3417 | 278 |
| 225 | 3300044694 | Ga0466963_0062754 | Ga0466963_0062754_1063_1923 | 278 |
| 226 | 3300044842 | Ga0466957_0160011 | Ga0466957_0160011_285_1145 | 278 |
| 227 | 3300045976 | Ga0466967_0128786 | Ga0466967_0128786_133_993 | 278 |
| 228 | 3300048924 | Ga0496121_0000652 | Ga0496121_0000652_3793_4752 | 278 |
| 229 | 3300053735 | Ga0500596_000434 | Ga0500596_000434_480_1502 | 278 |
| 230 | 3300005354 | Ga0070675_100417732 | Ga0070675_1004177321 | 279 |
| 231 | 3300005457 | Ga0070662_100008480 | Ga0070662_1000084804 | 279 |
| 232 | 3300013297 | Ga0157378_10042205 | Ga0157378_100422053 | 279 |
| 233 | 3300025926 | Ga0207659_10366304 | Ga0207659_103663042 | 279 |
| 234 | 3300025933 | Ga0207706_10016273 | Ga0207706_100162737 | 279 |
| 235 | 3300028786 | Ga0307517_10009682 | Ga0307517_100096826 | 279 |
| 236 | 3300005331 | Ga0070670_100034115 | Ga0070670_1000341152 | 280 |
| 237 | 3300005335 | Ga0070666_10002971 | Ga0070666_100029717 | 280 |
| 238 | 3300005338 | Ga0068868_100072400 | Ga0068868_1000724004 | 280 |
| 239 | 3300005354 | Ga0070675_100022550 | Ga0070675_1000225502 | 280 |
| 240 | 3300005355 | Ga0070671_100079772 | Ga0070671_1000797723 | 280 |
| 241 | 3300005364 | Ga0070673_100000526 | Ga0070673_1000005264 | 280 |
| 242 | 3300005367 | Ga0070667_100013712 | Ga0070667_1000137126 | 280 |
| 243 | 3300005456 | Ga0070678_100026409 | Ga0070678_1000264095 | 280 |
| 244 | 3300005457 | Ga0070662_100031341 | Ga0070662_1000313414 | 280 |
| 245 | 3300005466 | Ga0070685_10059227 | Ga0070685_100592273 | 280 |
| 246 | 3300005548 | Ga0070665_100062601 | Ga0070665_1000626015 | 280 |
| 247 | 3300005564 | Ga0070664_100055897 | Ga0070664_1000558974 | 280 |
| 248 | 3300005616 | Ga0068852_100257577 | Ga0068852_1002575772 | 280 |
| 249 | 3300005618 | Ga0068864_100038826 | Ga0068864_1000388264 | 280 |
| 250 | 3300005842 | Ga0068858_100019414 | Ga0068858_1000194146 | 280 |
| 251 | 3300006358 | Ga0068871_100018077 | Ga0068871_1000180776 | 280 |
| 252 | 3300009101 | Ga0105247_10288857 | Ga0105247_102888572 | 280 |
| 253 | 3300009177 | Ga0105248_10053309 | Ga0105248_100533092 | 280 |
| 254 | 3300013102 | Ga0157371_10028512 | Ga0157371_100285124 | 280 |
| 255 | 3300013296 | Ga0157374_10002253 | Ga0157374_100022535 | 280 |
| 256 | 3300013306 | Ga0163162_10010319 | Ga0163162_100103194 | 280 |
| 257 | 3300013308 | Ga0157375_10011554 | Ga0157375_100115545 | 280 |
| 258 | 3300014325 | Ga0163163_10002706 | Ga0163163_100027063 | 280 |
| 259 | 3300025903 | Ga0207680_10008315 | Ga0207680_100083154 | 280 |
| 260 | 3300025925 | Ga0207650_10005864 | Ga0207650_100058649 | 280 |
| 261 | 3300025931 | Ga0207644_10000614 | Ga0207644_1000061423 | 280 |
| 262 | 3300025933 | Ga0207706_10078803 | Ga0207706_100788034 | 280 |
| 263 | 3300025940 | Ga0207691_10021942 | Ga0207691_100219426 | 280 |
| 264 | 3300025941 | Ga0207711_10011304 | Ga0207711_100113046 | 280 |
| 265 | 3300025945 | Ga0207679_10049190 | Ga0207679_100491903 | 280 |
| 266 | 3300025960 | Ga0207651_10020954 | Ga0207651_100209542 | 280 |
| 267 | 3300025986 | Ga0207658_10153378 | Ga0207658_101533782 | 280 |
| 268 | 3300026023 | Ga0207677_10100638 | Ga0207677_101006382 | 280 |
| 269 | 3300026088 | Ga0207641_10003063 | Ga0207641_100030634 | 280 |
| 270 | 3300026095 | Ga0207676_10001223 | Ga0207676_1000122322 | 280 |
| 271 | 3300026121 | Ga0207683_10049845 | Ga0207683_100498454 | 280 |
| 272 | 3300026142 | Ga0207698_10241134 | Ga0207698_102411342 | 280 |
| 273 | 3300028379 | Ga0268266_10046045 | Ga0268266_100460454 | 280 |
| 274 | 3300042012 | Ga0439455_0015588 | Ga0439455_0015588_535_1425 | 280 |
| 275 | 3300042157 | Ga0439458_0007395 | Ga0439458_0007395_556_1446 | 280 |
| 276 | 3300044842 | Ga0466957_0054643 | Ga0466957_0054643_217_1107 | 280 |
| 277 | 3300048906 | Ga0496103_0059631 | Ga0496103_0059631_635_1483 | 280 |
| 278 | 3300048911 | Ga0496108_0002906 | Ga0496108_0002906_940_1788 | 280 |
| 279 | 3300048912 | Ga0496109_0006553 | Ga0496109_0006553_957_1805 | 280 |
| 280 | 3300048913 | Ga0496110_0033905 | Ga0496110_0033905_3279_4127 | 280 |
| 281 | 3300048914 | Ga0496111_0002376 | Ga0496111_0002376_987_1835 | 280 |
| 282 | 3300048915 | Ga0496112_0061899 | Ga0496112_0061899_738_1586 | 280 |
| 283 | 3300048916 | Ga0496113_0011965 | Ga0496113_0011965_2230_3078 | 280 |
| 284 | 3300048917 | Ga0496114_0203216 | Ga0496114_0203216_716_1564 | 280 |
| 285 | 3300005354 | Ga0070675_100249451 | Ga0070675_1002494512 | 281 |
| 286 | 3300005543 | Ga0070672_100047900 | Ga0070672_1000479004 | 281 |
| 287 | 3300025925 | Ga0207650_10156255 | Ga0207650_101562552 | 281 |
| 288 | 3300025940 | Ga0207691_10031381 | Ga0207691_100313815 | 281 |
| 289 | 3300032004 | Ga0307414_10241334 | Ga0307414_102413341 | 281 |
| 290 | 3300032005 | Ga0307411_10254276 | Ga0307411_102542762 | 281 |
| 291 | 3300037418 | Ga0395900_0106959 | Ga0395900_0106959_978_1868 | 281 |
| 292 | 3300037466 | Ga0395898_0019188 | Ga0395898_0019188_294_1184 | 281 |
| 293 | 3300037471 | Ga0395905_0071420 | Ga0395905_0071420_535_1425 | 281 |
| 294 | 3300038443 | Ga0395901_0028743 | Ga0395901_0028743_3305_4195 | 281 |
| 295 | 3300042157 | Ga0439458_0000590 | Ga0439458_0000590_3423_4274 | 281 |
| 296 | 3300048913 | Ga0496110_0493540 | Ga0496110_0493540_234_1085 | 281 |
| 297 | 3300031995 | Ga0307409_100248451 | Ga0307409_1002484512 | 282 |
| 298 | 3300037418 | Ga0395900_0327259 | Ga0395900_0327259_18_908 | 282 |
| 299 | 3300037471 | Ga0395905_0064094 | Ga0395905_0064094_221_1111 | 282 |
| 300 | 3300037471 | Ga0395905_0135768 | Ga0395905_0135768_1008_1862 | 282 |
| 301 | 3300038443 | Ga0395901_0053134 | Ga0395901_0053134_2099_2989 | 282 |
| 302 | 3300046537 | Ga0495598_0034026 | Ga0495598_0034026_216_1151 | 282 |
