F482180

General Info

Members Datasets Scaffolds Average Seq Length
819 569 522 391

Family's Representative Sequence

Representative Sequence 3300038725|Ga0400484_39394|Ga0400484_39394_6405_7679
Length 424
Sequence MRIKNKPQRRKERRGLEKNLRVLRASAVKLEEEKMSFAKRVSHLQEEGAYAVLARAQELERNGRTIIHLEIGEPDFETGANVSMAGIRAISEGRTRYNPPRGIAELREVIAADAGQRRGMEIRPSQVVVGPGAKPTLFFPTLALVEPGDEVIYPNPGFPTYEAMIGAAGGVPVPVPLREEKQFSFDLAVFDQLVNEKTRLIVLNSPSNPTGGVMPVADLEHIAALAQKNDCWVLSDEIYSRMVYDDTAVPSIASLPGMAERTVIADGFSKTYAMTGWRLGYGIMPEALADRIQLLLTHTIGCTAHFTQYAGIEALTGPQDWVDKMVASYRRRRDLLVNGLNAIPGINCQIPQGAFYVFPNVKELGISSAELANYILEEAGVALLPGTAFGKYGEGYLRLSYANSLENLERAMILMATALAKKTR

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
3 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
4 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
5 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
6 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
7 2512875024 Mesorhizobium loti R88b Isolate Nodule
8 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
9 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
10 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
11 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
12 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
13 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
14 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
15 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
16 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
17 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
18 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
19 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
20 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
21 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
22 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
23 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
24 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
25 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
26 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
27 2738543024 Aminobacter sp. AP02 Isolate Unclassified
28 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
29 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
30 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
31 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
32 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
33 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
34 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
35 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
36 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
37 2842694124 Methylopila sp. R-72369 Isolate Unclassified
38 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
39 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
40 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
41 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
42 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
43 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
44 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
45 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
46 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
47 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
48 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
49 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
50 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
51 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
52 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
53 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
54 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
55 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
56 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
57 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
58 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
59 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
60 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
61 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
62 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
63 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
64 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
65 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
66 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
67 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
68 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
69 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
70 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
71 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
72 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
73 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
74 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
75 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
76 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
77 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
78 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
79 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
80 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
81 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
82 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
83 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
84 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
85 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
86 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
87 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
88 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
89 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
90 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
91 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
92 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
93 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
94 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
95 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
96 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
97 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
98 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
99 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
100 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
101 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
102 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
103 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
104 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
105 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
106 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
107 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
108 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
109 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
110 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
111 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
112 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
113 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
114 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
115 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
116 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
117 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
118 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
119 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
120 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
121 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
122 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
123 2902330777 Methylobacterium sp. 2A Isolate Unclassified
124 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
125 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
126 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
127 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
128 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
129 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
130 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
131 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
132 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
133 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
134 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
135 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
136 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
137 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
138 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
139 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
140 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
141 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
142 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
143 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
144 2909042592 Labrys sp. LIt4 Isolate Nodule
145 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
146 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
147 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
148 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
149 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
150 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
151 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
152 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
153 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
154 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
155 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
156 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
157 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
158 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
159 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
160 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
161 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
162 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
163 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
164 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
165 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
166 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
167 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
168 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
169 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
170 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
171 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
172 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
173 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
174 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
175 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
176 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
177 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
178 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
179 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
180 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
181 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
182 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
183 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
184 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
185 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
186 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
187 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
188 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
189 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
190 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
191 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
192 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
193 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
194 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
195 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
196 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
197 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
198 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
199 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
200 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
201 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
202 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
203 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
204 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
205 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
206 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
207 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
208 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
209 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
210 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
211 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
212 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
213 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
214 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
215 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
216 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
217 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
218 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
219 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
220 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
221 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
222 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
223 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
224 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
225 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
226 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
227 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
228 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
229 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
230 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
231 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
232 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
233 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
234 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
235 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
236 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
237 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
238 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
239 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
240 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
241 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
242 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
243 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
244 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
245 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
246 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
247 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
248 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
249 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
250 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
251 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
252 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
253 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
254 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
255 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
256 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
257 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
258 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
259 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
260 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
261 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
262 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
263 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
264 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
265 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
266 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
267 3004167301 Mesorhizobium loti 582 Isolate Unclassified
268 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
269 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
270 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
271 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
272 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
273 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
274 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
275 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
276 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
277 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
278 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
279 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
280 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
281 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
282 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
283 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
284 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
285 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
286 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
287 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
288 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
289 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
290 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
291 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
292 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
293 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
294 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
295 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
296 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
297 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
298 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
299 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
300 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
301 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
302 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
303 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
304 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
305 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
306 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
307 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
308 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
309 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
310 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
311 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
312 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
313 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
314 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
315 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
316 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
317 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
318 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
319 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
320 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
321 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
322 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
323 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
324 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
325 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
326 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
327 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
328 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
329 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
