F482113

General Info

Members Datasets Scaffolds Average Seq Length
817 324 1634 190

Family's Representative Sequence

Representative Sequence 3300049587|Ga0501071_0332285|Ga0501071_0332285_453_1100
Length 215
Sequence VPHIAEQDDRRPVGAPAQRAGLLPAPIAADPKVFVVTGPSGVGKGTLIRTLRERVPGLELSVSATTRTPRPGEEDGIDYHFLSEAEFGQRLDAGDFVEHAEYAGNRYGTLRSEIDRAAAVGAKALVLEIEVQGARQVREALPGAVQVFIAPPSDDALRTRLVGRGSDAPEQIERRLAVAADELAARDEFEHVIVNDRLEEAVEELVRLVATMCAE

Samples

Sample ID Description Type Environment
1 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
97 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
98 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
99 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
145 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
148 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
149 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
150 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
151 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
152 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
153 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
154 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
155 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
156 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
157 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
158 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
159 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
160 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
161 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
162 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
163 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
164 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
165 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
166 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
167 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
168 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
169 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
170 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
171 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
172 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
173 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
174 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
175 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
176 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
177 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
178 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
179 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
180 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
181 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
182 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
183 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
184 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
185 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
186 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
187 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
188 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
189 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
190 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
191 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
192 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
193 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
194 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
195 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
196 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
197 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
198 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
199 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
200 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
201 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
202 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
203 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
204 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
205 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
206 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
207 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
208 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
209 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
210 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
211 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
212 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
213 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
214 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
215 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
216 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
217 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
218 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
219 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
220 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
221 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
222 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
223 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
224 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
225 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
226 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
227 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
228 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
229 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
230 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
231 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
232 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
233 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
234 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
235 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
236 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
237 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
238 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
239 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
240 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
241 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
242 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
243 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
244 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
245 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
246 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
247 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
248 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
249 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
250 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
251 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
252 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
253 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
254 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
255 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
256 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
257 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
258 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
259 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
260 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
261 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
262 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
263 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
264 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
265 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
266 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
267 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
268 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
269 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
270 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
271 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
272 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
273 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
274 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
275 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
276 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
277 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
278 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
279 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
280 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
281 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
282 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
286 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
291 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
292 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
293 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
294 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