| 303 | 3300031852 | Ga0307410_10045915 | Ga0307410_100459152 | 283 |
| 304 | 3300031901 | Ga0307406_10092330 | Ga0307406_100923302 | 283 |
| 305 | 3300044656 | Ga0466969_0029974 | Ga0466969_0029974_236_1096 | 283 |
| 306 | 3300044684 | Ga0466966_0013413 | Ga0466966_0013413_2667_3527 | 283 |
| 307 | 3300005355 | Ga0070671_100040369 | Ga0070671_1000403692 | 284 |
| 308 | 3300005548 | Ga0070665_100049036 | Ga0070665_1000490364 | 284 |
| 309 | 3300006358 | Ga0068871_100118178 | Ga0068871_1001181782 | 284 |
| 310 | 3300009177 | Ga0105248_10007546 | Ga0105248_100075466 | 284 |
| 311 | 3300025931 | Ga0207644_10017567 | Ga0207644_100175677 | 284 |
| 312 | 3300025933 | Ga0207706_10068152 | Ga0207706_100681522 | 284 |
| 313 | 3300025941 | Ga0207711_10006917 | Ga0207711_100069177 | 284 |
| 314 | 3300028379 | Ga0268266_10166318 | Ga0268266_101663183 | 284 |
| 315 | 3300037418 | Ga0395900_0036295 | Ga0395900_0036295_3042_3917 | 284 |
| 316 | 3300037471 | Ga0395905_0058040 | Ga0395905_0058040_755_1630 | 284 |
| 317 | 3300048903 | Ga0496100_0029988 | Ga0496100_0029988_996_1940 | 284 |
| 318 | 3300048904 | Ga0496101_0010849 | Ga0496101_0010849_3438_4382 | 284 |
| 319 | 3300048910 | Ga0496107_0002900 | Ga0496107_0002900_4835_5779 | 284 |
| 320 | 3300048917 | Ga0496114_0003038 | Ga0496114_0003038_11516_12460 | 284 |
| 321 | 3300048918 | Ga0496115_0020881 | Ga0496115_0020881_3685_4629 | 284 |
| 322 | 3300005578 | Ga0068854_100498957 | Ga0068854_1004989572 | 285 |
| 323 | 3300025981 | Ga0207640_10157226 | Ga0207640_101572261 | 285 |
| 324 | 3300037312 | Ga0395899_0070866 | Ga0395899_0070866_1365_2243 | 285 |
| 325 | 3300013100 | Ga0157373_10035475 | Ga0157373_100354756 | 286 |
| 326 | 3300031548 | Ga0307408_100243896 | Ga0307408_1002438962 | 286 |
| 327 | 3300031824 | Ga0307413_10076619 | Ga0307413_100766192 | 286 |
| 328 | 3300031852 | Ga0307410_10035145 | Ga0307410_100351453 | 286 |
| 329 | 3300031903 | Ga0307407_10155856 | Ga0307407_101558562 | 286 |
| 330 | 3300031995 | Ga0307409_100008827 | Ga0307409_1000088273 | 286 |
| 331 | 3300032004 | Ga0307414_10098254 | Ga0307414_100982543 | 286 |
| 332 | 3300032005 | Ga0307411_10001313 | Ga0307411_100013137 | 286 |
| 333 | 3300032126 | Ga0307415_100341727 | Ga0307415_1003417272 | 286 |
| 334 | 3300005331 | Ga0070670_100017478 | Ga0070670_1000174784 | 287 |
| 335 | 3300005456 | Ga0070678_100055808 | Ga0070678_1000558082 | 287 |
| 336 | 3300005457 | Ga0070662_100175010 | Ga0070662_1001750102 | 287 |
| 337 | 3300005564 | Ga0070664_100234275 | Ga0070664_1002342751 | 287 |
| 338 | 3300005618 | Ga0068864_100017019 | Ga0068864_1000170195 | 287 |
| 339 | 3300013100 | Ga0157373_10034110 | Ga0157373_100341105 | 287 |
| 340 | 3300013296 | Ga0157374_10006457 | Ga0157374_100064573 | 287 |
| 341 | 3300013306 | Ga0163162_10579082 | Ga0163162_105790822 | 287 |
| 342 | 3300026095 | Ga0207676_10202653 | Ga0207676_102026533 | 287 |
| 343 | 3300026121 | Ga0207683_10080418 | Ga0207683_100804182 | 287 |
| 344 | 3300044694 | Ga0466963_0043158 | Ga0466963_0043158_1300_2166 | 287 |
| 345 | 3300044842 | Ga0466957_0040546 | Ga0466957_0040546_50_916 | 287 |
| 346 | 3300045836 | Ga0466958_0028552 | Ga0466958_0028552_1768_2634 | 287 |
| 347 | 3300045976 | Ga0466967_0006997 | Ga0466967_0006997_3221_4087 | 287 |
| 348 | 3300005331 | Ga0070670_100046505 | Ga0070670_1000465056 | 288 |
| 349 | 3300005335 | Ga0070666_10088106 | Ga0070666_100881063 | 288 |
| 350 | 3300005335 | Ga0070666_10090277 | Ga0070666_100902772 | 288 |
| 351 | 3300005337 | Ga0070682_100230083 | Ga0070682_1002300832 | 288 |
| 352 | 3300005339 | Ga0070660_100031694 | Ga0070660_1000316945 | 288 |
| 353 | 3300005344 | Ga0070661_100180550 | Ga0070661_1001805502 | 288 |
| 354 | 3300005344 | Ga0070661_100338265 | Ga0070661_1003382651 | 288 |
| 355 | 3300005353 | Ga0070669_100241665 | Ga0070669_1002416652 | 288 |
| 356 | 3300005355 | Ga0070671_100102174 | Ga0070671_1001021741 | 288 |
| 357 | 3300005356 | Ga0070674_100179494 | Ga0070674_1001794942 | 288 |
| 358 | 3300005356 | Ga0070674_100316929 | Ga0070674_1003169292 | 288 |
| 359 | 3300005364 | Ga0070673_100100394 | Ga0070673_1001003942 | 288 |
| 360 | 3300005366 | Ga0070659_100033445 | Ga0070659_1000334452 | 288 |
| 361 | 3300005367 | Ga0070667_100056858 | Ga0070667_1000568583 | 288 |
| 362 | 3300005367 | Ga0070667_100483504 | Ga0070667_1004835042 | 288 |
| 363 | 3300005456 | Ga0070678_100088158 | Ga0070678_1000881582 | 288 |
| 364 | 3300005456 | Ga0070678_100148461 | Ga0070678_1001484613 | 288 |
| 365 | 3300005457 | Ga0070662_100107260 | Ga0070662_1001072602 | 288 |
| 366 | 3300005466 | Ga0070685_10070701 | Ga0070685_100707012 | 288 |
| 367 | 3300005842 | Ga0068858_100225699 | Ga0068858_1002256992 | 288 |
| 368 | 3300006358 | Ga0068871_100132682 | Ga0068871_1001326821 | 288 |
| 369 | 3300025903 | Ga0207680_10035012 | Ga0207680_100350123 | 288 |
| 370 | 3300025931 | Ga0207644_10051182 | Ga0207644_100511822 | 288 |
| 371 | 3300025937 | Ga0207669_10030009 | Ga0207669_100300092 | 288 |
| 372 | 3300025940 | Ga0207691_10252389 | Ga0207691_102523892 | 288 |
| 373 | 3300025941 | Ga0207711_10007240 | Ga0207711_100072406 | 288 |
| 374 | 3300025960 | Ga0207651_10017897 | Ga0207651_100178972 | 288 |
| 375 | 3300025986 | Ga0207658_10091650 | Ga0207658_100916502 | 288 |
| 376 | 3300026023 | Ga0207677_10137600 | Ga0207677_101376002 | 288 |
| 377 | 3300026121 | Ga0207683_10128444 | Ga0207683_101284443 | 288 |
| 378 | 3300028379 | Ga0268266_10269385 | Ga0268266_102693852 | 288 |
| 379 | 3300037471 | Ga0395905_0104119 | Ga0395905_0104119_270_1142 | 288 |
| 380 | 3300044842 | Ga0466957_0039900 | Ga0466957_0039900_46_942 | 288 |
| 381 | 3300045836 | Ga0466958_0032340 | Ga0466958_0032340_41_937 | 288 |