330 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
331 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
332 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
333 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
334 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
335 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
336 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
337 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
338 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
339 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
340 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
341 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
342 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
343 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
344 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
345 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
346 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
347 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
348 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
349 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
350 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
351 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
352 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
353 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
354 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
355 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
356 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
357 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
358 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
359 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
360 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
361 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
362 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
363 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
364 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
365 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
366 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
367 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
368 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
369 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
370 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
371 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
372 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
373 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
374 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
375 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
376 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
377 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
378 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
379 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
380 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
381 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
382 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
383 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
384 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
385 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
386 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
387 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
388 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
389 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
390 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
391 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
392 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
393 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
394 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
395 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
396 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
397 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
398 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
399 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
400 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
401 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
402 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
403 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
404 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
405 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
406 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
407 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
408 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
409 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
410 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
411 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
412 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
413 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
414 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
415 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
416 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
417 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
418 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
419 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
420 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
421 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
422 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
423 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
424 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
425 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
426 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
427 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
428 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
429 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
430 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
431 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
432 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
433 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
434 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
435 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
436 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
437 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
438 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
439 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
440 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
441 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
442 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
443 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
444 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
445 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
446 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
447 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
448 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
449 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
450 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
451 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
452 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
453 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
454 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
455 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
456 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
457 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
458 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
459 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
460 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
461 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
462 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
463 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
464 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
465 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
466 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
467 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
468 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
469 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
470 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
471 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
472 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
473 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
474 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
475 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
476 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
477 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
478 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
479 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
480 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
481 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
482 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
483 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
484 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
485 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
486 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
487 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
488 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
489 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
490 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
491 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
492 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
493 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
494 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
495 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
496 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
497 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
498 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
499 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
500 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
501 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
502 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
503 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
504 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
505 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
506 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
507 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
508 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
509 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
510 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
511 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
512 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
513 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
514 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
515 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
516 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
517 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
518 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
519 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
520 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
521 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
522 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
523 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
524 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
525 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
526 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
527 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
528 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
529 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
530 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
531 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
532 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
533 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
534 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
535 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
536 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
537 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
538 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
539 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
540 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
541 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
542 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
543 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
544 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
545 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
546 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
547 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
548 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
549 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
550 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
551 641522639 Methylobacterium sp. 4-46 Isolate Nodule
552 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
553 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
554 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
555 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
556 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
557 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
558 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
559 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
560 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
561 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
562 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
563 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
564 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
565 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
566 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
567 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
568 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified
569 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 63.61
Metatranscriptomes 0.12
Isolates 36.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.88
Nodule 28.21
Rhizoplane 3.91
Rhizosphere 52.01
Stem 0
Stem Tuber 0
Unclassified 10.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10031910 3300002067 Bacteria 1561
2 JGI25156J39149_1007095 3300002705 Bacteria 2982
3 JGI25157J39369_1000706 3300002741 Bacteria 18004
4 JGI25159J45721_1004883 3300002987 Bacteria 4322
5 JGI25151J46595_10000436 3300003187 Bacteria 41270
6 JGI25165J46597_1000042 3300003214 Bacteria 271606
7 JGI25153J46596_10003217 3300003215 Bacteria 9178
8 JGI25160J50197_1017137 3300003354 Bacteria 2306
9 Ga0055542_1000761 3300003762 Bacteria 24456
10 Ga0065712_10001938 3300005290 Bacteria 5677
11 Ga0065712_10143452 3300005290 Unclassified 1429
12 Ga0070680_100020062 3300005336 Bacteria 5300
13 Ga0068868_100079930 3300005338 Bacteria 2619
14 Ga0070691_10024536 3300005341 Bacteria 2802
15 Ga0070691_10052663 3300005341 Bacteria 1946
16 Ga0070687_100002321 3300005343 Bacteria 7080
17 Ga0070668_100205235 3300005347 Bacteria 1619
18 Ga0070675_100258997 3300005354 Bacteria 1524
19 Ga0070674_100000478 3300005356 Bacteria 20201
20 Ga0070688_100001954 3300005365 Bacteria 10358
21 Ga0070703_10001434 3300005406 Bacteria 7187
22 Ga0070709_10126477 3300005434 Bacteria 1739
23 Ga0070701_10019338 3300005438 Bacteria 3216
24 Ga0070705_100001394 3300005440 Bacteria 12811
25 Ga0070700_100003215 3300005441 Bacteria 8395
26 Ga0070694_100002550 3300005444 Bacteria 10759
27 Ga0070708_100006906 3300005445 Bacteria 9055
28 Ga0070708_100014663 3300005445 Bacteria 6456
29 Ga0070663_100046982 3300005455 Bacteria 3057
30 Ga0070678_100154570 3300005456 Bacteria 1852
31 Ga0070662_100047111 3300005457 Bacteria 3099
32 Ga0070662_100080774 3300005457 Bacteria 2421
33 Ga0070681_10174780 3300005458 Bacteria 2069
34 Ga0068867_100162151 3300005459 Bacteria 1764
35 Ga0070706_100000232 3300005467 Bacteria 68304
36 Ga0070706_100022752 3300005467 Bacteria 5773
37 Ga0070707_100006355 3300005468 Bacteria 10990
38 Ga0070707_100011702 3300005468 Bacteria 8188
39 Ga0070698_100005421 3300005471 Bacteria 13939
40 Ga0070699_100012031 3300005518 Bacteria 7470
41 Ga0070699_100220178 3300005518 Bacteria 1691
42 Ga0070679_100041157 3300005530 Bacteria 4599
43 Ga0070684_100296732 3300005535 Bacteria 1482
44 Ga0070697_100005908 3300005536 Bacteria 9448
45 Ga0070697_100175677 3300005536 Bacteria 1814
46 Ga0070697_100209410 3300005536 Bacteria 1659
47 Ga0068853_100014287 3300005539 Bacteria 6498
48 Ga0070695_100001172 3300005545 Bacteria 14398
49 Ga0070695_100009322 3300005545 Bacteria 5837
50 Ga0070696_100001543 3300005546 Bacteria 15094
51 Ga0070693_100031015 3300005547 Bacteria 2927
52 Ga0070665_100026701 3300005548 Bacteria 5815
53 Ga0070665_100054407 3300005548 Bacteria 4014
54 Ga0070665_100169391 3300005548 Bacteria 2185
55 Ga0070704_100043512 3300005549 Bacteria 3113
56 Ga0068855_100053133 3300005563 Bacteria 4767
57 Ga0068857_100070483 3300005577 Bacteria 3114
58 Ga0068856_100019963 3300005614 Bacteria 6505
59 Ga0070702_100036778 3300005615 Bacteria 2715
60 Ga0068852_100198937 3300005616 Bacteria 1895
61 Ga0068864_100014202 3300005618 Bacteria 6612
62 Ga0068861_100090712 3300005719 Bacteria 2411
63 Ga0068861_100099490 3300005719 Bacteria 2310
64 Ga0068862_100007019 3300005844 Bacteria 9353
65 Ga0081455_10216358 3300005937 Bacteria 1424
66 Ga0081538_10027435 3300005981 Bacteria 3948
67 Ga0081540_1010027 3300005983 Bacteria 6449
68 Ga0081540_1011749 3300005983 Bacteria 5826
69 Ga0081539_10000609 3300005985 Bacteria 72508
70 Ga0081539_10021387 3300005985 Bacteria 4324
71 Ga0070717_10001033 3300006028 Bacteria 18652
72 Ga0070717_10003023 3300006028 Bacteria 11987
73 Ga0075363_100032940 3300006048 Bacteria 2695
74 Ga0075364_10004279 3300006051 Bacteria 8197
75 Ga0075367_10005385 3300006178 Bacteria 6347
76 Ga0075367_10058724 3300006178 Bacteria 2289
77 Ga0075367_10073349 3300006178 Bacteria 2062
78 Ga0075428_100031858 3300006844 Bacteria 5824
79 Ga0075428_100032615 3300006844 Bacteria 5752
80 Ga0075428_100054425 3300006844 Bacteria 4386
81 Ga0075428_100056314 3300006844 Bacteria 4307
82 Ga0075428_100071008 3300006844 Bacteria 3806
83 Ga0075430_100074413 3300006846 Bacteria 2848
84 Ga0075430_100175236 3300006846 Bacteria 1784
85 Ga0075431_100001046 3300006847 Bacteria 24694
86 Ga0075431_100002212 3300006847 Bacteria 18636
87 Ga0075431_100045647 3300006847 Bacteria 4517
88 Ga0105240_10016012 3300009093 Bacteria 10165
89 Ga0105240_10104652 3300009093 Bacteria 3437
90 Ga0111539_10224306 3300009094 Bacteria 2189
91 Ga0111539_10297056 3300009094 Bacteria 1880
92 Ga0111539_10507537 3300009094 Bacteria 1404
93 Ga0114129_10016469 3300009147 Bacteria 10523
94 Ga0114129_10148020 3300009147 Bacteria 3215
95 Ga0114129_10421602 3300009147 Bacteria 1755
96 Ga0105243_10149681 3300009148 Bacteria 2001
97 Ga0105238_10012662 3300009551 Bacteria 8513
98 Ga0105249_10006261 3300009553 Bacteria 10337
99 Ga0157373_10173325 3300013100 Bacteria 1518
100 Ga0157374_10239902 3300013296 Bacteria 1782
101 Ga0163162_10153750 3300013306 Bacteria 2419
102 Ga0157379_10132939 3300014968 Bacteria 2240
103 Ga0182007_10012507 3300015262 Bacteria 3262
104 Ga0206353_11955115 3300020082 Bacteria 2116
105 Ga0213872_10063372 3300021361 Bacteria 1671
106 Ga0213876_10000915 3300021384 Bacteria 19496
107 Ga0213876_10072220 3300021384 Bacteria 1822
108 Ga0213875_10000391 3300021388 Bacteria 39122
109 Ga0213875_10003194 3300021388 Bacteria 9421
110 Ga0213875_10006561 3300021388 Bacteria 6089
111 Ga0213871_10011082 3300021441 Bacteria 2061
112 Ga0224572_1001846 3300024225 Bacteria 3263
113 Ga0209026_1000029 3300025250 Bacteria 337109
114 Ga0209148_1000080 3300025254 Bacteria 277806
115 Ga0209759_1000040 3300025256 Bacteria 254501
116 Ga0209233_1000028 3300025261 Bacteria 642062
117 Ga0209233_1003389 3300025261 Bacteria 5620
118 Ga0209455_1000171 3300025272 Bacteria 109696
119 Ga0209130_1000167 3300025284 Bacteria 95517
120 Ga0209025_1000077 3300025294 Bacteria 271958
121 Ga0209025_1003608 3300025294 Bacteria 14413
122 Ga0209025_1015789 3300025294 Bacteria 4518
123 Ga0209758_1000036 3300025297 Bacteria 441671
124 Ga0209758_1004420 3300025297 Bacteria 11708
125 Ga0209758_1004860 3300025297 Bacteria 10834
126 Ga0207426_1000239 3300025302 Bacteria 123307
127 Ga0207653_10003312 3300025885 Bacteria 5083
128 Ga0207699_10052251 3300025906 Bacteria 2418
129 Ga0207643_10104917 3300025908 Bacteria 1660
130 Ga0207705_10105819 3300025909 Bacteria 2074
131 Ga0207684_10000489 3300025910 Bacteria 50446
132 Ga0207707_10018671 3300025912 Bacteria 6047
133 Ga0207695_10195990 3300025913 Bacteria 1936
134 Ga0207663_10141100 3300025916 Bacteria 1679
135 Ga0207652_10066221 3300025921 Bacteria 3130
136 Ga0207652_10094416 3300025921 Bacteria 2634
137 Ga0207646_10003498 3300025922 Bacteria 17706
138 Ga0207646_10029731 3300025922 Bacteria 4961
139 Ga0207646_10321722 3300025922 Bacteria 1398
140 Ga0207700_10045456 3300025928 Bacteria 3240
141 Ga0207664_10050419 3300025929 Bacteria 3282
142 Ga0207644_10191508 3300025931 Bacteria 1608
143 Ga0207689_10030419 3300025942 Bacteria 4499
144 Ga0207661_10080104 3300025944 Bacteria 2694
145 Ga0207703_10153903 3300026035 Bacteria 2008
146 Ga0207678_10240532 3300026067 Bacteria 1550
147 Ga0207708_10012179 3300026075 Bacteria 6415
148 Ga0207708_10031759 3300026075 Bacteria 4010
149 Ga0207702_10283613 3300026078 Bacteria 1567
150 Ga0207641_10185394 3300026088 Bacteria 1909
151 Ga0207676_10026932 3300026095 Bacteria 4277
152 Ga0207674_10005484 3300026116 Bacteria 15067
153 Ga0207675_100040029 3300026118 Bacteria 4374
154 Ga0207675_100138927 3300026118 Bacteria 2307
155 Ga0207683_10039963 3300026121 Bacteria 4092
156 Ga0207698_10019455 3300026142 Bacteria 4650
157 Ga0209813_10002328 3300027866 Bacteria 4351
158 Ga0207428_10016982 3300027907 Bacteria 6254
159 Ga0268266_10319078 3300028379 Bacteria 1454
160 Ga0268265_10004578 3300028380 Bacteria 9558
161 Ga0265318_10049959 3300028577 Bacteria 1572
162 Ga0265322_10000068 3300028654 Bacteria 49602
163 Ga0265325_10001708 3300031241 Bacteria 15269
164 Ga0265325_10039960 3300031241 Bacteria 2466
165 Ga0265325_10077814 3300031241 Bacteria 1653
166 Ga0265340_10002223 3300031247 Bacteria 11099
167 Ga0265340_10018326 3300031247 Bacteria 3611
168 Ga0265339_10001551 3300031249 Bacteria 16995
169 Ga0265339_10019507 3300031249 Bacteria 3980
170 Ga0265339_10064232 3300031249 Bacteria 1970
171 Ga0265316_10003139 3300031344 Bacteria 16822
172 Ga0265316_10012132 3300031344 Bacteria 7736
173 Ga0265316_10038081 3300031344 Bacteria 3878
174 Ga0307513_10078364 3300031456 Bacteria 3418
175 Ga0265313_10000448 3300031595 Bacteria 43625
176 Ga0265313_10020220 3300031595 Bacteria 3679
177 Ga0265313_10020466 3300031595 Bacteria 3649
178 Ga0307508_10076676 3300031616 Bacteria 2921
179 Ga0316579_10006580 3300031691 Bacteria 4749
180 Ga0316579_10020859 3300031691 Bacteria 2913
181 Ga0316579_10040775 3300031691 Bacteria 2154
182 Ga0265314_10034245 3300031711 Bacteria 3715
183 Ga0265314_10096143 3300031711 Bacteria 1917
184 Ga0265342_10009206 3300031712 Bacteria 6989
185 Ga0316576_10111976 3300031727 Bacteria 2046
186 Ga0316578_10002543 3300031728 Bacteria 8053
187 Ga0316578_10105925 3300031728 Bacteria 1687
188 Ga0307516_10011659 3300031730 Bacteria 9538
189 Ga0316577_10151465 3300031733 Bacteria 1307
190 Ga0307410_10166749 3300031852 Bacteria 1656
191 Ga0316580_10004219 3300032139 Bacteria 4151
192 Ga0307510_10045718 3300033180 Bacteria 4720
193 Ga0373926_0035757 3300035083 Bacteria 1763
194 Ga0373956_0001924 3300035119 Bacteria 8571
195 Ga0373957_0040217 3300035120 Bacteria 1757
196 Ga0373924_0008451 3300035410 Bacteria 3743
197 Ga0373935_0016237 3300035692 Bacteria 4507
198 Ga0373935_0118736 3300035692 Bacteria 1764
199 Ga0373927_0035758 3300035695 Bacteria 3230
200 Ga0373933_0002515 3300035724 Bacteria 10296
201 Ga0373947_0021014 3300035725 Bacteria 3775
202 Ga0373937_0031797 3300036401 Bacteria 4784
203 Ga0316582_0010511 3300036647 Bacteria 5074
204 Ga0316582_0043042 3300036647 Bacteria 2832
205 Ga0316582_0048188 3300036647 Bacteria 2693
206 Ga0316584_0000872 3300036712 Bacteria 17133
207 Ga0316584_0015819 3300036712 Bacteria 5402
208 Ga0316584_0032464 3300036712 Bacteria 3865
209 Ga0316584_0071843 3300036712 Bacteria 2593
210 Ga0316584_0080005 3300036712 Bacteria 2449
211 Ga0316584_0156634 3300036712 Bacteria 1693
212 Ga0373925_0287994 3300037068 Bacteria 1324
213 Ga0395900_0340203 3300037418 Bacteria 1476
214 Ga0316581_0000782 3300037588 Bacteria 6570
215 Ga0316581_0029635 3300037588 Unclassified 1645
216 Ga0436364_0010042 3300037853 Bacteria 102214
217 Ga0436364_0549528 3300037853 Bacteria 14336
218 Ga0436364_0685371 3300037853 Bacteria 68284
219 Ga0400484_39394 3300038725 Bacteria 11243
220 Ga0400483_017255 3300039062 Bacteria 9912
221 Ga0400483_165172 3300039062 Bacteria 9498
222 Ga0400483_183052 3300039062 Bacteria 3025
223 Ga0400483_236881 3300039062 Bacteria 5331
224 Ga0400483_265909 3300039062 Bacteria 8765
225 Ga0436365_0167783 3300039437 Bacteria 30845
226 Ga0436365_0536235 3300039437 Bacteria 9986
227 Ga0436365_0693504 3300039437 Bacteria 82758
228 Ga0436365_0831867 3300039437 Bacteria 2044
229 Ga0436360_0064987 3300039438 Bacteria 2565
230 Ga0436361_0301719 3300039447 Bacteria 1847
231 Ga0436361_0340312 3300039447 Bacteria 4192
232 Ga0436361_0349975 3300039447 Bacteria 2462
233 Ga0436361_1209447 3300039447 Bacteria 1691
234 Ga0436363_0573820 3300039450 Bacteria 8262
235 Ga0436363_0715384 3300039450 Bacteria 10341
236 Ga0436363_1484825 3300039450 Bacteria 1339
237 Ga0436363_1547701 3300039450 Bacteria 8513
238 Ga0436362_0969859 3300039453 Bacteria 3323
239 Ga0439440_0023721 3300042993 Unclassified 1401
240 Ga0453683_0054776 3300044673 Bacteria 2496
241 Ga0453684_0001430 3300044712 Bacteria 68343
242 Ga0453684_0040212 3300044712 Bacteria 6356
243 Ga0453684_0056492 3300044712 Bacteria 5091
244 Ga0453684_0059934 3300044712 Bacteria 4901
245 Ga0453684_0340199 3300044712 Bacteria 1694
246 Ga0466968_0002176 3300044735 Bacteria 7148
247 Ga0466968_0005181 3300044735 Bacteria 4876
248 Ga0466960_0037682 3300044901 Bacteria 2269
249 Ga0451576_0000009 3300045051 Bacteria 712666
250 Ga0451576_0002127 3300045051 Bacteria 30771
251 Ga0451576_0558292 3300045051 Bacteria 1203
252 Ga0466967_0188526 3300045976 Bacteria 1948
253 Ga0495629_0012044 3300046459 Bacteria 6268
254 Ga0495638_0003543 3300046460 Bacteria 12235
255 Ga0495638_0054870 3300046460 Bacteria 2476
256 Ga0495651_0003394 3300046462 Bacteria 12218
257 Ga0495653_0004556 3300046463 Bacteria 11199
258 Ga0495580_0072748 3300046472 Bacteria 2400
259 Ga0495582_0047458 3300046473 Bacteria 2366
260 Ga0495608_0002249 3300046511 Bacteria 13939
261 Ga0495610_0013771 3300046512 Bacteria 4785
262 Ga0495618_0001172 3300046514 Bacteria 17756
263 Ga0495628_0034175 3300046516 Bacteria 4092
264 Ga0495643_0092242 3300046522 Bacteria 1561
265 Ga0495652_0004437 3300046529 Bacteria 13417
266 Ga0495640_0005042 3300046533 Bacteria 10490
267 Ga0495587_0021831 3300046536 Bacteria 3949
268 Ga0495667_0044894 3300046559 Bacteria 2926
269 Ga0495634_0007035 3300046642 Bacteria 8485
270 Ga0495625_0038244 3300046660 Bacteria 3514
271 Ga0495635_0005384 3300046663 Bacteria 8903
272 Ga0495657_0025526 3300046675 Bacteria 4195
273 Ga0495623_0011358 3300046679 Bacteria 5761
274 Ga0495646_0006441 3300046680 Bacteria 7444
275 Ga0495613_0091243 3300046689 Bacteria 2206
276 Ga0495670_0022015 3300046691 Bacteria 3147
277 Ga0495600_0001574 3300046809 Bacteria 12692
278 Ga0495604_0000150 3300047317 Bacteria 60582
279 Ga0495674_0040568 3300047319 Bacteria 4163
280 Ga0495676_0016306 3300047321 Bacteria 6598
281 Ga0495680_0000699 3300047322 Bacteria 37651
282 Ga0495675_0007130 3300047444 Bacteria 6878
283 Ga0495686_0069331 3300047472 Bacteria 2174
284 Ga0496100_0249835 3300048903 Bacteria 1312
285 Ga0496102_0039194 3300048905 Bacteria 4280
286 Ga0496102_0199713 3300048905 Bacteria 1885
287 Ga0496104_0001490 3300048907 Bacteria 20205
288 Ga0496104_0003654 3300048907 Bacteria 13281
289 Ga0496104_0006182 3300048907 Bacteria 10515
290 Ga0496105_0002850 3300048908 Bacteria 12652
291 Ga0496105_0003480 3300048908 Bacteria 11651
292 Ga0496105_0051925 3300048908 Bacteria 3385
293 Ga0496106_0011468 3300048909 Bacteria 6554
294 Ga0496106_0206710 3300048909 Bacteria 1563
295 Ga0496108_0003952 3300048911 Bacteria 11907
296 Ga0496108_0005160 3300048911 Bacteria 10558
297 Ga0496109_0003935 3300048912 Bacteria 12413
298 Ga0496109_0004749 3300048912 Bacteria 11355
299 Ga0496110_0000113 3300048913 Bacteria 44443
300 Ga0496110_0017309 3300048913 Bacteria 6029
301 Ga0496110_0035124 3300048913 Bacteria 4347
302 Ga0496111_0000458 3300048914 Bacteria 20697
303 Ga0496111_0000718 3300048914 Bacteria 17646
304 Ga0496111_0020182 3300048914 Bacteria 4637
305 Ga0496112_0019676 3300048915 Bacteria 6378
306 Ga0496112_0098480 3300048915 Bacteria 2894
307 Ga0496112_0301066 3300048915 Bacteria 1549
308 Ga0496113_0002796 3300048916 Bacteria 10267
309 Ga0496113_0014258 3300048916 Bacteria 5418
310 Ga0496114_0016673 3300048917 Bacteria 5925
311 Ga0496115_0014819 3300048918 Bacteria 5912
312 Ga0496115_0042790 3300048918 Bacteria 3610
313 Ga0496118_0055136 3300048921 Bacteria 3003
314 Ga0496118_0111385 3300048921 Bacteria 1815
315 Ga0496119_0001398 3300048922 Bacteria 29250
316 Ga0496120_0001370 3300048923 Bacteria 29844
317 Ga0496121_0070628 3300048924 Bacteria 2812
318 Ga0496121_0115011 3300048924 Bacteria 2044
319 Ga0496122_0001032 3300048925 Bacteria 48968
320 Ga0496123_0000806 3300048926 Bacteria 50579
321 Ga0496123_0051165 3300048926 Bacteria 2753
322 Ga0496125_0104048 3300048928 Bacteria 2081
323 Ga0501031_0005116 3300049568 Bacteria 8542
324 Ga0501032_0000238 3300049569 Bacteria 45642
325 Ga0501032_0017280 3300049569 Bacteria 5065
326 Ga0501032_0073694 3300049569 Bacteria 2274
327 Ga0501032_0081690 3300049569 Bacteria 2150
328 Ga0501032_0086333 3300049569 Bacteria 2085
329 Ga0501032_0142155 3300049569 Bacteria 1580
330 Ga0501033_0016486 3300049570 Bacteria 5595
331 Ga0501033_0023537 3300049570 Bacteria 4644
332 Ga0501033_0120707 3300049570 Bacteria 1902
333 Ga0501033_0185071 3300049570 Bacteria 1492
334 Ga0501034_0002653 3300049571 Bacteria 21171
335 Ga0501034_0004312 3300049571 Bacteria 15860
336 Ga0501034_0014877 3300049571 Bacteria 8003
337 Ga0501034_0020143 3300049571 Bacteria 6810
338 Ga0501034_0030547 3300049571 Bacteria 5477
339 Ga0501034_0032884 3300049571 Bacteria 5266
340 Ga0501034_0049137 3300049571 Bacteria 4257
341 Ga0501034_0083119 3300049571 Bacteria 3203
342 Ga0501034_0097390 3300049571 Bacteria 2937
343 Ga0501034_0391603 3300049571 Bacteria 1313
344 Ga0501036_0001536 3300049572 Bacteria 17831
345 Ga0501036_0003303 3300049572 Bacteria 12872
346 Ga0501036_0058034 3300049572 Bacteria 3279
347 Ga0501036_0107592 3300049572 Bacteria 2357
348 Ga0501036_0129714 3300049572 Bacteria 2129
349 Ga0501036_0143885 3300049572 Bacteria 2011
350 Ga0501037_0039910 3300049573 Bacteria 3454
351 Ga0501037_0043039 3300049573 Bacteria 3319
352 Ga0501037_0160884 3300049573 Bacteria 1600
353 Ga0501037_0188373 3300049573 Bacteria 1461
354 Ga0501038_0009911 3300049574 Bacteria 8723
355 Ga0501038_0019076 3300049574 Bacteria 6184
356 Ga0501038_0035281 3300049574 Bacteria 4391
357 Ga0501038_0076939 3300049574 Bacteria 2818
358 Ga0501038_0079017 3300049574 Bacteria 2775
359 Ga0501038_0095692 3300049574 Bacteria 2480
360 Ga0501039_0024279 3300049575 Bacteria 4655
361 Ga0501039_0039572 3300049575 Bacteria 3641
362 Ga0501039_0143449 3300049575 Bacteria 1876
363 Ga0501039_0162768 3300049575 Bacteria 1754
364 Ga0501039_0163233 3300049575 Bacteria 1751
365 Ga0501040_0013655 3300049576 Bacteria 5341
366 Ga0501040_0027140 3300049576 Bacteria 3854
367 Ga0501040_0041823 3300049576 Bacteria 3122
368 Ga0501040_0209081 3300049576 Bacteria 1387
369 Ga0501041_0031061 3300049577 Bacteria 3225
370 Ga0501041_0078819 3300049577 Bacteria 2027
371 Ga0501041_0103783 3300049577 Bacteria 1761
372 Ga0501042_0007935 3300049578 Bacteria 6982
373 Ga0501042_0010639 3300049578 Bacteria 6180
374 Ga0501042_0199105 3300049578 Bacteria 1444
375 Ga0501043_0000736 3300049579 Bacteria 29004
376 Ga0501043_0010338 3300049579 Bacteria 7316
377 Ga0501043_0105872 3300049579 Bacteria 2209
378 Ga0501043_0180562 3300049579 Bacteria 1644
379 Ga0501043_0196328 3300049579 Bacteria 1567
380 Ga0501046_0007945 3300049580 Bacteria 9282
381 Ga0501046_0030399 3300049580 Bacteria 4383
382 Ga0501046_0074525 3300049580 Bacteria 2633
383 Ga0501046_0116631 3300049580 Bacteria 2035
384 Ga0501047_0000124 3300049581 Bacteria 94721
385 Ga0501047_0012748 3300049581 Bacteria 7964
386 Ga0501047_0029328 3300049581 Bacteria 5307
387 Ga0501047_0043610 3300049581 Bacteria 4333
388 Ga0501047_0096714 3300049581 Bacteria 2831
389 Ga0501047_0141056 3300049581 Bacteria 2288
390 Ga0501047_0180580 3300049581 Bacteria 1977
391 Ga0501047_0199073 3300049581 Bacteria 1864
392 Ga0501047_0202112 3300049581 Bacteria 1848
393 Ga0501047_0223703 3300049581 Bacteria 1737
394 Ga0501048_0008611 3300049582 Bacteria 7703
395 Ga0501048_0115145 3300049582 Bacteria 1899
396 Ga0501067_0001307 3300049583 Bacteria 13493
397 Ga0501067_0004048 3300049583 Bacteria 8083
398 Ga0501067_0045980 3300049583 Bacteria 2423
399 Ga0501067_0062591 3300049583 Bacteria 2060
400 Ga0501068_0008727 3300049584 Bacteria 5652
401 Ga0501068_0020629 3300049584 Bacteria 3841
402 Ga0501068_0036089 3300049584 Bacteria 2954
403 Ga0501068_0063858 3300049584 Bacteria 2240
404 Ga0501068_0071661 3300049584 Bacteria 2115
405 Ga0501069_0075408 3300049585 Bacteria 1894
406 Ga0501069_0115901 3300049585 Bacteria 1528
407 Ga0501070_0000229 3300049586 Bacteria 52795
408 Ga0501070_0005227 3300049586 Bacteria 11067
409 Ga0501070_0010861 3300049586 Bacteria 7692
410 Ga0501070_0041971 3300049586 Bacteria 3809
411 Ga0501070_0050657 3300049586 Bacteria 3446
412 Ga0501070_0078669 3300049586 Bacteria 2729
413 Ga0501070_0155796 3300049586 Bacteria 1884
414 Ga0501071_0011715 3300049587 Bacteria 5918
415 Ga0501071_0012733 3300049587 Bacteria 5719
416 Ga0501071_0220436 3300049587 Bacteria 1427
417 Ga0501071_0250773 3300049587 Bacteria 1336
418 Ga0501072_0002828 3300049588 Bacteria 13022
419 Ga0501072_0009532 3300049588 Bacteria 7385
420 Ga0501072_0085666 3300049588 Bacteria 2500
421 Ga0501073_0009708 3300049589 Bacteria 7090
422 Ga0501073_0010790 3300049589 Bacteria 6689
423 Ga0501073_0017780 3300049589 Bacteria 5146
424 Ga0501073_0021727 3300049589 Bacteria 4623
425 Ga0501073_0041756 3300049589 Bacteria 3240
426 Ga0501073_0069535 3300049589 Bacteria 2453
427 Ga0501073_0077738 3300049589 Bacteria 2309
428 Ga0501073_0129309 3300049589 Bacteria 1750
429 Ga0501074_0023598 3300049590 Bacteria 4471
430 Ga0501074_0028354 3300049590 Bacteria 4058
431 Ga0501074_0119904 3300049590 Bacteria 1881
432 Ga0501074_0160520 3300049590 Bacteria 1605
433 Ga0501075_0005275 3300049591 Bacteria 8833
434 Ga0501075_0114962 3300049591 Bacteria 2046
435 Ga0501076_0006327 3300049592 Bacteria 8581
436 Ga0501076_0025489 3300049592 Bacteria 4575
437 Ga0501076_0093490 3300049592 Bacteria 2420
438 Ga0501077_0098593 3300049593 Bacteria 1852
439 Ga0501079_0016277 3300049741 Bacteria 5682
440 Ga0501079_0035052 3300049741 Bacteria 3861
441 Ga0501079_0042222 3300049741 Bacteria 3522
442 Ga0501079_0065430 3300049741 Bacteria 2804
443 Ga0501080_0000130 3300049742 Bacteria 53465
444 Ga0501080_0007746 3300049742 Bacteria 9710
445 Ga0501080_0016328 3300049742 Bacteria 6855
446 Ga0501080_0024231 3300049742 Bacteria 5626
447 Ga0501080_0027681 3300049742 Bacteria 5270
448 Ga0501080_0043335 3300049742 Bacteria 4190
449 Ga0501080_0089934 3300049742 Bacteria 2852
450 Ga0501080_0103359 3300049742 Bacteria 2642
451 Ga0501080_0110525 3300049742 Bacteria 2547
452 Ga0501080_0149062 3300049742 Bacteria 2163
453 Ga0501080_0367428 3300049742 Bacteria 1297
454 Ga0501081_0003672 3300049743 Bacteria 9825
455 Ga0501081_0103416 3300049743 Bacteria 2015
456 Ga0501083_0000480 3300049744 Bacteria 25565
457 Ga0501083_0011760 3300049744 Bacteria 6135
458 Ga0501083_0011873 3300049744 Bacteria 6103
459 Ga0501083_0013234 3300049744 Bacteria 5766
460 Ga0501083_0077118 3300049744 Bacteria 2212
461 Ga0501083_0083711 3300049744 Bacteria 2113
462 Ga0501083_0087651 3300049744 Bacteria 2058
463 Ga0501035_0000373 3300049822 Bacteria 51518
464 Ga0501035_0004040 3300049822 Bacteria 13976
465 Ga0501035_0164738 3300049822 Bacteria 1917
466 Ga0501035_0180185 3300049822 Bacteria 1820
467 Ga0501035_0210966 3300049822 Bacteria 1661
468 Ga0501044_0023125 3300049823 Bacteria 6616
469 Ga0501044_0039770 3300049823 Bacteria 4904
470 Ga0501044_0060321 3300049823 Bacteria 3884
471 Ga0501044_0075405 3300049823 Bacteria 3424
472 Ga0501044_0135969 3300049823 Bacteria 2449
473 Ga0501044_0185250 3300049823 Bacteria 2047
474 Ga0501044_0228418 3300049823 Bacteria 1809
475 Ga0501045_0011533 3300049824 Bacteria 6207
476 Ga0501045_0104871 3300049824 Bacteria 2094
477 Ga0501045_0178045 3300049824 Bacteria 1584
478 nmdc:mga03n38_33757_c1 3300050490 Bacteria 2180
479 nmdc:mga06z11_35768_c1 3300050494 Bacteria 2447
480 nmdc:mga04h51_971_c1 3300050495 Bacteria 6630
481 nmdc:mga07m45_37653_c1 3300050496 Bacteria 2698
482 nmdc:mga05p37_156440_c1 3300050507 Bacteria 2785
483 nmdc:mga05p37_182147_c1 3300050507 Bacteria 2555
484 nmdc:mga05p37_313720_c1 3300050507 Bacteria 1858
485 nmdc:mga05p37_82638_c1 3300050507 Bacteria 3958
486 nmdc:mga09592_29249_c1 3300050508 Bacteria 4582
487 nmdc:mga0qj67_35336_c1 3300050509 Bacteria 3907
488 nmdc:mga0qj67_7547_c1 3300050509 Bacteria 8036
489 nmdc:mga06r32_1985_c1 3300050510 Bacteria 18277
490 nmdc:mga06r32_52676_c1 3300050510 Bacteria 3898
491 nmdc:mga06r32_55613_c1 3300050510 Bacteria 3796
492 nmdc:mga06r32_86904_c1 3300050510 Bacteria 3050
493 nmdc:mga08y16_20054_c1 3300050511 Bacteria 7053
494 nmdc:mga08x19_167701_c1 3300050514 Bacteria 1494
495 nmdc:mga0a205_88269_c1 3300050515 Bacteria 2997
496 Ga0495612_0010743 3300053078 Bacteria 3697
497 Ga0495595_0000221 3300053084 Bacteria 22745
498 Ga0500651_0118691 3300053093 Bacteria 1608
499 Ga0500651_0144565 3300053093 Bacteria 1431
500 Ga0500555_002895 3300053103 Bacteria 4914
501 Ga0500556_0000068 3300053104 Bacteria 103123
502 Ga0500658_0078164 3300053134 Bacteria 1410
503 Ga0500568_0000177 3300053139 Bacteria 55762
504 Ga0500568_0044613 3300053139 Bacteria 1767
505 Ga0500604_0009366 3300053151 Bacteria 2609
506 Ga0500616_0000001 3300053153 Bacteria 1986011
507 Ga0500620_000267 3300053155 Bacteria 10143
508 Ga0500620_001565 3300053155 Bacteria 4290
509 Ga0500645_000051 3300053730 Bacteria 98521
510 Ga0501084_0009054 3300054114 Bacteria 8236
511 Ga0501084_0010394 3300054114 Bacteria 7695
512 Ga0501084_0012288 3300054114 Bacteria 7091
513 Ga0501084_0019577 3300054114 Bacteria 5640
514 Ga0501084_0024425 3300054114 Bacteria 5042
515 Ga0501084_0072722 3300054114 Bacteria 2880
516 Ga0501084_0130091 3300054114 Bacteria 2119
517 Ga0501082_0000046 3300060353 Bacteria 86307
518 Ga0501082_0006510 3300060353 Bacteria 10128
519 Ga0501082_0015911 3300060353 Bacteria 6470
520 Ga0501082_0055241 3300060353 Bacteria 3421
521 Ga0501082_0096097 3300060353 Bacteria 2561
522 Ga0530510_0073466 3300061734 Bacteria 2482