295 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
296 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
297 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
298 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
299 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
300 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
301 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
302 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
303 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
304 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
306 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
307 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
308 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
309 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
310 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
311 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
312 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
313 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
314 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
315 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
316 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
317 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
318 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
319 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
320 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
321 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
322 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
323 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
324 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.41
Metatranscriptomes 1.59
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.73
Nodule 0
Rhizoplane 8.32
Rhizosphere 87.39
Stem 0
Stem Tuber 0
Unclassified 3.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501071_0332285 3300049587 Bacteria 1155
2 JGI25407J50210_10000104 3300003373 Bacteria 11688
3 JGI25407J50210_10018572 3300003373 Bacteria 1807
4 Ga0070658_10011862 3300005327 Bacteria 6997
5 Ga0070658_10378361 3300005327 Bacteria 1214
6 Ga0070683_100011110 3300005329 Bacteria 7764
7 Ga0070683_100065117 3300005329 Bacteria 3393
8 Ga0070683_100163518 3300005329 Bacteria 2111
9 Ga0070683_100445415 3300005329 Bacteria 1236
10 Ga0070683_100691102 3300005329 Bacteria 977
11 Ga0070683_100724921 3300005329 Bacteria 952
12 Ga0070683_101099630 3300005329 Bacteria 763
13 Ga0068869_100070985 3300005334 Bacteria 2578
14 Ga0070666_10158979 3300005335 Bacteria 1579
15 Ga0070680_100004347 3300005336 Bacteria 10649
16 Ga0070680_100060097 3300005336 Bacteria 3110
17 Ga0070680_100139899 3300005336 Bacteria 2029
18 Ga0070680_100205620 3300005336 Bacteria 1660
19 Ga0070680_100711128 3300005336 Bacteria 864
20 Ga0070680_100960803 3300005336 Bacteria 738
21 Ga0070682_100014416 3300005337 Bacteria 4567
22 Ga0070682_100137438 3300005337 Bacteria 1662
23 Ga0070682_100764203 3300005337 Bacteria 781
24 Ga0068868_100087772 3300005338 Bacteria 2502
25 Ga0070660_100008187 3300005339 Bacteria 7307
26 Ga0070660_100019504 3300005339 Bacteria 4971
27 Ga0070660_100100458 3300005339 Bacteria 2291
28 Ga0070660_100136221 3300005339 Bacteria 1967
29 Ga0070660_100254230 3300005339 Bacteria 1433
30 Ga0070660_101008449 3300005339 Bacteria 703
31 Ga0070660_101022376 3300005339 Bacteria 698
32 Ga0070689_100072495 3300005340 Bacteria 2692
33 Ga0070661_100006256 3300005344 Bacteria 8215
34 Ga0070661_100006849 3300005344 Bacteria 7859
35 Ga0070661_100075434 3300005344 Bacteria 2485
36 Ga0070661_100593678 3300005344 Archaea 895
37 Ga0070661_100724770 3300005344 Bacteria 811
38 Ga0070668_100177452 3300005347 Bacteria 1738
39 Ga0070669_100439124 3300005353 Bacteria 1074
40 Ga0070671_100366415 3300005355 Bacteria 1230
41 Ga0070674_100811324 3300005356 Bacteria 809
42 Ga0070674_100932906 3300005356 Bacteria 758
43 Ga0070673_100120177 3300005364 Bacteria 2191
44 Ga0070659_100011282 3300005366 Bacteria 6603
45 Ga0070659_100691257 3300005366 Bacteria 881
46 Ga0070703_10055646 3300005406 Bacteria 1279
47 Ga0070709_10049444 3300005434 Bacteria 2629
48 Ga0070709_10712436 3300005434 Unclassified 782
49 Ga0070714_100042327 3300005435 Bacteria 3848
50 Ga0070714_100157490 3300005435 Bacteria 2052
51 Ga0070714_100187934 3300005435 Bacteria 1883
52 Ga0070714_100373793 3300005435 Unclassified 1342
53 Ga0070714_100526501 3300005435 Bacteria 1129
54 Ga0070713_100465035 3300005436 Bacteria 1190
55 Ga0070713_100953290 3300005436 Bacteria 826
56 Ga0070701_10193209 3300005438 Bacteria 1199
57 Ga0070711_100253542 3300005439 Bacteria 1381
58 Ga0070705_100060215 3300005440 Bacteria 2251
59 Ga0070700_100313386 3300005441 Bacteria 1150
60 Ga0070708_100448762 3300005445 Unclassified 1217
61 Ga0070663_100169395 3300005455 Bacteria 1687
62 Ga0070663_100466312 3300005455 Bacteria 1043
63 Ga0070663_100609005 3300005455 Bacteria 919
64 Ga0070678_100193775 3300005456 Bacteria 1673
65 Ga0070662_100025198 3300005457 Bacteria 4105
66 Ga0070662_100253848 3300005457 Bacteria 1415
67 Ga0070681_10008490 3300005458 Bacteria 10055
68 Ga0070681_10028181 3300005458 Bacteria 5647
69 Ga0070681_10082635 3300005458 Bacteria 3167
70 Ga0070681_10164785 3300005458 Bacteria 2139
71 Ga0070681_10219690 3300005458 Bacteria 1815
72 Ga0070681_10415779 3300005458 Bacteria 1256
73 Ga0070681_10488975 3300005458 Bacteria 1143
74 Ga0070681_10711261 3300005458 Bacteria 920
75 Ga0070681_10869577 3300005458 Bacteria 819
76 Ga0070699_100076728 3300005518 Bacteria 2909
77 Ga0070679_100087848 3300005530 Bacteria 3096
78 Ga0070679_100094128 3300005530 Bacteria 2983
79 Ga0070679_100231236 3300005530 Bacteria 1808
80 Ga0070679_100276783 3300005530 Bacteria 1631
81 Ga0070679_100890424 3300005530 Bacteria 833
82 Ga0070684_100038619 3300005535 Bacteria 4102
83 Ga0070684_100164503 3300005535 Bacteria 2013
84 Ga0070684_100205480 3300005535 Bacteria 1795
85 Ga0070684_100205537 3300005535 Bacteria 1794
86 Ga0070684_100208835 3300005535 Bacteria 1779
87 Ga0070684_100267201 3300005535 Unclassified 1565
88 Ga0070684_100903189 3300005535 Bacteria 827
89 Ga0068853_100360858 3300005539 Bacteria 1353
90 Ga0068853_100671994 3300005539 Bacteria 987
91 Ga0068853_101064575 3300005539 Bacteria 779
92 Ga0070686_100189089 3300005544 Bacteria 1468
93 Ga0070686_100239196 3300005544 Bacteria 1321
94 Ga0070695_100086659 3300005545 Bacteria 2081
95 Ga0070696_100105557 3300005546 Bacteria 2024
96 Ga0070693_100086088 3300005547 Bacteria 1884
97 Ga0070693_100358776 3300005547 Bacteria 1000
98 Ga0070693_100425220 3300005547 Bacteria 926
99 Ga0070665_100080403 3300005548 Bacteria 3264
100 Ga0070665_100648382 3300005548 Bacteria 1069
101 Ga0068855_100013130 3300005563 Bacteria 9991
102 Ga0068855_100068046 3300005563 Bacteria 4147
103 Ga0068855_100197764 3300005563 Bacteria 2264
104 Ga0068855_100198689 3300005563 Bacteria 2258
105 Ga0068855_100204531 3300005563 Bacteria 2222
106 Ga0068855_100254597 3300005563 Bacteria 1957
107 Ga0068855_100259944 3300005563 Bacteria 1934
108 Ga0068855_100342034 3300005563 Bacteria 1649
109 Ga0070664_100153355 3300005564 Bacteria 2035
110 Ga0070664_100238562 3300005564 Bacteria 1632
111 Ga0070664_101356670 3300005564 Bacteria 672
112 Ga0068857_100130624 3300005577 Bacteria 2265
113 Ga0068857_100133707 3300005577 Bacteria 2239
114 Ga0068854_100010961 3300005578 Bacteria 5882
115 Ga0068854_100341720 3300005578 Bacteria 1223
116 Ga0068854_101189352 3300005578 Bacteria 683
117 Ga0068856_100004589 3300005614 Bacteria 13737
118 Ga0068856_100112742 3300005614 Bacteria 2717
119 Ga0068856_100310067 3300005614 Bacteria 1596
120 Ga0070702_100012351 3300005615 Bacteria 4276
121 Ga0068852_100007990 3300005616 Bacteria 7758
122 Ga0068852_100125911 3300005616 Bacteria 2353
123 Ga0068852_101000607 3300005616 Bacteria 855
124 Ga0068859_100117675 3300005617 Bacteria 2723
125 Ga0068864_100000015 3300005618 Bacteria 303368
126 Ga0068861_100279508 3300005719 Bacteria 1437
127 Ga0068851_10057190 3300005834 Bacteria 1991
128 Ga0068851_10224728 3300005834 Bacteria 1056
129 Ga0081455_10027035 3300005937 Bacteria 5264
130 Ga0081455_10036701 3300005937 Bacteria 4359
131 Ga0081538_10000020 3300005981 Bacteria 139567
132 Ga0081538_10000200 3300005981 Bacteria 66229
133 Ga0081538_10002312 3300005981 Bacteria 18817
134 Ga0081538_10004968 3300005981 Bacteria 12112
135 Ga0081538_10018534 3300005981 Bacteria 5221
136 Ga0081538_10030012 3300005981 Bacteria 3701
137 Ga0081538_10092738 3300005981 Bacteria 1554
138 Ga0081538_10141626 3300005981 Bacteria 1108
139 Ga0081539_10000740 3300005985 Bacteria 65387
140 Ga0070717_10013706 3300006028 Bacteria 6220
141 Ga0070717_10065065 3300006028 Bacteria 3030
142 Ga0070717_10125947 3300006028 Bacteria 2199
143 Ga0075365_10000294 3300006038 Bacteria 17330
144 Ga0070712_100214240 3300006175 Bacteria 1521
145 Ga0075367_10163661 3300006178 Bacteria 1384