| 382 | 3300005331 | Ga0070670_100453696 | Ga0070670_1004536962 | 289 |
| 383 | 3300005344 | Ga0070661_100214084 | Ga0070661_1002140842 | 289 |
| 384 | 3300005355 | Ga0070671_100002090 | Ga0070671_1000020906 | 289 |
| 385 | 3300005364 | Ga0070673_100243256 | Ga0070673_1002432562 | 289 |
| 386 | 3300005543 | Ga0070672_100085892 | Ga0070672_1000858922 | 289 |
| 387 | 3300005548 | Ga0070665_100347397 | Ga0070665_1003473972 | 289 |
| 388 | 3300005564 | Ga0070664_100053058 | Ga0070664_1000530582 | 289 |
| 389 | 3300005564 | Ga0070664_100295690 | Ga0070664_1002956901 | 289 |
| 390 | 3300005564 | Ga0070664_100324974 | Ga0070664_1003249742 | 289 |
| 391 | 3300005578 | Ga0068854_100047615 | Ga0068854_1000476153 | 289 |
| 392 | 3300005618 | Ga0068864_100015861 | Ga0068864_1000158612 | 289 |
| 393 | 3300005718 | Ga0068866_10031671 | Ga0068866_100316712 | 289 |
| 394 | 3300005841 | Ga0068863_100044982 | Ga0068863_1000449822 | 289 |
| 395 | 3300006237 | Ga0097621_100112728 | Ga0097621_1001127283 | 289 |
| 396 | 3300009147 | Ga0114129_10223981 | Ga0114129_102239813 | 289 |
| 397 | 3300009177 | Ga0105248_10039813 | Ga0105248_100398136 | 289 |
| 398 | 3300009177 | Ga0105248_10833404 | Ga0105248_108334042 | 289 |
| 399 | 3300011119 | Ga0105246_10093439 | Ga0105246_100934392 | 289 |
| 400 | 3300013102 | Ga0157371_10060370 | Ga0157371_100603703 | 289 |
| 401 | 3300013102 | Ga0157371_10161522 | Ga0157371_101615222 | 289 |
| 402 | 3300013296 | Ga0157374_10219268 | Ga0157374_102192681 | 289 |
| 403 | 3300013306 | Ga0163162_10405206 | Ga0163162_104052062 | 289 |
| 404 | 3300013306 | Ga0163162_10448352 | Ga0163162_104483522 | 289 |
| 405 | 3300013308 | Ga0157375_10006249 | Ga0157375_1000624911 | 289 |
| 406 | 3300013308 | Ga0157375_10250951 | Ga0157375_102509512 | 289 |
| 407 | 3300014745 | Ga0157377_10034241 | Ga0157377_100342412 | 289 |
| 408 | 3300014969 | Ga0157376_10230628 | Ga0157376_102306282 | 289 |
| 409 | 3300025899 | Ga0207642_10004807 | Ga0207642_100048072 | 289 |
| 410 | 3300025901 | Ga0207688_10006467 | Ga0207688_100064672 | 289 |
| 411 | 3300025907 | Ga0207645_10047494 | Ga0207645_100474944 | 289 |
| 412 | 3300025919 | Ga0207657_10198325 | Ga0207657_101983251 | 289 |
| 413 | 3300025923 | Ga0207681_10114876 | Ga0207681_101148762 | 289 |
| 414 | 3300025925 | Ga0207650_10041114 | Ga0207650_100411143 | 289 |
| 415 | 3300025925 | Ga0207650_10049639 | Ga0207650_100496391 | 289 |
| 416 | 3300025927 | Ga0207687_10268920 | Ga0207687_102689202 | 289 |
| 417 | 3300025931 | Ga0207644_10000747 | Ga0207644_100007478 | 289 |
| 418 | 3300025933 | Ga0207706_10087387 | Ga0207706_100873871 | 289 |
| 419 | 3300025937 | Ga0207669_10052570 | Ga0207669_100525702 | 289 |
| 420 | 3300025940 | Ga0207691_10057234 | Ga0207691_100572343 | 289 |
| 421 | 3300025941 | Ga0207711_10029005 | Ga0207711_100290056 | 289 |
| 422 | 3300025942 | Ga0207689_10071034 | Ga0207689_100710342 | 289 |
| 423 | 3300025945 | Ga0207679_10001488 | Ga0207679_100014886 | 289 |
| 424 | 3300025960 | Ga0207651_10162727 | Ga0207651_101627272 | 289 |
| 425 | 3300025960 | Ga0207651_10400399 | Ga0207651_104003992 | 289 |
| 426 | 3300025986 | Ga0207658_10292784 | Ga0207658_102927842 | 289 |
| 427 | 3300026067 | Ga0207678_10038145 | Ga0207678_100381454 | 289 |
| 428 | 3300026089 | Ga0207648_10002768 | Ga0207648_100027684 | 289 |
| 429 | 3300026095 | Ga0207676_10238605 | Ga0207676_102386051 | 289 |
| 430 | 3300026121 | Ga0207683_10084215 | Ga0207683_100842153 | 289 |
| 431 | 3300031824 | Ga0307413_10098929 | Ga0307413_100989292 | 289 |
| 432 | 3300032002 | Ga0307416_100149259 | Ga0307416_1001492592 | 289 |
| 433 | 3300037312 | Ga0395899_0042526 | Ga0395899_0042526_294_1169 | 289 |
| 434 | 3300037471 | Ga0395905_0000104 | Ga0395905_0000104_98670_99545 | 289 |
| 435 | 3300037471 | Ga0395905_0281686 | Ga0395905_0281686_42_917 | 289 |
| 436 | 3300038443 | Ga0395901_0576660 | Ga0395901_0576660_59_934 | 289 |
| 437 | 3300044658 | Ga0466972_0077259 | Ga0466972_0077259_673_1548 | 289 |
| 438 | 3300044684 | Ga0466966_0031937 | Ga0466966_0031937_292_1188 | 289 |
| 439 | 3300044765 | Ga0466970_0061628 | Ga0466970_0061628_359_1255 | 289 |
| 440 | 3300044765 | Ga0466970_0084406 | Ga0466970_0084406_786_1685 | 289 |
| 441 | 3300044765 | Ga0466970_0242063 | Ga0466970_0242063_77_976 | 289 |
| 442 | 3300044842 | Ga0466957_0022875 | Ga0466957_0022875_2127_3026 | 289 |
| 443 | 3300045836 | Ga0466958_0013804 | Ga0466958_0013804_2992_3891 | 289 |
| 444 | 3300046506 | Ga0495583_0088651 | Ga0495583_0088651_337_1212 | 289 |
| 445 | 3300046616 | Ga0495668_0053335 | Ga0495668_0053335_1147_2022 | 289 |
| 446 | 3300046684 | Ga0495669_0007885 | Ga0495669_0007885_1879_2754 | 289 |
| 447 | 3300046684 | Ga0495669_0009309 | Ga0495669_0009309_1643_2518 | 289 |
| 448 | 3300046684 | Ga0495669_0074673 | Ga0495669_0074673_110_985 | 289 |
| 449 | 3300048906 | Ga0496103_0090215 | Ga0496103_0090215_901_1776 | 289 |
| 450 | 3300048911 | Ga0496108_0003739 | Ga0496108_0003739_7647_8522 | 289 |
| 451 | 3300048911 | Ga0496108_0006177 | Ga0496108_0006177_5411_6286 | 289 |
| 452 | 3300048912 | Ga0496109_0013577 | Ga0496109_0013577_3231_4106 | 289 |
| 453 | 3300048913 | Ga0496110_0046307 | Ga0496110_0046307_1944_2819 | 289 |
| 454 | 3300048915 | Ga0496112_0010745 | Ga0496112_0010745_6596_7471 | 289 |
| 455 | 3300048915 | Ga0496112_0050186 | Ga0496112_0050186_2237_3112 | 289 |
| 456 | 3300048916 | Ga0496113_0006279 | Ga0496113_0006279_2991_3866 | 289 |
| 457 | 3300048916 | Ga0496113_0335835 | Ga0496113_0335835_53_928 | 289 |
| 458 | 3300048917 | Ga0496114_0000029 | Ga0496114_0000029_32154_33023 | 289 |
| 459 | 3300049765 | Ga0501268_022242 | Ga0501268_022242_198_1070 | 289 |