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044712 Ga0453684_0340199 Ga0453684_0340199_571_1683 361
2 3300044673 Ga0453683_0054776 Ga0453683_0054776_696_1856 366
3 3300045051 Ga0451576_0000009 Ga0451576_0000009_610650_611810 366
4 3300005290 Ga0065712_10143452 Ga0065712_101434521 367
5 3300031691 Ga0316579_10020859 Ga0316579_100208592 369
6 3300036647 Ga0316582_0010511 Ga0316582_0010511_1277_2449 369
7 3300049589 Ga0501073_0017780 Ga0501073_0017780_2541_3716 370
8 3300009147 Ga0114129_10016469 Ga0114129_100164699 372
9 3300049589 Ga0501073_0041756 Ga0501073_0041756_1550_2716 372
10 3300049744 Ga0501083_0013234 Ga0501083_0013234_1007_2173 372
11 3300050507 nmdc:mga05p37_182147_c1 nmdc:mga05p37_182147_c1_458_1624 372
12 3300054114 Ga0501084_0010394 Ga0501084_0010394_3247_4413 372
13 3300045051 Ga0451576_0558292 Ga0451576_0558292_25_1185 373
14 3300039447 Ga0436361_0340312 Ga0436361_0340312_1097_2269 374
15 3300049585 Ga0501069_0115901 Ga0501069_0115901_307_1470 375
16 3300049586 Ga0501070_0041971 Ga0501070_0041971_890_2053 375
17 3300049744 Ga0501083_0011873 Ga0501083_0011873_626_1789 375
18 3300050511 nmdc:mga08y16_20054_c1 nmdc:mga08y16_20054_c1_2226_3425 375
19 3300050514 nmdc:mga08x19_167701_c1 nmdc:mga08x19_167701_c1_130_1311 375
20 3300060353 Ga0501082_0055241 Ga0501082_0055241_1097_2260 375
21 3300031249 Ga0265339_10064232 Ga0265339_100642321 376
22 3300031344 Ga0265316_10038081 Ga0265316_100380814 376
23 3300031711 Ga0265314_10096143 Ga0265314_100961432 376
24 3300031728 Ga0316578_10002543 Ga0316578_100025436 376
25 3300032139 Ga0316580_10004219 Ga0316580_100042192 376
26 3300009094 Ga0111539_10297056 Ga0111539_102970561 377
27 3300005290 Ga0065712_10001938 Ga0065712_100019385 378
28 3300005343 Ga0070687_100002321 Ga0070687_1000023218 378
29 3300005356 Ga0070674_100000478 Ga0070674_10000047815 378
30 3300005457 Ga0070662_100080774 Ga0070662_1000807742 378
31 3300006844 Ga0075428_100031858 Ga0075428_1000318583 378
32 3300006844 Ga0075428_100032615 Ga0075428_1000326153 378
33 3300031727 Ga0316576_10111976 Ga0316576_101119761 378
34 3300036712 Ga0316584_0000872 Ga0316584_0000872_2679_3869 378
35 3300036712 Ga0316584_0080005 Ga0316584_0080005_62_1234 378
36 3300037588 Ga0316581_0000782 Ga0316581_0000782_472_1662 378
37 3300042993 Ga0439440_0023721 Ga0439440_0023721_121_1302 378
38 3300049569 Ga0501032_0000238 Ga0501032_0000238_5149_6333 378
39 3300049571 Ga0501034_0032884 Ga0501034_0032884_577_1761 378
40 3300050515 nmdc:mga0a205_88269_c1 nmdc:mga0a205_88269_c1_933_2120 378
41 iso_pu_bacteria 2511231027 2511390315 378
42 iso_pu_bacteria 2545555834 2545674357 378
43 iso_pu_bacteria 2595698237 2596377279 378
44 iso_pu_bacteria 2643221547 2643758839 378
45 iso_pu_bacteria 2765235802 2765466365 378
46 iso_pu_bacteria 2828305725 2828308625 378
47 iso_pu_bacteria 2837651117 2837654175 378
48 iso_pu_bacteria 2842871566 2842872285 378
49 iso_pu_bacteria 2861691609 2861696691 378
50 iso_pu_bacteria 2870782633 2870789699 378
51 iso_pu_bacteria 2889306138 2889308443 378
52 iso_pu_bacteria 2889790730 2889792912 378
53 iso_pu_bacteria 2889914905 2889919072 378
54 iso_pu_bacteria 2894652903 2894655591 378
55 iso_pu_bacteria 2902330777 2902335163 378
56 iso_pu_bacteria 2902405164 2902410619 378
57 iso_pu_bacteria 2904578770 2904582248 378
58 iso_pu_bacteria 2919119836 2919122971 378
59 iso_pu_bacteria 2928125067 2928130730 378
60 iso_pu_bacteria 2928521798 2928524209 378
61 iso_pu_bacteria 2937843397 2937848381 378
62 iso_pu_bacteria 2954011201 2954013157 378
63 iso_pu_bacteria 3002141150 3002145117 378
64 iso_pu_bacteria 3003665799 3003667394 378
65 iso_pu_bacteria 641522639 641645039 378
66 iso_pu_bacteria 643348564 643599412 378
67 iso_pu_bacteria 8054563764 8054566246 378
68 3300009094 Ga0111539_10224306 Ga0111539_102243062 379
69 3300024225 Ga0224572_1001846 Ga0224572_10018462 379
70 3300031691 Ga0316579_10006580 Ga0316579_100065802 379
71 3300031691 Ga0316579_10040775 Ga0316579_100407752 379
72 3300031728 Ga0316578_10105925 Ga0316578_101059251 379
73 3300031733 Ga0316577_10151465 Ga0316577_101514651 379
74 3300036647 Ga0316582_0043042 Ga0316582_0043042_1253_2413 379
75 3300036712 Ga0316584_0015819 Ga0316584_0015819_3342_4529 379
76 3300036712 Ga0316584_0032464 Ga0316584_0032464_2429_3598 379
77 3300037588 Ga0316581_0029635 Ga0316581_0029635_430_1608 379
78 3300044712 Ga0453684_0040212 Ga0453684_0040212_549_1715 379
79 3300044712 Ga0453684_0056492 Ga0453684_0056492_2531_3691 379
80 3300045051 Ga0451576_0002127 Ga0451576_0002127_1794_2978 379
81 iso_pu_bacteria 2961127735 2961133876 379
82 3300005365 Ga0070688_100001954 Ga0070688_1000019546 380
83 3300005445 Ga0070708_100006906 Ga0070708_1000069063 380
84 3300005467 Ga0070706_100000232 Ga0070706_10000023215 380
85 3300005467 Ga0070706_100022752 Ga0070706_1000227524 380
86 3300005468 Ga0070707_100011702 Ga0070707_1000117023 380
87 3300005937 Ga0081455_10216358 Ga0081455_102163581 380
88 3300005981 Ga0081538_10027435 Ga0081538_100274352 380
89 3300006028 Ga0070717_10001033 Ga0070717_1000103316 380
90 3300025910 Ga0207684_10000489 Ga0207684_100004894 380
91 3300025922 Ga0207646_10029731 Ga0207646_100297314 380
92 3300026035 Ga0207703_10153903 Ga0207703_101539032 380
93 3300028577 Ga0265318_10049959 Ga0265318_100499591 380
94 3300031249 Ga0265339_10019507 Ga0265339_100195074 380
95 3300031344 Ga0265316_10012132 Ga0265316_100121326 380
96 3300031712 Ga0265342_10009206 Ga0265342_1000920610 380
97 3300031852 Ga0307410_10166749 Ga0307410_101667492 380
98 3300036712 Ga0316584_0071843 Ga0316584_0071843_72_1241 380
99 3300037068 Ga0373925_0287994 Ga0373925_0287994_17_1198 380
100 3300038725 Ga0400484_39394 Ga0400484_39394_6405_7679 380
101 3300039062 Ga0400483_017255 Ga0400483_017255_828_1991 380
102 3300039062 Ga0400483_165172 Ga0400483_165172_5673_6836 380
103 3300039062 Ga0400483_183052 Ga0400483_183052_748_1914 380
104 3300039062 Ga0400483_265909 Ga0400483_265909_5426_6589 380
105 3300044712 Ga0453684_0001430 Ga0453684_0001430_21614_22798 380
106 3300044712 Ga0453684_0059934 Ga0453684_0059934_1533_2720 380
107 3300049587 Ga0501071_0012733 Ga0501071_0012733_1416_2585 380
108 3300049592 Ga0501076_0093490 Ga0501076_0093490_94_1260 380
109 3300049823 Ga0501044_0185250 Ga0501044_0185250_489_1658 380
110 3300053103 Ga0500555_002895 Ga0500555_002895_2707_3909 380
111 iso_pu_bacteria 2919450847 2919452288 380
112 3300002987 JGI25159J45721_1004883 JGI25159J45721_10048834 381
113 3300003187 JGI25151J46595_10000436 JGI25151J46595_1000043622 381
114 3300003215 JGI25153J46596_10003217 JGI25153J46596_100032179 381
115 3300003354 JGI25160J50197_1017137 JGI25160J50197_10171371 381
116 3300005336 Ga0070680_100020062 Ga0070680_1000200622 381
117 3300005338 Ga0068868_100079930 Ga0068868_1000799302 381
118 3300005341 Ga0070691_10024536 Ga0070691_100245362 381
119 3300005341 Ga0070691_10052663 Ga0070691_100526631 381
120 3300005347 Ga0070668_100205235 Ga0070668_1002052352 381
121 3300005354 Ga0070675_100258997 Ga0070675_1002589971 381
122 3300005406 Ga0070703_10001434 Ga0070703_100014342 381
123 3300005434 Ga0070709_10126477 Ga0070709_101264772 381
124 3300005438 Ga0070701_10019338 Ga0070701_100193382 381
125 3300005440 Ga0070705_100001394 Ga0070705_10000139410 381
126 3300005441 Ga0070700_100003215 Ga0070700_1000032153 381
127 3300005444 Ga0070694_100002550 Ga0070694_1000025508 381
128 3300005445 Ga0070708_100014663 Ga0070708_1000146632 381
129 3300005455 Ga0070663_100046982 Ga0070663_1000469823 381
130 3300005456 Ga0070678_100154570 Ga0070678_1001545702 381
131 3300005457 Ga0070662_100047111 Ga0070662_1000471112 381
132 3300005458 Ga0070681_10174780 Ga0070681_101747802 381
133 3300005468 Ga0070707_100006355 Ga0070707_1000063559 381
134 3300005471 Ga0070698_100005421 Ga0070698_1000054211 381
135 3300005518 Ga0070699_100012031 Ga0070699_1000120312 381
136 3300005518 Ga0070699_100220178 Ga0070699_1002201782 381
137 3300005535 Ga0070684_100296732 Ga0070684_1002967321 381
138 3300005536 Ga0070697_100005908 Ga0070697_1000059082 381
139 3300005536 Ga0070697_100175677 Ga0070697_1001756771 381
140 3300005536 Ga0070697_100209410 Ga0070697_1002094101 381
141 3300005545 Ga0070695_100001172 Ga0070695_1000011725 381
142 3300005545 Ga0070695_100009322 Ga0070695_1000093222 381
143 3300005546 Ga0070696_100001543 Ga0070696_1000015432 381
144 3300005547 Ga0070693_100031015 Ga0070693_1000310152 381
145 3300005549 Ga0070704_100043512 Ga0070704_1000435121 381
146 3300005577 Ga0068857_100070483 Ga0068857_1000704832 381
147 3300005614 Ga0068856_100019963 Ga0068856_1000199632 381
148 3300005615 Ga0070702_100036778 Ga0070702_1000367782 381
149 3300005618 Ga0068864_100014202 Ga0068864_1000142026 381
150 3300005719 Ga0068861_100090712 Ga0068861_1000907123 381
151 3300005719 Ga0068861_100099490 Ga0068861_1000994902 381
152 3300005844 Ga0068862_100007019 Ga0068862_1000070197 381
153 3300005983 Ga0081540_1011749 Ga0081540_10117496 381
154 3300006028 Ga0070717_10003023 Ga0070717_100030232 381
155 3300006048 Ga0075363_100032940 Ga0075363_1000329402 381
156 3300006051 Ga0075364_10004279 Ga0075364_100042796 381
157 3300006178 Ga0075367_10005385 Ga0075367_100053852 381
158 3300006178 Ga0075367_10073349 Ga0075367_100733491 381
159 3300006844 Ga0075428_100054425 Ga0075428_1000544252 381
160 3300006844 Ga0075428_100056314 Ga0075428_1000563143 381
161 3300006844 Ga0075428_100071008 Ga0075428_1000710084 381
162 3300006846 Ga0075430_100074413 Ga0075430_1000744132 381
163 3300006846 Ga0075430_100175236 Ga0075430_1001752362 381
164 3300006847 Ga0075431_100001046 Ga0075431_1000010469 381
165 3300006847 Ga0075431_100002212 Ga0075431_1000022123 381
166 3300006847 Ga0075431_100045647 Ga0075431_1000456474 381
167 3300009147 Ga0114129_10148020 Ga0114129_101480203 381
168 3300009147 Ga0114129_10421602 Ga0114129_104216022 381
169 3300009148 Ga0105243_10149681 Ga0105243_101496811 381
170 3300009553 Ga0105249_10006261 Ga0105249_100062612 381
171 3300013296 Ga0157374_10239902 Ga0157374_102399022 381
172 3300013306 Ga0163162_10153750 Ga0163162_101537503 381
173 3300014968 Ga0157379_10132939 Ga0157379_101329392 381
174 3300021388 Ga0213875_10000391 Ga0213875_1000039128 381
175 3300021388 Ga0213875_10003194 Ga0213875_100031944 381
176 3300025284 Ga0209130_1000167 Ga0209130_100016769 381
177 3300025294 Ga0209025_1000077 Ga0209025_100007777 381
178 3300025297 Ga0209758_1000036 Ga0209758_1000036297 381
179 3300025297 Ga0209758_1004420 Ga0209758_10044204 381
180 3300025302 Ga0207426_1000239 Ga0207426_100023971 381
181 3300025885 Ga0207653_10003312 Ga0207653_100033122 381
182 3300025906 Ga0207699_10052251 Ga0207699_100522513 381
183 3300025908 Ga0207643_10104917 Ga0207643_101049172 381
184 3300025916 Ga0207663_10141100 Ga0207663_101411001 381
185 3300025921 Ga0207652_10094416 Ga0207652_100944162 381
186 3300025922 Ga0207646_10003498 Ga0207646_100034986 381
187 3300025922 Ga0207646_10321722 Ga0207646_103217222 381
188 3300025928 Ga0207700_10045456 Ga0207700_100454563 381
189 3300025929 Ga0207664_10050419 Ga0207664_100504193 381
190 3300025931 Ga0207644_10191508 Ga0207644_101915081 381
191 3300025942 Ga0207689_10030419 Ga0207689_100304192 381
192 3300025944 Ga0207661_10080104 Ga0207661_100801042 381
193 3300026067 Ga0207678_10240532 Ga0207678_102405321 381
194 3300026075 Ga0207708_10012179 Ga0207708_100121792 381
195 3300026075 Ga0207708_10031759 Ga0207708_100317591 381
196 3300026088 Ga0207641_10185394 Ga0207641_101853943 381
197 3300026095 Ga0207676_10026932 Ga0207676_100269322 381
198 3300026116 Ga0207674_10005484 Ga0207674_100054842 381
199 3300026118 Ga0207675_100040029 Ga0207675_1000400292 381
200 3300026118 Ga0207675_100138927 Ga0207675_1001389272 381
201 3300026121 Ga0207683_10039963 Ga0207683_100399634 381
202 3300027866 Ga0209813_10002328 Ga0209813_100023284 381
203 3300027907 Ga0207428_10016982 Ga0207428_100169822 381
204 3300028379 Ga0268266_10319078 Ga0268266_103190781 381
205 3300028380 Ga0268265_10004578 Ga0268265_100045788 381
206 3300028654 Ga0265322_10000068 Ga0265322_1000006820 381
207 3300031241 Ga0265325_10039960 Ga0265325_100399603 381
208 3300031241 Ga0265325_10077814 Ga0265325_100778141 381
209 3300031247 Ga0265340_10002223 Ga0265340_100022235 381
210 3300031247 Ga0265340_10018326 Ga0265340_100183263 381
211 3300031249 Ga0265339_10001551 Ga0265339_100015516 381
212 3300031344 Ga0265316_10003139 Ga0265316_1000313917 381
213 3300031595 Ga0265313_10000448 Ga0265313_1000044848 381
214 3300031595 Ga0265313_10020220 Ga0265313_100202203 381
215 3300031730 Ga0307516_10011659 Ga0307516_100116593 381
216 3300035083 Ga0373926_0035757 Ga0373926_0035757_53_1237 381
217 3300035692 Ga0373935_0118736 Ga0373935_0118736_236_1420 381
218 3300035695 Ga0373927_0035758 Ga0373927_0035758_165_1358 381
219 3300035725 Ga0373947_0021014 Ga0373947_0021014_356_1546 381
220 3300036401 Ga0373937_0031797 Ga0373937_0031797_986_2188 381
221 3300036712 Ga0316584_0156634 Ga0316584_0156634_254_1426 381
222 3300037853 Ga0436364_0010042 Ga0436364_0010042_44232_45413 381
223 3300037853 Ga0436364_0685371 Ga0436364_0685371_50953_52143 381
224 3300039062 Ga0400483_236881 Ga0400483_236881_2995_4164 381
225 3300039437 Ga0436365_0831867 Ga0436365_0831867_73_1263 381
226 3300039438 Ga0436360_0064987 Ga0436360_0064987_1216_2397 381
227 3300039447 Ga0436361_0349975 Ga0436361_0349975_464_1660 381
228 3300039453 Ga0436362_0969859 Ga0436362_0969859_979_2160 381
229 3300046460 Ga0495638_0003543 Ga0495638_0003543_5252_6433 381
230 3300046472 Ga0495580_0072748 Ga0495580_0072748_517_1701 381
231 3300046512 Ga0495610_0013771 Ga0495610_0013771_2007_3188 381
232 3300046691 Ga0495670_0022015 Ga0495670_0022015_794_2002 381
233 3300048903 Ga0496100_0249835 Ga0496100_0249835_55_1224 381
234 3300048905 Ga0496102_0039194 Ga0496102_0039194_1769_2938 381
235 3300048907 Ga0496104_0001490 Ga0496104_0001490_18457_19626 381
236 3300048907 Ga0496104_0003654 Ga0496104_0003654_1876_3045 381
237 3300048908 Ga0496105_0002850 Ga0496105_0002850_5916_7085 381
238 3300048908 Ga0496105_0051925 Ga0496105_0051925_570_1739 381
239 3300048909 Ga0496106_0011468 Ga0496106_0011468_1148_2317 381
240 3300048911 Ga0496108_0003952 Ga0496108_0003952_6953_8122 381
241 3300048912 Ga0496109_0004749 Ga0496109_0004749_122_1291 381
242 3300048913 Ga0496110_0017309 Ga0496110_0017309_1023_2192 381
243 3300048913 Ga0496110_0035124 Ga0496110_0035124_1023_2192 381
244 3300048914 Ga0496111_0000718 Ga0496111_0000718_5428_6597 381
245 3300048914 Ga0496111_0020182 Ga0496111_0020182_1676_2845 381
246 3300048915 Ga0496112_0098480 Ga0496112_0098480_142_1329 381
247 3300048916 Ga0496113_0014258 Ga0496113_0014258_2568_3737 381
248 3300048917 Ga0496114_0016673 Ga0496114_0016673_1287_2456 381
249 3300048918 Ga0496115_0042790 Ga0496115_0042790_19_1188 381
250 3300048921 Ga0496118_0055136 Ga0496118_0055136_1008_2195 381
251 3300048922 Ga0496119_0001398 Ga0496119_0001398_6037_7245 381
252 3300048924 Ga0496121_0070628 Ga0496121_0070628_1310_2497 381
253 3300048925 Ga0496122_0001032 Ga0496122_0001032_24200_25408 381
254 3300048926 Ga0496123_0000806 Ga0496123_0000806_24036_25244 381
255 3300049569 Ga0501032_0081690 Ga0501032_0081690_497_1699 381
256 3300049570 Ga0501033_0016486 Ga0501033_0016486_2984_4186 381
257 3300049572 Ga0501036_0129714 Ga0501036_0129714_463_1650 381
258 3300049574 Ga0501038_0076939 Ga0501038_0076939_800_2002 381
259 3300049574 Ga0501038_0095692 Ga0501038_0095692_450_1631 381
260 3300049575 Ga0501039_0162768 Ga0501039_0162768_31_1200 381
261 3300049576 Ga0501040_0013655 Ga0501040_0013655_3743_4945 381
262 3300049576 Ga0501040_0041823 Ga0501040_0041823_964_2133 381
263 3300049576 Ga0501040_0209081 Ga0501040_0209081_113_1282 381
264 3300049577 Ga0501041_0078819 Ga0501041_0078819_258_1460 381
265 3300049577 Ga0501041_0103783 Ga0501041_0103783_380_1549 381
266 3300049578 Ga0501042_0007935 Ga0501042_0007935_661_1863 381
267 3300049579 Ga0501043_0010338 Ga0501043_0010338_4368_5570 381
268 3300049580 Ga0501046_0074525 Ga0501046_0074525_522_1724 381
269 3300049581 Ga0501047_0141056 Ga0501047_0141056_896_2101 381
270 3300049581 Ga0501047_0180580 Ga0501047_0180580_409_1590 381
271 3300049581 Ga0501047_0202112 Ga0501047_0202112_187_1374 381
272 3300049582 Ga0501048_0115145 Ga0501048_0115145_75_1277 381
273 3300049583 Ga0501067_0062591 Ga0501067_0062591_267_1436 381
274 3300049587 Ga0501071_0250773 Ga0501071_0250773_91_1269 381
275 3300049588 Ga0501072_0009532 Ga0501072_0009532_5103_6305 381
276 3300049589 Ga0501073_0021727 Ga0501073_0021727_2283_3488 381
277 3300049590 Ga0501074_0028354 Ga0501074_0028354_1675_2844 381
278 3300049591 Ga0501075_0005275 Ga0501075_0005275_1557_2759 381
279 3300049592 Ga0501076_0025489 Ga0501076_0025489_2355_3524 381
280 3300049741 Ga0501079_0016277 Ga0501079_0016277_157_1326 381
281 3300049741 Ga0501079_0035052 Ga0501079_0035052_997_2199 381
282 3300049742 Ga0501080_0089934 Ga0501080_0089934_744_1913 381
283 3300049742 Ga0501080_0103359 Ga0501080_0103359_1396_2589 381
284 3300049742 Ga0501080_0110525 Ga0501080_0110525_608_1813 381
285 3300049743 Ga0501081_0103416 Ga0501081_0103416_427_1596 381
286 3300049744 Ga0501083_0083711 Ga0501083_0083711_545_1747 381
287 3300049824 Ga0501045_0178045 Ga0501045_0178045_91_1260 381
288 3300050490 nmdc:mga03n38_33757_c1 nmdc:mga03n38_33757_c1_281_1450 381
289 3300050494 nmdc:mga06z11_35768_c1 nmdc:mga06z11_35768_c1_555_1724 381
290 3300050495 nmdc:mga04h51_971_c1 nmdc:mga04h51_971_c1_50_1219 381
291 3300050507 nmdc:mga05p37_156440_c1 nmdc:mga05p37_156440_c1_531_1700 381
292 3300050507 nmdc:mga05p37_313720_c1 nmdc:mga05p37_313720_c1_315_1484 381
293 3300050507 nmdc:mga05p37_82638_c1 nmdc:mga05p37_82638_c1_963_2132 381
294 3300050508 nmdc:mga09592_29249_c1 nmdc:mga09592_29249_c1_555_1724 381
295 3300050509 nmdc:mga0qj67_35336_c1 nmdc:mga0qj67_35336_c1_629_1798 381
296 3300050509 nmdc:mga0qj67_7547_c1 nmdc:mga0qj67_7547_c1_5421_6590 381
297 3300050510 nmdc:mga06r32_1985_c1 nmdc:mga06r32_1985_c1_2329_3498 381
298 3300050510 nmdc:mga06r32_52676_c1 nmdc:mga06r32_52676_c1_559_1728 381
299 3300050510 nmdc:mga06r32_55613_c1 nmdc:mga06r32_55613_c1_613_1782 381
300 3300053104 Ga0500556_0000068 Ga0500556_0000068_96366_97574 381
301 3300053139 Ga0500568_0044613 Ga0500568_0044613_173_1339 381
302 3300054114 Ga0501084_0012288 Ga0501084_0012288_1210_2412 381
303 3300054114 Ga0501084_0019577 Ga0501084_0019577_4311_5480 381
304 3300060353 Ga0501082_0096097 Ga0501082_0096097_769_1938 381
305 3300061734 Ga0530510_0073466 Ga0530510_0073466_717_1919 381
306 iso_pu_bacteria 2909042592 2909046428 381
307 iso_pu_bacteria 8001845381 8001845965 381
308 3300005530 Ga0070679_100041157 Ga0070679_1000411573 382
309 3300005563 Ga0068855_100053133 Ga0068855_1000531332 382
310 3300005983 Ga0081540_1010027 Ga0081540_10100273 382
311 3300005985 Ga0081539_10000609 Ga0081539_1000060941 382
312 3300009093 Ga0105240_10104652 Ga0105240_101046523 382
313 3300009094 Ga0111539_10507537 Ga0111539_105075371 382
314 3300013100 Ga0157373_10173325 Ga0157373_101733252 382
315 3300020082 Ga0206353_11955115 Ga0206353_119551152 382
316 3300021361 Ga0213872_10063372 Ga0213872_100633722 382
317 3300021384 Ga0213876_10000915 Ga0213876_100009155 382
318 3300021384 Ga0213876_10072220 Ga0213876_100722202 382
319 3300021388 Ga0213875_10006561 Ga0213875_100065611 382
320 3300021441 Ga0213871_10011082 Ga0213871_100110822 382
321 3300025294 Ga0209025_1003608 Ga0209025_100360811 382
322 3300025294 Ga0209025_1015789 Ga0209025_10157893 382
323 3300025909 Ga0207705_10105819 Ga0207705_101058191 382
324 3300025912 Ga0207707_10018671 Ga0207707_100186715 382
325 3300025921 Ga0207652_10066221 Ga0207652_100662213 382
326 3300031241 Ga0265325_10001708 Ga0265325_100017088 382
327 3300031456 Ga0307513_10078364 Ga0307513_100783642 382
328 3300031595 Ga0265313_10020466 Ga0265313_100204662 382
329 3300031616 Ga0307508_10076676 Ga0307508_100766764 382
330 3300031711 Ga0265314_10034245 Ga0265314_100342452 382
331 3300033180 Ga0307510_10045718 Ga0307510_100457181 382
332 3300035119 Ga0373956_0001924 Ga0373956_0001924_5620_6801 382
333 3300035120 Ga0373957_0040217 Ga0373957_0040217_52_1233 382
334 3300035410 Ga0373924_0008451 Ga0373924_0008451_599_1780 382
335 3300035692 Ga0373935_0016237 Ga0373935_0016237_264_1445 382
336 3300035724 Ga0373933_0002515 Ga0373933_0002515_2372_3553 382
337 3300036647 Ga0316582_0048188 Ga0316582_0048188_1214_2395 382
338 3300037853 Ga0436364_0549528 Ga0436364_0549528_2293_3474 382
339 3300039437 Ga0436365_0167783 Ga0436365_0167783_17405_18586 382
340 3300039437 Ga0436365_0536235 Ga0436365_0536235_7441_8622 382
341 3300039437 Ga0436365_0693504 Ga0436365_0693504_35121_36302 382
342 3300039447 Ga0436361_0301719 Ga0436361_0301719_490_1683 382
343 3300039447 Ga0436361_1209447 Ga0436361_1209447_280_1464 382
344 3300039450 Ga0436363_0573820 Ga0436363_0573820_2385_3566 382
345 3300039450 Ga0436363_0715384 Ga0436363_0715384_1027_2472 382
346 3300039450 Ga0436363_1484825 Ga0436363_1484825_135_1316 382
347 3300039450 Ga0436363_1547701 Ga0436363_1547701_1789_2973 382
348 3300044735 Ga0466968_0002176 Ga0466968_0002176_4335_5516 382
349 3300044735 Ga0466968_0005181 Ga0466968_0005181_102_1289 382
350 3300044901 Ga0466960_0037682 Ga0466960_0037682_931_2112 382
351 3300045976 Ga0466967_0188526 Ga0466967_0188526_655_1854 382
352 3300046459 Ga0495629_0012044 Ga0495629_0012044_4646_5827 382
353 3300046462 Ga0495651_0003394 Ga0495651_0003394_2471_3652 382
354 3300046463 Ga0495653_0004556 Ga0495653_0004556_9440_10621 382
355 3300046473 Ga0495582_0047458 Ga0495582_0047458_625_1806 382
356 3300046511 Ga0495608_0002249 Ga0495608_0002249_9560_10741 382
357 3300046514 Ga0495618_0001172 Ga0495618_0001172_9167_10348 382
358 3300046516 Ga0495628_0034175 Ga0495628_0034175_2473_3654 382
359 3300046529 Ga0495652_0004437 Ga0495652_0004437_1387_2568 382
360 3300046533 Ga0495640_0005042 Ga0495640_0005042_64_1245 382
361 3300046536 Ga0495587_0021831 Ga0495587_0021831_830_2011 382
362 3300046559 Ga0495667_0044894 Ga0495667_0044894_1202_2383 382
363 3300046642 Ga0495634_0007035 Ga0495634_0007035_6062_7243 382
364 3300046663 Ga0495635_0005384 Ga0495635_0005384_2383_3564 382
365 3300046675 Ga0495657_0025526 Ga0495657_0025526_1882_3063 382
366 3300046679 Ga0495623_0011358 Ga0495623_0011358_4544_5725 382
367 3300046680 Ga0495646_0006441 Ga0495646_0006441_2750_3931 382
368 3300046689 Ga0495613_0091243 Ga0495613_0091243_47_1228 382
369 3300046809 Ga0495600_0001574 Ga0495600_0001574_1345_2526 382
370 3300047317 Ga0495604_0000150 Ga0495604_0000150_45222_46403 382
371 3300047319 Ga0495674_0040568 Ga0495674_0040568_1969_3150 382
372 3300047321 Ga0495676_0016306 Ga0495676_0016306_3946_5127 382
373 3300047322 Ga0495680_0000699 Ga0495680_0000699_23153_24334 382
374 3300047444 Ga0495675_0007130 Ga0495675_0007130_4986_6167 382
375 3300048907 Ga0496104_0006182 Ga0496104_0006182_5738_6919 382
376 3300048908 Ga0496105_0003480 Ga0496105_0003480_4393_5574 382
377 3300048909 Ga0496106_0206710 Ga0496106_0206710_207_1388 382
378 3300048911 Ga0496108_0005160 Ga0496108_0005160_3814_4995 382
379 3300048912 Ga0496109_0003935 Ga0496109_0003935_4035_5216 382
380 3300048913 Ga0496110_0000113 Ga0496110_0000113_2229_3410 382
381 3300048914 Ga0496111_0000458 Ga0496111_0000458_14295_15476 382
382 3300048915 Ga0496112_0019676 Ga0496112_0019676_2840_4021 382
383 3300048915 Ga0496112_0301066 Ga0496112_0301066_198_1379 382
384 3300048916 Ga0496113_0002796 Ga0496113_0002796_8831_10012 382
385 3300048918 Ga0496115_0014819 Ga0496115_0014819_1110_2291 382
386 3300048926 Ga0496123_0051165 Ga0496123_0051165_895_2079 382
387 3300049569 Ga0501032_0017280 Ga0501032_0017280_3690_4871 382
388 3300049569 Ga0501032_0073694 Ga0501032_0073694_611_1792 382
389 3300049569 Ga0501032_0086333 Ga0501032_0086333_241_1422 382
390 3300049569 Ga0501032_0142155 Ga0501032_0142155_153_1334 382
391 3300049570 Ga0501033_0023537 Ga0501033_0023537_1854_3035 382
392 3300049570 Ga0501033_0120707 Ga0501033_0120707_226_1407 382
393 3300049571 Ga0501034_0002653 Ga0501034_0002653_11878_13059 382
394 3300049571 Ga0501034_0014877 Ga0501034_0014877_6597_7778 382
395 3300049571 Ga0501034_0020143 Ga0501034_0020143_554_1735 382
396 3300049571 Ga0501034_0030547 Ga0501034_0030547_353_1534 382
397 3300049571 Ga0501034_0049137 Ga0501034_0049137_1223_2404 382
398 3300049571 Ga0501034_0083119 Ga0501034_0083119_631_1812 382
399 3300049571 Ga0501034_0097390 Ga0501034_0097390_547_1749 382
400 3300049571 Ga0501034_0391603 Ga0501034_0391603_58_1257 382
401 3300049572 Ga0501036_0001536 Ga0501036_0001536_14092_15273 382
402 3300049572 Ga0501036_0003303 Ga0501036_0003303_8622_9803 382
403 3300049572 Ga0501036_0058034 Ga0501036_0058034_959_2140 382
404 3300049572 Ga0501036_0107592 Ga0501036_0107592_447_1628 382
405 3300049572 Ga0501036_0143885 Ga0501036_0143885_273_1454 382
406 3300049573 Ga0501037_0039910 Ga0501037_0039910_332_1513 382
407 3300049573 Ga0501037_0043039 Ga0501037_0043039_435_1748 382
408 3300049573 Ga0501037_0160884 Ga0501037_0160884_79_1260 382
409 3300049573 Ga0501037_0188373 Ga0501037_0188373_218_1399 382
410 3300049574 Ga0501038_0009911 Ga0501038_0009911_2142_3323 382
411 3300049574 Ga0501038_0019076 Ga0501038_0019076_4143_5324 382
412 3300049574 Ga0501038_0035281 Ga0501038_0035281_3121_4302 382
413 3300049574 Ga0501038_0079017 Ga0501038_0079017_899_2080 382
414 3300049575 Ga0501039_0024279 Ga0501039_0024279_110_1291 382
415 3300049575 Ga0501039_0039572 Ga0501039_0039572_2098_3279 382
416 3300049575 Ga0501039_0143449 Ga0501039_0143449_642_1823 382
417 3300049575 Ga0501039_0163233 Ga0501039_0163233_514_1695 382
418 3300049576 Ga0501040_0027140 Ga0501040_0027140_2523_3704 382
419 3300049577 Ga0501041_0031061 Ga0501041_0031061_1477_2658 382
420 3300049578 Ga0501042_0199105 Ga0501042_0199105_173_1354 382
421 3300049579 Ga0501043_0000736 Ga0501043_0000736_21917_23098 382
422 3300049579 Ga0501043_0105872 Ga0501043_0105872_600_1781 382
423 3300049579 Ga0501043_0180562 Ga0501043_0180562_83_1264 382
424 3300049579 Ga0501043_0196328 Ga0501043_0196328_33_1214 382
425 3300049580 Ga0501046_0030399 Ga0501046_0030399_331_1512 382
426 3300049580 Ga0501046_0116631 Ga0501046_0116631_447_1628 382
427 3300049581 Ga0501047_0000124 Ga0501047_0000124_4057_5238 382
428 3300049581 Ga0501047_0029328 Ga0501047_0029328_148_1329 382
429 3300049581 Ga0501047_0043610 Ga0501047_0043610_556_1737 382
430 3300049581 Ga0501047_0096714 Ga0501047_0096714_769_1962 382
431 3300049581 Ga0501047_0199073 Ga0501047_0199073_554_1735 382
432 3300049581 Ga0501047_0223703 Ga0501047_0223703_514_1695 382
433 3300049583 Ga0501067_0001307 Ga0501067_0001307_4893_6071 382
434 3300049583 Ga0501067_0004048 Ga0501067_0004048_79_1257 382
435 3300049583 Ga0501067_0045980 Ga0501067_0045980_91_1272 382
436 3300049584 Ga0501068_0020629 Ga0501068_0020629_595_1776 382
437 3300049584 Ga0501068_0036089 Ga0501068_0036089_455_1636 382
438 3300049584 Ga0501068_0063858 Ga0501068_0063858_810_1991 382
439 3300049584 Ga0501068_0071661 Ga0501068_0071661_314_1495 382
440 3300049586 Ga0501070_0000229 Ga0501070_0000229_34426_35619 382
441 3300049586 Ga0501070_0005227 Ga0501070_0005227_9366_10547 382
442 3300049586 Ga0501070_0050657 Ga0501070_0050657_98_1279 382
443 3300049586 Ga0501070_0078669 Ga0501070_0078669_182_1363 382
444 3300049586 Ga0501070_0155796 Ga0501070_0155796_235_1416 382
445 3300049587 Ga0501071_0220436 Ga0501071_0220436_198_1379 382
446 3300049588 Ga0501072_0002828 Ga0501072_0002828_2853_4034 382
447 3300049588 Ga0501072_0085666 Ga0501072_0085666_635_1816 382
448 3300049589 Ga0501073_0010790 Ga0501073_0010790_76_1257 382
449 3300049589 Ga0501073_0069535 Ga0501073_0069535_769_1950 382
450 3300049589 Ga0501073_0077738 Ga0501073_0077738_1095_2276 382
451 3300049589 Ga0501073_0129309 Ga0501073_0129309_20_1201 382
452 3300049590 Ga0501074_0023598 Ga0501074_0023598_1410_2603 382
453 3300049590 Ga0501074_0160520 Ga0501074_0160520_341_1522 382
454 3300049591 Ga0501075_0114962 Ga0501075_0114962_113_1294 382
455 3300049592 Ga0501076_0006327 Ga0501076_0006327_5228_6409 382
456 3300049593 Ga0501077_0098593 Ga0501077_0098593_621_1799 382
457 3300049741 Ga0501079_0042222 Ga0501079_0042222_986_2167 382
458 3300049741 Ga0501079_0065430 Ga0501079_0065430_1575_2756 382
459 3300049742 Ga0501080_0000130 Ga0501080_0000130_21258_22439 382
460 3300049742 Ga0501080_0007746 Ga0501080_0007746_1708_2907 382
461 3300049742 Ga0501080_0016328 Ga0501080_0016328_3676_4857 382
462 3300049742 Ga0501080_0027681 Ga0501080_0027681_1019_2200 382
463 3300049742 Ga0501080_0043335 Ga0501080_0043335_436_1617 382
464 3300049742 Ga0501080_0149062 Ga0501080_0149062_649_1830 382
465 3300049742 Ga0501080_0367428 Ga0501080_0367428_27_1208 382
466 3300049743 Ga0501081_0003672 Ga0501081_0003672_6798_7979 382
467 3300049744 Ga0501083_0000480 Ga0501083_0000480_8224_9405 382
468 3300049744 Ga0501083_0011760 Ga0501083_0011760_3134_4315 382
469 3300049744 Ga0501083_0077118 Ga0501083_0077118_939_2120 382
470 3300049744 Ga0501083_0087651 Ga0501083_0087651_494_1675 382
471 3300049822 Ga0501035_0000373 Ga0501035_0000373_24789_25982 382
472 3300049822 Ga0501035_0004040 Ga0501035_0004040_8391_9572 382
473 3300049822 Ga0501035_0164738 Ga0501035_0164738_502_1683 382
474 3300049822 Ga0501035_0180185 Ga0501035_0180185_502_1683 382
475 3300049822 Ga0501035_0210966 Ga0501035_0210966_177_1370 382
476 3300049823 Ga0501044_0023125 Ga0501044_0023125_2213_3394 382
477 3300049823 Ga0501044_0039770 Ga0501044_0039770_1335_2516 382
478 3300049823 Ga0501044_0060321 Ga0501044_0060321_1812_3005 382
479 3300049823 Ga0501044_0075405 Ga0501044_0075405_302_1483 382
480 3300049823 Ga0501044_0135969 Ga0501044_0135969_52_1233 382
481 3300049823 Ga0501044_0228418 Ga0501044_0228418_394_1575 382
482 3300049824 Ga0501045_0104871 Ga0501045_0104871_571_1752 382
483 3300050510 nmdc:mga06r32_86904_c1 nmdc:mga06r32_86904_c1_259_1440 382
484 3300053078 Ga0495612_0010743 Ga0495612_0010743_1314_2495 382
485 3300053084 Ga0495595_0000221 Ga0495595_0000221_13180_14361 382
486 3300053093 Ga0500651_0118691 Ga0500651_0118691_179_1363 382
487 3300053093 Ga0500651_0144565 Ga0500651_0144565_104_1285 382
488 3300053134 Ga0500658_0078164 Ga0500658_0078164_117_1298 382
489 3300053153 Ga0500616_0000001 Ga0500616_0000001_704452_705633 382
490 3300053730 Ga0500645_000051 Ga0500645_000051_48125_49306 382
491 3300054114 Ga0501084_0009054 Ga0501084_0009054_1075_2256 382
492 3300054114 Ga0501084_0024425 Ga0501084_0024425_2379_3560 382
493 3300054114 Ga0501084_0072722 Ga0501084_0072722_1690_2868 382
494 3300054114 Ga0501084_0130091 Ga0501084_0130091_234_1415 382
495 3300060353 Ga0501082_0000046 Ga0501082_0000046_797_1978 382
496 3300060353 Ga0501082_0006510 Ga0501082_0006510_8735_9916 382
497 3300060353 Ga0501082_0015911 Ga0501082_0015911_4152_5333 382
498 iso_pu_bacteria 2842694124 2842696661 382
499 iso_pu_bacteria 2503198000 2503199982 383
500 iso_pu_bacteria 2508501123 2509118504 383
501 iso_pu_bacteria 2508501127 2509142568 383
502 iso_pu_bacteria 2510065059 2510319275 383
503 iso_pu_bacteria 2512875016 2512932550 383
504 iso_pu_bacteria 2512875024 2512960567 383
505 iso_pu_bacteria 2513237090 2513608662 383
506 iso_pu_bacteria 2513237164 2514036343 383
507 iso_pu_bacteria 2513237305 2514416476 383
508 iso_pu_bacteria 2513237351 2514587561 383
509 iso_pu_bacteria 2599185301 2599936418 383
510 iso_pu_bacteria 2643221550 2643774394 383
511 iso_pu_bacteria 2643221551 2643776549 383
512 iso_pu_bacteria 2643221555 2643794996 383
513 iso_pu_bacteria 2643221564 2643839080 383
514 iso_pu_bacteria 2643221595 2643984857 383
515 iso_pu_bacteria 2643221623 2644133233 383
516 iso_pu_bacteria 2643221627 2644153187 383
517 iso_pu_bacteria 2687453392 2688597228 383
518 iso_pu_bacteria 2693429783 2694628708 383
519 iso_pu_bacteria 2693429784 2694637378 383
520 iso_pu_bacteria 2721755686 2723574432 383
521 iso_pu_bacteria 2738543024 2739307505 383
522 iso_pu_bacteria 2756170246 2756671519 383
523 iso_pu_bacteria 2767802442 2770198996 383
524 iso_pu_bacteria 2775506904 2776285006 383
525 iso_pu_bacteria 2791355123 2792747984 383
526 iso_pu_bacteria 2839993093 2839998288 383
527 iso_pu_bacteria 2840764183 2840769124 383
528 iso_pu_bacteria 2844002411 2844008570 383
529 iso_pu_bacteria 2844009547 2844012609 383
530 iso_pu_bacteria 2847670302 2847675025 383
531 iso_pu_bacteria 2856314179 2856320743 383
532 iso_pu_bacteria 2856320880 2856323089 383
533 iso_pu_bacteria 2856328259 2856334849 383
534 iso_pu_bacteria 2856334872 2856341600 383
535 iso_pu_bacteria 2856342000 2856347358 383
536 iso_pu_bacteria 2856349417 2856354141 383
537 iso_pu_bacteria 2856356410 2856360380 383
538 iso_pu_bacteria 2856364286 2856368050 383
539 iso_pu_bacteria 2857349434 2857351802 383
540 iso_pu_bacteria 2857367948 2857373939 383
541 iso_pu_bacteria 2869162929 2869163818 383
542 iso_pu_bacteria 2869169390 2869172420 383
543 iso_pu_bacteria 2869234852 2869237045 383
544 iso_pu_bacteria 2869242130 2869246822 383
545 iso_pu_bacteria 2869249662 2869251577 383
546 iso_pu_bacteria 2869256925 2869260114 383
547 iso_pu_bacteria 2869264136 2869271085 383
548 iso_pu_bacteria 2869271264 2869277757 383
549 iso_pu_bacteria 2869278585 2869282640 383
550 iso_pu_bacteria 2869285874 2869290331 383
551 iso_pu_bacteria 2871429161 2871432615 383
552 iso_pu_bacteria 2871435913 2871436934 383
553 iso_pu_bacteria 2871444079 2871444624 383
554 iso_pu_bacteria 2871451962 2871453800 383
555 iso_pu_bacteria 2871459585 2871461225 383
556 iso_pu_bacteria 2871466892 2871469073 383
557 iso_pu_bacteria 2871481445 2871483824 383
558 iso_pu_bacteria 2871488783 2871493233 383
559 iso_pu_bacteria 2871495908 2871496790 383
560 iso_pu_bacteria 2874102143 2874109129 383
561 iso_pu_bacteria 2874109183 2874116412 383
562 iso_pu_bacteria 2874116593 2874122773 383
563 iso_pu_bacteria 2874123672 2874124074 383
564 iso_pu_bacteria 2874131515 2874134519 383
565 iso_pu_bacteria 2874139085 2874142297 383
566 iso_pu_bacteria 2874146452 2874152582 383
567 iso_pu_bacteria 2874155637 2874159982 383
568 iso_pu_bacteria 2874162495 2874167973 383
569 iso_pu_bacteria 2874168670 2874174800 383
570 iso_pu_bacteria 2876363079 2876365198 383
571 iso_pu_bacteria 2876369609 2876375753 383
572 iso_pu_bacteria 2876377896 2876385897 383
573 iso_pu_bacteria 2876386047 2876387921 383
574 iso_pu_bacteria 2876392853 2876398010 383
575 iso_pu_bacteria 2876399893 2876402844 383
576 iso_pu_bacteria 2876406927 2876410510 383
577 iso_pu_bacteria 2876413966 2876418498 383
578 iso_pu_bacteria 2876420981 2876422971 383
579 iso_pu_bacteria 2878035449 2878035923 383
580 iso_pu_bacteria 2878730984 2878734848 383
581 iso_pu_bacteria 2878738818 2878744520 383
582 iso_pu_bacteria 2878745973 2878750229 383
583 iso_pu_bacteria 2878753008 2878757278 383
584 iso_pu_bacteria 2878760144 2878761014 383
585 iso_pu_bacteria 2878767105 2878767978 383
586 iso_pu_bacteria 2878774303 2878774962 383
587 iso_pu_bacteria 2878781027 2878784356 383
588 iso_pu_bacteria 2881147464 2881149908 383
589 iso_pu_bacteria 2881155292 2881161054 383
590 iso_pu_bacteria 2881161766 2881166789 383
591 iso_pu_bacteria 2881853255 2881857993 383
592 iso_pu_bacteria 2882632389 2882632549 383
593 iso_pu_bacteria 2882912400 2882916298 383
594 iso_pu_bacteria 2885305155 2885308305 383
595 iso_pu_bacteria 2885312484 2885312902 383
596 iso_pu_bacteria 2885318864 2885320514 383
597 iso_pu_bacteria 2885326080 2885330830 383
598 iso_pu_bacteria 2885334103 2885342487 383
599 iso_pu_bacteria 2885342637 2885345263 383
600 iso_pu_bacteria 2885350715 2885357264 383
601 iso_pu_bacteria 2888337043 2888338309 383
602 iso_pu_bacteria 2888343758 2888345914 383
603 iso_pu_bacteria 2888350351 2888355146 383
604 iso_pu_bacteria 2889010040 2889010125 383
605 iso_pu_bacteria 2889016732 2889018204 383
606 iso_pu_bacteria 2903448605 2903450198 383
607 iso_pu_bacteria 2903492973 2903501005 383
608 iso_pu_bacteria 2903492973 2903504447 383
609 iso_pu_bacteria 2903513507 2903518628 383
610 iso_pu_bacteria 2903521522 2903522067 383
611 iso_pu_bacteria 2903528002 2903528445 383
612 iso_pu_bacteria 2903540706 2903541586 383
613 iso_pu_bacteria 2904659560 2904664661 383
614 iso_pu_bacteria 2906308376 2906312587 383
615 iso_pu_bacteria 2906321335 2906325296 383
616 iso_pu_bacteria 2906328253 2906330694 383
617 iso_pu_bacteria 2906363423 2906369646 383
618 iso_pu_bacteria 2906370794 2906376953 383
619 iso_pu_bacteria 2906378014 2906383587 383
620 iso_pu_bacteria 2906386501 2906388710 383
621 iso_pu_bacteria 2906401398 2906403226 383
622 iso_pu_bacteria 2906408224 2906411340 383
623 iso_pu_bacteria 2906414383 2906419808 383
624 iso_pu_bacteria 2906427513 2906430842 383
625 iso_pu_bacteria 2922130491 2922134240 383
626 iso_pu_bacteria 2922151315 2922155911 383
627 iso_pu_bacteria 2922158528 2922158895 383
628 iso_pu_bacteria 2922172374 2922177608 383
629 iso_pu_bacteria 2922178524 2922181258 383
630 iso_pu_bacteria 2922185730 2922190392 383
631 iso_pu_bacteria 2924710171 2924711180 383
632 iso_pu_bacteria 2924718760 2924722799 383
633 iso_pu_bacteria 2924726620 2924731691 383
634 iso_pu_bacteria 2924733363 2924737891 383
635 iso_pu_bacteria 2924741084 2924747568 383
636 iso_pu_bacteria 2924748358 2924749714 383
637 iso_pu_bacteria 2924762789 2924768129 383
638 iso_pu_bacteria 2924776078 2924782550 383
639 iso_pu_bacteria 2924784321 2924786583 383
640 iso_pu_bacteria 2937813078 2937819268 383
641 iso_pu_bacteria 2937836603 2937842627 383
642 iso_pu_bacteria 2937848649 2937852014 383
643 iso_pu_bacteria 2937861824 2937862674 383
644 iso_pu_bacteria 2937868953 2937874647 383
645 iso_pu_bacteria 2937877337 2937881192 383
646 iso_pu_bacteria 2937972304 2937977283 383
647 iso_pu_bacteria 2937994558 2937995443 383
648 iso_pu_bacteria 2938014810 2938021119 383
649 iso_pu_bacteria 2958034702 2958039423 383
650 iso_pu_bacteria 2958041894 2958052948 383
651 iso_pu_bacteria 2958064165 2958064931 383
652 iso_pu_bacteria 2958071322 2958073774 383
653 iso_pu_bacteria 2958084443 2958088251 383
654 iso_pu_bacteria 2958092219 2958096770 383
655 iso_pu_bacteria 2958100919 2958102165 383
656 iso_pu_bacteria 2958108152 2958109805 383
657 iso_pu_bacteria 2958115193 2958115502 383
658 iso_pu_bacteria 2958122699 2958129807 383
659 iso_pu_bacteria 2958130278 2958134719 383
660 iso_pu_bacteria 2958137437 2958138847 383
661 iso_pu_bacteria 2958144490 2958147687 383
662 iso_pu_bacteria 2958158011 2958158856 383
663 iso_pu_bacteria 2958165035 2958165916 383
664 iso_pu_bacteria 2958172287 2958175237 383
665 iso_pu_bacteria 2958179912 2958186526 383
666 iso_pu_bacteria 2961077736 2961085025 383
667 iso_pu_bacteria 2961114664 2961119659 383
668 iso_pu_bacteria 2961136820 2961139811 383
669 iso_pu_bacteria 2961163497 2961164379 383
670 iso_pu_bacteria 2961170736 2961175393 383
671 iso_pu_bacteria 2961183825 2961184383 383
672 iso_pu_bacteria 2963644680 2963646653 383
673 iso_pu_bacteria 2965018300 2965019365 383
674 iso_pu_bacteria 2965025482 2965027604 383
675 iso_pu_bacteria 2965032056 2965036274 383
676 iso_pu_bacteria 2965040258 2965043313 383
677 iso_pu_bacteria 2965047637 2965051529 383
678 iso_pu_bacteria 2965089291 2965093495 383
679 iso_pu_bacteria 2965110997 2965116048 383
680 iso_pu_bacteria 2965119406 2965126585 383
681 iso_pu_bacteria 2967996073 2967999605 383
682 iso_pu_bacteria 2968003550 2968007963 383
683 iso_pu_bacteria 2968016561 2968020750 383
684 iso_pu_bacteria 2968083720 2968090554 383
685 iso_pu_bacteria 2968091066 2968094760 383
686 iso_pu_bacteria 2968097103 2968099329 383
687 iso_pu_bacteria 2968110612 2968115914 383
688 iso_pu_bacteria 2968117919 2968119299 383
689 iso_pu_bacteria 2968128360 2968133670 383
690 iso_pu_bacteria 2968138860 2968146532 383
691 iso_pu_bacteria 2968171901 2968172780 383
692 iso_pu_bacteria 2970469710 2970474047 383
693 iso_pu_bacteria 2970489779 2970490687 383
694 iso_pu_bacteria 2970503327 2970507981 383
695 iso_pu_bacteria 2970510686 2970515314 383
696 iso_pu_bacteria 2970524798 2970527367 383
697 iso_pu_bacteria 2970532167 2970534292 383
698 iso_pu_bacteria 2970547951 2970552305 383
699 iso_pu_bacteria 2970554993 2970555872 383
700 iso_pu_bacteria 2970593180 2970597249 383
701 iso_pu_bacteria 2970619444 2970622761 383
702 iso_pu_bacteria 2970627176 2970632723 383
703 iso_pu_bacteria 2977821940 2977826437 383
704 iso_pu_bacteria 2977828996 2977832671 383
705 iso_pu_bacteria 2977843712 2977848375 383
706 iso_pu_bacteria 2977851361 2977855579 383
707 iso_pu_bacteria 2977858184 2977860920 383
708 iso_pu_bacteria 2977864932 2977865158 383
709 iso_pu_bacteria 2977872689 2977880121 383
710 iso_pu_bacteria 2977898635 2977899141 383
711 iso_pu_bacteria 2977907340 2977910146 383
712 iso_pu_bacteria 2977915119 2977918109 383
713 iso_pu_bacteria 2977922695 2977922971 383
714 iso_pu_bacteria 2977935797 2977940314 383
715 iso_pu_bacteria 2977942078 2977944747 383
716 iso_pu_bacteria 2977950692 2977953129 383
717 iso_pu_bacteria 2977957713 2977962313 383
718 iso_pu_bacteria 2977971508 2977976051 383
719 iso_pu_bacteria 2977986579 2977990136 383
720 iso_pu_bacteria 2979710463 2979715116 383
721 iso_pu_bacteria 2979742915 2979749048 383
722 iso_pu_bacteria 2979764755 2979766347 383
723 iso_pu_bacteria 2979772303 2979776139 383
724 iso_pu_bacteria 2979779861 2979785309 383
725 iso_pu_bacteria 2979808191 2979813165 383
726 iso_pu_bacteria 2987636660 2987638986 383
727 iso_pu_bacteria 2987645492 2987647979 383
728 iso_pu_bacteria 2987652177 2987653665 383
729 iso_pu_bacteria 2987659509 2987660383 383
730 iso_pu_bacteria 2987666974 2987671449 383
731 iso_pu_bacteria 2987673487 2987675405 383
732 iso_pu_bacteria 2996310559 2996312096 383
733 iso_pu_bacteria 2996336353 2996338721 383
734 iso_pu_bacteria 2996341866 2996344256 383
735 iso_pu_bacteria 2996348954 2996352633 383
736 iso_pu_bacteria 2996386984 2996390013 383
737 iso_pu_bacteria 3000135777 3000139616 383
738 iso_pu_bacteria 3004167301 3004167645 383
739 iso_pu_bacteria 3004188549 3004189434 383
740 iso_pu_bacteria 3004195979 3004199810 383
741 iso_pu_bacteria 3004203850 3004204771 383
742 iso_pu_bacteria 3004211236 3004218048 383
743 iso_pu_bacteria 3004218560 3004220905 383
744 iso_pu_bacteria 3004232784 3004235701 383
745 iso_pu_bacteria 3004239961 3004245301 383
746 iso_pu_bacteria 3004275668 3004279315 383
747 iso_pu_bacteria 3004334049 3004335750 383
748 iso_pu_bacteria 637000159 637075644 383
749 iso_pu_bacteria 649633066 649871782 383
750 iso_pu_bacteria 8002285264 8002291657 383
751 iso_pu_bacteria 8004300914 8004303897 383
752 iso_pu_bacteria 8004312739 8004321191 383
753 iso_pu_bacteria 8004361976 8004363745 383
754 iso_pu_bacteria 8004374579 8004378853 383
755 iso_pu_bacteria 8004387939 8004392537 383
756 iso_pu_bacteria 8004395343 8004395855 383
757 iso_pu_bacteria 8004445564 8004446516 383
758 iso_pu_bacteria 8004633249 8004635419 383
759 iso_pu_bacteria 8004640170 8004645139 383
760 iso_pu_bacteria 8004703790 8004712066 383
761 iso_pu_bacteria 8004714634 8004718846 383
762 iso_pu_bacteria 8004727605 8004730422 383
763 iso_pu_bacteria 8055617313 8055619461 383
764 3300002067 JGI24735J21928_10031910 JGI24735J21928_100319102 387
765 3300002705 JGI25156J39149_1007095 JGI25156J39149_10070952 387
766 3300002741 JGI25157J39369_1000706 JGI25157J39369_10007063 387
767 3300003214 JGI25165J46597_1000042 JGI25165J46597_1000042152 387
768 3300003762 Ga0055542_1000761 Ga0055542_100076112 387
769 3300005459 Ga0068867_100162151 Ga0068867_1001621511 387
770 3300005539 Ga0068853_100014287 Ga0068853_1000142873 387
771 3300005548 Ga0070665_100026701 Ga0070665_1000267012 387
772 3300005548 Ga0070665_100054407 Ga0070665_1000544074 387
773 3300005548 Ga0070665_100169391 Ga0070665_1001693912 387
774 3300005616 Ga0068852_100198937 Ga0068852_1001989372 387
775 3300005985 Ga0081539_10021387 Ga0081539_100213873 387
776 3300006178 Ga0075367_10058724 Ga0075367_100587242 387
777 3300009093 Ga0105240_10016012 Ga0105240_100160124 387
778 3300009551 Ga0105238_10012662 Ga0105238_100126629 387
779 3300015262 Ga0182007_10012507 Ga0182007_100125073 387
780 3300025250 Ga0209026_1000029 Ga0209026_1000029176 387
781 3300025254 Ga0209148_1000080 Ga0209148_1000080119 387
782 3300025256 Ga0209759_1000040 Ga0209759_100004030 387
783 3300025261 Ga0209233_1000028 Ga0209233_1000028444 387
784 3300025261 Ga0209233_1003389 Ga0209233_10033896 387
785 3300025272 Ga0209455_1000171 Ga0209455_100017136 387
786 3300025297 Ga0209758_1004860 Ga0209758_100486011 387
787 3300025913 Ga0207695_10195990 Ga0207695_101959902 387
788 3300026078 Ga0207702_10283613 Ga0207702_102836131 387
789 3300026142 Ga0207698_10019455 Ga0207698_100194552 387
790 3300037418 Ga0395900_0340203 Ga0395900_0340203_272_1456 387
791 3300046460 Ga0495638_0054870 Ga0495638_0054870_152_1336 387
792 3300046522 Ga0495643_0092242 Ga0495643_0092242_282_1472 387
793 3300046660 Ga0495625_0038244 Ga0495625_0038244_547_1731 387
794 3300047472 Ga0495686_0069331 Ga0495686_0069331_215_1402 387
795 3300048905 Ga0496102_0199713 Ga0496102_0199713_679_1863 387
796 3300048921 Ga0496118_0111385 Ga0496118_0111385_185_1369 387
797 3300048923 Ga0496120_0001370 Ga0496120_0001370_18304_19488 387
798 3300048924 Ga0496121_0115011 Ga0496121_0115011_735_1919 387
799 3300048928 Ga0496125_0104048 Ga0496125_0104048_322_1506 387
800 3300049568 Ga0501031_0005116 Ga0501031_0005116_4814_6001 387
801 3300049570 Ga0501033_0185071 Ga0501033_0185071_19_1209 387
802 3300049571 Ga0501034_0004312 Ga0501034_0004312_8850_10046 387
803 3300049578 Ga0501042_0010639 Ga0501042_0010639_4166_5353 387
804 3300049580 Ga0501046_0007945 Ga0501046_0007945_5716_6903 387
805 3300049581 Ga0501047_0012748 Ga0501047_0012748_4081_5268 387
806 3300049582 Ga0501048_0008611 Ga0501048_0008611_5344_6531 387
807 3300049584 Ga0501068_0008727 Ga0501068_0008727_106_1293 387
808 3300049585 Ga0501069_0075408 Ga0501069_0075408_109_1296 387
809 3300049586 Ga0501070_0010861 Ga0501070_0010861_1167_2357 387
810 3300049587 Ga0501071_0011715 Ga0501071_0011715_648_1838 387
811 3300049589 Ga0501073_0009708 Ga0501073_0009708_5759_6946 387
812 3300049590 Ga0501074_0119904 Ga0501074_0119904_651_1841 387
813 3300049742 Ga0501080_0024231 Ga0501080_0024231_4310_5500 387
814 3300049824 Ga0501045_0011533 Ga0501045_0011533_4409_5596 387
815 3300050496 nmdc:mga07m45_37653_c1 nmdc:mga07m45_37653_c1_360_1553 387
816 3300053139 Ga0500568_0000177 Ga0500568_0000177_48622_49812 387
817 3300053151 Ga0500604_0009366 Ga0500604_0009366_89_1273 387
818 3300053155 Ga0500620_000267 Ga0500620_000267_2815_3999 387
819 3300053155 Ga0500620_001565 Ga0500620_001565_1864_3054 387

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00155

Aminotran_1_2

Aminotransferase class I and II

64

413

0.95

PF01041

DegT_DnrJ_EryC1

DegT/DnrJ/EryC1/StrS aminotransferase family

137

238

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
5wml-assembly1.cif.gz_B arabidopsis thaliana prephenate aminotransferase mutant- k306a 0.9486 3 386
5wmk-assembly1.cif.gz_A-2 arabidopsis thaliana prephenate aminotransferase double mutant- t84v k169v 0.9472 3 386
8wou-assembly1.cif.gz_B the crystal structure of aspartate aminotransferases lpg0070 from legionella pneumophila 0.9471 1 384
5wmi-assembly1.cif.gz_A-2 arabidopsis thaliana prephenate aminotransferase mutant- t84v 0.9451 2 386
8wkj-assembly1.cif.gz_A-2 the crystal structure of aspartate aminotransferases lpg0070 from legionella pneumophila 0.9435 1 385
ID Description Score Start End Superfamily
1xi9D01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9623 286 386 3.90.1150.10
af_Q60317_288_372_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9612 296 381 3.90.1150.10
1j32B01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9512 285 384 3.90.1150.10
af_Q58097_268_366_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9458 285 381 3.90.1150.10
af_Q2FZL1_278_379_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9422 286 382 3.90.1150.10
ID Description Score Start End GO Terms
AF-A0A833G1Y3-F1-model_v4 aspartate transaminase (EC 2.6.1.1) 0.9926 1 224 GO:0006520
GO:0008483
GO:0009058
GO:0030170
AF-A0A3S1SBI5-F1-model_v4 aspartate transaminase (EC 2.6.1.1) 0.9895 255 387 GO:0006520
GO:0008483
GO:0009058
GO:0030170
AF-A0A833G1Y3-F1-model_v4 aspartate transaminase (EC 2.6.1.1) 0.9838 1 224 GO:0006520
GO:0008483
GO:0009058
GO:0030170
AF-A0A4R3M710-F1-model_v4 aspartate transaminase (EC 2.6.1.1) 0.9823 1 386 GO:0006520
GO:0008483
GO:0009058
GO:0030170
AF-A0A833L4Z0-F1-model_v4 aspartate transaminase (EC 2.6.1.1) 0.9806 1 386 GO:0006520
GO:0008483
GO:0009058
GO:0030170

Feature Viewer

pLDDT pTM Quality
94.92 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map