146 Ga0075367_10547390 3300006178 Bacteria 735
147 Ga0097621_100100370 3300006237 Bacteria 2435
148 Ga0068871_100137505 3300006358 Bacteria 2075
149 Ga0068871_100146961 3300006358 Bacteria 2008
150 Ga0068871_101179992 3300006358 Bacteria 718
151 Ga0075428_100264010 3300006844 Bacteria 1853
152 Ga0075430_100000896 3300006846 Bacteria 23379
153 Ga0075430_100087100 3300006846 Bacteria 2613
154 Ga0075431_100086472 3300006847 Bacteria 3235
155 Ga0075433_10096866 3300006852 Bacteria 2611
156 Ga0075433_10384546 3300006852 Bacteria 1239
157 Ga0075433_11075244 3300006852 Bacteria 700
158 Ga0075434_100000288 3300006871 Bacteria 35846
159 Ga0075434_100018510 3300006871 Bacteria 6731
160 Ga0075434_101344590 3300006871 Bacteria 725
161 Ga0068865_100287330 3300006881 Bacteria 1311
162 Ga0097620_100117671 3300006931 Bacteria 2723
163 Ga0075435_100009347 3300007076 Bacteria 7091
164 Ga0075435_100455318 3300007076 Bacteria 1104
165 Ga0105240_10077895 3300009093 Bacteria 4083
166 Ga0105240_10104814 3300009093 Bacteria 3434
167 Ga0105240_10201527 3300009093 Bacteria 2332
168 Ga0105240_10523857 3300009093 Bacteria 1315
169 Ga0105240_10546866 3300009093 Bacteria 1282
170 Ga0105240_10797374 3300009093 Bacteria 1023
171 Ga0111539_10044032 3300009094 Bacteria 5349
172 Ga0111539_10993146 3300009094 Bacteria 976
173 Ga0105245_10020014 3300009098 Bacteria 5866
174 Ga0105245_10077422 3300009098 Bacteria 3032
175 Ga0105247_10328782 3300009101 Bacteria 1069
176 Ga0114129_10167769 3300009147 Bacteria 2994
177 Ga0114129_12578874 3300009147 Bacteria 607
178 Ga0105243_10145258 3300009148 Bacteria 2029
179 Ga0105243_10157670 3300009148 Bacteria 1954
180 Ga0105243_10410532 3300009148 Bacteria 1260
181 Ga0105241_10232388 3300009174 Bacteria 1555
182 Ga0105241_10261041 3300009174 Bacteria 1472
183 Ga0105242_10069847 3300009176 Bacteria 2910
184 Ga0105242_10462381 3300009176 Bacteria 1198
185 Ga0105242_10585861 3300009176 Bacteria 1075
186 Ga0105248_10153320 3300009177 Bacteria 2599
187 Ga0105237_10065849 3300009545 Bacteria 3618
188 Ga0105237_10076796 3300009545 Bacteria 3330
189 Ga0105237_10275223 3300009545 Bacteria 1686
190 Ga0105237_10808913 3300009545 Bacteria 944
191 Ga0105238_10016816 3300009551 Bacteria 7417
192 Ga0105238_10024093 3300009551 Bacteria 6205
193 Ga0105238_10029238 3300009551 Bacteria 5615
194 Ga0105249_10332080 3300009553 Bacteria 1534
195 Ga0105239_10165256 3300010375 Bacteria 2474
196 Ga0105239_10175948 3300010375 Bacteria 2393
197 Ga0105239_11099000 3300010375 Bacteria 915
198 Ga0157373_10029236 3300013100 Bacteria 3972
199 Ga0157371_10589044 3300013102 Bacteria 827
200 Ga0157370_10004882 3300013104 Bacteria 15217
201 Ga0157370_10294487 3300013104 Bacteria 1499
202 Ga0157370_10712675 3300013104 Bacteria 916
203 Ga0157370_10832155 3300013104 Bacteria 839
204 Ga0157369_10006129 3300013105 Bacteria 13955
205 Ga0157369_10018632 3300013105 Bacteria 7782
206 Ga0157369_10078611 3300013105 Bacteria 3534
207 Ga0157369_10103686 3300013105 Bacteria 3030
208 Ga0157369_10438866 3300013105 Bacteria 1353
209 Ga0157369_10771483 3300013105 Bacteria 988
210 Ga0157369_10850138 3300013105 Bacteria 937
211 Ga0157369_11294942 3300013105 Unclassified 743
212 Ga0157374_10043473 3300013296 Bacteria 4151
213 Ga0157374_10647685 3300013296 Bacteria 1068
214 Ga0157378_10801385 3300013297 Unclassified 968
215 Ga0157372_10016430 3300013307 Bacteria 7941
216 Ga0157372_10067351 3300013307 Bacteria 4023
217 Ga0157372_10069442 3300013307 Bacteria 3962
218 Ga0157372_10301713 3300013307 Bacteria 1863
219 Ga0163163_10005491 3300014325 Bacteria 10972
220 Ga0157377_10000811 3300014745 Bacteria 12922
221 Ga0157376_10012411 3300014969 Bacteria 6324
222 Ga0157376_10216561 3300014969 Bacteria 1771
223 Ga0163161_10282932 3300017792 Bacteria 1301
224 Ga0206356_11241351 3300020070 Bacteria 1384
225 Ga0206356_11351312 3300020070 Bacteria 4885
226 Ga0206354_11219733 3300020081 Bacteria 769
227 Ga0206354_11394741 3300020081 Bacteria 2834
228 Ga0206354_11560368 3300020081 Bacteria 1001
229 Ga0206354_11656200 3300020081 Bacteria 2490
230 Ga0206353_10100840 3300020082 Bacteria 1034
231 Ga0206353_10260902 3300020082 Bacteria 2037
232 Ga0206353_10785855 3300020082 Bacteria 945
233 Ga0206353_10797388 3300020082 Bacteria 6861
234 Ga0206353_11184676 3300020082 Bacteria 1862
235 Ga0206353_11315790 3300020082 Bacteria 1329
236 Ga0206353_11465659 3300020082 Bacteria 3752
237 Ga0213874_10000264 3300021377 Bacteria 10100
238 Ga0213876_10014761 3300021384 Bacteria 4140
239 Ga0213876_10023263 3300021384 Bacteria 3273
240 Ga0213875_10011438 3300021388 Bacteria 4416
241 Ga0213875_10016071 3300021388 Bacteria 3631
242 Ga0213875_10141173 3300021388 Bacteria 1127
243 Ga0207642_10051877 3300025899 Bacteria 1858
244 Ga0207710_10149755 3300025900 Bacteria 1131
245 Ga0207680_10034303 3300025903 Bacteria 2903
246 Ga0207647_10137924 3300025904 Bacteria 1430
247 Ga0207699_10016150 3300025906 Bacteria 3897
248 Ga0207699_10222621 3300025906 Bacteria 1289
249 Ga0207643_10124032 3300025908 Bacteria 1532
250 Ga0207705_10024033 3300025909 Bacteria 4348
251 Ga0207705_10045265 3300025909 Bacteria 3163
252 Ga0207705_10049149 3300025909 Bacteria 3036
253 Ga0207705_10169123 3300025909 Unclassified 1645
254 Ga0207705_10495966 3300025909 Bacteria 948
255 Ga0207654_10126066 3300025911 Bacteria 1614
256 Ga0207654_10202229 3300025911 Bacteria 1308
257 Ga0207654_10280082 3300025911 Bacteria 1128
258 Ga0207707_10002473 3300025912 Bacteria 16636
259 Ga0207707_10023064 3300025912 Bacteria 5445
260 Ga0207707_10072100 3300025912 Bacteria 3011
261 Ga0207707_10094470 3300025912 Bacteria 2612
262 Ga0207707_10176146 3300025912 Bacteria 1868
263 Ga0207707_10176916 3300025912 Bacteria 1864
264 Ga0207707_10423102 3300025912 Unclassified 1142
265 Ga0207671_10268542 3300025914 Bacteria 1344
266 Ga0207671_10305684 3300025914 Bacteria 1257
267 Ga0207693_10148398 3300025915 Bacteria 1844
268 Ga0207660_10008507 3300025917 Bacteria 6638
269 Ga0207660_10096024 3300025917 Bacteria 2206
270 Ga0207660_10098807 3300025917 Bacteria 2178
271 Ga0207660_10240320 3300025917 Bacteria 1426
272 Ga0207662_10032222 3300025918 Bacteria 3049
273 Ga0207657_10001972 3300025919 Bacteria 22152
274 Ga0207657_10019359 3300025919 Bacteria 6467
275 Ga0207657_10033039 3300025919 Bacteria 4668
276 Ga0207657_10105190 3300025919 Bacteria 2337
277 Ga0207657_10522883 3300025919 Bacteria 928
278 Ga0207657_10522884 3300025919 Bacteria 928
279 Ga0207657_10586744 3300025919 Bacteria 870
280 Ga0207649_10026261 3300025920 Bacteria 3405
281 Ga0207649_10127346 3300025920 Bacteria 1725
282 Ga0207649_10177829 3300025920 Bacteria 1487
283 Ga0207649_10662271 3300025920 Bacteria 807
284 Ga0207652_10067465 3300025921 Bacteria 3102
285 Ga0207652_10086258 3300025921 Bacteria 2752
286 Ga0207652_10142945 3300025921 Bacteria 2140
287 Ga0207652_10262084 3300025921 Bacteria 1559
288 Ga0207652_10774381 3300025921 Bacteria 853
289 Ga0207694_10102874 3300025924 Bacteria 2265
290 Ga0207694_10124866 3300025924 Bacteria 2058
291 Ga0207687_10003687 3300025927 Bacteria 10313
292 Ga0207687_10149839 3300025927 Bacteria 1779
293 Ga0207700_10127214 3300025928 Bacteria 2075
294 Ga0207700_10523891 3300025928 Unclassified 1050
295 Ga0207700_10945947 3300025928 Bacteria 771
296 Ga0207664_10060093 3300025929 Bacteria 3029
297 Ga0207664_10118764 3300025929 Unclassified 2209
298 Ga0207664_10140364 3300025929 Bacteria 2043
299 Ga0207664_10191297 3300025929 Bacteria 1762
300 Ga0207664_10516200 3300025929 Bacteria 1071
301 Ga0207644_10115487 3300025931 Bacteria 2036
302 Ga0207644_10121456 3300025931 Bacteria 1989
303 Ga0207690_10012160 3300025932 Bacteria 5150
304 Ga0207690_10050575 3300025932 Bacteria 2775
305 Ga0207690_10070800 3300025932 Bacteria 2403
306 Ga0207706_10393403 3300025933 Bacteria 1202
307 Ga0207686_10280770 3300025934 Bacteria 1229
308 Ga0207709_10053325 3300025935 Bacteria 2488
309 Ga0207709_10415859 3300025935 Bacteria 1032
310 Ga0207669_10421050 3300025937 Bacteria 1051
311 Ga0207704_10420651 3300025938 Bacteria 1059
312 Ga0207665_10213942 3300025939 Bacteria 1409
313 Ga0207711_10369982 3300025941 Bacteria 1329
314 Ga0207711_10624605 3300025941 Bacteria 1005
315 Ga0207689_10051166 3300025942 Bacteria 3405
316 Ga0207661_10203749 3300025944 Bacteria 1740
317 Ga0207661_10301286 3300025944 Bacteria 1437
318 Ga0207661_10490526 3300025944 Bacteria 1122
319 Ga0207661_10810375 3300025944 Bacteria 862
320 Ga0207679_10259310 3300025945 Bacteria 1482
321 Ga0207679_10937971 3300025945 Bacteria 792
322 Ga0207667_10063012 3300025949 Bacteria 3875
323 Ga0207667_10078675 3300025949 Bacteria 3417
324 Ga0207667_10159174 3300025949 Bacteria 2323
325 Ga0207667_10225442 3300025949 Bacteria 1920
326 Ga0207667_10227218 3300025949 Bacteria 1912
327 Ga0207667_10262874 3300025949 Unclassified 1764
328 Ga0207712_10241330 3300025961 Bacteria 1456
329 Ga0207668_10082426 3300025972 Bacteria 2337
330 Ga0207677_10010576 3300026023 Bacteria 5228