| 460 | 3300053083 | Ga0495655_0009272 | Ga0495655_0009272_294_1169 | 289 |
| 461 | 3300001990 | JGI24737J22298_10003882 | JGI24737J22298_100038825 | 290 |
| 462 | 3300002067 | JGI24735J21928_10034551 | JGI24735J21928_100345512 | 290 |
| 463 | 3300002075 | JGI24738J21930_10023956 | JGI24738J21930_100239562 | 290 |
| 464 | 3300005327 | Ga0070658_10005785 | Ga0070658_100057853 | 290 |
| 465 | 3300005327 | Ga0070658_10058220 | Ga0070658_100582203 | 290 |
| 466 | 3300005327 | Ga0070658_10432808 | Ga0070658_104328082 | 290 |
| 467 | 3300005329 | Ga0070683_100014717 | Ga0070683_1000147176 | 290 |
| 468 | 3300005331 | Ga0070670_100061091 | Ga0070670_1000610914 | 290 |
| 469 | 3300005336 | Ga0070680_100001257 | Ga0070680_1000012575 | 290 |
| 470 | 3300005339 | Ga0070660_100011824 | Ga0070660_1000118246 | 290 |
| 471 | 3300005339 | Ga0070660_100029369 | Ga0070660_1000293694 | 290 |
| 472 | 3300005344 | Ga0070661_100041131 | Ga0070661_1000411314 | 290 |
| 473 | 3300005344 | Ga0070661_100057595 | Ga0070661_1000575954 | 290 |
| 474 | 3300005355 | Ga0070671_100010165 | Ga0070671_1000101657 | 290 |
| 475 | 3300005355 | Ga0070671_100013194 | Ga0070671_1000131946 | 290 |
| 476 | 3300005355 | Ga0070671_100015041 | Ga0070671_1000150413 | 290 |
| 477 | 3300005355 | Ga0070671_100024137 | Ga0070671_1000241372 | 290 |
| 478 | 3300005355 | Ga0070671_100255942 | Ga0070671_1002559422 | 290 |
| 479 | 3300005364 | Ga0070673_100075965 | Ga0070673_1000759651 | 290 |
| 480 | 3300005366 | Ga0070659_100081853 | Ga0070659_1000818533 | 290 |
| 481 | 3300005366 | Ga0070659_100105558 | Ga0070659_1001055583 | 290 |
| 482 | 3300005455 | Ga0070663_100042383 | Ga0070663_1000423834 | 290 |
| 483 | 3300005455 | Ga0070663_100046448 | Ga0070663_1000464482 | 290 |
| 484 | 3300005456 | Ga0070678_100013930 | Ga0070678_1000139304 | 290 |
| 485 | 3300005456 | Ga0070678_100030421 | Ga0070678_1000304215 | 290 |
| 486 | 3300005457 | Ga0070662_100020844 | Ga0070662_1000208444 | 290 |
| 487 | 3300005457 | Ga0070662_100447501 | Ga0070662_1004475012 | 290 |
| 488 | 3300005458 | Ga0070681_10179834 | Ga0070681_101798342 | 290 |
| 489 | 3300005458 | Ga0070681_10302226 | Ga0070681_103022262 | 290 |
| 490 | 3300005530 | Ga0070679_100041620 | Ga0070679_1000416202 | 290 |
| 491 | 3300005530 | Ga0070679_100368457 | Ga0070679_1003684572 | 290 |
| 492 | 3300005530 | Ga0070679_100510688 | Ga0070679_1005106882 | 290 |
| 493 | 3300005546 | Ga0070696_100132326 | Ga0070696_1001323263 | 290 |
| 494 | 3300005547 | Ga0070693_100131924 | Ga0070693_1001319242 | 290 |
| 495 | 3300005563 | Ga0068855_100025356 | Ga0068855_1000253566 | 290 |
| 496 | 3300005564 | Ga0070664_100023816 | Ga0070664_1000238163 | 290 |
| 497 | 3300005564 | Ga0070664_100138913 | Ga0070664_1001389132 | 290 |
| 498 | 3300005564 | Ga0070664_100224907 | Ga0070664_1002249072 | 290 |
| 499 | 3300005577 | Ga0068857_100000489 | Ga0068857_10000048917 | 290 |
| 500 | 3300005577 | Ga0068857_100039061 | Ga0068857_1000390613 | 290 |
| 501 | 3300005578 | Ga0068854_100094980 | Ga0068854_1000949802 | 290 |
| 502 | 3300005614 | Ga0068856_100026683 | Ga0068856_1000266832 | 290 |
| 503 | 3300005614 | Ga0068856_100067148 | Ga0068856_1000671485 | 290 |
| 504 | 3300005616 | Ga0068852_100030485 | Ga0068852_1000304854 | 290 |
| 505 | 3300005617 | Ga0068859_100095345 | Ga0068859_1000953454 | 290 |
| 506 | 3300005618 | Ga0068864_100033561 | Ga0068864_1000335612 | 290 |
| 507 | 3300005834 | Ga0068851_10043978 | Ga0068851_100439783 | 290 |
| 508 | 3300005841 | Ga0068863_100001894 | Ga0068863_10000189414 | 290 |
| 509 | 3300005841 | Ga0068863_100015595 | Ga0068863_1000155953 | 290 |
| 510 | 3300005844 | Ga0068862_100206171 | Ga0068862_1002061711 | 290 |
| 511 | 3300006195 | Ga0075366_10211493 | Ga0075366_102114931 | 290 |
| 512 | 3300006237 | Ga0097621_100152950 | Ga0097621_1001529502 | 290 |
| 513 | 3300006358 | Ga0068871_100588605 | Ga0068871_1005886051 | 290 |
| 514 | 3300006931 | Ga0097620_100095342 | Ga0097620_1000953424 | 290 |
| 515 | 3300009177 | Ga0105248_10096217 | Ga0105248_100962174 | 290 |
| 516 | 3300009177 | Ga0105248_10161249 | Ga0105248_101612493 | 290 |
| 517 | 3300013100 | Ga0157373_10065118 | Ga0157373_100651183 | 290 |
| 518 | 3300013102 | Ga0157371_10069090 | Ga0157371_100690903 | 290 |
| 519 | 3300013102 | Ga0157371_10092679 | Ga0157371_100926792 | 290 |
| 520 | 3300013102 | Ga0157371_10140539 | Ga0157371_101405392 | 290 |
| 521 | 3300013296 | Ga0157374_10548682 | Ga0157374_105486822 | 290 |
| 522 | 3300014497 | Ga0182008_10021494 | Ga0182008_100214943 | 290 |
| 523 | 3300014968 | Ga0157379_10003612 | Ga0157379_1000361216 | 290 |
| 524 | 3300020082 | Ga0206353_11121746 | Ga0206353_111217462 | 290 |
| 525 | 3300021384 | Ga0213876_10009352 | Ga0213876_100093526 | 290 |
| 526 | 3300025321 | Ga0207656_10038801 | Ga0207656_100388011 | 290 |
| 527 | 3300025893 | Ga0207682_10047573 | Ga0207682_100475732 | 290 |
| 528 | 3300025903 | Ga0207680_10078625 | Ga0207680_100786252 | 290 |
| 529 | 3300025904 | Ga0207647_10043548 | Ga0207647_100435482 | 290 |
| 530 | 3300025909 | Ga0207705_10000493 | Ga0207705_1000049320 | 290 |
| 531 | 3300025909 | Ga0207705_10006514 | Ga0207705_100065148 | 290 |
| 532 | 3300025909 | Ga0207705_10035332 | Ga0207705_100353326 | 290 |
| 533 | 3300025912 | Ga0207707_10107496 | Ga0207707_101074962 | 290 |
| 534 | 3300025917 | Ga0207660_10097667 | Ga0207660_100976672 | 290 |
| 535 | 3300025917 | Ga0207660_10334345 | Ga0207660_103343452 | 290 |
| 536 | 3300025919 | Ga0207657_10009843 | Ga0207657_100098433 | 290 |
| 537 | 3300025919 | Ga0207657_10017883 | Ga0207657_100178834 | 290 |
| 538 | 3300025919 | Ga0207657_10178342 | Ga0207657_101783422 | 290 |
| 539 | 3300025921 | Ga0207652_10000034 | Ga0207652_10000034132 | 290 |
| 540 | 3300025923 | Ga0207681_10206083 | Ga0207681_102060832 | 290 |
| 541 | 3300025925 | Ga0207650_10050942 | Ga0207650_100509423 | 290 |
| 542 | 3300025926 | Ga0207659_10058028 | Ga0207659_100580282 | 290 |
| 543 | 3300025931 | Ga0207644_10006207 | Ga0207644_1000620710 | 290 |
| 544 | 3300025931 | Ga0207644_10015601 | Ga0207644_100156014 | 290 |
| 545 | 3300025931 | Ga0207644_10060288 | Ga0207644_100602882 | 290 |
| 546 | 3300025931 | Ga0207644_10363534 | Ga0207644_103635342 | 290 |
| 547 | 3300025932 | Ga0207690_10061043 | Ga0207690_100610433 | 290 |
| 548 | 3300025932 | Ga0207690_10426109 | Ga0207690_104261092 | 290 |
| 549 | 3300025933 | Ga0207706_10046530 | Ga0207706_100465303 | 290 |
| 550 | 3300025937 | Ga0207669_10030707 | Ga0207669_100307074 | 290 |
| 551 | 3300025941 | Ga0207711_10031078 | Ga0207711_100310783 | 290 |
| 552 | 3300025941 | Ga0207711_10045504 | Ga0207711_100455045 | 290 |
| 553 | 3300025941 | Ga0207711_10062395 | Ga0207711_100623954 | 290 |
| 554 | 3300025944 | Ga0207661_10009979 | Ga0207661_100099794 | 290 |
| 555 | 3300025945 | Ga0207679_10066068 | Ga0207679_100660684 | 290 |
| 556 | 3300025945 | Ga0207679_10380766 | Ga0207679_103807662 | 290 |
| 557 | 3300025949 | Ga0207667_10049976 | Ga0207667_100499764 | 290 |
| 558 | 3300025960 | Ga0207651_10070728 | Ga0207651_100707283 | 290 |
| 559 | 3300025960 | Ga0207651_10318509 | Ga0207651_103185091 | 290 |
| 560 | 3300025981 | Ga0207640_10078101 | Ga0207640_100781012 | 290 |
| 561 | 3300025981 | Ga0207640_10149938 | Ga0207640_101499382 | 290 |
| 562 | 3300025986 | Ga0207658_10087862 | Ga0207658_100878622 | 290 |
| 563 | 3300026067 | Ga0207678_10012950 | Ga0207678_100129504 | 290 |
| 564 | 3300026067 | Ga0207678_10017638 | Ga0207678_100176384 | 290 |
| 565 | 3300026067 | Ga0207678_10396879 | Ga0207678_103968792 | 290 |
| 566 | 3300026078 | Ga0207702_10044465 | Ga0207702_100444652 | 290 |
| 567 | 3300026078 | Ga0207702_10058235 | Ga0207702_100582352 | 290 |
| 568 | 3300026088 | Ga0207641_10005258 | Ga0207641_1000525814 | 290 |
| 569 | 3300026088 | Ga0207641_10012388 | Ga0207641_100123887 | 290 |
| 570 | 3300026095 | Ga0207676_10251700 | Ga0207676_102517002 | 290 |
| 571 | 3300026095 | Ga0207676_10685116 | Ga0207676_106851161 | 290 |
| 572 | 3300026116 | Ga0207674_10003897 | Ga0207674_100038974 | 290 |
| 573 | 3300026116 | Ga0207674_10005996 | Ga0207674_100059966 | 290 |
| 574 | 3300026116 | Ga0207674_10179584 | Ga0207674_101795843 | 290 |
| 575 | 3300026121 | Ga0207683_10015269 | Ga0207683_100152696 | 290 |
| 576 | 3300026142 | Ga0207698_10000672 | Ga0207698_100006727 | 290 |
| 577 | 3300028380 | Ga0268265_10158063 | Ga0268265_101580631 | 290 |
| 578 | 3300028381 | Ga0268264_10092534 | Ga0268264_100925344 | 290 |
| 579 | 3300031731 | Ga0307405_10021657 | Ga0307405_100216574 | 290 |
| 580 | 3300032002 | Ga0307416_100560135 | Ga0307416_1005601351 | 290 |
| 581 | 3300032126 | Ga0307415_100016305 | Ga0307415_1000163052 | 290 |
| 582 | 3300037312 | Ga0395899_0000669 | Ga0395899_0000669_2189_3067 | 290 |
| 583 | 3300037312 | Ga0395899_0031627 | Ga0395899_0031627_2296_3174 | 290 |
| 584 | 3300037312 | Ga0395899_0042725 | Ga0395899_0042725_1228_2112 | 290 |
| 585 | 3300037418 | Ga0395900_0000308 | Ga0395900_0000308_9866_10744 | 290 |
| 586 | 3300037418 | Ga0395900_0001779 | Ga0395900_0001779_3581_4459 | 290 |
| 587 | 3300037418 | Ga0395900_0003085 | Ga0395900_0003085_1956_2840 | 290 |
| 588 | 3300037418 | Ga0395900_0437944 | Ga0395900_0437944_84_962 | 290 |
| 589 | 3300037466 | Ga0395898_0001096 | Ga0395898_0001096_11181_12059 | 290 |
| 590 | 3300037466 | Ga0395898_0052037 | Ga0395898_0052037_224_1102 | 290 |
| 591 | 3300037466 | Ga0395898_0079198 | Ga0395898_0079198_1016_1900 | 290 |
| 592 | 3300037471 | Ga0395905_0000005 | Ga0395905_0000005_483639_484517 | 290 |
| 593 | 3300037471 | Ga0395905_0004102 | Ga0395905_0004102_2990_3868 | 290 |
| 594 | 3300037471 | Ga0395905_0008459 | Ga0395905_0008459_1489_2367 | 290 |
| 595 | 3300037471 | Ga0395905_0015364 | Ga0395905_0015364_5332_6210 | 290 |
| 596 | 3300037471 | Ga0395905_0036894 | Ga0395905_0036894_199_1077 | 290 |
| 597 | 3300037471 | Ga0395905_0037718 | Ga0395905_0037718_1271_2155 | 290 |
| 598 | 3300037471 | Ga0395905_0107222 | Ga0395905_0107222_323_1204 | 290 |
| 599 | 3300038443 | Ga0395901_0020938 | Ga0395901_0020938_684_1562 | 290 |
| 600 | 3300038443 | Ga0395901_0085676 | Ga0395901_0085676_1139_2023 | 290 |
| 601 | 3300038443 | Ga0395901_0167194 | Ga0395901_0167194_165_1043 | 290 |
| 602 | 3300038443 | Ga0395901_0282216 | Ga0395901_0282216_387_1265 | 290 |
| 603 | 3300038443 | Ga0395901_0341045 | Ga0395901_0341045_463_1344 | 290 |
| 604 | 3300046537 | Ga0495598_0004019 | Ga0495598_0004019_1195_2073 | 290 |
| 605 | 3300046558 | Ga0495633_0108868 | Ga0495633_0108868_245_1123 | 290 |
| 606 | 3300046684 | Ga0495669_0073756 | Ga0495669_0073756_396_1274 | 290 |
| 607 | 3300046691 | Ga0495670_0000071 | Ga0495670_0000071_34749_35627 | 290 |
| 608 | 3300047445 | Ga0495677_0120182 | Ga0495677_0120182_63_950 | 290 |
| 609 | 3300048904 | Ga0496101_0285753 | Ga0496101_0285753_216_1094 | 290 |
| 610 | 3300048905 | Ga0496102_0060901 | Ga0496102_0060901_2164_3042 | 290 |
| 611 | 3300048906 | Ga0496103_0051009 | Ga0496103_0051009_216_1094 | 290 |
| 612 | 3300048907 | Ga0496104_0240695 | Ga0496104_0240695_384_1262 | 290 |
| 613 | 3300048909 | Ga0496106_0016396 | Ga0496106_0016396_4078_4956 | 290 |
| 614 | 3300048910 | Ga0496107_0092038 | Ga0496107_0092038_685_1563 | 290 |
| 615 | 3300048912 | Ga0496109_0067116 | Ga0496109_0067116_355_1233 | 290 |
| 616 | 3300048912 | Ga0496109_0183840 | Ga0496109_0183840_740_1627 | 290 |