331 Ga0207639_10108692 3300026041 Bacteria 2255
332 Ga0207639_10278971 3300026041 Bacteria 1469
333 Ga0207639_10297756 3300026041 Bacteria 1425
334 Ga0207678_10154748 3300026067 Bacteria 1957
335 Ga0207678_10899868 3300026067 Bacteria 783
336 Ga0207708_10253896 3300026075 Bacteria 1418
337 Ga0207708_10408152 3300026075 Bacteria 1125
338 Ga0207702_10008420 3300026078 Bacteria 8701
339 Ga0207702_10130349 3300026078 Bacteria 2262
340 Ga0207702_10179603 3300026078 Bacteria 1948
341 Ga0207676_10000018 3300026095 Bacteria 306375
342 Ga0207674_10072348 3300026116 Bacteria 3464
343 Ga0207674_10296967 3300026116 Bacteria 1564
344 Ga0207675_100360851 3300026118 Bacteria 1425
345 Ga0207683_10005639 3300026121 Bacteria 10734
346 Ga0207698_10000004 3300026142 Bacteria 313614
347 Ga0207698_10092693 3300026142 Bacteria 2477
348 Ga0207698_10164327 3300026142 Bacteria 1946
349 Ga0207698_10314886 3300026142 Unclassified 1463
350 Ga0207698_10443532 3300026142 Bacteria 1251
351 Ga0209813_10105462 3300027866 Unclassified 964
352 Ga0268266_10632639 3300028379 Bacteria 1029
353 Ga0268265_10509743 3300028380 Bacteria 1135
354 Ga0265337_1009785 3300028556 Bacteria 3401
355 Ga0265326_10000757 3300028558 Bacteria 11956
356 Ga0265319_1000842 3300028563 Bacteria 19569
357 Ga0265319_1072360 3300028563 Bacteria 1103
358 Ga0265334_10012155 3300028573 Bacteria 3617
359 Ga0265318_10007046 3300028577 Bacteria 5120
360 Ga0265318_10013959 3300028577 Bacteria 3380
361 Ga0265318_10079004 3300028577 Bacteria 1216
362 Ga0265322_10012985 3300028654 Bacteria 2411
363 Ga0265322_10086042 3300028654 Bacteria 892
364 Ga0265336_10000005 3300028666 Bacteria 399349
365 Ga0265338_10000001 3300028800 Bacteria 1177449
366 Ga0265338_10019418 3300028800 Bacteria 7212
367 Ga0265324_10010261 3300029957 Bacteria 3620
368 Ga0265320_10061377 3300031240 Bacteria 1792
369 Ga0265325_10011163 3300031241 Bacteria 5169
370 Ga0265340_10000001 3300031247 Bacteria 1647668
371 Ga0265340_10084132 3300031247 Bacteria 1494
372 Ga0265339_10017306 3300031249 Bacteria 4273
373 Ga0265327_10042695 3300031251 Bacteria 2432
374 Ga0265327_10043117 3300031251 Bacteria 2417
375 Ga0265316_10044788 3300031344 Bacteria 3516
376 Ga0307408_100111396 3300031548 Bacteria 2103
377 Ga0265313_10005262 3300031595 Bacteria 9580
378 Ga0265313_10093375 3300031595 Bacteria 1346
379 Ga0265314_10015874 3300031711 Bacteria 5964
380 Ga0265314_10306141 3300031711 Bacteria 889
381 Ga0265342_10069045 3300031712 Bacteria 2064
382 Ga0307405_10445458 3300031731 Bacteria 1025
383 Ga0307413_10088056 3300031824 Bacteria 2013
384 Ga0307406_10023996 3300031901 Bacteria 3637
385 Ga0307406_10059658 3300031901 Bacteria 2457
386 Ga0307406_10153133 3300031901 Bacteria 1647
387 Ga0307407_10274770 3300031903 Bacteria 1164
388 Ga0307409_100821487 3300031995 Bacteria 938
389 Ga0307416_100049028 3300032002 Bacteria 3355
390 Ga0307416_100931111 3300032002 Bacteria 970
391 Ga0307414_10354348 3300032004 Bacteria 1261
392 Ga0307415_100593433 3300032126 Bacteria 984
393 Ga0373934_0053026 3300035086 Bacteria 1609
394 Ga0373944_0005822 3300035089 Bacteria 3260
395 Ga0373944_0094392 3300035089 Bacteria 1003
396 Ga0373923_0027686 3300035111 Bacteria 2262
397 Ga0373923_0056623 3300035111 Bacteria 1656
398 Ga0373936_0112275 3300035113 Bacteria 1158
399 Ga0373945_0005048 3300035116 Bacteria 4205
400 Ga0373945_0124517 3300035116 Bacteria 1027
401 Ga0373953_0097348 3300035117 Bacteria 1236
402 Ga0373943_0000948 3300035170 Bacteria 12836
403 Ga0373943_0005005 3300035170 Bacteria 5977
404 Ga0373946_0028313 3300035171 Bacteria 2222
405 Ga0373946_0034334 3300035171 Bacteria 2048
406 Ga0373955_0014289 3300035172 Bacteria 3859
407 Ga0373955_0081204 3300035172 Bacteria 1832
408 Ga0373924_0103454 3300035410 Bacteria 1226
409 Ga0373935_0039711 3300035692 Bacteria 2951
410 Ga0373935_0092235 3300035692 Bacteria 1984
411 Ga0373927_0013935 3300035695 Bacteria 5334
412 Ga0373927_0188986 3300035695 Bacteria 1351
413 Ga0373933_0138036 3300035724 Bacteria 1537
414 Ga0373947_0003156 3300035725 Bacteria 9813
415 Ga0373947_0020606 3300035725 Bacteria 3808
416 Ga0373937_0073679 3300036401 Bacteria 3150
417 Ga0373937_0242408 3300036401 Bacteria 1698
418 Ga0373925_0013684 3300037068 Bacteria 5875
419 Ga0395900_0026920 3300037418 Bacteria 5886
420 Ga0395900_0176437 3300037418 Bacteria 2173
421 Ga0395900_0389205 3300037418 Bacteria 1360
422 Ga0395900_0568862 3300037418 Bacteria 1076
423 Ga0395900_1014184 3300037418 Bacteria 750
424 Ga0395898_0001107 3300037466 Bacteria 41584
425 Ga0395898_0002378 3300037466 Bacteria 22342
426 Ga0395898_0272877 3300037466 Bacteria 1613
427 Ga0395898_0516897 3300037466 Unclassified 1135
428 Ga0395898_0891579 3300037466 Bacteria 828
429 Ga0395905_0412021 3300037471 Bacteria 1247
430 Ga0436364_0324999 3300037853 Bacteria 16084
431 Ga0436364_0679661 3300037853 Bacteria 7415
432 Ga0436364_1504966 3300037853 Bacteria 4206
433 Ga0395901_0003426 3300038443 Bacteria 15984
434 Ga0395901_0009580 3300038443 Bacteria 9830
435 Ga0395901_0014827 3300038443 Bacteria 7918
436 Ga0395901_0280896 3300038443 Bacteria 1730
437 Ga0395901_0587348 3300038443 Bacteria 1125
438 Ga0395901_1617830 3300038443 Bacteria 601
439 Ga0436365_0179721 3300039437 Bacteria 17630
440 Ga0436365_0253877 3300039437 Bacteria 2223
441 Ga0436365_0268135 3300039437 Unclassified 997
442 Ga0436365_0268336 3300039437 Bacteria 814
443 Ga0436365_0388251 3300039437 Bacteria 1057
444 Ga0436365_0903847 3300039437 Bacteria 1896
445 Ga0436365_1168763 3300039437 Bacteria 90017
446 Ga0436365_1380658 3300039437 Bacteria 17187
447 Ga0436365_1915237 3300039437 Bacteria 2463
448 Ga0436363_0130947 3300039450 Bacteria 4705
449 Ga0436363_0270595 3300039450 Bacteria 832
450 Ga0436363_0357892 3300039450 Bacteria 5705
451 Ga0436363_0414720 3300039450 Bacteria 1758
452 Ga0436363_0889395 3300039450 Bacteria 1043
453 Ga0436363_1028583 3300039450 Bacteria 13936
454 Ga0436363_1424363 3300039450 Bacteria 1571
455 Ga0436363_1582569 3300039450 Bacteria 1406
456 Ga0436362_0250370 3300039453 Bacteria 2343
457 Ga0436362_1242845 3300039453 Bacteria 3881
458 Ga0451835_0797243 3300041492 Bacteria 725
459 Ga0451849_0689619 3300041505 Bacteria 1224
460 Ga0451853_2929055 3300041512 Bacteria 925
461 Ga0439448_0089687 3300042005 Bacteria 1038
462 Ga0439464_0027573 3300042439 Bacteria 1580
463 Ga0439440_0012953 3300042993 Bacteria 1781
464 Ga0466969_0343593 3300044656 Bacteria 676
465 Ga0466966_0015990 3300044684 Bacteria 4961
466 Ga0466966_0026087 3300044684 Bacteria 3815
467 Ga0466966_0041440 3300044684 Bacteria 2959
468 Ga0466961_0008119 3300044693 Bacteria 6683
469 Ga0466961_0020291 3300044693 Bacteria 4275
470 Ga0466961_0064965 3300044693 Bacteria 2319
471 Ga0466961_0066735 3300044693 Bacteria 2285
472 Ga0466961_0140784 3300044693 Bacteria 1510
473 Ga0466961_0524407 3300044693 Unclassified 714
474 Ga0466963_0000353 3300044694 Bacteria 20819
475 Ga0466963_0001104 3300044694 Bacteria 14058
476 Ga0466963_0016032 3300044694 Bacteria 4653
477 Ga0466963_0016292 3300044694 Bacteria 4620
478 Ga0466963_0037220 3300044694 Bacteria 3176
479 Ga0466963_0068016 3300044694 Bacteria 2391
480 Ga0466963_0221103 3300044694 Bacteria 1326
481 Ga0466963_0232998 3300044694 Bacteria 1290
482 Ga0466963_0308540 3300044694 Bacteria 1113
483 Ga0466963_0430999 3300044694 Bacteria 930
484 Ga0466963_0454273 3300044694 Bacteria 904
485 Ga0466963_0517100 3300044694 Bacteria 843
486 Ga0466964_0004892 3300044706 Bacteria 4951
487 Ga0466964_0008108 3300044706 Bacteria 3940
488 Ga0466964_0014919 3300044706 Bacteria 2959
489 Ga0466964_0097495 3300044706 Bacteria 1290
490 Ga0466964_0098566 3300044706 Bacteria 1284
491 Ga0466964_0120990 3300044706 Bacteria 1180
492 Ga0466964_0125951 3300044706 Bacteria 1160
493 Ga0466964_0239502 3300044706 Bacteria 889
494 Ga0466964_0249427 3300044706 Bacteria 874
495 Ga0466964_0429241 3300044706 Bacteria 696
496 Ga0466971_0046888 3300044719 Bacteria 1942
497 Ga0466971_0063726 3300044719 Bacteria 1668
498 Ga0466971_0248394 3300044719 Bacteria 847
499 Ga0466968_0015782 3300044735 Bacteria 3000
500 Ga0466968_0090495 3300044735 Bacteria 1355
501 Ga0466968_0117558 3300044735 Bacteria 1201
502 Ga0466968_0120121 3300044735 Bacteria 1188
503 Ga0466970_0124656 3300044765 Bacteria 1412
504 Ga0466970_0131844 3300044765 Bacteria 1373
505 Ga0466970_0169407 3300044765 Bacteria 1210
506 Ga0466957_0036258 3300044842 Bacteria 2964
507 Ga0466957_0059881 3300044842 Bacteria 2335
508 Ga0466957_0071816 3300044842 Bacteria 2141
509 Ga0466957_0216887 3300044842 Bacteria 1262
510 Ga0466957_0298214 3300044842 Bacteria 1082
511 Ga0466957_0719380 3300044842 Unclassified 706
512 Ga0466960_0303717 3300044901 Bacteria 900
513 Ga0466959_0014461 3300045049 Bacteria 5735
514 Ga0466959_0071515 3300045049 Bacteria 2512
515 Ga0466959_0091009 3300045049 Bacteria 2191
516 Ga0466959_0101400 3300045049 Bacteria 2060
517 Ga0466959_0229720 3300045049 Unclassified 1284