| 617 | 3300048914 | Ga0496111_0067683 | Ga0496111_0067683_910_1788 | 290 |
| 618 | 3300048915 | Ga0496112_0040084 | Ga0496112_0040084_3636_4514 | 290 |
| 619 | 3300048915 | Ga0496112_0147653 | Ga0496112_0147653_273_1151 | 290 |
| 620 | 3300048916 | Ga0496113_0005727 | Ga0496113_0005727_3876_4754 | 290 |
| 621 | 3300049583 | Ga0501067_0030314 | Ga0501067_0030314_1640_2533 | 290 |
| 622 | 3300049583 | Ga0501067_0147758 | Ga0501067_0147758_344_1222 | 290 |
| 623 | 3300049584 | Ga0501068_0202444 | Ga0501068_0202444_216_1109 | 290 |
| 624 | 3300049585 | Ga0501069_0195704 | Ga0501069_0195704_113_1006 | 290 |
| 625 | 3300001979 | JGI24740J21852_10064007 | JGI24740J21852_100640071 | 291 |
| 626 | 3300005327 | Ga0070658_10014069 | Ga0070658_100140696 | 291 |
| 627 | 3300005327 | Ga0070658_10033263 | Ga0070658_100332632 | 291 |
| 628 | 3300005327 | Ga0070658_10077703 | Ga0070658_100777032 | 291 |
| 629 | 3300005339 | Ga0070660_100055119 | Ga0070660_1000551194 | 291 |
| 630 | 3300005366 | Ga0070659_100083906 | Ga0070659_1000839063 | 291 |
| 631 | 3300005435 | Ga0070714_100221619 | Ga0070714_1002216192 | 291 |
| 632 | 3300005458 | Ga0070681_10172187 | Ga0070681_101721871 | 291 |
| 633 | 3300005543 | Ga0070672_100085857 | Ga0070672_1000858572 | 291 |
| 634 | 3300005564 | Ga0070664_100011449 | Ga0070664_1000114498 | 291 |
| 635 | 3300005614 | Ga0068856_100675248 | Ga0068856_1006752481 | 291 |
| 636 | 3300005616 | Ga0068852_100496465 | Ga0068852_1004964652 | 291 |
| 637 | 3300005617 | Ga0068859_100086744 | Ga0068859_1000867444 | 291 |
| 638 | 3300005618 | Ga0068864_100001058 | Ga0068864_10000105822 | 291 |
| 639 | 3300006177 | Ga0075362_10115478 | Ga0075362_101154782 | 291 |
| 640 | 3300006931 | Ga0097620_100086740 | Ga0097620_1000867405 | 291 |
| 641 | 3300009177 | Ga0105248_10000862 | Ga0105248_1000086221 | 291 |
| 642 | 3300009177 | Ga0105248_10030585 | Ga0105248_100305852 | 291 |
| 643 | 3300013102 | Ga0157371_10013911 | Ga0157371_100139114 | 291 |
| 644 | 3300013104 | Ga0157370_10085127 | Ga0157370_100851272 | 291 |
| 645 | 3300013104 | Ga0157370_10372834 | Ga0157370_103728342 | 291 |
| 646 | 3300013105 | Ga0157369_10082819 | Ga0157369_100828193 | 291 |
| 647 | 3300014325 | Ga0163163_10042407 | Ga0163163_100424072 | 291 |
| 648 | 3300014968 | Ga0157379_10229701 | Ga0157379_102297012 | 291 |
| 649 | 3300025909 | Ga0207705_10153617 | Ga0207705_101536172 | 291 |
| 650 | 3300025909 | Ga0207705_10311681 | Ga0207705_103116812 | 291 |
| 651 | 3300025919 | Ga0207657_10174931 | Ga0207657_101749312 | 291 |
| 652 | 3300025932 | Ga0207690_10250263 | Ga0207690_102502632 | 291 |
| 653 | 3300025941 | Ga0207711_10000344 | Ga0207711_1000034425 | 291 |
| 654 | 3300025944 | Ga0207661_10005561 | Ga0207661_1000556111 | 291 |
| 655 | 3300026078 | Ga0207702_10351556 | Ga0207702_103515562 | 291 |
| 656 | 3300026095 | Ga0207676_10001683 | Ga0207676_1000168320 | 291 |
| 657 | 3300026142 | Ga0207698_10482833 | Ga0207698_104828332 | 291 |
| 658 | 3300037312 | Ga0395899_0041264 | Ga0395899_0041264_65_946 | 291 |
| 659 | 3300037312 | Ga0395899_0045250 | Ga0395899_0045250_1111_2049 | 291 |
| 660 | 3300037312 | Ga0395899_0281051 | Ga0395899_0281051_139_1032 | 291 |
| 661 | 3300037418 | Ga0395900_0040236 | Ga0395900_0040236_1832_2713 | 291 |
| 662 | 3300037418 | Ga0395900_0063223 | Ga0395900_0063223_2030_2911 | 291 |
| 663 | 3300037418 | Ga0395900_0184621 | Ga0395900_0184621_1135_2016 | 291 |
| 664 | 3300037418 | Ga0395900_0192970 | Ga0395900_0192970_1151_2044 | 291 |
| 665 | 3300037418 | Ga0395900_0201824 | Ga0395900_0201824_848_1729 | 291 |
| 666 | 3300037418 | Ga0395900_0211619 | Ga0395900_0211619_256_1137 | 291 |
| 667 | 3300037418 | Ga0395900_0499229 | Ga0395900_0499229_50_931 | 291 |
| 668 | 3300037466 | Ga0395898_0053594 | Ga0395898_0053594_799_1737 | 291 |
| 669 | 3300037466 | Ga0395898_0233362 | Ga0395898_0233362_438_1319 | 291 |
| 670 | 3300037466 | Ga0395898_0343906 | Ga0395898_0343906_413_1294 | 291 |
| 671 | 3300037471 | Ga0395905_0013074 | Ga0395905_0013074_1149_2030 | 291 |
| 672 | 3300037471 | Ga0395905_0029447 | Ga0395905_0029447_1384_2277 | 291 |
| 673 | 3300037471 | Ga0395905_0107854 | Ga0395905_0107854_225_1106 | 291 |
| 674 | 3300037471 | Ga0395905_0475173 | Ga0395905_0475173_61_942 | 291 |
| 675 | 3300038443 | Ga0395901_0131734 | Ga0395901_0131734_113_1006 | 291 |
| 676 | 3300038443 | Ga0395901_0247424 | Ga0395901_0247424_237_1130 | 291 |
| 677 | 3300038443 | Ga0395901_0251336 | Ga0395901_0251336_134_1015 | 291 |
| 678 | 3300039437 | Ga0436365_0881543 | Ga0436365_0881543_5176_6057 | 291 |
| 679 | 3300044719 | Ga0466971_0060097 | Ga0466971_0060097_192_1073 | 291 |
| 680 | 3300044842 | Ga0466957_0139265 | Ga0466957_0139265_587_1468 | 291 |
| 681 | 3300045049 | Ga0466959_0048801 | Ga0466959_0048801_1616_2497 | 291 |
| 682 | 3300045976 | Ga0466967_0117662 | Ga0466967_0117662_125_1006 | 291 |
| 683 | 3300045976 | Ga0466967_0157070 | Ga0466967_0157070_1168_2058 | 291 |
| 684 | 3300046528 | Ga0495642_0068810 | Ga0495642_0068810_290_1171 | 291 |
| 685 | 3300046528 | Ga0495642_0078536 | Ga0495642_0078536_89_982 | 291 |
| 686 | 3300048904 | Ga0496101_0041590 | Ga0496101_0041590_265_1146 | 291 |
| 687 | 3300048904 | Ga0496101_0371510 | Ga0496101_0371510_106_987 | 291 |
| 688 | 3300048907 | Ga0496104_0137509 | Ga0496104_0137509_803_1684 | 291 |
| 689 | 3300048909 | Ga0496106_0001313 | Ga0496106_0001313_14398_15279 | 291 |
| 690 | 3300048910 | Ga0496107_0003295 | Ga0496107_0003295_3910_4791 | 291 |
| 691 | 3300048910 | Ga0496107_0011494 | Ga0496107_0011494_1507_2388 | 291 |
| 692 | 3300048911 | Ga0496108_0054179 | Ga0496108_0054179_114_995 | 291 |
| 693 | 3300048912 | Ga0496109_0013443 | Ga0496109_0013443_4647_5528 | 291 |
| 694 | 3300048912 | Ga0496109_0069377 | Ga0496109_0069377_111_992 | 291 |
| 695 | 3300048913 | Ga0496110_0025175 | Ga0496110_0025175_2359_3240 | 291 |
| 696 | 3300048913 | Ga0496110_0118944 | Ga0496110_0118944_420_1301 | 291 |
| 697 | 3300048914 | Ga0496111_0000496 | Ga0496111_0000496_6830_7711 | 291 |
| 698 | 3300048915 | Ga0496112_0000275 | Ga0496112_0000275_3989_4870 | 291 |
| 699 | 3300048915 | Ga0496112_0040418 | Ga0496112_0040418_2193_3074 | 291 |
| 700 | 3300048915 | Ga0496112_0697361 | Ga0496112_0697361_20_901 | 291 |
| 701 | 3300048916 | Ga0496113_0010921 | Ga0496113_0010921_1499_2380 | 291 |
| 702 | 3300048918 | Ga0496115_0031543 | Ga0496115_0031543_1476_2357 | 291 |
| 703 | 3300049584 | Ga0501068_0052576 | Ga0501068_0052576_1098_1979 | 291 |
| 704 | 3300001915 | JGI24741J21665_1000578 | JGI24741J21665_10005782 | 292 |
| 705 | 3300001979 | JGI24740J21852_10011466 | JGI24740J21852_100114664 | 292 |
| 706 | 3300001979 | JGI24740J21852_10039629 | JGI24740J21852_100396291 | 292 |
| 707 | 3300001989 | JGI24739J22299_10006424 | JGI24739J22299_100064245 | 292 |
| 708 | 3300001989 | JGI24739J22299_10006645 | JGI24739J22299_100066452 | 292 |
| 709 | 3300001990 | JGI24737J22298_10009065 | JGI24737J22298_100090654 | 292 |
| 710 | 3300002067 | JGI24735J21928_10004145 | JGI24735J21928_100041455 | 292 |
| 711 | 3300002075 | JGI24738J21930_10013004 | JGI24738J21930_100130042 | 292 |
| 712 | 3300005327 | Ga0070658_10000269 | Ga0070658_1000026925 | 292 |
| 713 | 3300005327 | Ga0070658_10023711 | Ga0070658_100237118 | 292 |
| 714 | 3300005327 | Ga0070658_10112574 | Ga0070658_101125742 | 292 |
| 715 | 3300005329 | Ga0070683_100033941 | Ga0070683_1000339417 | 292 |
| 716 | 3300005331 | Ga0070670_100071411 | Ga0070670_1000714114 | 292 |
| 717 | 3300005335 | Ga0070666_10000330 | Ga0070666_100003308 | 292 |
| 718 | 3300005337 | Ga0070682_100065376 | Ga0070682_1000653762 | 292 |
| 719 | 3300005339 | Ga0070660_100000109 | Ga0070660_10000010924 | 292 |
| 720 | 3300005344 | Ga0070661_100000070 | Ga0070661_10000007065 | 292 |
| 721 | 3300005344 | Ga0070661_100359650 | Ga0070661_1003596502 | 292 |
| 722 | 3300005355 | Ga0070671_100005801 | Ga0070671_1000058017 | 292 |
| 723 | 3300005366 | Ga0070659_100000312 | Ga0070659_10000031215 | 292 |
| 724 | 3300005366 | Ga0070659_100045336 | Ga0070659_1000453363 | 292 |
| 725 | 3300005456 | Ga0070678_100531214 | Ga0070678_1005312141 | 292 |
| 726 | 3300005457 | Ga0070662_100000037 | Ga0070662_10000003755 | 292 |
| 727 | 3300005458 | Ga0070681_10074936 | Ga0070681_100749362 | 292 |
| 728 | 3300005539 | Ga0068853_100000309 | Ga0068853_10000030925 | 292 |
| 729 | 3300005539 | Ga0068853_100037689 | Ga0068853_1000376896 | 292 |
| 730 | 3300005539 | Ga0068853_100238089 | Ga0068853_1002380893 | 292 |
| 731 | 3300005547 | Ga0070693_100009762 | Ga0070693_1000097622 | 292 |
| 732 | 3300005548 | Ga0070665_100226276 | Ga0070665_1002262762 | 292 |
| 733 | 3300005563 | Ga0068855_100004288 | Ga0068855_10000428816 | 292 |
| 734 | 3300005563 | Ga0068855_100132915 | Ga0068855_1001329152 | 292 |
| 735 | 3300005564 | Ga0070664_100000077 | Ga0070664_10000007725 | 292 |
| 736 | 3300005564 | Ga0070664_100302000 | Ga0070664_1003020002 | 292 |
| 737 | 3300005577 | Ga0068857_100102317 | Ga0068857_1001023172 | 292 |
| 738 | 3300005614 | Ga0068856_100000444 | Ga0068856_10000044425 | 292 |
| 739 | 3300005616 | Ga0068852_100000350 | Ga0068852_10000035017 | 292 |
| 740 | 3300005616 | Ga0068852_100013451 | Ga0068852_1000134514 | 292 |
| 741 | 3300005616 | Ga0068852_100173855 | Ga0068852_1001738554 | 292 |
| 742 | 3300005834 | Ga0068851_10013866 | Ga0068851_100138665 | 292 |
| 743 | 3300005834 | Ga0068851_10019522 | Ga0068851_100195223 | 292 |
| 744 | 3300009093 | Ga0105240_10064049 | Ga0105240_100640495 | 292 |
| 745 | 3300009174 | Ga0105241_10123039 | Ga0105241_101230394 | 292 |
| 746 | 3300009177 | Ga0105248_10000719 | Ga0105248_1000071926 | 292 |
| 747 | 3300009551 | Ga0105238_10052947 | Ga0105238_100529473 | 292 |
| 748 | 3300009551 | Ga0105238_10087105 | Ga0105238_100871052 | 292 |
| 749 | 3300010375 | Ga0105239_10027029 | Ga0105239_100270297 | 292 |
| 750 | 3300013100 | Ga0157373_10014974 | Ga0157373_100149742 | 292 |
| 751 | 3300013102 | Ga0157371_10023554 | Ga0157371_100235542 | 292 |
| 752 | 3300013102 | Ga0157371_10091433 | Ga0157371_100914332 | 292 |
| 753 | 3300013102 | Ga0157371_10147816 | Ga0157371_101478162 | 292 |
| 754 | 3300013104 | Ga0157370_10071175 | Ga0157370_100711753 | 292 |
| 755 | 3300013105 | Ga0157369_10106711 | Ga0157369_101067113 | 292 |
| 756 | 3300013105 | Ga0157369_10127638 | Ga0157369_101276383 | 292 |
| 757 | 3300013307 | Ga0157372_10034866 | Ga0157372_100348662 | 292 |
| 758 | 3300014325 | Ga0163163_10000123 | Ga0163163_1000012365 | 292 |
| 759 | 3300025321 | Ga0207656_10008268 | Ga0207656_100082682 | 292 |
| 760 | 3300025321 | Ga0207656_10011612 | Ga0207656_100116123 | 292 |
| 761 | 3300025903 | Ga0207680_10001021 | Ga0207680_100010219 | 292 |
| 762 | 3300025904 | Ga0207647_10017660 | Ga0207647_100176602 | 292 |
| 763 | 3300025904 | Ga0207647_10030159 | Ga0207647_100301593 | 292 |
| 764 | 3300025909 | Ga0207705_10000086 | Ga0207705_1000008626 | 292 |
| 765 | 3300025909 | Ga0207705_10127925 | Ga0207705_101279252 | 292 |
| 766 | 3300025909 | Ga0207705_10157488 | Ga0207705_101574882 | 292 |
| 767 | 3300025912 | Ga0207707_10017647 | Ga0207707_100176477 | 292 |
| 768 | 3300025913 | Ga0207695_10597251 | Ga0207695_105972511 | 292 |
| 769 | 3300025917 | Ga0207660_10000484 | Ga0207660_1000048417 | 292 |
| 770 | 3300025919 | Ga0207657_10001020 | Ga0207657_100010207 | 292 |
| 771 | 3300025919 | Ga0207657_10052428 | Ga0207657_100524283 | 292 |