518 Ga0466959_0388032 3300045049 Bacteria 950
519 Ga0466959_0701767 3300045049 Bacteria 678
520 Ga0466958_0001260 3300045836 Bacteria 11862
521 Ga0466958_0015866 3300045836 Bacteria 4329
522 Ga0466958_0021158 3300045836 Bacteria 3797
523 Ga0466958_0036094 3300045836 Bacteria 2957
524 Ga0466958_0119627 3300045836 Bacteria 1648
525 Ga0466958_0125161 3300045836 Bacteria 1611
526 Ga0466958_0157298 3300045836 Bacteria 1435
527 Ga0466958_0159647 3300045836 Bacteria 1424
528 Ga0466958_0238913 3300045836 Bacteria 1161
529 Ga0466958_0245956 3300045836 Bacteria 1143
530 Ga0466958_0287806 3300045836 Bacteria 1054
531 Ga0466958_0348029 3300045836 Bacteria 954
532 Ga0466967_0002964 3300045976 Bacteria 10850
533 Ga0466967_0018586 3300045976 Bacteria 5560
534 Ga0466967_0021070 3300045976 Bacteria 5282
535 Ga0466967_0021859 3300045976 Bacteria 5205
536 Ga0466967_0042543 3300045976 Bacteria 3926
537 Ga0466967_0044590 3300045976 Bacteria 3847
538 Ga0466967_0073945 3300045976 Bacteria 3059
539 Ga0466967_0088670 3300045976 Bacteria 2808
540 Ga0466967_0130719 3300045976 Bacteria 2330
541 Ga0466967_0150541 3300045976 Bacteria 2174
542 Ga0466967_0151283 3300045976 Bacteria 2169
543 Ga0466967_0201179 3300045976 Bacteria 1887
544 Ga0466967_0203962 3300045976 Bacteria 1873
545 Ga0466967_0296615 3300045976 Bacteria 1554
546 Ga0466967_0315665 3300045976 Bacteria 1506
547 Ga0466967_0336728 3300045976 Bacteria 1458
548 Ga0466967_0375265 3300045976 Bacteria 1380
549 Ga0466967_0411275 3300045976 Bacteria 1317
550 Ga0466967_0423767 3300045976 Bacteria 1297
551 Ga0466967_0513159 3300045976 Bacteria 1177
552 Ga0466967_0555933 3300045976 Bacteria 1130
553 Ga0466967_0572875 3300045976 Bacteria 1112
554 Ga0466967_0743987 3300045976 Bacteria 972
555 Ga0466967_0933418 3300045976 Unclassified 863
556 Ga0466967_0985073 3300045976 Bacteria 839
557 Ga0466967_1141426 3300045976 Bacteria 776
558 Ga0495592_0094096 3300046454 Bacteria 2145
559 Ga0495592_0279435 3300046454 Bacteria 1092
560 Ga0495603_0015739 3300046455 Bacteria 4574
561 Ga0495603_0337894 3300046455 Bacteria 864
562 Ga0495629_0009258 3300046459 Bacteria 7205
563 Ga0495629_0020903 3300046459 Bacteria 4672
564 Ga0495629_0100124 3300046459 Bacteria 2022
565 Ga0495641_0000793 3300046461 Bacteria 26791
566 Ga0495641_0164725 3300046461 Bacteria 992
567 Ga0495651_0039755 3300046462 Bacteria 3660
568 Ga0495651_0105476 3300046462 Bacteria 2090
569 Ga0495651_0113961 3300046462 Bacteria 1995
570 Ga0495653_0056093 3300046463 Bacteria 3004
571 Ga0495653_0064595 3300046463 Bacteria 2757
572 Ga0495653_0073341 3300046463 Bacteria 2554
573 Ga0495580_0026424 3300046472 Bacteria 4232
574 Ga0495580_0101146 3300046472 Bacteria 2005
575 Ga0495582_0003686 3300046473 Bacteria 8633
576 Ga0495582_0004168 3300046473 Bacteria 8126
577 Ga0495582_0033145 3300046473 Bacteria 2839
578 Ga0495605_0066459 3300046474 Bacteria 1713
579 Ga0495639_0002486 3300046475 Bacteria 8042
580 Ga0495639_0019251 3300046475 Bacteria 2978
581 Ga0495639_0095558 3300046475 Bacteria 1398
582 Ga0495662_0003248 3300046476 Bacteria 8215
583 Ga0495662_0005102 3300046476 Bacteria 6577
584 Ga0495664_0018878 3300046477 Bacteria 3958
585 Ga0495664_0061057 3300046477 Bacteria 2245
586 Ga0495664_0067639 3300046477 Bacteria 2131
587 Ga0495594_0017126 3300046499 Bacteria 3825
588 Ga0495596_0061427 3300046500 Bacteria 1463
589 Ga0495608_0010163 3300046511 Bacteria 6568
590 Ga0495608_0011453 3300046511 Bacteria 6173
591 Ga0495608_0018113 3300046511 Bacteria 4863
592 Ga0495608_0079918 3300046511 Bacteria 2126
593 Ga0495608_0445939 3300046511 Bacteria 788
594 Ga0495618_0000115 3300046514 Bacteria 58375
595 Ga0495618_0331197 3300046514 Bacteria 941
596 Ga0495618_0347145 3300046514 Bacteria 915
597 Ga0495618_0454045 3300046514 Bacteria 777
598 Ga0495628_0262890 3300046516 Bacteria 1286
599 Ga0495630_0095193 3300046517 Bacteria 2251
600 Ga0495630_0166820 3300046517 Bacteria 1676
601 Ga0495666_0009556 3300046526 Bacteria 4846
602 Ga0495666_0032459 3300046526 Bacteria 2555
603 Ga0495652_0042560 3300046529 Bacteria 3915
604 Ga0495665_0001332 3300046531 Bacteria 13180
605 Ga0495665_0004084 3300046531 Bacteria 7873
606 Ga0495640_0395833 3300046533 Bacteria 849
607 Ga0495640_0497668 3300046533 Bacteria 742
608 Ga0495586_0086592 3300046535 Bacteria 1727
609 Ga0495587_0033023 3300046536 Bacteria 3125
610 Ga0495587_0066661 3300046536 Bacteria 2099
611 Ga0495587_0075187 3300046536 Bacteria 1961
612 Ga0495645_0115284 3300046543 Bacteria 1898
613 Ga0495667_0013391 3300046559 Bacteria 5552
614 Ga0495667_0025494 3300046559 Bacteria 3983
615 Ga0495667_0070211 3300046559 Bacteria 2285
616 Ga0495667_0097878 3300046559 Bacteria 1899
617 Ga0495668_0219094 3300046616 Bacteria 1042
618 Ga0495634_0028676 3300046642 Bacteria 3861
619 Ga0495634_0034982 3300046642 Bacteria 3443
620 Ga0495635_0011984 3300046663 Bacteria 6074
621 Ga0495635_0045493 3300046663 Bacteria 3029
622 Ga0495635_0118629 3300046663 Bacteria 1805
623 Ga0495635_0163560 3300046663 Bacteria 1514
624 Ga0495588_0017324 3300046674 Bacteria 3495
625 Ga0495588_0314942 3300046674 Unclassified 823
626 Ga0495657_0012099 3300046675 Bacteria 6420
627 Ga0495657_0031824 3300046675 Bacteria 3684
628 Ga0495599_0020820 3300046678 Bacteria 4087
629 Ga0495599_0130705 3300046678 Bacteria 1559
630 Ga0495623_0148158 3300046679 Bacteria 1390
631 Ga0495623_0153777 3300046679 Bacteria 1357
632 Ga0495646_0014007 3300046680 Bacteria 5098
633 Ga0495646_0080992 3300046680 Bacteria 1893
634 Ga0495647_0002012 3300046681 Bacteria 6349
635 Ga0495658_0000379 3300046683 Bacteria 24931
636 Ga0495613_0001753 3300046689 Bacteria 16515
637 Ga0495613_0013003 3300046689 Bacteria 6184
638 Ga0495624_0015742 3300046690 Bacteria 5099
639 Ga0495624_0158817 3300046690 Bacteria 1381
640 Ga0495624_0191385 3300046690 Bacteria 1244
641 Ga0495600_0008198 3300046809 Bacteria 6415
642 Ga0495600_0077933 3300046809 Bacteria 2165
643 Ga0495600_0109104 3300046809 Bacteria 1802
644 Ga0495581_0002043 3300047315 Bacteria 11350
645 Ga0495581_0005670 3300047315 Bacteria 7241
646 Ga0495604_0026326 3300047317 Bacteria 4630
647 Ga0495604_0068890 3300047317 Bacteria 2683
648 Ga0495674_0034090 3300047319 Bacteria 4606
649 Ga0495674_0039755 3300047319 Bacteria 4213
650 Ga0495674_0126250 3300047319 Bacteria 2158
651 Ga0495676_0002172 3300047321 Bacteria 17365
652 Ga0495676_0043365 3300047321 Bacteria 3682
653 Ga0495676_0419586 3300047321 Bacteria 886
654 Ga0495680_0012431 3300047322 Bacteria 7491
655 Ga0495680_0050186 3300047322 Bacteria 3263
656 Ga0495680_0167091 3300047322 Bacteria 1594
657 Ga0495675_0084336 3300047444 Bacteria 1999
658 Ga0495675_0140167 3300047444 Bacteria 1499
659 Ga0495684_0005173 3300047471 Bacteria 10166
660 Ga0495684_0097315 3300047471 Bacteria 2226
661 Ga0495684_0470612 3300047471 Bacteria 869
662 Ga0495593_0010191 3300047673 Bacteria 5432
663 Ga0495593_0019130 3300047673 Bacteria 3843
664 Ga0495602_0052414 3300048088 Bacteria 3623
665 Ga0495602_0070809 3300048088 Bacteria 2981
666 Ga0495602_0197369 3300048088 Bacteria 1538
667 Ga0495614_0007391 3300048089 Bacteria 4893
668 Ga0495614_0050939 3300048089 Bacteria 1774
669 Ga0495614_0142344 3300048089 Bacteria 1066
670 Ga0496100_0014411 3300048903 Bacteria 4590
671 Ga0496100_0015773 3300048903 Bacteria 4418
672 Ga0496100_0076332 3300048903 Bacteria 2250
673 Ga0496100_0087868 3300048903 Bacteria 2114
674 Ga0496100_0185109 3300048903 Bacteria 1508
675 Ga0496100_0410136 3300048903 Bacteria 1033
676 Ga0496101_0002875 3300048904 Bacteria 10590
677 Ga0496101_0018591 3300048904 Bacteria 4728
678 Ga0496101_0024995 3300048904 Bacteria 4140
679 Ga0496101_0038693 3300048904 Bacteria 3388
680 Ga0496101_0047663 3300048904 Bacteria 3077
681 Ga0496102_0006393 3300048905 Bacteria 10043
682 Ga0496102_0007158 3300048905 Bacteria 9524
683 Ga0496102_0057760 3300048905 Bacteria 3544
684 Ga0496102_0178118 3300048905 Bacteria 2002
685 Ga0496102_0713538 3300048905 Bacteria 926
686 Ga0496103_0004333 3300048906 Bacteria 8618
687 Ga0496103_0065673 3300048906 Bacteria 2263
688 Ga0496103_0108037 3300048906 Bacteria 1765
689 Ga0496104_0003577 3300048907 Bacteria 13415
690 Ga0496104_1132038 3300048907 Bacteria 686
691 Ga0496105_0004361 3300048908 Bacteria 10651
692 Ga0496105_0007507 3300048908 Bacteria 8447
693 Ga0496105_0049383 3300048908 Bacteria 3473
694 Ga0496105_0250894 3300048908 Bacteria 1434
695 Ga0496106_0004788 3300048909 Bacteria 10010
696 Ga0496106_0005708 3300048909 Bacteria 9207
697 Ga0496106_0040068 3300048909 Bacteria 3507
698 Ga0496106_0068056 3300048909 Bacteria 2716
699 Ga0496106_0079533 3300048909 Bacteria 2517
700 Ga0496107_0002187 3300048910 Bacteria 12564
701 Ga0496107_0051696 3300048910 Bacteria 2964
702 Ga0496107_0059666 3300048910 Bacteria 2761
703 Ga0496107_0206967 3300048910 Bacteria 1458
704 Ga0496108_0007095 3300048911 Bacteria 9073
705 Ga0496108_0189520 3300048911 Bacteria 1782
706 Ga0496108_0568863 3300048911 Unclassified 988
707 Ga0496109_0004651 3300048912 Bacteria 11458
708 Ga0496109_0018187 3300048912 Bacteria 6171
709 Ga0496109_0063728 3300048912 Bacteria 3372
710 Ga0496109_0300102 3300048912 Bacteria 1514
711 Ga0496110_0058749 3300048913 Bacteria 3387
712 Ga0496110_0073010 3300048913 Bacteria 3045
713 Ga0496111_0005981 3300048914 Bacteria 7855
714 Ga0496111_0012824 3300048914 Bacteria 5687
715 Ga0496111_0049942 3300048914 Bacteria 3016
716 Ga0496111_0171945 3300048914 Bacteria 1610
717 Ga0496112_0000025 3300048915 Bacteria 146197
718 Ga0496112_0001450 3300048915 Bacteria 18215
719 Ga0496112_0006292 3300048915 Bacteria 10415
720 Ga0496112_0026743 3300048915 Bacteria 5558
721 Ga0496112_0408848 3300048915 Bacteria 1296
722 Ga0496112_0700134 3300048915 Bacteria 941
723 Ga0496113_0017566 3300048916 Bacteria 4968
724 Ga0496114_0001055 3300048917 Bacteria 20710
725 Ga0496114_0029665 3300048917 Bacteria 4498
726 Ga0496114_0131618 3300048917 Bacteria 2160
727 Ga0496114_0383888 3300048917 Bacteria 1244
728 Ga0496115_0001930 3300048918 Bacteria 14798
729 Ga0496115_0004249 3300048918 Bacteria 10358
730 Ga0496115_0010743 3300048918 Bacteria 6848
731 Ga0496115_0012929 3300048918 Bacteria 6295
732 Ga0496115_0062843 3300048918 Bacteria 2996
733 Ga0496115_0108678 3300048918 Bacteria 2277
734 Ga0496115_0113367 3300048918 Bacteria 2228
735 Ga0496115_0403600 3300048918 Bacteria 1109
736 Ga0496115_0790097 3300048918 Bacteria 739
737 Ga0496115_1002982 3300048918 Bacteria 638
738 Ga0501033_0580846 3300049570 Bacteria 770
739 Ga0501034_0322439 3300049571 Bacteria 1478
740 Ga0501038_0153573 3300049574 Bacteria 1876
741 Ga0501040_0008267 3300049576 Bacteria 6767
742 Ga0501041_0072853 3300049577 Bacteria 2111
743 Ga0501043_0411786 3300049579 Bacteria 1020
744 Ga0501046_0262668 3300049580 Bacteria 1268
745 Ga0501047_0398062 3300049581 Bacteria 1210
746 Ga0501048_0654663 3300049582 Bacteria 754
747 Ga0501067_0079231 3300049583 Bacteria 1820
748 Ga0501067_0222096 3300049583 Bacteria 1052
749 Ga0501068_0031718 3300049584 Bacteria 3139
750 Ga0501069_0001571 3300049585 Bacteria 11282
751 Ga0501070_0375354 3300049586 Bacteria 1152
752 Ga0501070_0782567 3300049586 Bacteria 750
753 Ga0501071_0142715 3300049587 Bacteria 1784
754 Ga0501071_0267675 3300049587 Bacteria 1291
755 Ga0501072_0185730 3300049588 Bacteria 1658
756 Ga0501074_0144407 3300049590 Bacteria 1702
757 Ga0501074_0175987 3300049590 Bacteria 1527
758 Ga0501075_0052651 3300049591 Bacteria 3061
759 Ga0501075_0492098 3300049591 Bacteria 936
760 Ga0501075_0602307 3300049591 Bacteria 838
761 Ga0501076_0011471 3300049592 Bacteria 6602
762 Ga0501076_0067739 3300049592 Bacteria 2851
763 Ga0501076_0190511 3300049592 Bacteria 1673
764 Ga0501077_0250484 3300049593 Bacteria 1126
765 Ga0501079_0075417 3300049741 Bacteria 2608
766 Ga0501079_0573460 3300049741 Bacteria 888
767 Ga0501080_0524243 3300049742 Bacteria 1057
768 Ga0501080_0638987 3300049742 Bacteria 942
769 Ga0501081_0124824 3300049743 Bacteria 1836
770 Ga0501081_0474083 3300049743 Bacteria 931
771 Ga0501083_0390038 3300049744 Bacteria 906
772 Ga0501083_0391518 3300049744 Bacteria 904
773 Ga0501035_0181960 3300049822 Bacteria 1811
774 Ga0501044_0507847 3300049823 Bacteria 1106
775 Ga0501045_0127714 3300049824 Bacteria 1889
776 Ga0501045_0318987 3300049824 Bacteria 1156
777 nmdc:mga00v17_762364_c1 3300050491 Bacteria 618
778 nmdc:mga0yw44_21256_c1 3300050492 Bacteria 3617
779 nmdc:mga05p37_386141_c1 3300050507 Bacteria 1639
780 nmdc:mga05p37_526501_c1 3300050507 Bacteria 1351
781 nmdc:mga05p37_667065_c1 3300050507 Bacteria 1161
782 nmdc:mga09592_71762_c1 3300050508 Bacteria 2939
783 nmdc:mga0qj67_5244_c1 3300050509 Bacteria 9451
784 nmdc:mga06r32_142833_c1 3300050510 Bacteria 2371
785 nmdc:mga06r32_78564_c1 3300050510 Bacteria 3208
786 nmdc:mga0n895_1128341_c1 3300050512 Bacteria 760
787 nmdc:mga0n895_4747_c1 3300050512 Bacteria 11229
788 nmdc:mga0n895_66521_c1 3300050512 Bacteria 3569
789 nmdc:mga0rr50_101221_c1 3300050513 Bacteria 2264
790 nmdc:mga0rr50_10604_c1 3300050513 Bacteria 5419
791 nmdc:mga0rr50_8707_c1 3300050513 Bacteria 6328
792 nmdc:mga0a205_20179_c1 3300050515 Bacteria 1892
793 Ga0495601_0017039 3300053077 Bacteria 4407
794 Ga0495601_0215016 3300053077 Bacteria 1255
795 Ga0495601_0347772 3300053077 Unclassified 964
796 Ga0495612_0119095 3300053078 Bacteria 1134
797 Ga0495655_0085734 3300053083 Bacteria 909
798 Ga0495595_0019206 3300053084 Unclassified 2964
799 Ga0495595_0030992 3300053084 Bacteria 2401
800 Ga0495619_0000008 3300053085 Bacteria 305999
801 Ga0495619_0006528 3300053085 Bacteria 7384
802 Ga0495619_0010424 3300053085 Bacteria 5848
803 Ga0495619_0039047 3300053085 Bacteria 3098
804 Ga0495619_0043227 3300053085 Bacteria 2953
805 Ga0501084_0311744 3300054114 Bacteria 1329
806 Ga0501082_0173602 3300060353 Bacteria 1874
807 Ga0501082_0233475 3300060353 Unclassified 1601
808 Ga0501082_0778473 3300060353 Bacteria 837
809 Ga0466962_0000708 3300061719 Bacteria 14840
810 Ga0466962_0009518 3300061719 Bacteria 4660
811 Ga0466962_0031519 3300061719 Unclassified 2538
812 Ga0466962_0090002 3300061719 Bacteria 1470
813 Ga0466962_0093762 3300061719 Bacteria 1439
814 Ga0466962_0140990 3300061719 Bacteria 1167
815 Ga0466962_0328212 3300061719 Bacteria 760
816 Ga0466962_0496178 3300061719 Unclassified 617
817 Ga0530510_0141877 3300061734 Bacteria 1770
818 Ga0501071_0332285
819 JGI25407J50210_10000104
820 JGI25407J50210_10018572
821 Ga0070658_10011862
822 Ga0070658_10378361
823 Ga0070683_100011110
824 Ga0070683_100065117
825 Ga0070683_100163518
826 Ga0070683_100445415
827 Ga0070683_100691102
828 Ga0070683_100724921
829 Ga0070683_101099630
830 Ga0068869_100070985
831 Ga0070666_10158979
832 Ga0070680_100004347
833 Ga0070680_100060097
834 Ga0070680_100139899
835 Ga0070680_100205620
836 Ga0070680_100711128
837 Ga0070680_100960803
838 Ga0070682_100014416
839 Ga0070682_100137438
840 Ga0070682_100764203
841 Ga0068868_100087772
842 Ga0070660_100008187
843 Ga0070660_100019504
844 Ga0070660_100100458
845 Ga0070660_100136221
846 Ga0070660_100254230
847 Ga0070660_101008449
848 Ga0070660_101022376
849 Ga0070689_100072495
850 Ga0070661_100006256
851 Ga0070661_100006849
852 Ga0070661_100075434
853 Ga0070661_100593678
854 Ga0070661_100724770
855 Ga0070668_100177452
856 Ga0070669_100439124
857 Ga0070671_100366415
858 Ga0070674_100811324
859 Ga0070674_100932906
860 Ga0070673_100120177
861 Ga0070659_100011282
862 Ga0070659_100691257
863 Ga0070703_10055646
864 Ga0070709_10049444
865 Ga0070709_10712436
866 Ga0070714_100042327
867 Ga0070714_100157490
868 Ga0070714_100187934
869 Ga0070714_100373793
870 Ga0070714_100526501
871 Ga0070713_100465035
872 Ga0070713_100953290
873 Ga0070701_10193209
874 Ga0070711_100253542
875 Ga0070705_100060215
876 Ga0070700_100313386
877 Ga0070708_100448762
878 Ga0070663_100169395
879 Ga0070663_100466312
880 Ga0070663_100609005
881 Ga0070678_100193775
882 Ga0070662_100025198
883 Ga0070662_100253848
884 Ga0070681_10008490
885 Ga0070681_10028181
886 Ga0070681_10082635
887 Ga0070681_10164785
888 Ga0070681_10219690
889 Ga0070681_10415779
890 Ga0070681_10488975
891 Ga0070681_10711261
892 Ga0070681_10869577
893 Ga0070699_100076728
894 Ga0070679_100087848
895 Ga0070679_100094128
896 Ga0070679_100231236
897 Ga0070679_100276783
898 Ga0070679_100890424
899 Ga0070684_100038619
900 Ga0070684_100164503
901 Ga0070684_100205480
902 Ga0070684_100205537
903 Ga0070684_100208835
904 Ga0070684_100267201
905 Ga0070684_100903189
906 Ga0068853_100360858
907 Ga0068853_100671994
908 Ga0068853_101064575
909 Ga0070686_100189089
910 Ga0070686_100239196
911 Ga0070695_100086659
912 Ga0070696_100105557
913 Ga0070693_100086088
914 Ga0070693_100358776
915 Ga0070693_100425220
916 Ga0070665_100080403
917 Ga0070665_100648382
918 Ga0068855_100013130
919 Ga0068855_100068046
920 Ga0068855_100197764
921 Ga0068855_100198689
922 Ga0068855_100204531
923 Ga0068855_100254597
924 Ga0068855_100259944
925 Ga0068855_100342034
926 Ga0070664_100153355
927 Ga0070664_100238562
928 Ga0070664_101356670
929 Ga0068857_100130624
930 Ga0068857_100133707
931 Ga0068854_100010961
932 Ga0068854_100341720
933 Ga0068854_101189352
934 Ga0068856_100004589
935 Ga0068856_100112742
936 Ga0068856_100310067
937 Ga0070702_100012351
938 Ga0068852_100007990
939 Ga0068852_100125911
940 Ga0068852_101000607
941 Ga0068859_100117675
942 Ga0068864_100000015
943 Ga0068861_100279508
944 Ga0068851_10057190
945 Ga0068851_10224728
946 Ga0081455_10027035
947 Ga0081455_10036701
948 Ga0081538_10000020
949 Ga0081538_10000200
950 Ga0081538_10002312
951 Ga0081538_10004968
952 Ga0081538_10018534
953 Ga0081538_10030012
954 Ga0081538_10092738
955 Ga0081538_10141626
956 Ga0081539_10000740
957 Ga0070717_10013706
958 Ga0070717_10065065
959 Ga0070717_10125947
960 Ga0075365_10000294
961 Ga0070712_100214240
962 Ga0075367_10163661
963 Ga0075367_10547390
964 Ga0097621_100100370
965 Ga0068871_100137505
966 Ga0068871_100146961
967 Ga0068871_101179992
968 Ga0075428_100264010
969 Ga0075430_100000896
970 Ga0075430_100087100
971 Ga0075431_100086472
972 Ga0075433_10096866
973 Ga0075433_10384546
974 Ga0075433_11075244
975 Ga0075434_100000288
976 Ga0075434_100018510
977 Ga0075434_101344590
978 Ga0068865_100287330
979 Ga0097620_100117671
980 Ga0075435_100009347
981 Ga0075435_100455318
982 Ga0105240_10077895
983 Ga0105240_10104814
984 Ga0105240_10201527
985 Ga0105240_10523857
986 Ga0105240_10546866
987 Ga0105240_10797374
988 Ga0111539_10044032
989 Ga0111539_10993146
990 Ga0105245_10020014
991 Ga0105245_10077422
992 Ga0105247_10328782
993 Ga0114129_10167769
994 Ga0114129_12578874
995 Ga0105243_10145258
996 Ga0105243_10157670
997 Ga0105243_10410532
998 Ga0105241_10232388
999 Ga0105241_10261041
1000 Ga0105242_10069847
1001 Ga0105242_10462381
1002 Ga0105242_10585861
1003 Ga0105248_10153320
1004 Ga0105237_10065849
1005 Ga0105237_10076796
1006 Ga0105237_10275223
1007 Ga0105237_10808913
1008 Ga0105238_10016816
1009 Ga0105238_10024093
1010 Ga0105238_10029238
1011 Ga0105249_10332080
1012 Ga0105239_10165256
1013 Ga0105239_10175948
1014 Ga0105239_11099000
1015 Ga0157373_10029236
1016 Ga0157371_10589044
1017 Ga0157370_10004882
1018 Ga0157370_10294487
1019 Ga0157370_10712675
1020 Ga0157370_10832155
1021 Ga0157369_10006129
1022 Ga0157369_10018632
1023 Ga0157369_10078611
1024 Ga0157369_10103686
1025 Ga0157369_10438866
1026 Ga0157369_10771483
1027 Ga0157369_10850138
1028 Ga0157369_11294942
1029 Ga0157374_10043473
1030 Ga0157374_10647685
1031 Ga0157378_10801385
1032 Ga0157372_10016430
1033 Ga0157372_10067351
1034 Ga0157372_10069442
1035 Ga0157372_10301713
1036 Ga0163163_10005491
1037 Ga0157377_10000811
1038 Ga0157376_10012411
1039 Ga0157376_10216561
1040 Ga0163161_10282932
1041 Ga0206356_11241351
1042 Ga0206356_11351312
1043 Ga0206354_11219733
1044 Ga0206354_11394741
1045 Ga0206354_11560368
1046 Ga0206354_11656200
1047 Ga0206353_10100840
1048 Ga0206353_10260902
1049 Ga0206353_10785855
1050 Ga0206353_10797388
1051 Ga0206353_11184676
1052 Ga0206353_11315790
1053 Ga0206353_11465659
1054 Ga0213874_10000264
1055 Ga0213876_10014761
1056 Ga0213876_10023263
1057 Ga0213875_10011438
1058 Ga0213875_10016071
1059 Ga0213875_10141173
1060 Ga0207642_10051877
1061 Ga0207710_10149755
1062 Ga0207680_10034303
1063 Ga0207647_10137924
1064 Ga0207699_10016150
1065 Ga0207699_10222621
1066 Ga0207643_10124032
1067 Ga0207705_10024033
1068 Ga0207705_10045265
1069 Ga0207705_10049149
1070 Ga0207705_10169123
1071 Ga0207705_10495966
1072 Ga0207654_10126066
1073 Ga0207654_10202229
1074 Ga0207654_10280082
1075 Ga0207707_10002473
1076 Ga0207707_10023064
1077 Ga0207707_10072100
1078 Ga0207707_10094470
1079 Ga0207707_10176146
1080 Ga0207707_10176916
1081 Ga0207707_10423102
1082 Ga0207671_10268542
1083 Ga0207671_10305684
1084 Ga0207693_10148398
1085 Ga0207660_10008507
1086 Ga0207660_10096024
1087 Ga0207660_10098807
1088 Ga0207660_10240320
1089 Ga0207662_10032222
1090 Ga0207657_10001972
1091 Ga0207657_10019359
1092 Ga0207657_10033039
1093 Ga0207657_10105190
1094 Ga0207657_10522883
1095 Ga0207657_10522884
1096 Ga0207657_10586744
1097 Ga0207649_10026261
1098 Ga0207649_10127346
1099 Ga0207649_10177829
1100 Ga0207649_10662271
1101 Ga0207652_10067465
1102 Ga0207652_10086258
1103 Ga0207652_10142945
1104 Ga0207652_10262084
1105 Ga0207652_10774381
1106 Ga0207694_10102874
1107 Ga0207694_10124866
1108 Ga0207687_10003687
1109 Ga0207687_10149839
1110 Ga0207700_10127214
1111 Ga0207700_10523891
1112 Ga0207700_10945947
1113 Ga0207664_10060093
1114 Ga0207664_10118764
1115 Ga0207664_10140364
1116 Ga0207664_10191297
1117 Ga0207664_10516200
1118 Ga0207644_10115487
1119 Ga0207644_10121456
1120 Ga0207690_10012160
1121 Ga0207690_10050575
1122 Ga0207690_10070800
1123 Ga0207706_10393403
1124 Ga0207686_10280770
1125 Ga0207709_10053325
1126 Ga0207709_10415859
1127 Ga0207669_10421050
1128 Ga0207704_10420651
1129 Ga0207665_10213942
1130 Ga0207711_10369982
1131 Ga0207711_10624605
1132 Ga0207689_10051166
1133 Ga0207661_10203749
1134 Ga0207661_10301286
1135 Ga0207661_10490526
1136 Ga0207661_10810375
1137 Ga0207679_10259310
1138 Ga0207679_10937971
1139 Ga0207667_10063012
1140 Ga0207667_10078675
1141 Ga0207667_10159174
1142 Ga0207667_10225442
1143 Ga0207667_10227218
1144 Ga0207667_10262874
1145 Ga0207712_10241330
1146 Ga0207668_10082426
1147 Ga0207677_10010576
1148 Ga0207639_10108692
1149 Ga0207639_10278971
1150 Ga0207639_10297756
1151 Ga0207678_10154748
1152 Ga0207678_10899868
1153 Ga0207708_10253896
1154 Ga0207708_10408152
1155 Ga0207702_10008420
1156 Ga0207702_10130349
1157 Ga0207702_10179603
1158 Ga0207676_10000018
1159 Ga0207674_10072348
1160 Ga0207674_10296967
1161 Ga0207675_100360851
1162 Ga0207683_10005639
1163 Ga0207698_10000004
1164 Ga0207698_10092693
1165 Ga0207698_10164327
1166 Ga0207698_10314886
1167 Ga0207698_10443532
1168 Ga0209813_10105462
1169 Ga0268266_10632639
1170 Ga0268265_10509743
1171 Ga0265337_1009785
1172 Ga0265326_10000757
1173 Ga0265319_1000842
1174 Ga0265319_1072360
1175 Ga0265334_10012155
1176 Ga0265318_10007046
1177 Ga0265318_10013959
1178 Ga0265318_10079004
1179 Ga0265322_10012985
1180 Ga0265322_10086042
1181 Ga0265336_10000005
1182 Ga0265338_10000001
1183 Ga0265338_10019418
1184 Ga0265324_10010261
1185 Ga0265320_10061377
1186 Ga0265325_10011163
1187 Ga0265340_10000001
1188 Ga0265340_10084132
1189 Ga0265339_10017306
1190 Ga0265327_10042695
1191 Ga0265327_10043117
1192 Ga0265316_10044788
1193 Ga0307408_100111396
1194 Ga0265313_10005262
1195 Ga0265313_10093375
1196 Ga0265314_10015874
1197 Ga0265314_10306141
1198 Ga0265342_10069045
1199 Ga0307405_10445458
1200 Ga0307413_10088056
1201 Ga0307406_10023996
1202 Ga0307406_10059658
1203 Ga0307406_10153133
1204 Ga0307407_10274770
1205 Ga0307409_100821487
1206 Ga0307416_100049028
1207 Ga0307416_100931111
1208 Ga0307414_10354348
1209 Ga0307415_100593433
1210 Ga0373934_0053026
1211 Ga0373944_0005822
1212 Ga0373944_0094392
1213 Ga0373923_0027686
1214 Ga0373923_0056623
1215 Ga0373936_0112275
1216 Ga0373945_0005048
1217 Ga0373945_0124517
1218 Ga0373953_0097348
1219 Ga0373943_0000948
1220 Ga0373943_0005005
1221 Ga0373946_0028313
1222 Ga0373946_0034334
1223 Ga0373955_0014289
1224 Ga0373955_0081204
1225 Ga0373924_0103454
1226 Ga0373935_0039711
1227 Ga0373935_0092235
1228 Ga0373927_0013935
1229 Ga0373927_0188986
1230 Ga0373933_0138036
1231 Ga0373947_0003156
1232 Ga0373947_0020606
1233 Ga0373937_0073679
1234 Ga0373937_0242408
1235 Ga0373925_0013684
1236 Ga0395900_0026920
1237 Ga0395900_0176437
1238 Ga0395900_0389205
1239 Ga0395900_0568862
1240 Ga0395900_1014184
1241 Ga0395898_0001107
1242 Ga0395898_0002378
1243 Ga0395898_0272877
1244 Ga0395898_0516897
1245 Ga0395898_0891579
1246 Ga0395905_0412021
1247 Ga0436364_0324999
1248 Ga0436364_0679661
1249 Ga0436364_1504966
1250 Ga0395901_0003426
1251 Ga0395901_0009580
1252 Ga0395901_0014827
1253 Ga0395901_0280896
1254 Ga0395901_0587348
1255 Ga0395901_1617830
1256 Ga0436365_0179721
1257 Ga0436365_0253877
1258 Ga0436365_0268135
1259 Ga0436365_0268336
1260 Ga0436365_0388251
1261 Ga0436365_0903847
1262 Ga0436365_1168763
1263 Ga0436365_1380658
1264 Ga0436365_1915237
1265 Ga0436363_0130947
1266 Ga0436363_0270595
1267 Ga0436363_0357892
1268 Ga0436363_0414720
1269 Ga0436363_0889395
1270 Ga0436363_1028583
1271 Ga0436363_1424363
1272 Ga0436363_1582569
1273 Ga0436362_0250370
1274 Ga0436362_1242845
1275 Ga0451835_0797243
1276 Ga0451849_0689619
1277 Ga0451853_2929055
1278 Ga0439448_0089687
1279 Ga0439464_0027573
1280 Ga0439440_0012953
1281 Ga0466969_0343593
1282 Ga0466966_0015990
1283 Ga0466966_0026087
1284 Ga0466966_0041440
1285 Ga0466961_0008119
1286 Ga0466961_0020291
1287 Ga0466961_0064965
1288 Ga0466961_0066735
1289 Ga0466961_0140784
1290 Ga0466961_0524407
1291 Ga0466963_0000353
1292 Ga0466963_0001104
1293 Ga0466963_0016032
1294 Ga0466963_0016292
1295 Ga0466963_0037220
1296 Ga0466963_0068016
1297 Ga0466963_0221103
1298 Ga0466963_0232998
1299 Ga0466963_0308540
1300 Ga0466963_0430999
1301 Ga0466963_0454273
1302 Ga0466963_0517100
1303 Ga0466964_0004892
1304 Ga0466964_0008108
1305 Ga0466964_0014919
1306 Ga0466964_0097495
1307 Ga0466964_0098566
1308 Ga0466964_0120990
1309 Ga0466964_0125951
1310 Ga0466964_0239502
1311 Ga0466964_0249427
1312 Ga0466964_0429241
1313 Ga0466971_0046888
1314 Ga0466971_0063726
1315 Ga0466971_0248394
1316 Ga0466968_0015782
1317 Ga0466968_0090495
1318 Ga0466968_0117558
1319 Ga0466968_0120121
1320 Ga0466970_0124656
1321 Ga0466970_0131844
1322 Ga0466970_0169407
1323 Ga0466957_0036258
1324 Ga0466957_0059881
1325 Ga0466957_0071816
1326 Ga0466957_0216887
1327 Ga0466957_0298214
1328 Ga0466957_0719380
1329 Ga0466960_0303717
1330 Ga0466959_0014461
1331 Ga0466959_0071515
1332 Ga0466959_0091009
1333 Ga0466959_0101400
1334 Ga0466959_0229720
1335 Ga0466959_0388032
1336 Ga0466959_0701767
1337 Ga0466958_0001260
1338 Ga0466958_0015866
1339 Ga0466958_0021158
1340 Ga0466958_0036094
1341 Ga0466958_0119627
1342 Ga0466958_0125161
1343 Ga0466958_0157298
1344 Ga0466958_0159647
1345 Ga0466958_0238913
1346 Ga0466958_0245956
1347 Ga0466958_0287806
1348 Ga0466958_0348029
1349 Ga0466967_0002964
1350 Ga0466967_0018586
1351 Ga0466967_0021070
1352 Ga0466967_0021859
1353 Ga0466967_0042543
1354 Ga0466967_0044590
1355 Ga0466967_0073945
1356 Ga0466967_0088670
1357 Ga0466967_0130719
1358 Ga0466967_0150541
1359 Ga0466967_0151283
1360 Ga0466967_0201179
1361 Ga0466967_0203962
1362 Ga0466967_0296615
1363 Ga0466967_0315665
1364 Ga0466967_0336728
1365 Ga0466967_0375265
1366 Ga0466967_0411275
1367 Ga0466967_0423767
1368 Ga0466967_0513159
1369 Ga0466967_0555933
1370 Ga0466967_0572875
1371 Ga0466967_0743987
1372 Ga0466967_0933418
1373 Ga0466967_0985073
1374 Ga0466967_1141426
1375 Ga0495592_0094096
1376 Ga0495592_0279435
1377 Ga0495603_0015739
1378 Ga0495603_0337894
1379 Ga0495629_0009258
1380 Ga0495629_0020903
1381 Ga0495629_0100124
1382 Ga0495641_0000793
1383 Ga0495641_0164725
1384 Ga0495651_0039755
1385 Ga0495651_0105476
1386 Ga0495651_0113961
1387 Ga0495653_0056093
1388 Ga0495653_0064595
1389 Ga0495653_0073341
1390 Ga0495580_0026424
1391 Ga0495580_0101146
1392 Ga0495582_0003686
1393 Ga0495582_0004168
1394 Ga0495582_0033145
1395 Ga0495605_0066459
1396 Ga0495639_0002486
1397 Ga0495639_0019251
1398 Ga0495639_0095558
1399 Ga0495662_0003248
1400 Ga0495662_0005102
1401 Ga0495664_0018878
1402 Ga0495664_0061057
1403 Ga0495664_0067639
1404 Ga0495594_0017126
1405 Ga0495596_0061427
1406 Ga0495608_0010163
1407 Ga0495608_0011453
1408 Ga0495608_0018113
1409 Ga0495608_0079918
1410 Ga0495608_0445939
1411 Ga0495618_0000115
1412 Ga0495618_0331197
1413 Ga0495618_0347145
1414 Ga0495618_0454045
1415 Ga0495628_0262890
1416 Ga0495630_0095193
1417 Ga0495630_0166820
1418 Ga0495666_0009556
1419 Ga0495666_0032459
1420 Ga0495652_0042560
1421 Ga0495665_0001332
1422 Ga0495665_0004084
1423 Ga0495640_0395833
1424 Ga0495640_0497668
1425 Ga0495586_0086592
1426 Ga0495587_0033023
1427 Ga0495587_0066661
1428 Ga0495587_0075187
1429 Ga0495645_0115284
1430 Ga0495667_0013391
1431 Ga0495667_0025494
1432 Ga0495667_0070211
1433 Ga0495667_0097878
1434 Ga0495668_0219094
1435 Ga0495634_0028676
1436 Ga0495634_0034982
1437 Ga0495635_0011984
1438 Ga0495635_0045493
1439 Ga0495635_0118629
1440 Ga0495635_0163560
1441 Ga0495588_0017324
1442 Ga0495588_0314942
1443 Ga0495657_0012099
1444 Ga0495657_0031824
1445 Ga0495599_0020820
1446 Ga0495599_0130705
1447 Ga0495623_0148158
1448 Ga0495623_0153777
1449 Ga0495646_0014007
1450 Ga0495646_0080992
1451 Ga0495647_0002012
1452 Ga0495658_0000379
1453 Ga0495613_0001753
1454 Ga0495613_0013003
1455 Ga0495624_0015742
1456 Ga0495624_0158817
1457 Ga0495624_0191385
1458 Ga0495600_0008198
1459 Ga0495600_0077933
1460 Ga0495600_0109104
1461 Ga0495581_0002043
1462 Ga0495581_0005670
1463 Ga0495604_0026326
1464 Ga0495604_0068890
1465 Ga0495674_0034090
1466 Ga0495674_0039755
1467 Ga0495674_0126250
1468 Ga0495676_0002172
1469 Ga0495676_0043365
1470 Ga0495676_0419586
1471 Ga0495680_0012431
1472 Ga0495680_0050186
1473 Ga0495680_0167091
1474 Ga0495675_0084336
1475 Ga0495675_0140167
1476 Ga0495684_0005173
1477 Ga0495684_0097315
1478 Ga0495684_0470612
1479 Ga0495593_0010191
1480 Ga0495593_0019130
1481 Ga0495602_0052414
1482 Ga0495602_0070809
1483 Ga0495602_0197369
1484 Ga0495614_0007391
1485 Ga0495614_0050939
1486 Ga0495614_0142344
1487 Ga0496100_0014411
1488 Ga0496100_0015773
1489 Ga0496100_0076332
1490 Ga0496100_0087868
1491 Ga0496100_0185109
1492 Ga0496100_0410136
1493 Ga0496101_0002875
1494 Ga0496101_0018591
1495 Ga0496101_0024995
1496 Ga0496101_0038693
1497 Ga0496101_0047663
1498 Ga0496102_0006393
1499 Ga0496102_0007158
1500 Ga0496102_0057760
1501 Ga0496102_0178118
1502 Ga0496102_0713538
1503 Ga0496103_0004333
1504 Ga0496103_0065673
1505 Ga0496103_0108037
1506 Ga0496104_0003577
1507 Ga0496104_1132038
1508 Ga0496105_0004361
1509 Ga0496105_0007507
1510 Ga0496105_0049383
1511 Ga0496105_0250894
1512 Ga0496106_0004788
1513 Ga0496106_0005708
1514 Ga0496106_0040068
1515 Ga0496106_0068056
1516 Ga0496106_0079533
1517 Ga0496107_0002187
1518 Ga0496107_0051696
1519 Ga0496107_0059666
1520 Ga0496107_0206967
1521 Ga0496108_0007095
1522 Ga0496108_0189520
1523 Ga0496108_0568863
1524 Ga0496109_0004651
1525 Ga0496109_0018187
1526 Ga0496109_0063728
1527 Ga0496109_0300102
1528 Ga0496110_0058749
1529 Ga0496110_0073010
1530 Ga0496111_0005981
1531 Ga0496111_0012824
1532 Ga0496111_0049942
1533 Ga0496111_0171945
1534 Ga0496112_0000025
1535 Ga0496112_0001450
1536 Ga0496112_0006292
1537 Ga0496112_0026743
1538 Ga0496112_0408848
1539 Ga0496112_0700134
1540 Ga0496113_0017566
1541 Ga0496114_0001055
1542 Ga0496114_0029665
1543 Ga0496114_0131618
1544 Ga0496114_0383888
1545 Ga0496115_0001930
1546 Ga0496115_0004249
1547 Ga0496115_0010743
1548 Ga0496115_0012929
1549 Ga0496115_0062843
1550 Ga0496115_0108678
1551 Ga0496115_0113367
1552 Ga0496115_0403600
1553 Ga0496115_0790097
1554 Ga0496115_1002982
1555 Ga0501033_0580846
1556 Ga0501034_0322439
1557 Ga0501038_0153573
1558 Ga0501040_0008267
1559 Ga0501041_0072853
1560 Ga0501043_0411786
1561 Ga0501046_0262668
1562 Ga0501047_0398062
1563 Ga0501048_0654663
1564 Ga0501067_0079231
1565 Ga0501067_0222096
1566 Ga0501068_0031718
1567 Ga0501069_0001571
1568 Ga0501070_0375354
1569 Ga0501070_0782567
1570 Ga0501071_0142715
1571 Ga0501071_0267675
1572 Ga0501072_0185730
1573 Ga0501074_0144407
1574 Ga0501074_0175987
1575 Ga0501075_0052651
1576 Ga0501075_0492098
1577 Ga0501075_0602307
1578 Ga0501076_0011471
1579 Ga0501076_0067739
1580 Ga0501076_0190511
1581 Ga0501077_0250484
1582 Ga0501079_0075417
1583 Ga0501079_0573460
1584 Ga0501080_0524243
1585 Ga0501080_0638987
1586 Ga0501081_0124824
1587 Ga0501081_0474083
1588 Ga0501083_0390038
1589 Ga0501083_0391518
1590 Ga0501035_0181960
1591 Ga0501044_0507847
1592 Ga0501045_0127714
1593 Ga0501045_0318987
1594 nmdc:mga00v17_762364_c1
1595 nmdc:mga0yw44_21256_c1
1596 nmdc:mga05p37_386141_c1
1597 nmdc:mga05p37_526501_c1
1598 nmdc:mga05p37_667065_c1
1599 nmdc:mga09592_71762_c1
1600 nmdc:mga0qj67_5244_c1
1601 nmdc:mga06r32_142833_c1
1602 nmdc:mga06r32_78564_c1
1603 nmdc:mga0n895_1128341_c1
1604 nmdc:mga0n895_4747_c1
1605 nmdc:mga0n895_66521_c1
1606 nmdc:mga0rr50_101221_c1
1607 nmdc:mga0rr50_10604_c1
1608 nmdc:mga0rr50_8707_c1
1609 nmdc:mga0a205_20179_c1
1610 Ga0495601_0017039
1611 Ga0495601_0215016
1612 Ga0495601_0347772
1613 Ga0495612_0119095
1614 Ga0495655_0085734
1615 Ga0495595_0019206
1616 Ga0495595_0030992
1617 Ga0495619_0000008
1618 Ga0495619_0006528
1619 Ga0495619_0010424
1620 Ga0495619_0039047
1621 Ga0495619_0043227
1622 Ga0501084_0311744
1623 Ga0501082_0173602
1624 Ga0501082_0233475
1625 Ga0501082_0778473
1626 Ga0466962_0000708
1627 Ga0466962_0009518
1628 Ga0466962_0031519
1629 Ga0466962_0090002
1630 Ga0466962_0093762
1631 Ga0466962_0140990
1632 Ga0466962_0328212
1633 Ga0466962_0496178
1634 Ga0530510_0141877

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00625

Guanylate_kin

Guanylate kinase

30

212

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7yki-assembly1.cif.gz_A crystal structure of magi2 pdz0-gk domain in complex with phospho-sapap1 gbr3 peptide 0.9188 19 68
1ex7-assembly1.cif.gz_A crystal structure of yeast guanylate kinase in complex with guanosine-5'-monophosphate 0.8989 2 163
1z6g-assembly1.cif.gz_A crystal structure of guanylate kinase from plasmodium falciparum 0.8951 2 164
2an9-assembly1.cif.gz_A crystal structure of oligomeric e.coli guanylate kinase in complex with gdp 0.8841 2 167
2an9-assembly1.cif.gz_A crystal structure of oligomeric e.coli guanylate kinase in complex with gdp 0.8744 2 167
ID Description Score Start End Superfamily
af_Q94JM2_119_167_3.30.63.10 Alpha Beta;2-Layer Sandwich;Guanylate Kinase phosphate binding domain;Guanylate Kinase phosphate binding domain 1.001 20 65 3.30.63.10
2qorA02 Alpha Beta;2-Layer Sandwich;Guanylate Kinase phosphate binding domain;Guanylate Kinase phosphate binding domain 0.9718 20 72 3.30.63.10
af_Q2QPW1_160_210_3.30.63.10 Alpha Beta;2-Layer Sandwich;Guanylate Kinase phosphate binding domain;Guanylate Kinase phosphate binding domain 0.9661 20 68 3.30.63.10
1s4qA02 Alpha Beta;2-Layer Sandwich;Guanylate Kinase phosphate binding domain;Guanylate Kinase phosphate binding domain 0.9637 20 72 3.30.63.10
1s96B02 Alpha Beta;2-Layer Sandwich;Guanylate Kinase phosphate binding domain;Guanylate Kinase phosphate binding domain 0.9635 20 72 3.30.63.10
ID Description Score Start End GO Terms
AF-A0A358ARE9-F1-model_v4 Guanylate kinase (EC 2.7.4.8) (GMP kinase) 0.9671 2 163 GO:0004385
GO:0005524
GO:0005829
AF-A0A2V7K455-F1-model_v4 Guanylate kinase 0.9567 2 95 GO:0004385
GO:0005829
AF-A0A838IBH2-F1-model_v4 Guanylate kinase (EC 2.7.4.8) (GMP kinase) 0.9559 2 143 GO:0004385
GO:0005524
GO:0005829
AF-A0A538IMD3-F1-model_v4 Guanylate kinase (EC 2.7.4.8) (GMP kinase) 0.9558 2 120 GO:0004385
GO:0005524
GO:0005829
AF-A0A7V4KMV4-F1-model_v4 Guanylate kinase (EC 2.7.4.8) (GMP kinase) 0.9544 2 166 GO:0004385
GO:0005524
GO:0005829

Map