| 772 | 3300025919 | Ga0207657_10072347 | Ga0207657_100723472 | 292 |
| 773 | 3300025920 | Ga0207649_10000420 | Ga0207649_1000042019 | 292 |
| 774 | 3300025921 | Ga0207652_10009794 | Ga0207652_100097945 | 292 |
| 775 | 3300025924 | Ga0207694_10208765 | Ga0207694_102087652 | 292 |
| 776 | 3300025925 | Ga0207650_10171230 | Ga0207650_101712302 | 292 |
| 777 | 3300025931 | Ga0207644_10013631 | Ga0207644_100136312 | 292 |
| 778 | 3300025932 | Ga0207690_10000413 | Ga0207690_1000041325 | 292 |
| 779 | 3300025933 | Ga0207706_10000192 | Ga0207706_1000019244 | 292 |
| 780 | 3300025933 | Ga0207706_10078243 | Ga0207706_100782434 | 292 |
| 781 | 3300025941 | Ga0207711_10002038 | Ga0207711_100020385 | 292 |
| 782 | 3300025944 | Ga0207661_10045917 | Ga0207661_100459175 | 292 |
| 783 | 3300025944 | Ga0207661_10074814 | Ga0207661_100748144 | 292 |
| 784 | 3300025945 | Ga0207679_10000347 | Ga0207679_100003479 | 292 |
| 785 | 3300025949 | Ga0207667_10000850 | Ga0207667_1000085020 | 292 |
| 786 | 3300025949 | Ga0207667_10056357 | Ga0207667_100563572 | 292 |
| 787 | 3300025949 | Ga0207667_10205764 | Ga0207667_102057642 | 292 |
| 788 | 3300025981 | Ga0207640_10016104 | Ga0207640_100161045 | 292 |
| 789 | 3300025986 | Ga0207658_10005150 | Ga0207658_100051508 | 292 |
| 790 | 3300026041 | Ga0207639_10000412 | Ga0207639_100004123 | 292 |
| 791 | 3300026041 | Ga0207639_10000923 | Ga0207639_1000092310 | 292 |
| 792 | 3300026067 | Ga0207678_10001315 | Ga0207678_100013153 | 292 |
| 793 | 3300026067 | Ga0207678_10001460 | Ga0207678_100014607 | 292 |
| 794 | 3300026078 | Ga0207702_10005023 | Ga0207702_100050236 | 292 |
| 795 | 3300026116 | Ga0207674_10095577 | Ga0207674_100955772 | 292 |
| 796 | 3300026142 | Ga0207698_10000542 | Ga0207698_1000054214 | 292 |
| 797 | 3300026142 | Ga0207698_10008977 | Ga0207698_100089774 | 292 |
| 798 | 3300026142 | Ga0207698_10033462 | Ga0207698_100334622 | 292 |
| 799 | 3300026142 | Ga0207698_10450582 | Ga0207698_104505821 | 292 |
| 800 | 3300028379 | Ga0268266_10389160 | Ga0268266_103891602 | 292 |
| 801 | 3300035121 | Ga0373960_0040034 | Ga0373960_0040034_76_969 | 292 |
| 802 | 3300035207 | Ga0373942_0004964 | Ga0373942_0004964_1763_2656 | 292 |
| 803 | 3300035241 | Ga0373961_0025745 | Ga0373961_0025745_423_1316 | 292 |
| 804 | 3300035691 | Ga0373931_0001320 | Ga0373931_0001320_5005_5898 | 292 |
| 805 | 3300037312 | Ga0395899_0009002 | Ga0395899_0009002_841_1725 | 292 |
| 806 | 3300037312 | Ga0395899_0014277 | Ga0395899_0014277_3413_4297 | 292 |
| 807 | 3300037312 | Ga0395899_0044505 | Ga0395899_0044505_307_1191 | 292 |
| 808 | 3300037418 | Ga0395900_0008220 | Ga0395900_0008220_8703_9587 | 292 |
| 809 | 3300037418 | Ga0395900_0033740 | Ga0395900_0033740_2473_3357 | 292 |
| 810 | 3300037466 | Ga0395898_0021270 | Ga0395898_0021270_3063_3947 | 292 |
| 811 | 3300037466 | Ga0395898_0065908 | Ga0395898_0065908_1369_2253 | 292 |
| 812 | 3300037471 | Ga0395905_0023579 | Ga0395905_0023579_1860_2744 | 292 |
| 813 | 3300038443 | Ga0395901_0000782 | Ga0395901_0000782_7207_8091 | 292 |
| 814 | 3300038443 | Ga0395901_0103175 | Ga0395901_0103175_357_1241 | 292 |
| 815 | 3300044694 | Ga0466963_0028762 | Ga0466963_0028762_1433_2326 | 292 |
| 816 | 3300044694 | Ga0466963_0047770 | Ga0466963_0047770_1576_2460 | 292 |
| 817 | 3300044706 | Ga0466964_0027173 | Ga0466964_0027173_1239_2123 | 292 |
| 818 | 3300045976 | Ga0466967_0048466 | Ga0466967_0048466_1919_2803 | 292 |
| 819 | 3300045976 | Ga0466967_0057847 | Ga0466967_0057847_2340_3233 | 292 |
| 820 | 3300045976 | Ga0466967_0076838 | Ga0466967_0076838_978_1862 | 292 |
| 821 | 3300045976 | Ga0466967_0088576 | Ga0466967_0088576_188_1072 | 292 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4n31-assembly1.cif.gz_B | structure and activity of streptococcus pyogenes sipa: a signal peptidase homologue essential for pilus polymerisation | 0.7683 | 53 | 269 |
| 4n31-assembly1.cif.gz_A | structure and activity of streptococcus pyogenes sipa: a signal peptidase homologue essential for pilus polymerisation | 0.7377 | 53 | 258 |
| 4n31-assembly1.cif.gz_B | structure and activity of streptococcus pyogenes sipa: a signal peptidase homologue essential for pilus polymerisation | 0.7374 | 53 | 269 |
| 4k8w-assembly1.cif.gz_A-2 | an arm-swapped dimer of the s. pyogenes pilin specific assembly factor sipa | 0.7321 | 90 | 256 |
| 4k8w-assembly1.cif.gz_A-2 | an arm-swapped dimer of the s. pyogenes pilin specific assembly factor sipa | 0.6567 | 90 | 256 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1kn9D01 | Mainly Beta;Ribbon;Umud Fragment, subunit A;Umud Fragment, subunit A | 0.7973 | 48 | 266 | 2.10.109.10 |
| 4n31B00 | Mainly Beta;Ribbon;Umud Fragment, subunit A;Umud Fragment, subunit A | 0.7683 | 53 | 269 | 2.10.109.10 |
| 2wweA01 | Alpha Beta;2-Layer Sandwich;PX Domain;Phox-like domain | 0.7501 | 186 | 203 | 3.30.1520.10 |
| 1b12C01 | Mainly Beta;Ribbon;Umud Fragment, subunit A;Umud Fragment, subunit A | 0.7429 | 52 | 281 | 2.10.109.10 |
| 4n31B00 | Mainly Beta;Ribbon;Umud Fragment, subunit A;Umud Fragment, subunit A | 0.7374 | 53 | 269 | 2.10.109.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7Y0G9E4-F1-model_v4 | Signal peptidase I (EC 3.4.21.89) | 0.9182 | 39 | 284 |
GO:0004252
GO:0006465 GO:0016020 |
| AF-A0A7G9L5Y1-F1-model_v4 | Signal peptidase I (EC 3.4.21.89) | 0.9046 | 45 | 290 |
GO:0004252
GO:0006465 GO:0016020 |
| AF-A0A844ZJJ1-F1-model_v4 | Signal peptidase I (EC 3.4.21.89) | 0.8995 | 39 | 284 |
GO:0004252
GO:0006465 GO:0016020 |
| AF-A0A7W5S895-F1-model_v4 | Signal peptidase I (EC 3.4.21.89) | 0.8964 | 33 | 286 |
GO:0004252
GO:0006465 GO:0016020 |
| AF-A0A7Y1XGL1-F1-model_v4 | deleted | 0.891 | 25 | 284 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar