F482113
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 817 | 324 | 1634 | 190 |
Family's Representative Sequence
| Representative Sequence | 3300049587|Ga0501071_0332285|Ga0501071_0332285_453_1100 |
| Length | 215 |
| Sequence | VPHIAEQDDRRPVGAPAQRAGLLPAPIAADPKVFVVTGPSGVGKGTLIRTLRERVPGLELSVSATTRTPRPGEEDGIDYHFLSEAEFGQRLDAGDFVEHAEYAGNRYGTLRSEIDRAAAVGAKALVLEIEVQGARQVREALPGAVQVFIAPPSDDALRTRLVGRGSDAPEQIERRLAVAADELAARDEFEHVIVNDRLEEAVEELVRLVATMCAE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 2 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 6 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 36 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 42 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 44 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 45 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 46 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 48 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 49 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 50 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 51 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 52 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 53 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 54 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 55 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 57 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 59 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 61 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 62 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 63 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 64 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 65 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 66 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 67 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 69 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 94 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 95 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 96 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 97 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 98 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 99 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 148 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 149 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 150 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 151 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 152 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 153 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 154 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 155 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 156 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 157 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 158 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 159 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 160 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 161 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 162 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 163 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 164 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 165 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 166 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 167 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 168 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 169 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 170 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 171 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 172 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 173 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 174 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 175 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 176 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 177 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 178 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 179 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 180 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 181 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 182 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 183 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 184 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 185 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 186 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 187 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 188 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 189 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 190 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 191 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 192 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 193 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 194 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 195 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 196 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 197 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 198 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 199 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 200 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 201 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 202 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 203 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 204 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 205 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 206 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 207 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 208 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 209 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 210 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 211 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 212 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 213 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 214 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 215 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 216 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 217 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 267 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 268 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 269 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 270 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 271 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 272 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 273 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 274 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 275 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 276 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 277 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 278 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 279 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 280 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 281 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 282 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 298 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 308 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 309 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 310 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 311 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 324 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.41 |
| Metatranscriptomes | 1.59 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.73 |
| Nodule | 0 |
| Rhizoplane | 8.32 |
| Rhizosphere | 87.39 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.18 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501071_0332285 | 3300049587 | Bacteria | 1155 |
| 2 | JGI25407J50210_10000104 | 3300003373 | Bacteria | 11688 |
| 3 | JGI25407J50210_10018572 | 3300003373 | Bacteria | 1807 |
| 4 | Ga0070658_10011862 | 3300005327 | Bacteria | 6997 |
| 5 | Ga0070658_10378361 | 3300005327 | Bacteria | 1214 |
| 6 | Ga0070683_100011110 | 3300005329 | Bacteria | 7764 |
| 7 | Ga0070683_100065117 | 3300005329 | Bacteria | 3393 |
| 8 | Ga0070683_100163518 | 3300005329 | Bacteria | 2111 |
| 9 | Ga0070683_100445415 | 3300005329 | Bacteria | 1236 |
| 10 | Ga0070683_100691102 | 3300005329 | Bacteria | 977 |
| 11 | Ga0070683_100724921 | 3300005329 | Bacteria | 952 |
| 12 | Ga0070683_101099630 | 3300005329 | Bacteria | 763 |
| 13 | Ga0068869_100070985 | 3300005334 | Bacteria | 2578 |
| 14 | Ga0070666_10158979 | 3300005335 | Bacteria | 1579 |
| 15 | Ga0070680_100004347 | 3300005336 | Bacteria | 10649 |
| 16 | Ga0070680_100060097 | 3300005336 | Bacteria | 3110 |
| 17 | Ga0070680_100139899 | 3300005336 | Bacteria | 2029 |
| 18 | Ga0070680_100205620 | 3300005336 | Bacteria | 1660 |
| 19 | Ga0070680_100711128 | 3300005336 | Bacteria | 864 |
| 20 | Ga0070680_100960803 | 3300005336 | Bacteria | 738 |
| 21 | Ga0070682_100014416 | 3300005337 | Bacteria | 4567 |
| 22 | Ga0070682_100137438 | 3300005337 | Bacteria | 1662 |
| 23 | Ga0070682_100764203 | 3300005337 | Bacteria | 781 |
| 24 | Ga0068868_100087772 | 3300005338 | Bacteria | 2502 |
| 25 | Ga0070660_100008187 | 3300005339 | Bacteria | 7307 |
| 26 | Ga0070660_100019504 | 3300005339 | Bacteria | 4971 |
| 27 | Ga0070660_100100458 | 3300005339 | Bacteria | 2291 |
| 28 | Ga0070660_100136221 | 3300005339 | Bacteria | 1967 |
| 29 | Ga0070660_100254230 | 3300005339 | Bacteria | 1433 |
| 30 | Ga0070660_101008449 | 3300005339 | Bacteria | 703 |
| 31 | Ga0070660_101022376 | 3300005339 | Bacteria | 698 |
| 32 | Ga0070689_100072495 | 3300005340 | Bacteria | 2692 |
| 33 | Ga0070661_100006256 | 3300005344 | Bacteria | 8215 |
| 34 | Ga0070661_100006849 | 3300005344 | Bacteria | 7859 |
| 35 | Ga0070661_100075434 | 3300005344 | Bacteria | 2485 |
| 36 | Ga0070661_100593678 | 3300005344 | Archaea | 895 |
| 37 | Ga0070661_100724770 | 3300005344 | Bacteria | 811 |
| 38 | Ga0070668_100177452 | 3300005347 | Bacteria | 1738 |
| 39 | Ga0070669_100439124 | 3300005353 | Bacteria | 1074 |
| 40 | Ga0070671_100366415 | 3300005355 | Bacteria | 1230 |
| 41 | Ga0070674_100811324 | 3300005356 | Bacteria | 809 |
| 42 | Ga0070674_100932906 | 3300005356 | Bacteria | 758 |
| 43 | Ga0070673_100120177 | 3300005364 | Bacteria | 2191 |
| 44 | Ga0070659_100011282 | 3300005366 | Bacteria | 6603 |
| 45 | Ga0070659_100691257 | 3300005366 | Bacteria | 881 |
| 46 | Ga0070703_10055646 | 3300005406 | Bacteria | 1279 |
| 47 | Ga0070709_10049444 | 3300005434 | Bacteria | 2629 |
| 48 | Ga0070709_10712436 | 3300005434 | Unclassified | 782 |
| 49 | Ga0070714_100042327 | 3300005435 | Bacteria | 3848 |
| 50 | Ga0070714_100157490 | 3300005435 | Bacteria | 2052 |
| 51 | Ga0070714_100187934 | 3300005435 | Bacteria | 1883 |
| 52 | Ga0070714_100373793 | 3300005435 | Unclassified | 1342 |
| 53 | Ga0070714_100526501 | 3300005435 | Bacteria | 1129 |
| 54 | Ga0070713_100465035 | 3300005436 | Bacteria | 1190 |
| 55 | Ga0070713_100953290 | 3300005436 | Bacteria | 826 |
| 56 | Ga0070701_10193209 | 3300005438 | Bacteria | 1199 |
| 57 | Ga0070711_100253542 | 3300005439 | Bacteria | 1381 |
| 58 | Ga0070705_100060215 | 3300005440 | Bacteria | 2251 |
| 59 | Ga0070700_100313386 | 3300005441 | Bacteria | 1150 |
| 60 | Ga0070708_100448762 | 3300005445 | Unclassified | 1217 |
| 61 | Ga0070663_100169395 | 3300005455 | Bacteria | 1687 |
| 62 | Ga0070663_100466312 | 3300005455 | Bacteria | 1043 |
| 63 | Ga0070663_100609005 | 3300005455 | Bacteria | 919 |
| 64 | Ga0070678_100193775 | 3300005456 | Bacteria | 1673 |
| 65 | Ga0070662_100025198 | 3300005457 | Bacteria | 4105 |
| 66 | Ga0070662_100253848 | 3300005457 | Bacteria | 1415 |
| 67 | Ga0070681_10008490 | 3300005458 | Bacteria | 10055 |
| 68 | Ga0070681_10028181 | 3300005458 | Bacteria | 5647 |
| 69 | Ga0070681_10082635 | 3300005458 | Bacteria | 3167 |
| 70 | Ga0070681_10164785 | 3300005458 | Bacteria | 2139 |
| 71 | Ga0070681_10219690 | 3300005458 | Bacteria | 1815 |
| 72 | Ga0070681_10415779 | 3300005458 | Bacteria | 1256 |
| 73 | Ga0070681_10488975 | 3300005458 | Bacteria | 1143 |
| 74 | Ga0070681_10711261 | 3300005458 | Bacteria | 920 |
| 75 | Ga0070681_10869577 | 3300005458 | Bacteria | 819 |
| 76 | Ga0070699_100076728 | 3300005518 | Bacteria | 2909 |
| 77 | Ga0070679_100087848 | 3300005530 | Bacteria | 3096 |
| 78 | Ga0070679_100094128 | 3300005530 | Bacteria | 2983 |
| 79 | Ga0070679_100231236 | 3300005530 | Bacteria | 1808 |
| 80 | Ga0070679_100276783 | 3300005530 | Bacteria | 1631 |
| 81 | Ga0070679_100890424 | 3300005530 | Bacteria | 833 |
| 82 | Ga0070684_100038619 | 3300005535 | Bacteria | 4102 |
| 83 | Ga0070684_100164503 | 3300005535 | Bacteria | 2013 |
| 84 | Ga0070684_100205480 | 3300005535 | Bacteria | 1795 |
| 85 | Ga0070684_100205537 | 3300005535 | Bacteria | 1794 |
| 86 | Ga0070684_100208835 | 3300005535 | Bacteria | 1779 |
| 87 | Ga0070684_100267201 | 3300005535 | Unclassified | 1565 |
| 88 | Ga0070684_100903189 | 3300005535 | Bacteria | 827 |
| 89 | Ga0068853_100360858 | 3300005539 | Bacteria | 1353 |
| 90 | Ga0068853_100671994 | 3300005539 | Bacteria | 987 |
| 91 | Ga0068853_101064575 | 3300005539 | Bacteria | 779 |
| 92 | Ga0070686_100189089 | 3300005544 | Bacteria | 1468 |
| 93 | Ga0070686_100239196 | 3300005544 | Bacteria | 1321 |
| 94 | Ga0070695_100086659 | 3300005545 | Bacteria | 2081 |
| 95 | Ga0070696_100105557 | 3300005546 | Bacteria | 2024 |
| 96 | Ga0070693_100086088 | 3300005547 | Bacteria | 1884 |
| 97 | Ga0070693_100358776 | 3300005547 | Bacteria | 1000 |
| 98 | Ga0070693_100425220 | 3300005547 | Bacteria | 926 |
| 99 | Ga0070665_100080403 | 3300005548 | Bacteria | 3264 |
| 100 | Ga0070665_100648382 | 3300005548 | Bacteria | 1069 |
| 101 | Ga0068855_100013130 | 3300005563 | Bacteria | 9991 |
| 102 | Ga0068855_100068046 | 3300005563 | Bacteria | 4147 |
| 103 | Ga0068855_100197764 | 3300005563 | Bacteria | 2264 |
| 104 | Ga0068855_100198689 | 3300005563 | Bacteria | 2258 |
| 105 | Ga0068855_100204531 | 3300005563 | Bacteria | 2222 |
| 106 | Ga0068855_100254597 | 3300005563 | Bacteria | 1957 |
| 107 | Ga0068855_100259944 | 3300005563 | Bacteria | 1934 |
| 108 | Ga0068855_100342034 | 3300005563 | Bacteria | 1649 |
| 109 | Ga0070664_100153355 | 3300005564 | Bacteria | 2035 |
| 110 | Ga0070664_100238562 | 3300005564 | Bacteria | 1632 |
| 111 | Ga0070664_101356670 | 3300005564 | Bacteria | 672 |
| 112 | Ga0068857_100130624 | 3300005577 | Bacteria | 2265 |
| 113 | Ga0068857_100133707 | 3300005577 | Bacteria | 2239 |
| 114 | Ga0068854_100010961 | 3300005578 | Bacteria | 5882 |
| 115 | Ga0068854_100341720 | 3300005578 | Bacteria | 1223 |
| 116 | Ga0068854_101189352 | 3300005578 | Bacteria | 683 |
| 117 | Ga0068856_100004589 | 3300005614 | Bacteria | 13737 |
| 118 | Ga0068856_100112742 | 3300005614 | Bacteria | 2717 |
| 119 | Ga0068856_100310067 | 3300005614 | Bacteria | 1596 |
| 120 | Ga0070702_100012351 | 3300005615 | Bacteria | 4276 |
| 121 | Ga0068852_100007990 | 3300005616 | Bacteria | 7758 |
| 122 | Ga0068852_100125911 | 3300005616 | Bacteria | 2353 |
| 123 | Ga0068852_101000607 | 3300005616 | Bacteria | 855 |
| 124 | Ga0068859_100117675 | 3300005617 | Bacteria | 2723 |
| 125 | Ga0068864_100000015 | 3300005618 | Bacteria | 303368 |
| 126 | Ga0068861_100279508 | 3300005719 | Bacteria | 1437 |
| 127 | Ga0068851_10057190 | 3300005834 | Bacteria | 1991 |
| 128 | Ga0068851_10224728 | 3300005834 | Bacteria | 1056 |
| 129 | Ga0081455_10027035 | 3300005937 | Bacteria | 5264 |
| 130 | Ga0081455_10036701 | 3300005937 | Bacteria | 4359 |
| 131 | Ga0081538_10000020 | 3300005981 | Bacteria | 139567 |
| 132 | Ga0081538_10000200 | 3300005981 | Bacteria | 66229 |
| 133 | Ga0081538_10002312 | 3300005981 | Bacteria | 18817 |
| 134 | Ga0081538_10004968 | 3300005981 | Bacteria | 12112 |
| 135 | Ga0081538_10018534 | 3300005981 | Bacteria | 5221 |
| 136 | Ga0081538_10030012 | 3300005981 | Bacteria | 3701 |
| 137 | Ga0081538_10092738 | 3300005981 | Bacteria | 1554 |
| 138 | Ga0081538_10141626 | 3300005981 | Bacteria | 1108 |
| 139 | Ga0081539_10000740 | 3300005985 | Bacteria | 65387 |
| 140 | Ga0070717_10013706 | 3300006028 | Bacteria | 6220 |
| 141 | Ga0070717_10065065 | 3300006028 | Bacteria | 3030 |
| 142 | Ga0070717_10125947 | 3300006028 | Bacteria | 2199 |
| 143 | Ga0075365_10000294 | 3300006038 | Bacteria | 17330 |
| 144 | Ga0070712_100214240 | 3300006175 | Bacteria | 1521 |
| 145 | Ga0075367_10163661 | 3300006178 | Bacteria | 1384 |
| 146 | Ga0075367_10547390 | 3300006178 | Bacteria | 735 |
| 147 | Ga0097621_100100370 | 3300006237 | Bacteria | 2435 |
| 148 | Ga0068871_100137505 | 3300006358 | Bacteria | 2075 |
| 149 | Ga0068871_100146961 | 3300006358 | Bacteria | 2008 |
| 150 | Ga0068871_101179992 | 3300006358 | Bacteria | 718 |
| 151 | Ga0075428_100264010 | 3300006844 | Bacteria | 1853 |
| 152 | Ga0075430_100000896 | 3300006846 | Bacteria | 23379 |
| 153 | Ga0075430_100087100 | 3300006846 | Bacteria | 2613 |
| 154 | Ga0075431_100086472 | 3300006847 | Bacteria | 3235 |
| 155 | Ga0075433_10096866 | 3300006852 | Bacteria | 2611 |
| 156 | Ga0075433_10384546 | 3300006852 | Bacteria | 1239 |
| 157 | Ga0075433_11075244 | 3300006852 | Bacteria | 700 |
| 158 | Ga0075434_100000288 | 3300006871 | Bacteria | 35846 |
| 159 | Ga0075434_100018510 | 3300006871 | Bacteria | 6731 |
| 160 | Ga0075434_101344590 | 3300006871 | Bacteria | 725 |
| 161 | Ga0068865_100287330 | 3300006881 | Bacteria | 1311 |
| 162 | Ga0097620_100117671 | 3300006931 | Bacteria | 2723 |
| 163 | Ga0075435_100009347 | 3300007076 | Bacteria | 7091 |
| 164 | Ga0075435_100455318 | 3300007076 | Bacteria | 1104 |
| 165 | Ga0105240_10077895 | 3300009093 | Bacteria | 4083 |
| 166 | Ga0105240_10104814 | 3300009093 | Bacteria | 3434 |
| 167 | Ga0105240_10201527 | 3300009093 | Bacteria | 2332 |
| 168 | Ga0105240_10523857 | 3300009093 | Bacteria | 1315 |
| 169 | Ga0105240_10546866 | 3300009093 | Bacteria | 1282 |
| 170 | Ga0105240_10797374 | 3300009093 | Bacteria | 1023 |
| 171 | Ga0111539_10044032 | 3300009094 | Bacteria | 5349 |
| 172 | Ga0111539_10993146 | 3300009094 | Bacteria | 976 |
| 173 | Ga0105245_10020014 | 3300009098 | Bacteria | 5866 |
| 174 | Ga0105245_10077422 | 3300009098 | Bacteria | 3032 |
| 175 | Ga0105247_10328782 | 3300009101 | Bacteria | 1069 |
| 176 | Ga0114129_10167769 | 3300009147 | Bacteria | 2994 |
| 177 | Ga0114129_12578874 | 3300009147 | Bacteria | 607 |
| 178 | Ga0105243_10145258 | 3300009148 | Bacteria | 2029 |
| 179 | Ga0105243_10157670 | 3300009148 | Bacteria | 1954 |
| 180 | Ga0105243_10410532 | 3300009148 | Bacteria | 1260 |
| 181 | Ga0105241_10232388 | 3300009174 | Bacteria | 1555 |
| 182 | Ga0105241_10261041 | 3300009174 | Bacteria | 1472 |
| 183 | Ga0105242_10069847 | 3300009176 | Bacteria | 2910 |
| 184 | Ga0105242_10462381 | 3300009176 | Bacteria | 1198 |
| 185 | Ga0105242_10585861 | 3300009176 | Bacteria | 1075 |
| 186 | Ga0105248_10153320 | 3300009177 | Bacteria | 2599 |
| 187 | Ga0105237_10065849 | 3300009545 | Bacteria | 3618 |
| 188 | Ga0105237_10076796 | 3300009545 | Bacteria | 3330 |
| 189 | Ga0105237_10275223 | 3300009545 | Bacteria | 1686 |
| 190 | Ga0105237_10808913 | 3300009545 | Bacteria | 944 |
| 191 | Ga0105238_10016816 | 3300009551 | Bacteria | 7417 |
| 192 | Ga0105238_10024093 | 3300009551 | Bacteria | 6205 |
| 193 | Ga0105238_10029238 | 3300009551 | Bacteria | 5615 |
| 194 | Ga0105249_10332080 | 3300009553 | Bacteria | 1534 |
| 195 | Ga0105239_10165256 | 3300010375 | Bacteria | 2474 |
| 196 | Ga0105239_10175948 | 3300010375 | Bacteria | 2393 |
| 197 | Ga0105239_11099000 | 3300010375 | Bacteria | 915 |
| 198 | Ga0157373_10029236 | 3300013100 | Bacteria | 3972 |
| 199 | Ga0157371_10589044 | 3300013102 | Bacteria | 827 |
| 200 | Ga0157370_10004882 | 3300013104 | Bacteria | 15217 |
| 201 | Ga0157370_10294487 | 3300013104 | Bacteria | 1499 |
| 202 | Ga0157370_10712675 | 3300013104 | Bacteria | 916 |
| 203 | Ga0157370_10832155 | 3300013104 | Bacteria | 839 |
| 204 | Ga0157369_10006129 | 3300013105 | Bacteria | 13955 |
| 205 | Ga0157369_10018632 | 3300013105 | Bacteria | 7782 |
| 206 | Ga0157369_10078611 | 3300013105 | Bacteria | 3534 |
| 207 | Ga0157369_10103686 | 3300013105 | Bacteria | 3030 |
| 208 | Ga0157369_10438866 | 3300013105 | Bacteria | 1353 |
| 209 | Ga0157369_10771483 | 3300013105 | Bacteria | 988 |
| 210 | Ga0157369_10850138 | 3300013105 | Bacteria | 937 |
| 211 | Ga0157369_11294942 | 3300013105 | Unclassified | 743 |
| 212 | Ga0157374_10043473 | 3300013296 | Bacteria | 4151 |
| 213 | Ga0157374_10647685 | 3300013296 | Bacteria | 1068 |
| 214 | Ga0157378_10801385 | 3300013297 | Unclassified | 968 |
| 215 | Ga0157372_10016430 | 3300013307 | Bacteria | 7941 |
| 216 | Ga0157372_10067351 | 3300013307 | Bacteria | 4023 |
| 217 | Ga0157372_10069442 | 3300013307 | Bacteria | 3962 |
| 218 | Ga0157372_10301713 | 3300013307 | Bacteria | 1863 |
| 219 | Ga0163163_10005491 | 3300014325 | Bacteria | 10972 |
| 220 | Ga0157377_10000811 | 3300014745 | Bacteria | 12922 |
| 221 | Ga0157376_10012411 | 3300014969 | Bacteria | 6324 |
| 222 | Ga0157376_10216561 | 3300014969 | Bacteria | 1771 |
| 223 | Ga0163161_10282932 | 3300017792 | Bacteria | 1301 |
| 224 | Ga0206356_11241351 | 3300020070 | Bacteria | 1384 |
| 225 | Ga0206356_11351312 | 3300020070 | Bacteria | 4885 |
| 226 | Ga0206354_11219733 | 3300020081 | Bacteria | 769 |
| 227 | Ga0206354_11394741 | 3300020081 | Bacteria | 2834 |
| 228 | Ga0206354_11560368 | 3300020081 | Bacteria | 1001 |
| 229 | Ga0206354_11656200 | 3300020081 | Bacteria | 2490 |
| 230 | Ga0206353_10100840 | 3300020082 | Bacteria | 1034 |
| 231 | Ga0206353_10260902 | 3300020082 | Bacteria | 2037 |
| 232 | Ga0206353_10785855 | 3300020082 | Bacteria | 945 |
| 233 | Ga0206353_10797388 | 3300020082 | Bacteria | 6861 |
| 234 | Ga0206353_11184676 | 3300020082 | Bacteria | 1862 |
| 235 | Ga0206353_11315790 | 3300020082 | Bacteria | 1329 |
| 236 | Ga0206353_11465659 | 3300020082 | Bacteria | 3752 |
| 237 | Ga0213874_10000264 | 3300021377 | Bacteria | 10100 |
| 238 | Ga0213876_10014761 | 3300021384 | Bacteria | 4140 |
| 239 | Ga0213876_10023263 | 3300021384 | Bacteria | 3273 |
| 240 | Ga0213875_10011438 | 3300021388 | Bacteria | 4416 |
| 241 | Ga0213875_10016071 | 3300021388 | Bacteria | 3631 |
| 242 | Ga0213875_10141173 | 3300021388 | Bacteria | 1127 |
| 243 | Ga0207642_10051877 | 3300025899 | Bacteria | 1858 |
| 244 | Ga0207710_10149755 | 3300025900 | Bacteria | 1131 |
| 245 | Ga0207680_10034303 | 3300025903 | Bacteria | 2903 |
| 246 | Ga0207647_10137924 | 3300025904 | Bacteria | 1430 |
| 247 | Ga0207699_10016150 | 3300025906 | Bacteria | 3897 |
| 248 | Ga0207699_10222621 | 3300025906 | Bacteria | 1289 |
| 249 | Ga0207643_10124032 | 3300025908 | Bacteria | 1532 |
| 250 | Ga0207705_10024033 | 3300025909 | Bacteria | 4348 |
| 251 | Ga0207705_10045265 | 3300025909 | Bacteria | 3163 |
| 252 | Ga0207705_10049149 | 3300025909 | Bacteria | 3036 |
| 253 | Ga0207705_10169123 | 3300025909 | Unclassified | 1645 |
| 254 | Ga0207705_10495966 | 3300025909 | Bacteria | 948 |
| 255 | Ga0207654_10126066 | 3300025911 | Bacteria | 1614 |
| 256 | Ga0207654_10202229 | 3300025911 | Bacteria | 1308 |
| 257 | Ga0207654_10280082 | 3300025911 | Bacteria | 1128 |
| 258 | Ga0207707_10002473 | 3300025912 | Bacteria | 16636 |
| 259 | Ga0207707_10023064 | 3300025912 | Bacteria | 5445 |
| 260 | Ga0207707_10072100 | 3300025912 | Bacteria | 3011 |
| 261 | Ga0207707_10094470 | 3300025912 | Bacteria | 2612 |
| 262 | Ga0207707_10176146 | 3300025912 | Bacteria | 1868 |
| 263 | Ga0207707_10176916 | 3300025912 | Bacteria | 1864 |
| 264 | Ga0207707_10423102 | 3300025912 | Unclassified | 1142 |
| 265 | Ga0207671_10268542 | 3300025914 | Bacteria | 1344 |
| 266 | Ga0207671_10305684 | 3300025914 | Bacteria | 1257 |
| 267 | Ga0207693_10148398 | 3300025915 | Bacteria | 1844 |
| 268 | Ga0207660_10008507 | 3300025917 | Bacteria | 6638 |
| 269 | Ga0207660_10096024 | 3300025917 | Bacteria | 2206 |
| 270 | Ga0207660_10098807 | 3300025917 | Bacteria | 2178 |
| 271 | Ga0207660_10240320 | 3300025917 | Bacteria | 1426 |
| 272 | Ga0207662_10032222 | 3300025918 | Bacteria | 3049 |
| 273 | Ga0207657_10001972 | 3300025919 | Bacteria | 22152 |
| 274 | Ga0207657_10019359 | 3300025919 | Bacteria | 6467 |
| 275 | Ga0207657_10033039 | 3300025919 | Bacteria | 4668 |
| 276 | Ga0207657_10105190 | 3300025919 | Bacteria | 2337 |
| 277 | Ga0207657_10522883 | 3300025919 | Bacteria | 928 |
| 278 | Ga0207657_10522884 | 3300025919 | Bacteria | 928 |
| 279 | Ga0207657_10586744 | 3300025919 | Bacteria | 870 |
| 280 | Ga0207649_10026261 | 3300025920 | Bacteria | 3405 |
| 281 | Ga0207649_10127346 | 3300025920 | Bacteria | 1725 |
| 282 | Ga0207649_10177829 | 3300025920 | Bacteria | 1487 |
| 283 | Ga0207649_10662271 | 3300025920 | Bacteria | 807 |
| 284 | Ga0207652_10067465 | 3300025921 | Bacteria | 3102 |
| 285 | Ga0207652_10086258 | 3300025921 | Bacteria | 2752 |
| 286 | Ga0207652_10142945 | 3300025921 | Bacteria | 2140 |
| 287 | Ga0207652_10262084 | 3300025921 | Bacteria | 1559 |
| 288 | Ga0207652_10774381 | 3300025921 | Bacteria | 853 |
| 289 | Ga0207694_10102874 | 3300025924 | Bacteria | 2265 |
| 290 | Ga0207694_10124866 | 3300025924 | Bacteria | 2058 |
| 291 | Ga0207687_10003687 | 3300025927 | Bacteria | 10313 |
| 292 | Ga0207687_10149839 | 3300025927 | Bacteria | 1779 |
| 293 | Ga0207700_10127214 | 3300025928 | Bacteria | 2075 |
| 294 | Ga0207700_10523891 | 3300025928 | Unclassified | 1050 |
| 295 | Ga0207700_10945947 | 3300025928 | Bacteria | 771 |
| 296 | Ga0207664_10060093 | 3300025929 | Bacteria | 3029 |
| 297 | Ga0207664_10118764 | 3300025929 | Unclassified | 2209 |
| 298 | Ga0207664_10140364 | 3300025929 | Bacteria | 2043 |
| 299 | Ga0207664_10191297 | 3300025929 | Bacteria | 1762 |
| 300 | Ga0207664_10516200 | 3300025929 | Bacteria | 1071 |
| 301 | Ga0207644_10115487 | 3300025931 | Bacteria | 2036 |
| 302 | Ga0207644_10121456 | 3300025931 | Bacteria | 1989 |
| 303 | Ga0207690_10012160 | 3300025932 | Bacteria | 5150 |
| 304 | Ga0207690_10050575 | 3300025932 | Bacteria | 2775 |
| 305 | Ga0207690_10070800 | 3300025932 | Bacteria | 2403 |
| 306 | Ga0207706_10393403 | 3300025933 | Bacteria | 1202 |
| 307 | Ga0207686_10280770 | 3300025934 | Bacteria | 1229 |
| 308 | Ga0207709_10053325 | 3300025935 | Bacteria | 2488 |
| 309 | Ga0207709_10415859 | 3300025935 | Bacteria | 1032 |
| 310 | Ga0207669_10421050 | 3300025937 | Bacteria | 1051 |
| 311 | Ga0207704_10420651 | 3300025938 | Bacteria | 1059 |
| 312 | Ga0207665_10213942 | 3300025939 | Bacteria | 1409 |
| 313 | Ga0207711_10369982 | 3300025941 | Bacteria | 1329 |
| 314 | Ga0207711_10624605 | 3300025941 | Bacteria | 1005 |
| 315 | Ga0207689_10051166 | 3300025942 | Bacteria | 3405 |
| 316 | Ga0207661_10203749 | 3300025944 | Bacteria | 1740 |
| 317 | Ga0207661_10301286 | 3300025944 | Bacteria | 1437 |
| 318 | Ga0207661_10490526 | 3300025944 | Bacteria | 1122 |
| 319 | Ga0207661_10810375 | 3300025944 | Bacteria | 862 |
| 320 | Ga0207679_10259310 | 3300025945 | Bacteria | 1482 |
| 321 | Ga0207679_10937971 | 3300025945 | Bacteria | 792 |
| 322 | Ga0207667_10063012 | 3300025949 | Bacteria | 3875 |
| 323 | Ga0207667_10078675 | 3300025949 | Bacteria | 3417 |
| 324 | Ga0207667_10159174 | 3300025949 | Bacteria | 2323 |
| 325 | Ga0207667_10225442 | 3300025949 | Bacteria | 1920 |
| 326 | Ga0207667_10227218 | 3300025949 | Bacteria | 1912 |
| 327 | Ga0207667_10262874 | 3300025949 | Unclassified | 1764 |
| 328 | Ga0207712_10241330 | 3300025961 | Bacteria | 1456 |
| 329 | Ga0207668_10082426 | 3300025972 | Bacteria | 2337 |
| 330 | Ga0207677_10010576 | 3300026023 | Bacteria | 5228 |
| 331 | Ga0207639_10108692 | 3300026041 | Bacteria | 2255 |
| 332 | Ga0207639_10278971 | 3300026041 | Bacteria | 1469 |
| 333 | Ga0207639_10297756 | 3300026041 | Bacteria | 1425 |
| 334 | Ga0207678_10154748 | 3300026067 | Bacteria | 1957 |
| 335 | Ga0207678_10899868 | 3300026067 | Bacteria | 783 |
| 336 | Ga0207708_10253896 | 3300026075 | Bacteria | 1418 |
| 337 | Ga0207708_10408152 | 3300026075 | Bacteria | 1125 |
| 338 | Ga0207702_10008420 | 3300026078 | Bacteria | 8701 |
| 339 | Ga0207702_10130349 | 3300026078 | Bacteria | 2262 |
| 340 | Ga0207702_10179603 | 3300026078 | Bacteria | 1948 |
| 341 | Ga0207676_10000018 | 3300026095 | Bacteria | 306375 |
| 342 | Ga0207674_10072348 | 3300026116 | Bacteria | 3464 |
| 343 | Ga0207674_10296967 | 3300026116 | Bacteria | 1564 |
| 344 | Ga0207675_100360851 | 3300026118 | Bacteria | 1425 |
| 345 | Ga0207683_10005639 | 3300026121 | Bacteria | 10734 |
| 346 | Ga0207698_10000004 | 3300026142 | Bacteria | 313614 |
| 347 | Ga0207698_10092693 | 3300026142 | Bacteria | 2477 |
| 348 | Ga0207698_10164327 | 3300026142 | Bacteria | 1946 |
| 349 | Ga0207698_10314886 | 3300026142 | Unclassified | 1463 |
| 350 | Ga0207698_10443532 | 3300026142 | Bacteria | 1251 |
| 351 | Ga0209813_10105462 | 3300027866 | Unclassified | 964 |
| 352 | Ga0268266_10632639 | 3300028379 | Bacteria | 1029 |
| 353 | Ga0268265_10509743 | 3300028380 | Bacteria | 1135 |
| 354 | Ga0265337_1009785 | 3300028556 | Bacteria | 3401 |
| 355 | Ga0265326_10000757 | 3300028558 | Bacteria | 11956 |
| 356 | Ga0265319_1000842 | 3300028563 | Bacteria | 19569 |
| 357 | Ga0265319_1072360 | 3300028563 | Bacteria | 1103 |
| 358 | Ga0265334_10012155 | 3300028573 | Bacteria | 3617 |
| 359 | Ga0265318_10007046 | 3300028577 | Bacteria | 5120 |
| 360 | Ga0265318_10013959 | 3300028577 | Bacteria | 3380 |
| 361 | Ga0265318_10079004 | 3300028577 | Bacteria | 1216 |
| 362 | Ga0265322_10012985 | 3300028654 | Bacteria | 2411 |
| 363 | Ga0265322_10086042 | 3300028654 | Bacteria | 892 |
| 364 | Ga0265336_10000005 | 3300028666 | Bacteria | 399349 |
| 365 | Ga0265338_10000001 | 3300028800 | Bacteria | 1177449 |
| 366 | Ga0265338_10019418 | 3300028800 | Bacteria | 7212 |
| 367 | Ga0265324_10010261 | 3300029957 | Bacteria | 3620 |
| 368 | Ga0265320_10061377 | 3300031240 | Bacteria | 1792 |
| 369 | Ga0265325_10011163 | 3300031241 | Bacteria | 5169 |
| 370 | Ga0265340_10000001 | 3300031247 | Bacteria | 1647668 |
| 371 | Ga0265340_10084132 | 3300031247 | Bacteria | 1494 |
| 372 | Ga0265339_10017306 | 3300031249 | Bacteria | 4273 |
| 373 | Ga0265327_10042695 | 3300031251 | Bacteria | 2432 |
| 374 | Ga0265327_10043117 | 3300031251 | Bacteria | 2417 |
| 375 | Ga0265316_10044788 | 3300031344 | Bacteria | 3516 |
| 376 | Ga0307408_100111396 | 3300031548 | Bacteria | 2103 |
| 377 | Ga0265313_10005262 | 3300031595 | Bacteria | 9580 |
| 378 | Ga0265313_10093375 | 3300031595 | Bacteria | 1346 |
| 379 | Ga0265314_10015874 | 3300031711 | Bacteria | 5964 |
| 380 | Ga0265314_10306141 | 3300031711 | Bacteria | 889 |
| 381 | Ga0265342_10069045 | 3300031712 | Bacteria | 2064 |
| 382 | Ga0307405_10445458 | 3300031731 | Bacteria | 1025 |
| 383 | Ga0307413_10088056 | 3300031824 | Bacteria | 2013 |
| 384 | Ga0307406_10023996 | 3300031901 | Bacteria | 3637 |
| 385 | Ga0307406_10059658 | 3300031901 | Bacteria | 2457 |
| 386 | Ga0307406_10153133 | 3300031901 | Bacteria | 1647 |
| 387 | Ga0307407_10274770 | 3300031903 | Bacteria | 1164 |
| 388 | Ga0307409_100821487 | 3300031995 | Bacteria | 938 |
| 389 | Ga0307416_100049028 | 3300032002 | Bacteria | 3355 |
| 390 | Ga0307416_100931111 | 3300032002 | Bacteria | 970 |
| 391 | Ga0307414_10354348 | 3300032004 | Bacteria | 1261 |
| 392 | Ga0307415_100593433 | 3300032126 | Bacteria | 984 |
| 393 | Ga0373934_0053026 | 3300035086 | Bacteria | 1609 |
| 394 | Ga0373944_0005822 | 3300035089 | Bacteria | 3260 |
| 395 | Ga0373944_0094392 | 3300035089 | Bacteria | 1003 |
| 396 | Ga0373923_0027686 | 3300035111 | Bacteria | 2262 |
| 397 | Ga0373923_0056623 | 3300035111 | Bacteria | 1656 |
| 398 | Ga0373936_0112275 | 3300035113 | Bacteria | 1158 |
| 399 | Ga0373945_0005048 | 3300035116 | Bacteria | 4205 |
| 400 | Ga0373945_0124517 | 3300035116 | Bacteria | 1027 |
| 401 | Ga0373953_0097348 | 3300035117 | Bacteria | 1236 |
| 402 | Ga0373943_0000948 | 3300035170 | Bacteria | 12836 |
| 403 | Ga0373943_0005005 | 3300035170 | Bacteria | 5977 |
| 404 | Ga0373946_0028313 | 3300035171 | Bacteria | 2222 |
| 405 | Ga0373946_0034334 | 3300035171 | Bacteria | 2048 |
| 406 | Ga0373955_0014289 | 3300035172 | Bacteria | 3859 |
| 407 | Ga0373955_0081204 | 3300035172 | Bacteria | 1832 |
| 408 | Ga0373924_0103454 | 3300035410 | Bacteria | 1226 |
| 409 | Ga0373935_0039711 | 3300035692 | Bacteria | 2951 |
| 410 | Ga0373935_0092235 | 3300035692 | Bacteria | 1984 |
| 411 | Ga0373927_0013935 | 3300035695 | Bacteria | 5334 |
| 412 | Ga0373927_0188986 | 3300035695 | Bacteria | 1351 |
| 413 | Ga0373933_0138036 | 3300035724 | Bacteria | 1537 |
| 414 | Ga0373947_0003156 | 3300035725 | Bacteria | 9813 |
| 415 | Ga0373947_0020606 | 3300035725 | Bacteria | 3808 |
| 416 | Ga0373937_0073679 | 3300036401 | Bacteria | 3150 |
| 417 | Ga0373937_0242408 | 3300036401 | Bacteria | 1698 |
| 418 | Ga0373925_0013684 | 3300037068 | Bacteria | 5875 |
| 419 | Ga0395900_0026920 | 3300037418 | Bacteria | 5886 |
| 420 | Ga0395900_0176437 | 3300037418 | Bacteria | 2173 |
| 421 | Ga0395900_0389205 | 3300037418 | Bacteria | 1360 |
| 422 | Ga0395900_0568862 | 3300037418 | Bacteria | 1076 |
| 423 | Ga0395900_1014184 | 3300037418 | Bacteria | 750 |
| 424 | Ga0395898_0001107 | 3300037466 | Bacteria | 41584 |
| 425 | Ga0395898_0002378 | 3300037466 | Bacteria | 22342 |
| 426 | Ga0395898_0272877 | 3300037466 | Bacteria | 1613 |
| 427 | Ga0395898_0516897 | 3300037466 | Unclassified | 1135 |
| 428 | Ga0395898_0891579 | 3300037466 | Bacteria | 828 |
| 429 | Ga0395905_0412021 | 3300037471 | Bacteria | 1247 |
| 430 | Ga0436364_0324999 | 3300037853 | Bacteria | 16084 |
| 431 | Ga0436364_0679661 | 3300037853 | Bacteria | 7415 |
| 432 | Ga0436364_1504966 | 3300037853 | Bacteria | 4206 |
| 433 | Ga0395901_0003426 | 3300038443 | Bacteria | 15984 |
| 434 | Ga0395901_0009580 | 3300038443 | Bacteria | 9830 |
| 435 | Ga0395901_0014827 | 3300038443 | Bacteria | 7918 |
| 436 | Ga0395901_0280896 | 3300038443 | Bacteria | 1730 |
| 437 | Ga0395901_0587348 | 3300038443 | Bacteria | 1125 |
| 438 | Ga0395901_1617830 | 3300038443 | Bacteria | 601 |
| 439 | Ga0436365_0179721 | 3300039437 | Bacteria | 17630 |
| 440 | Ga0436365_0253877 | 3300039437 | Bacteria | 2223 |
| 441 | Ga0436365_0268135 | 3300039437 | Unclassified | 997 |
| 442 | Ga0436365_0268336 | 3300039437 | Bacteria | 814 |
| 443 | Ga0436365_0388251 | 3300039437 | Bacteria | 1057 |
| 444 | Ga0436365_0903847 | 3300039437 | Bacteria | 1896 |
| 445 | Ga0436365_1168763 | 3300039437 | Bacteria | 90017 |
| 446 | Ga0436365_1380658 | 3300039437 | Bacteria | 17187 |
| 447 | Ga0436365_1915237 | 3300039437 | Bacteria | 2463 |
| 448 | Ga0436363_0130947 | 3300039450 | Bacteria | 4705 |
| 449 | Ga0436363_0270595 | 3300039450 | Bacteria | 832 |
| 450 | Ga0436363_0357892 | 3300039450 | Bacteria | 5705 |
| 451 | Ga0436363_0414720 | 3300039450 | Bacteria | 1758 |
| 452 | Ga0436363_0889395 | 3300039450 | Bacteria | 1043 |
| 453 | Ga0436363_1028583 | 3300039450 | Bacteria | 13936 |
| 454 | Ga0436363_1424363 | 3300039450 | Bacteria | 1571 |
| 455 | Ga0436363_1582569 | 3300039450 | Bacteria | 1406 |
| 456 | Ga0436362_0250370 | 3300039453 | Bacteria | 2343 |
| 457 | Ga0436362_1242845 | 3300039453 | Bacteria | 3881 |
| 458 | Ga0451835_0797243 | 3300041492 | Bacteria | 725 |
| 459 | Ga0451849_0689619 | 3300041505 | Bacteria | 1224 |
| 460 | Ga0451853_2929055 | 3300041512 | Bacteria | 925 |
| 461 | Ga0439448_0089687 | 3300042005 | Bacteria | 1038 |
| 462 | Ga0439464_0027573 | 3300042439 | Bacteria | 1580 |
| 463 | Ga0439440_0012953 | 3300042993 | Bacteria | 1781 |
| 464 | Ga0466969_0343593 | 3300044656 | Bacteria | 676 |
| 465 | Ga0466966_0015990 | 3300044684 | Bacteria | 4961 |
| 466 | Ga0466966_0026087 | 3300044684 | Bacteria | 3815 |
| 467 | Ga0466966_0041440 | 3300044684 | Bacteria | 2959 |
| 468 | Ga0466961_0008119 | 3300044693 | Bacteria | 6683 |
| 469 | Ga0466961_0020291 | 3300044693 | Bacteria | 4275 |
| 470 | Ga0466961_0064965 | 3300044693 | Bacteria | 2319 |
| 471 | Ga0466961_0066735 | 3300044693 | Bacteria | 2285 |
| 472 | Ga0466961_0140784 | 3300044693 | Bacteria | 1510 |
| 473 | Ga0466961_0524407 | 3300044693 | Unclassified | 714 |
| 474 | Ga0466963_0000353 | 3300044694 | Bacteria | 20819 |
| 475 | Ga0466963_0001104 | 3300044694 | Bacteria | 14058 |
| 476 | Ga0466963_0016032 | 3300044694 | Bacteria | 4653 |
| 477 | Ga0466963_0016292 | 3300044694 | Bacteria | 4620 |
| 478 | Ga0466963_0037220 | 3300044694 | Bacteria | 3176 |
| 479 | Ga0466963_0068016 | 3300044694 | Bacteria | 2391 |
| 480 | Ga0466963_0221103 | 3300044694 | Bacteria | 1326 |
| 481 | Ga0466963_0232998 | 3300044694 | Bacteria | 1290 |
| 482 | Ga0466963_0308540 | 3300044694 | Bacteria | 1113 |
| 483 | Ga0466963_0430999 | 3300044694 | Bacteria | 930 |
| 484 | Ga0466963_0454273 | 3300044694 | Bacteria | 904 |
| 485 | Ga0466963_0517100 | 3300044694 | Bacteria | 843 |
| 486 | Ga0466964_0004892 | 3300044706 | Bacteria | 4951 |
| 487 | Ga0466964_0008108 | 3300044706 | Bacteria | 3940 |
| 488 | Ga0466964_0014919 | 3300044706 | Bacteria | 2959 |
| 489 | Ga0466964_0097495 | 3300044706 | Bacteria | 1290 |
| 490 | Ga0466964_0098566 | 3300044706 | Bacteria | 1284 |
| 491 | Ga0466964_0120990 | 3300044706 | Bacteria | 1180 |
| 492 | Ga0466964_0125951 | 3300044706 | Bacteria | 1160 |
| 493 | Ga0466964_0239502 | 3300044706 | Bacteria | 889 |
| 494 | Ga0466964_0249427 | 3300044706 | Bacteria | 874 |
| 495 | Ga0466964_0429241 | 3300044706 | Bacteria | 696 |
| 496 | Ga0466971_0046888 | 3300044719 | Bacteria | 1942 |
| 497 | Ga0466971_0063726 | 3300044719 | Bacteria | 1668 |
| 498 | Ga0466971_0248394 | 3300044719 | Bacteria | 847 |
| 499 | Ga0466968_0015782 | 3300044735 | Bacteria | 3000 |
| 500 | Ga0466968_0090495 | 3300044735 | Bacteria | 1355 |
| 501 | Ga0466968_0117558 | 3300044735 | Bacteria | 1201 |
| 502 | Ga0466968_0120121 | 3300044735 | Bacteria | 1188 |
| 503 | Ga0466970_0124656 | 3300044765 | Bacteria | 1412 |
| 504 | Ga0466970_0131844 | 3300044765 | Bacteria | 1373 |
| 505 | Ga0466970_0169407 | 3300044765 | Bacteria | 1210 |
| 506 | Ga0466957_0036258 | 3300044842 | Bacteria | 2964 |
| 507 | Ga0466957_0059881 | 3300044842 | Bacteria | 2335 |
| 508 | Ga0466957_0071816 | 3300044842 | Bacteria | 2141 |
| 509 | Ga0466957_0216887 | 3300044842 | Bacteria | 1262 |
| 510 | Ga0466957_0298214 | 3300044842 | Bacteria | 1082 |
| 511 | Ga0466957_0719380 | 3300044842 | Unclassified | 706 |
| 512 | Ga0466960_0303717 | 3300044901 | Bacteria | 900 |
| 513 | Ga0466959_0014461 | 3300045049 | Bacteria | 5735 |
| 514 | Ga0466959_0071515 | 3300045049 | Bacteria | 2512 |
| 515 | Ga0466959_0091009 | 3300045049 | Bacteria | 2191 |
| 516 | Ga0466959_0101400 | 3300045049 | Bacteria | 2060 |
| 517 | Ga0466959_0229720 | 3300045049 | Unclassified | 1284 |
| 518 | Ga0466959_0388032 | 3300045049 | Bacteria | 950 |
| 519 | Ga0466959_0701767 | 3300045049 | Bacteria | 678 |
| 520 | Ga0466958_0001260 | 3300045836 | Bacteria | 11862 |
| 521 | Ga0466958_0015866 | 3300045836 | Bacteria | 4329 |
| 522 | Ga0466958_0021158 | 3300045836 | Bacteria | 3797 |
| 523 | Ga0466958_0036094 | 3300045836 | Bacteria | 2957 |
| 524 | Ga0466958_0119627 | 3300045836 | Bacteria | 1648 |
| 525 | Ga0466958_0125161 | 3300045836 | Bacteria | 1611 |
| 526 | Ga0466958_0157298 | 3300045836 | Bacteria | 1435 |
| 527 | Ga0466958_0159647 | 3300045836 | Bacteria | 1424 |
| 528 | Ga0466958_0238913 | 3300045836 | Bacteria | 1161 |
| 529 | Ga0466958_0245956 | 3300045836 | Bacteria | 1143 |
| 530 | Ga0466958_0287806 | 3300045836 | Bacteria | 1054 |
| 531 | Ga0466958_0348029 | 3300045836 | Bacteria | 954 |
| 532 | Ga0466967_0002964 | 3300045976 | Bacteria | 10850 |
| 533 | Ga0466967_0018586 | 3300045976 | Bacteria | 5560 |
| 534 | Ga0466967_0021070 | 3300045976 | Bacteria | 5282 |
| 535 | Ga0466967_0021859 | 3300045976 | Bacteria | 5205 |
| 536 | Ga0466967_0042543 | 3300045976 | Bacteria | 3926 |
| 537 | Ga0466967_0044590 | 3300045976 | Bacteria | 3847 |
| 538 | Ga0466967_0073945 | 3300045976 | Bacteria | 3059 |
| 539 | Ga0466967_0088670 | 3300045976 | Bacteria | 2808 |
| 540 | Ga0466967_0130719 | 3300045976 | Bacteria | 2330 |
| 541 | Ga0466967_0150541 | 3300045976 | Bacteria | 2174 |
| 542 | Ga0466967_0151283 | 3300045976 | Bacteria | 2169 |
| 543 | Ga0466967_0201179 | 3300045976 | Bacteria | 1887 |
| 544 | Ga0466967_0203962 | 3300045976 | Bacteria | 1873 |
| 545 | Ga0466967_0296615 | 3300045976 | Bacteria | 1554 |
| 546 | Ga0466967_0315665 | 3300045976 | Bacteria | 1506 |
| 547 | Ga0466967_0336728 | 3300045976 | Bacteria | 1458 |
| 548 | Ga0466967_0375265 | 3300045976 | Bacteria | 1380 |
| 549 | Ga0466967_0411275 | 3300045976 | Bacteria | 1317 |
| 550 | Ga0466967_0423767 | 3300045976 | Bacteria | 1297 |
| 551 | Ga0466967_0513159 | 3300045976 | Bacteria | 1177 |
| 552 | Ga0466967_0555933 | 3300045976 | Bacteria | 1130 |
| 553 | Ga0466967_0572875 | 3300045976 | Bacteria | 1112 |
| 554 | Ga0466967_0743987 | 3300045976 | Bacteria | 972 |
| 555 | Ga0466967_0933418 | 3300045976 | Unclassified | 863 |
| 556 | Ga0466967_0985073 | 3300045976 | Bacteria | 839 |
| 557 | Ga0466967_1141426 | 3300045976 | Bacteria | 776 |
| 558 | Ga0495592_0094096 | 3300046454 | Bacteria | 2145 |
| 559 | Ga0495592_0279435 | 3300046454 | Bacteria | 1092 |
| 560 | Ga0495603_0015739 | 3300046455 | Bacteria | 4574 |
| 561 | Ga0495603_0337894 | 3300046455 | Bacteria | 864 |
| 562 | Ga0495629_0009258 | 3300046459 | Bacteria | 7205 |
| 563 | Ga0495629_0020903 | 3300046459 | Bacteria | 4672 |
| 564 | Ga0495629_0100124 | 3300046459 | Bacteria | 2022 |
| 565 | Ga0495641_0000793 | 3300046461 | Bacteria | 26791 |
| 566 | Ga0495641_0164725 | 3300046461 | Bacteria | 992 |
| 567 | Ga0495651_0039755 | 3300046462 | Bacteria | 3660 |
| 568 | Ga0495651_0105476 | 3300046462 | Bacteria | 2090 |
| 569 | Ga0495651_0113961 | 3300046462 | Bacteria | 1995 |
| 570 | Ga0495653_0056093 | 3300046463 | Bacteria | 3004 |
| 571 | Ga0495653_0064595 | 3300046463 | Bacteria | 2757 |
| 572 | Ga0495653_0073341 | 3300046463 | Bacteria | 2554 |
| 573 | Ga0495580_0026424 | 3300046472 | Bacteria | 4232 |
| 574 | Ga0495580_0101146 | 3300046472 | Bacteria | 2005 |
| 575 | Ga0495582_0003686 | 3300046473 | Bacteria | 8633 |
| 576 | Ga0495582_0004168 | 3300046473 | Bacteria | 8126 |
| 577 | Ga0495582_0033145 | 3300046473 | Bacteria | 2839 |
| 578 | Ga0495605_0066459 | 3300046474 | Bacteria | 1713 |
| 579 | Ga0495639_0002486 | 3300046475 | Bacteria | 8042 |
| 580 | Ga0495639_0019251 | 3300046475 | Bacteria | 2978 |
| 581 | Ga0495639_0095558 | 3300046475 | Bacteria | 1398 |
| 582 | Ga0495662_0003248 | 3300046476 | Bacteria | 8215 |
| 583 | Ga0495662_0005102 | 3300046476 | Bacteria | 6577 |
| 584 | Ga0495664_0018878 | 3300046477 | Bacteria | 3958 |
| 585 | Ga0495664_0061057 | 3300046477 | Bacteria | 2245 |
| 586 | Ga0495664_0067639 | 3300046477 | Bacteria | 2131 |
| 587 | Ga0495594_0017126 | 3300046499 | Bacteria | 3825 |
| 588 | Ga0495596_0061427 | 3300046500 | Bacteria | 1463 |
| 589 | Ga0495608_0010163 | 3300046511 | Bacteria | 6568 |
| 590 | Ga0495608_0011453 | 3300046511 | Bacteria | 6173 |
| 591 | Ga0495608_0018113 | 3300046511 | Bacteria | 4863 |
| 592 | Ga0495608_0079918 | 3300046511 | Bacteria | 2126 |
| 593 | Ga0495608_0445939 | 3300046511 | Bacteria | 788 |
| 594 | Ga0495618_0000115 | 3300046514 | Bacteria | 58375 |
| 595 | Ga0495618_0331197 | 3300046514 | Bacteria | 941 |
| 596 | Ga0495618_0347145 | 3300046514 | Bacteria | 915 |
| 597 | Ga0495618_0454045 | 3300046514 | Bacteria | 777 |
| 598 | Ga0495628_0262890 | 3300046516 | Bacteria | 1286 |
| 599 | Ga0495630_0095193 | 3300046517 | Bacteria | 2251 |
| 600 | Ga0495630_0166820 | 3300046517 | Bacteria | 1676 |
| 601 | Ga0495666_0009556 | 3300046526 | Bacteria | 4846 |
| 602 | Ga0495666_0032459 | 3300046526 | Bacteria | 2555 |
| 603 | Ga0495652_0042560 | 3300046529 | Bacteria | 3915 |
| 604 | Ga0495665_0001332 | 3300046531 | Bacteria | 13180 |
| 605 | Ga0495665_0004084 | 3300046531 | Bacteria | 7873 |
| 606 | Ga0495640_0395833 | 3300046533 | Bacteria | 849 |
| 607 | Ga0495640_0497668 | 3300046533 | Bacteria | 742 |
| 608 | Ga0495586_0086592 | 3300046535 | Bacteria | 1727 |
| 609 | Ga0495587_0033023 | 3300046536 | Bacteria | 3125 |
| 610 | Ga0495587_0066661 | 3300046536 | Bacteria | 2099 |
| 611 | Ga0495587_0075187 | 3300046536 | Bacteria | 1961 |
| 612 | Ga0495645_0115284 | 3300046543 | Bacteria | 1898 |
| 613 | Ga0495667_0013391 | 3300046559 | Bacteria | 5552 |
| 614 | Ga0495667_0025494 | 3300046559 | Bacteria | 3983 |
| 615 | Ga0495667_0070211 | 3300046559 | Bacteria | 2285 |
| 616 | Ga0495667_0097878 | 3300046559 | Bacteria | 1899 |
| 617 | Ga0495668_0219094 | 3300046616 | Bacteria | 1042 |
| 618 | Ga0495634_0028676 | 3300046642 | Bacteria | 3861 |
| 619 | Ga0495634_0034982 | 3300046642 | Bacteria | 3443 |
| 620 | Ga0495635_0011984 | 3300046663 | Bacteria | 6074 |
| 621 | Ga0495635_0045493 | 3300046663 | Bacteria | 3029 |
| 622 | Ga0495635_0118629 | 3300046663 | Bacteria | 1805 |
| 623 | Ga0495635_0163560 | 3300046663 | Bacteria | 1514 |
| 624 | Ga0495588_0017324 | 3300046674 | Bacteria | 3495 |
| 625 | Ga0495588_0314942 | 3300046674 | Unclassified | 823 |
| 626 | Ga0495657_0012099 | 3300046675 | Bacteria | 6420 |
| 627 | Ga0495657_0031824 | 3300046675 | Bacteria | 3684 |
| 628 | Ga0495599_0020820 | 3300046678 | Bacteria | 4087 |
| 629 | Ga0495599_0130705 | 3300046678 | Bacteria | 1559 |
| 630 | Ga0495623_0148158 | 3300046679 | Bacteria | 1390 |
| 631 | Ga0495623_0153777 | 3300046679 | Bacteria | 1357 |
| 632 | Ga0495646_0014007 | 3300046680 | Bacteria | 5098 |
| 633 | Ga0495646_0080992 | 3300046680 | Bacteria | 1893 |
| 634 | Ga0495647_0002012 | 3300046681 | Bacteria | 6349 |
| 635 | Ga0495658_0000379 | 3300046683 | Bacteria | 24931 |
| 636 | Ga0495613_0001753 | 3300046689 | Bacteria | 16515 |
| 637 | Ga0495613_0013003 | 3300046689 | Bacteria | 6184 |
| 638 | Ga0495624_0015742 | 3300046690 | Bacteria | 5099 |
| 639 | Ga0495624_0158817 | 3300046690 | Bacteria | 1381 |
| 640 | Ga0495624_0191385 | 3300046690 | Bacteria | 1244 |
| 641 | Ga0495600_0008198 | 3300046809 | Bacteria | 6415 |
| 642 | Ga0495600_0077933 | 3300046809 | Bacteria | 2165 |
| 643 | Ga0495600_0109104 | 3300046809 | Bacteria | 1802 |
| 644 | Ga0495581_0002043 | 3300047315 | Bacteria | 11350 |
| 645 | Ga0495581_0005670 | 3300047315 | Bacteria | 7241 |
| 646 | Ga0495604_0026326 | 3300047317 | Bacteria | 4630 |
| 647 | Ga0495604_0068890 | 3300047317 | Bacteria | 2683 |
| 648 | Ga0495674_0034090 | 3300047319 | Bacteria | 4606 |
| 649 | Ga0495674_0039755 | 3300047319 | Bacteria | 4213 |
| 650 | Ga0495674_0126250 | 3300047319 | Bacteria | 2158 |
| 651 | Ga0495676_0002172 | 3300047321 | Bacteria | 17365 |
| 652 | Ga0495676_0043365 | 3300047321 | Bacteria | 3682 |
| 653 | Ga0495676_0419586 | 3300047321 | Bacteria | 886 |
| 654 | Ga0495680_0012431 | 3300047322 | Bacteria | 7491 |
| 655 | Ga0495680_0050186 | 3300047322 | Bacteria | 3263 |
| 656 | Ga0495680_0167091 | 3300047322 | Bacteria | 1594 |
| 657 | Ga0495675_0084336 | 3300047444 | Bacteria | 1999 |
| 658 | Ga0495675_0140167 | 3300047444 | Bacteria | 1499 |
| 659 | Ga0495684_0005173 | 3300047471 | Bacteria | 10166 |
| 660 | Ga0495684_0097315 | 3300047471 | Bacteria | 2226 |
| 661 | Ga0495684_0470612 | 3300047471 | Bacteria | 869 |
| 662 | Ga0495593_0010191 | 3300047673 | Bacteria | 5432 |
| 663 | Ga0495593_0019130 | 3300047673 | Bacteria | 3843 |
| 664 | Ga0495602_0052414 | 3300048088 | Bacteria | 3623 |
| 665 | Ga0495602_0070809 | 3300048088 | Bacteria | 2981 |
| 666 | Ga0495602_0197369 | 3300048088 | Bacteria | 1538 |
| 667 | Ga0495614_0007391 | 3300048089 | Bacteria | 4893 |
| 668 | Ga0495614_0050939 | 3300048089 | Bacteria | 1774 |
| 669 | Ga0495614_0142344 | 3300048089 | Bacteria | 1066 |
| 670 | Ga0496100_0014411 | 3300048903 | Bacteria | 4590 |
| 671 | Ga0496100_0015773 | 3300048903 | Bacteria | 4418 |
| 672 | Ga0496100_0076332 | 3300048903 | Bacteria | 2250 |
| 673 | Ga0496100_0087868 | 3300048903 | Bacteria | 2114 |
| 674 | Ga0496100_0185109 | 3300048903 | Bacteria | 1508 |
| 675 | Ga0496100_0410136 | 3300048903 | Bacteria | 1033 |
| 676 | Ga0496101_0002875 | 3300048904 | Bacteria | 10590 |
| 677 | Ga0496101_0018591 | 3300048904 | Bacteria | 4728 |
| 678 | Ga0496101_0024995 | 3300048904 | Bacteria | 4140 |
| 679 | Ga0496101_0038693 | 3300048904 | Bacteria | 3388 |
| 680 | Ga0496101_0047663 | 3300048904 | Bacteria | 3077 |
| 681 | Ga0496102_0006393 | 3300048905 | Bacteria | 10043 |
| 682 | Ga0496102_0007158 | 3300048905 | Bacteria | 9524 |
| 683 | Ga0496102_0057760 | 3300048905 | Bacteria | 3544 |
| 684 | Ga0496102_0178118 | 3300048905 | Bacteria | 2002 |
| 685 | Ga0496102_0713538 | 3300048905 | Bacteria | 926 |
| 686 | Ga0496103_0004333 | 3300048906 | Bacteria | 8618 |
| 687 | Ga0496103_0065673 | 3300048906 | Bacteria | 2263 |
| 688 | Ga0496103_0108037 | 3300048906 | Bacteria | 1765 |
| 689 | Ga0496104_0003577 | 3300048907 | Bacteria | 13415 |
| 690 | Ga0496104_1132038 | 3300048907 | Bacteria | 686 |
| 691 | Ga0496105_0004361 | 3300048908 | Bacteria | 10651 |
| 692 | Ga0496105_0007507 | 3300048908 | Bacteria | 8447 |
| 693 | Ga0496105_0049383 | 3300048908 | Bacteria | 3473 |
| 694 | Ga0496105_0250894 | 3300048908 | Bacteria | 1434 |
| 695 | Ga0496106_0004788 | 3300048909 | Bacteria | 10010 |
| 696 | Ga0496106_0005708 | 3300048909 | Bacteria | 9207 |
| 697 | Ga0496106_0040068 | 3300048909 | Bacteria | 3507 |
| 698 | Ga0496106_0068056 | 3300048909 | Bacteria | 2716 |
| 699 | Ga0496106_0079533 | 3300048909 | Bacteria | 2517 |
| 700 | Ga0496107_0002187 | 3300048910 | Bacteria | 12564 |
| 701 | Ga0496107_0051696 | 3300048910 | Bacteria | 2964 |
| 702 | Ga0496107_0059666 | 3300048910 | Bacteria | 2761 |
| 703 | Ga0496107_0206967 | 3300048910 | Bacteria | 1458 |
| 704 | Ga0496108_0007095 | 3300048911 | Bacteria | 9073 |
| 705 | Ga0496108_0189520 | 3300048911 | Bacteria | 1782 |
| 706 | Ga0496108_0568863 | 3300048911 | Unclassified | 988 |
| 707 | Ga0496109_0004651 | 3300048912 | Bacteria | 11458 |
| 708 | Ga0496109_0018187 | 3300048912 | Bacteria | 6171 |
| 709 | Ga0496109_0063728 | 3300048912 | Bacteria | 3372 |
| 710 | Ga0496109_0300102 | 3300048912 | Bacteria | 1514 |
| 711 | Ga0496110_0058749 | 3300048913 | Bacteria | 3387 |
| 712 | Ga0496110_0073010 | 3300048913 | Bacteria | 3045 |
| 713 | Ga0496111_0005981 | 3300048914 | Bacteria | 7855 |
| 714 | Ga0496111_0012824 | 3300048914 | Bacteria | 5687 |
| 715 | Ga0496111_0049942 | 3300048914 | Bacteria | 3016 |
| 716 | Ga0496111_0171945 | 3300048914 | Bacteria | 1610 |
| 717 | Ga0496112_0000025 | 3300048915 | Bacteria | 146197 |
| 718 | Ga0496112_0001450 | 3300048915 | Bacteria | 18215 |
| 719 | Ga0496112_0006292 | 3300048915 | Bacteria | 10415 |
| 720 | Ga0496112_0026743 | 3300048915 | Bacteria | 5558 |
| 721 | Ga0496112_0408848 | 3300048915 | Bacteria | 1296 |
| 722 | Ga0496112_0700134 | 3300048915 | Bacteria | 941 |
| 723 | Ga0496113_0017566 | 3300048916 | Bacteria | 4968 |
| 724 | Ga0496114_0001055 | 3300048917 | Bacteria | 20710 |
| 725 | Ga0496114_0029665 | 3300048917 | Bacteria | 4498 |
| 726 | Ga0496114_0131618 | 3300048917 | Bacteria | 2160 |
| 727 | Ga0496114_0383888 | 3300048917 | Bacteria | 1244 |
| 728 | Ga0496115_0001930 | 3300048918 | Bacteria | 14798 |
| 729 | Ga0496115_0004249 | 3300048918 | Bacteria | 10358 |
| 730 | Ga0496115_0010743 | 3300048918 | Bacteria | 6848 |
| 731 | Ga0496115_0012929 | 3300048918 | Bacteria | 6295 |
| 732 | Ga0496115_0062843 | 3300048918 | Bacteria | 2996 |
| 733 | Ga0496115_0108678 | 3300048918 | Bacteria | 2277 |
| 734 | Ga0496115_0113367 | 3300048918 | Bacteria | 2228 |
| 735 | Ga0496115_0403600 | 3300048918 | Bacteria | 1109 |
| 736 | Ga0496115_0790097 | 3300048918 | Bacteria | 739 |
| 737 | Ga0496115_1002982 | 3300048918 | Bacteria | 638 |
| 738 | Ga0501033_0580846 | 3300049570 | Bacteria | 770 |
| 739 | Ga0501034_0322439 | 3300049571 | Bacteria | 1478 |
| 740 | Ga0501038_0153573 | 3300049574 | Bacteria | 1876 |
| 741 | Ga0501040_0008267 | 3300049576 | Bacteria | 6767 |
| 742 | Ga0501041_0072853 | 3300049577 | Bacteria | 2111 |
| 743 | Ga0501043_0411786 | 3300049579 | Bacteria | 1020 |
| 744 | Ga0501046_0262668 | 3300049580 | Bacteria | 1268 |
| 745 | Ga0501047_0398062 | 3300049581 | Bacteria | 1210 |
| 746 | Ga0501048_0654663 | 3300049582 | Bacteria | 754 |
| 747 | Ga0501067_0079231 | 3300049583 | Bacteria | 1820 |
| 748 | Ga0501067_0222096 | 3300049583 | Bacteria | 1052 |
| 749 | Ga0501068_0031718 | 3300049584 | Bacteria | 3139 |
| 750 | Ga0501069_0001571 | 3300049585 | Bacteria | 11282 |
| 751 | Ga0501070_0375354 | 3300049586 | Bacteria | 1152 |
| 752 | Ga0501070_0782567 | 3300049586 | Bacteria | 750 |
| 753 | Ga0501071_0142715 | 3300049587 | Bacteria | 1784 |
| 754 | Ga0501071_0267675 | 3300049587 | Bacteria | 1291 |
| 755 | Ga0501072_0185730 | 3300049588 | Bacteria | 1658 |
| 756 | Ga0501074_0144407 | 3300049590 | Bacteria | 1702 |
| 757 | Ga0501074_0175987 | 3300049590 | Bacteria | 1527 |
| 758 | Ga0501075_0052651 | 3300049591 | Bacteria | 3061 |
| 759 | Ga0501075_0492098 | 3300049591 | Bacteria | 936 |
| 760 | Ga0501075_0602307 | 3300049591 | Bacteria | 838 |
| 761 | Ga0501076_0011471 | 3300049592 | Bacteria | 6602 |
| 762 | Ga0501076_0067739 | 3300049592 | Bacteria | 2851 |
| 763 | Ga0501076_0190511 | 3300049592 | Bacteria | 1673 |
| 764 | Ga0501077_0250484 | 3300049593 | Bacteria | 1126 |
| 765 | Ga0501079_0075417 | 3300049741 | Bacteria | 2608 |
| 766 | Ga0501079_0573460 | 3300049741 | Bacteria | 888 |
| 767 | Ga0501080_0524243 | 3300049742 | Bacteria | 1057 |
| 768 | Ga0501080_0638987 | 3300049742 | Bacteria | 942 |
| 769 | Ga0501081_0124824 | 3300049743 | Bacteria | 1836 |
| 770 | Ga0501081_0474083 | 3300049743 | Bacteria | 931 |
| 771 | Ga0501083_0390038 | 3300049744 | Bacteria | 906 |
| 772 | Ga0501083_0391518 | 3300049744 | Bacteria | 904 |
| 773 | Ga0501035_0181960 | 3300049822 | Bacteria | 1811 |
| 774 | Ga0501044_0507847 | 3300049823 | Bacteria | 1106 |
| 775 | Ga0501045_0127714 | 3300049824 | Bacteria | 1889 |
| 776 | Ga0501045_0318987 | 3300049824 | Bacteria | 1156 |
| 777 | nmdc:mga00v17_762364_c1 | 3300050491 | Bacteria | 618 |
| 778 | nmdc:mga0yw44_21256_c1 | 3300050492 | Bacteria | 3617 |
| 779 | nmdc:mga05p37_386141_c1 | 3300050507 | Bacteria | 1639 |
| 780 | nmdc:mga05p37_526501_c1 | 3300050507 | Bacteria | 1351 |
| 781 | nmdc:mga05p37_667065_c1 | 3300050507 | Bacteria | 1161 |
| 782 | nmdc:mga09592_71762_c1 | 3300050508 | Bacteria | 2939 |
| 783 | nmdc:mga0qj67_5244_c1 | 3300050509 | Bacteria | 9451 |
| 784 | nmdc:mga06r32_142833_c1 | 3300050510 | Bacteria | 2371 |
| 785 | nmdc:mga06r32_78564_c1 | 3300050510 | Bacteria | 3208 |
| 786 | nmdc:mga0n895_1128341_c1 | 3300050512 | Bacteria | 760 |
| 787 | nmdc:mga0n895_4747_c1 | 3300050512 | Bacteria | 11229 |
| 788 | nmdc:mga0n895_66521_c1 | 3300050512 | Bacteria | 3569 |
| 789 | nmdc:mga0rr50_101221_c1 | 3300050513 | Bacteria | 2264 |
| 790 | nmdc:mga0rr50_10604_c1 | 3300050513 | Bacteria | 5419 |
| 791 | nmdc:mga0rr50_8707_c1 | 3300050513 | Bacteria | 6328 |
| 792 | nmdc:mga0a205_20179_c1 | 3300050515 | Bacteria | 1892 |
| 793 | Ga0495601_0017039 | 3300053077 | Bacteria | 4407 |
| 794 | Ga0495601_0215016 | 3300053077 | Bacteria | 1255 |
| 795 | Ga0495601_0347772 | 3300053077 | Unclassified | 964 |
| 796 | Ga0495612_0119095 | 3300053078 | Bacteria | 1134 |
| 797 | Ga0495655_0085734 | 3300053083 | Bacteria | 909 |
| 798 | Ga0495595_0019206 | 3300053084 | Unclassified | 2964 |
| 799 | Ga0495595_0030992 | 3300053084 | Bacteria | 2401 |
| 800 | Ga0495619_0000008 | 3300053085 | Bacteria | 305999 |
| 801 | Ga0495619_0006528 | 3300053085 | Bacteria | 7384 |
| 802 | Ga0495619_0010424 | 3300053085 | Bacteria | 5848 |
| 803 | Ga0495619_0039047 | 3300053085 | Bacteria | 3098 |
| 804 | Ga0495619_0043227 | 3300053085 | Bacteria | 2953 |
| 805 | Ga0501084_0311744 | 3300054114 | Bacteria | 1329 |
| 806 | Ga0501082_0173602 | 3300060353 | Bacteria | 1874 |
| 807 | Ga0501082_0233475 | 3300060353 | Unclassified | 1601 |
| 808 | Ga0501082_0778473 | 3300060353 | Bacteria | 837 |
| 809 | Ga0466962_0000708 | 3300061719 | Bacteria | 14840 |
| 810 | Ga0466962_0009518 | 3300061719 | Bacteria | 4660 |
| 811 | Ga0466962_0031519 | 3300061719 | Unclassified | 2538 |
| 812 | Ga0466962_0090002 | 3300061719 | Bacteria | 1470 |
| 813 | Ga0466962_0093762 | 3300061719 | Bacteria | 1439 |
| 814 | Ga0466962_0140990 | 3300061719 | Bacteria | 1167 |
| 815 | Ga0466962_0328212 | 3300061719 | Bacteria | 760 |
| 816 | Ga0466962_0496178 | 3300061719 | Unclassified | 617 |
| 817 | Ga0530510_0141877 | 3300061734 | Bacteria | 1770 |
| 818 | Ga0501071_0332285 | |||
| 819 | JGI25407J50210_10000104 | |||
| 820 | JGI25407J50210_10018572 | |||
| 821 | Ga0070658_10011862 | |||
| 822 | Ga0070658_10378361 | |||
| 823 | Ga0070683_100011110 | |||
| 824 | Ga0070683_100065117 | |||
| 825 | Ga0070683_100163518 | |||
| 826 | Ga0070683_100445415 | |||
| 827 | Ga0070683_100691102 | |||
| 828 | Ga0070683_100724921 | |||
| 829 | Ga0070683_101099630 | |||
| 830 | Ga0068869_100070985 | |||
| 831 | Ga0070666_10158979 | |||
| 832 | Ga0070680_100004347 | |||
| 833 | Ga0070680_100060097 | |||
| 834 | Ga0070680_100139899 | |||
| 835 | Ga0070680_100205620 | |||
| 836 | Ga0070680_100711128 | |||
| 837 | Ga0070680_100960803 | |||
| 838 | Ga0070682_100014416 | |||
| 839 | Ga0070682_100137438 | |||
| 840 | Ga0070682_100764203 | |||
| 841 | Ga0068868_100087772 | |||
| 842 | Ga0070660_100008187 | |||
| 843 | Ga0070660_100019504 | |||
| 844 | Ga0070660_100100458 | |||
| 845 | Ga0070660_100136221 | |||
| 846 | Ga0070660_100254230 | |||
| 847 | Ga0070660_101008449 | |||
| 848 | Ga0070660_101022376 | |||
| 849 | Ga0070689_100072495 | |||
| 850 | Ga0070661_100006256 | |||
| 851 | Ga0070661_100006849 | |||
| 852 | Ga0070661_100075434 | |||
| 853 | Ga0070661_100593678 | |||
| 854 | Ga0070661_100724770 | |||
| 855 | Ga0070668_100177452 | |||
| 856 | Ga0070669_100439124 | |||
| 857 | Ga0070671_100366415 | |||
| 858 | Ga0070674_100811324 | |||
| 859 | Ga0070674_100932906 | |||
| 860 | Ga0070673_100120177 | |||
| 861 | Ga0070659_100011282 | |||
| 862 | Ga0070659_100691257 | |||
| 863 | Ga0070703_10055646 | |||
| 864 | Ga0070709_10049444 | |||
| 865 | Ga0070709_10712436 | |||
| 866 | Ga0070714_100042327 | |||
| 867 | Ga0070714_100157490 | |||
| 868 | Ga0070714_100187934 | |||
| 869 | Ga0070714_100373793 | |||
| 870 | Ga0070714_100526501 | |||
| 871 | Ga0070713_100465035 | |||
| 872 | Ga0070713_100953290 | |||
| 873 | Ga0070701_10193209 | |||
| 874 | Ga0070711_100253542 | |||
| 875 | Ga0070705_100060215 | |||
| 876 | Ga0070700_100313386 | |||
| 877 | Ga0070708_100448762 | |||
| 878 | Ga0070663_100169395 | |||
| 879 | Ga0070663_100466312 | |||
| 880 | Ga0070663_100609005 | |||
| 881 | Ga0070678_100193775 | |||
| 882 | Ga0070662_100025198 | |||
| 883 | Ga0070662_100253848 | |||
| 884 | Ga0070681_10008490 | |||
| 885 | Ga0070681_10028181 | |||
| 886 | Ga0070681_10082635 | |||
| 887 | Ga0070681_10164785 | |||
| 888 | Ga0070681_10219690 | |||
| 889 | Ga0070681_10415779 | |||
| 890 | Ga0070681_10488975 | |||
| 891 | Ga0070681_10711261 | |||
| 892 | Ga0070681_10869577 | |||
| 893 | Ga0070699_100076728 | |||
| 894 | Ga0070679_100087848 | |||
| 895 | Ga0070679_100094128 | |||
| 896 | Ga0070679_100231236 | |||
| 897 | Ga0070679_100276783 | |||
| 898 | Ga0070679_100890424 | |||
| 899 | Ga0070684_100038619 | |||
| 900 | Ga0070684_100164503 | |||
| 901 | Ga0070684_100205480 | |||
| 902 | Ga0070684_100205537 | |||
| 903 | Ga0070684_100208835 | |||
| 904 | Ga0070684_100267201 | |||
| 905 | Ga0070684_100903189 | |||
| 906 | Ga0068853_100360858 | |||
| 907 | Ga0068853_100671994 | |||
| 908 | Ga0068853_101064575 | |||
| 909 | Ga0070686_100189089 | |||
| 910 | Ga0070686_100239196 | |||
| 911 | Ga0070695_100086659 | |||
| 912 | Ga0070696_100105557 | |||
| 913 | Ga0070693_100086088 | |||
| 914 | Ga0070693_100358776 | |||
| 915 | Ga0070693_100425220 | |||
| 916 | Ga0070665_100080403 | |||
| 917 | Ga0070665_100648382 | |||
| 918 | Ga0068855_100013130 | |||
| 919 | Ga0068855_100068046 | |||
| 920 | Ga0068855_100197764 | |||
| 921 | Ga0068855_100198689 | |||
| 922 | Ga0068855_100204531 | |||
| 923 | Ga0068855_100254597 | |||
| 924 | Ga0068855_100259944 | |||
| 925 | Ga0068855_100342034 | |||
| 926 | Ga0070664_100153355 | |||
| 927 | Ga0070664_100238562 | |||
| 928 | Ga0070664_101356670 | |||
| 929 | Ga0068857_100130624 | |||
| 930 | Ga0068857_100133707 | |||
| 931 | Ga0068854_100010961 | |||
| 932 | Ga0068854_100341720 | |||
| 933 | Ga0068854_101189352 | |||
| 934 | Ga0068856_100004589 | |||
| 935 | Ga0068856_100112742 | |||
| 936 | Ga0068856_100310067 | |||
| 937 | Ga0070702_100012351 | |||
| 938 | Ga0068852_100007990 | |||
| 939 | Ga0068852_100125911 | |||
| 940 | Ga0068852_101000607 | |||
| 941 | Ga0068859_100117675 | |||
| 942 | Ga0068864_100000015 | |||
| 943 | Ga0068861_100279508 | |||
| 944 | Ga0068851_10057190 | |||
| 945 | Ga0068851_10224728 | |||
| 946 | Ga0081455_10027035 | |||
| 947 | Ga0081455_10036701 | |||
| 948 | Ga0081538_10000020 | |||
| 949 | Ga0081538_10000200 | |||
| 950 | Ga0081538_10002312 | |||
| 951 | Ga0081538_10004968 | |||
| 952 | Ga0081538_10018534 | |||
| 953 | Ga0081538_10030012 | |||
| 954 | Ga0081538_10092738 | |||
| 955 | Ga0081538_10141626 | |||
| 956 | Ga0081539_10000740 | |||
| 957 | Ga0070717_10013706 | |||
| 958 | Ga0070717_10065065 | |||
| 959 | Ga0070717_10125947 | |||
| 960 | Ga0075365_10000294 | |||
| 961 | Ga0070712_100214240 | |||
| 962 | Ga0075367_10163661 | |||
| 963 | Ga0075367_10547390 | |||
| 964 | Ga0097621_100100370 | |||
| 965 | Ga0068871_100137505 | |||
| 966 | Ga0068871_100146961 | |||
| 967 | Ga0068871_101179992 | |||
| 968 | Ga0075428_100264010 | |||
| 969 | Ga0075430_100000896 | |||
| 970 | Ga0075430_100087100 | |||
| 971 | Ga0075431_100086472 | |||
| 972 | Ga0075433_10096866 | |||
| 973 | Ga0075433_10384546 | |||
| 974 | Ga0075433_11075244 | |||
| 975 | Ga0075434_100000288 | |||
| 976 | Ga0075434_100018510 | |||
| 977 | Ga0075434_101344590 | |||
| 978 | Ga0068865_100287330 | |||
| 979 | Ga0097620_100117671 | |||
| 980 | Ga0075435_100009347 | |||
| 981 | Ga0075435_100455318 | |||
| 982 | Ga0105240_10077895 | |||
| 983 | Ga0105240_10104814 | |||
| 984 | Ga0105240_10201527 | |||
| 985 | Ga0105240_10523857 | |||
| 986 | Ga0105240_10546866 | |||
| 987 | Ga0105240_10797374 | |||
| 988 | Ga0111539_10044032 | |||
| 989 | Ga0111539_10993146 | |||
| 990 | Ga0105245_10020014 | |||
| 991 | Ga0105245_10077422 | |||
| 992 | Ga0105247_10328782 | |||
| 993 | Ga0114129_10167769 | |||
| 994 | Ga0114129_12578874 | |||
| 995 | Ga0105243_10145258 | |||
| 996 | Ga0105243_10157670 | |||
| 997 | Ga0105243_10410532 | |||
| 998 | Ga0105241_10232388 | |||
| 999 | Ga0105241_10261041 | |||
| 1000 | Ga0105242_10069847 | |||
| 1001 | Ga0105242_10462381 | |||
| 1002 | Ga0105242_10585861 | |||
| 1003 | Ga0105248_10153320 | |||
| 1004 | Ga0105237_10065849 | |||
| 1005 | Ga0105237_10076796 | |||
| 1006 | Ga0105237_10275223 | |||
| 1007 | Ga0105237_10808913 | |||
| 1008 | Ga0105238_10016816 | |||
| 1009 | Ga0105238_10024093 | |||
| 1010 | Ga0105238_10029238 | |||
| 1011 | Ga0105249_10332080 | |||
| 1012 | Ga0105239_10165256 | |||
| 1013 | Ga0105239_10175948 | |||
| 1014 | Ga0105239_11099000 | |||
| 1015 | Ga0157373_10029236 | |||
| 1016 | Ga0157371_10589044 | |||
| 1017 | Ga0157370_10004882 | |||
| 1018 | Ga0157370_10294487 | |||
| 1019 | Ga0157370_10712675 | |||
| 1020 | Ga0157370_10832155 | |||
| 1021 | Ga0157369_10006129 | |||
| 1022 | Ga0157369_10018632 | |||
| 1023 | Ga0157369_10078611 | |||
| 1024 | Ga0157369_10103686 | |||
| 1025 | Ga0157369_10438866 | |||
| 1026 | Ga0157369_10771483 | |||
| 1027 | Ga0157369_10850138 | |||
| 1028 | Ga0157369_11294942 | |||
| 1029 | Ga0157374_10043473 | |||
| 1030 | Ga0157374_10647685 | |||
| 1031 | Ga0157378_10801385 | |||
| 1032 | Ga0157372_10016430 | |||
| 1033 | Ga0157372_10067351 | |||
| 1034 | Ga0157372_10069442 | |||
| 1035 | Ga0157372_10301713 | |||
| 1036 | Ga0163163_10005491 | |||
| 1037 | Ga0157377_10000811 | |||
| 1038 | Ga0157376_10012411 | |||
| 1039 | Ga0157376_10216561 | |||
| 1040 | Ga0163161_10282932 | |||
| 1041 | Ga0206356_11241351 | |||
| 1042 | Ga0206356_11351312 | |||
| 1043 | Ga0206354_11219733 | |||
| 1044 | Ga0206354_11394741 | |||
| 1045 | Ga0206354_11560368 | |||
| 1046 | Ga0206354_11656200 | |||
| 1047 | Ga0206353_10100840 | |||
| 1048 | Ga0206353_10260902 | |||
| 1049 | Ga0206353_10785855 | |||
| 1050 | Ga0206353_10797388 | |||
| 1051 | Ga0206353_11184676 | |||
| 1052 | Ga0206353_11315790 | |||
| 1053 | Ga0206353_11465659 | |||
| 1054 | Ga0213874_10000264 | |||
| 1055 | Ga0213876_10014761 | |||
| 1056 | Ga0213876_10023263 | |||
| 1057 | Ga0213875_10011438 | |||
| 1058 | Ga0213875_10016071 | |||
| 1059 | Ga0213875_10141173 | |||
| 1060 | Ga0207642_10051877 | |||
| 1061 | Ga0207710_10149755 | |||
| 1062 | Ga0207680_10034303 | |||
| 1063 | Ga0207647_10137924 | |||
| 1064 | Ga0207699_10016150 | |||
| 1065 | Ga0207699_10222621 | |||
| 1066 | Ga0207643_10124032 | |||
| 1067 | Ga0207705_10024033 | |||
| 1068 | Ga0207705_10045265 | |||
| 1069 | Ga0207705_10049149 | |||
| 1070 | Ga0207705_10169123 | |||
| 1071 | Ga0207705_10495966 | |||
| 1072 | Ga0207654_10126066 | |||
| 1073 | Ga0207654_10202229 | |||
| 1074 | Ga0207654_10280082 | |||
| 1075 | Ga0207707_10002473 | |||
| 1076 | Ga0207707_10023064 | |||
| 1077 | Ga0207707_10072100 | |||
| 1078 | Ga0207707_10094470 | |||
| 1079 | Ga0207707_10176146 | |||
| 1080 | Ga0207707_10176916 | |||
| 1081 | Ga0207707_10423102 | |||
| 1082 | Ga0207671_10268542 | |||
| 1083 | Ga0207671_10305684 | |||
| 1084 | Ga0207693_10148398 | |||
| 1085 | Ga0207660_10008507 | |||
| 1086 | Ga0207660_10096024 | |||
| 1087 | Ga0207660_10098807 | |||
| 1088 | Ga0207660_10240320 | |||
| 1089 | Ga0207662_10032222 | |||
| 1090 | Ga0207657_10001972 | |||
| 1091 | Ga0207657_10019359 | |||
| 1092 | Ga0207657_10033039 | |||
| 1093 | Ga0207657_10105190 | |||
| 1094 | Ga0207657_10522883 | |||
| 1095 | Ga0207657_10522884 | |||
| 1096 | Ga0207657_10586744 | |||
| 1097 | Ga0207649_10026261 | |||
| 1098 | Ga0207649_10127346 | |||
| 1099 | Ga0207649_10177829 | |||
| 1100 | Ga0207649_10662271 | |||
| 1101 | Ga0207652_10067465 | |||
| 1102 | Ga0207652_10086258 | |||
| 1103 | Ga0207652_10142945 | |||
| 1104 | Ga0207652_10262084 | |||
| 1105 | Ga0207652_10774381 | |||
| 1106 | Ga0207694_10102874 | |||
| 1107 | Ga0207694_10124866 | |||
| 1108 | Ga0207687_10003687 | |||
| 1109 | Ga0207687_10149839 | |||
| 1110 | Ga0207700_10127214 | |||
| 1111 | Ga0207700_10523891 | |||
| 1112 | Ga0207700_10945947 | |||
| 1113 | Ga0207664_10060093 | |||
| 1114 | Ga0207664_10118764 | |||
| 1115 | Ga0207664_10140364 | |||
| 1116 | Ga0207664_10191297 | |||
| 1117 | Ga0207664_10516200 | |||
| 1118 | Ga0207644_10115487 | |||
| 1119 | Ga0207644_10121456 | |||
| 1120 | Ga0207690_10012160 | |||
| 1121 | Ga0207690_10050575 | |||
| 1122 | Ga0207690_10070800 | |||
| 1123 | Ga0207706_10393403 | |||
| 1124 | Ga0207686_10280770 | |||
| 1125 | Ga0207709_10053325 | |||
| 1126 | Ga0207709_10415859 | |||
| 1127 | Ga0207669_10421050 | |||
| 1128 | Ga0207704_10420651 | |||
| 1129 | Ga0207665_10213942 | |||
| 1130 | Ga0207711_10369982 | |||
| 1131 | Ga0207711_10624605 | |||
| 1132 | Ga0207689_10051166 | |||
| 1133 | Ga0207661_10203749 | |||
| 1134 | Ga0207661_10301286 | |||
| 1135 | Ga0207661_10490526 | |||
| 1136 | Ga0207661_10810375 | |||
| 1137 | Ga0207679_10259310 | |||
| 1138 | Ga0207679_10937971 | |||
| 1139 | Ga0207667_10063012 | |||
| 1140 | Ga0207667_10078675 | |||
| 1141 | Ga0207667_10159174 | |||
| 1142 | Ga0207667_10225442 | |||
| 1143 | Ga0207667_10227218 | |||
| 1144 | Ga0207667_10262874 | |||
| 1145 | Ga0207712_10241330 | |||
| 1146 | Ga0207668_10082426 | |||
| 1147 | Ga0207677_10010576 | |||
| 1148 | Ga0207639_10108692 | |||
| 1149 | Ga0207639_10278971 | |||
| 1150 | Ga0207639_10297756 | |||
| 1151 | Ga0207678_10154748 | |||
| 1152 | Ga0207678_10899868 | |||
| 1153 | Ga0207708_10253896 | |||
| 1154 | Ga0207708_10408152 | |||
| 1155 | Ga0207702_10008420 | |||
| 1156 | Ga0207702_10130349 | |||
| 1157 | Ga0207702_10179603 | |||
| 1158 | Ga0207676_10000018 | |||
| 1159 | Ga0207674_10072348 | |||
| 1160 | Ga0207674_10296967 | |||
| 1161 | Ga0207675_100360851 | |||
| 1162 | Ga0207683_10005639 | |||
| 1163 | Ga0207698_10000004 | |||
| 1164 | Ga0207698_10092693 | |||
| 1165 | Ga0207698_10164327 | |||
| 1166 | Ga0207698_10314886 | |||
| 1167 | Ga0207698_10443532 | |||
| 1168 | Ga0209813_10105462 | |||
| 1169 | Ga0268266_10632639 | |||
| 1170 | Ga0268265_10509743 | |||
| 1171 | Ga0265337_1009785 | |||
| 1172 | Ga0265326_10000757 | |||
| 1173 | Ga0265319_1000842 | |||
| 1174 | Ga0265319_1072360 | |||
| 1175 | Ga0265334_10012155 | |||
| 1176 | Ga0265318_10007046 | |||
| 1177 | Ga0265318_10013959 | |||
| 1178 | Ga0265318_10079004 | |||
| 1179 | Ga0265322_10012985 | |||
| 1180 | Ga0265322_10086042 | |||
| 1181 | Ga0265336_10000005 | |||
| 1182 | Ga0265338_10000001 | |||
| 1183 | Ga0265338_10019418 | |||
| 1184 | Ga0265324_10010261 | |||
| 1185 | Ga0265320_10061377 | |||
| 1186 | Ga0265325_10011163 | |||
| 1187 | Ga0265340_10000001 | |||
| 1188 | Ga0265340_10084132 | |||
| 1189 | Ga0265339_10017306 | |||
| 1190 | Ga0265327_10042695 | |||
| 1191 | Ga0265327_10043117 | |||
| 1192 | Ga0265316_10044788 | |||
| 1193 | Ga0307408_100111396 | |||
| 1194 | Ga0265313_10005262 | |||
| 1195 | Ga0265313_10093375 | |||
| 1196 | Ga0265314_10015874 | |||
| 1197 | Ga0265314_10306141 | |||
| 1198 | Ga0265342_10069045 | |||
| 1199 | Ga0307405_10445458 | |||
| 1200 | Ga0307413_10088056 | |||
| 1201 | Ga0307406_10023996 | |||
| 1202 | Ga0307406_10059658 | |||
| 1203 | Ga0307406_10153133 | |||
| 1204 | Ga0307407_10274770 | |||
| 1205 | Ga0307409_100821487 | |||
| 1206 | Ga0307416_100049028 | |||
| 1207 | Ga0307416_100931111 | |||
| 1208 | Ga0307414_10354348 | |||
| 1209 | Ga0307415_100593433 | |||
| 1210 | Ga0373934_0053026 | |||
| 1211 | Ga0373944_0005822 | |||
| 1212 | Ga0373944_0094392 | |||
| 1213 | Ga0373923_0027686 | |||
| 1214 | Ga0373923_0056623 | |||
| 1215 | Ga0373936_0112275 | |||
| 1216 | Ga0373945_0005048 | |||
| 1217 | Ga0373945_0124517 | |||
| 1218 | Ga0373953_0097348 | |||
| 1219 | Ga0373943_0000948 | |||
| 1220 | Ga0373943_0005005 | |||
| 1221 | Ga0373946_0028313 | |||
| 1222 | Ga0373946_0034334 | |||
| 1223 | Ga0373955_0014289 | |||
| 1224 | Ga0373955_0081204 | |||
| 1225 | Ga0373924_0103454 | |||
| 1226 | Ga0373935_0039711 | |||
| 1227 | Ga0373935_0092235 | |||
| 1228 | Ga0373927_0013935 | |||
| 1229 | Ga0373927_0188986 | |||
| 1230 | Ga0373933_0138036 | |||
| 1231 | Ga0373947_0003156 | |||
| 1232 | Ga0373947_0020606 | |||
| 1233 | Ga0373937_0073679 | |||
| 1234 | Ga0373937_0242408 | |||
| 1235 | Ga0373925_0013684 | |||
| 1236 | Ga0395900_0026920 | |||
| 1237 | Ga0395900_0176437 | |||
| 1238 | Ga0395900_0389205 | |||
| 1239 | Ga0395900_0568862 | |||
| 1240 | Ga0395900_1014184 | |||
| 1241 | Ga0395898_0001107 | |||
| 1242 | Ga0395898_0002378 | |||
| 1243 | Ga0395898_0272877 | |||
| 1244 | Ga0395898_0516897 | |||
| 1245 | Ga0395898_0891579 | |||
| 1246 | Ga0395905_0412021 | |||
| 1247 | Ga0436364_0324999 | |||
| 1248 | Ga0436364_0679661 | |||
| 1249 | Ga0436364_1504966 | |||
| 1250 | Ga0395901_0003426 | |||
| 1251 | Ga0395901_0009580 | |||
| 1252 | Ga0395901_0014827 | |||
| 1253 | Ga0395901_0280896 | |||
| 1254 | Ga0395901_0587348 | |||
| 1255 | Ga0395901_1617830 | |||
| 1256 | Ga0436365_0179721 | |||
| 1257 | Ga0436365_0253877 | |||
| 1258 | Ga0436365_0268135 | |||
| 1259 | Ga0436365_0268336 | |||
| 1260 | Ga0436365_0388251 | |||
| 1261 | Ga0436365_0903847 | |||
| 1262 | Ga0436365_1168763 | |||
| 1263 | Ga0436365_1380658 | |||
| 1264 | Ga0436365_1915237 | |||
| 1265 | Ga0436363_0130947 | |||
| 1266 | Ga0436363_0270595 | |||
| 1267 | Ga0436363_0357892 | |||
| 1268 | Ga0436363_0414720 | |||
| 1269 | Ga0436363_0889395 | |||
| 1270 | Ga0436363_1028583 | |||
| 1271 | Ga0436363_1424363 | |||
| 1272 | Ga0436363_1582569 | |||
| 1273 | Ga0436362_0250370 | |||
| 1274 | Ga0436362_1242845 | |||
| 1275 | Ga0451835_0797243 | |||
| 1276 | Ga0451849_0689619 | |||
| 1277 | Ga0451853_2929055 | |||
| 1278 | Ga0439448_0089687 | |||
| 1279 | Ga0439464_0027573 | |||
| 1280 | Ga0439440_0012953 | |||
| 1281 | Ga0466969_0343593 | |||
| 1282 | Ga0466966_0015990 | |||
| 1283 | Ga0466966_0026087 | |||
| 1284 | Ga0466966_0041440 | |||
| 1285 | Ga0466961_0008119 | |||
| 1286 | Ga0466961_0020291 | |||
| 1287 | Ga0466961_0064965 | |||
| 1288 | Ga0466961_0066735 | |||
| 1289 | Ga0466961_0140784 | |||
| 1290 | Ga0466961_0524407 | |||
| 1291 | Ga0466963_0000353 | |||
| 1292 | Ga0466963_0001104 | |||
| 1293 | Ga0466963_0016032 | |||
| 1294 | Ga0466963_0016292 | |||
| 1295 | Ga0466963_0037220 | |||
| 1296 | Ga0466963_0068016 | |||
| 1297 | Ga0466963_0221103 | |||
| 1298 | Ga0466963_0232998 | |||
| 1299 | Ga0466963_0308540 | |||
| 1300 | Ga0466963_0430999 | |||
| 1301 | Ga0466963_0454273 | |||
| 1302 | Ga0466963_0517100 | |||
| 1303 | Ga0466964_0004892 | |||
| 1304 | Ga0466964_0008108 | |||
| 1305 | Ga0466964_0014919 | |||
| 1306 | Ga0466964_0097495 | |||
| 1307 | Ga0466964_0098566 | |||
| 1308 | Ga0466964_0120990 | |||
| 1309 | Ga0466964_0125951 | |||
| 1310 | Ga0466964_0239502 | |||
| 1311 | Ga0466964_0249427 | |||
| 1312 | Ga0466964_0429241 | |||
| 1313 | Ga0466971_0046888 | |||
| 1314 | Ga0466971_0063726 | |||
| 1315 | Ga0466971_0248394 | |||
| 1316 | Ga0466968_0015782 | |||
| 1317 | Ga0466968_0090495 | |||
| 1318 | Ga0466968_0117558 | |||
| 1319 | Ga0466968_0120121 | |||
| 1320 | Ga0466970_0124656 | |||
| 1321 | Ga0466970_0131844 | |||
| 1322 | Ga0466970_0169407 | |||
| 1323 | Ga0466957_0036258 | |||
| 1324 | Ga0466957_0059881 | |||
| 1325 | Ga0466957_0071816 | |||
| 1326 | Ga0466957_0216887 | |||
| 1327 | Ga0466957_0298214 | |||
| 1328 | Ga0466957_0719380 | |||
| 1329 | Ga0466960_0303717 | |||
| 1330 | Ga0466959_0014461 | |||
| 1331 | Ga0466959_0071515 | |||
| 1332 | Ga0466959_0091009 | |||
| 1333 | Ga0466959_0101400 | |||
| 1334 | Ga0466959_0229720 | |||
| 1335 | Ga0466959_0388032 | |||
| 1336 | Ga0466959_0701767 | |||
| 1337 | Ga0466958_0001260 | |||
| 1338 | Ga0466958_0015866 | |||
| 1339 | Ga0466958_0021158 | |||
| 1340 | Ga0466958_0036094 | |||
| 1341 | Ga0466958_0119627 | |||
| 1342 | Ga0466958_0125161 | |||
| 1343 | Ga0466958_0157298 | |||
| 1344 | Ga0466958_0159647 | |||
| 1345 | Ga0466958_0238913 | |||
| 1346 | Ga0466958_0245956 | |||
| 1347 | Ga0466958_0287806 | |||
| 1348 | Ga0466958_0348029 | |||
| 1349 | Ga0466967_0002964 | |||
| 1350 | Ga0466967_0018586 | |||
| 1351 | Ga0466967_0021070 | |||
| 1352 | Ga0466967_0021859 | |||
| 1353 | Ga0466967_0042543 | |||
| 1354 | Ga0466967_0044590 | |||
| 1355 | Ga0466967_0073945 | |||
| 1356 | Ga0466967_0088670 | |||
| 1357 | Ga0466967_0130719 | |||
| 1358 | Ga0466967_0150541 | |||
| 1359 | Ga0466967_0151283 | |||
| 1360 | Ga0466967_0201179 | |||
| 1361 | Ga0466967_0203962 | |||
| 1362 | Ga0466967_0296615 | |||
| 1363 | Ga0466967_0315665 | |||
| 1364 | Ga0466967_0336728 | |||
| 1365 | Ga0466967_0375265 | |||
| 1366 | Ga0466967_0411275 | |||
| 1367 | Ga0466967_0423767 | |||
| 1368 | Ga0466967_0513159 | |||
| 1369 | Ga0466967_0555933 | |||
| 1370 | Ga0466967_0572875 | |||
| 1371 | Ga0466967_0743987 | |||
| 1372 | Ga0466967_0933418 | |||
| 1373 | Ga0466967_0985073 | |||
| 1374 | Ga0466967_1141426 | |||
| 1375 | Ga0495592_0094096 | |||
| 1376 | Ga0495592_0279435 | |||
| 1377 | Ga0495603_0015739 | |||
| 1378 | Ga0495603_0337894 | |||
| 1379 | Ga0495629_0009258 | |||
| 1380 | Ga0495629_0020903 | |||
| 1381 | Ga0495629_0100124 | |||
| 1382 | Ga0495641_0000793 | |||
| 1383 | Ga0495641_0164725 | |||
| 1384 | Ga0495651_0039755 | |||
| 1385 | Ga0495651_0105476 | |||
| 1386 | Ga0495651_0113961 | |||
| 1387 | Ga0495653_0056093 | |||
| 1388 | Ga0495653_0064595 | |||
| 1389 | Ga0495653_0073341 | |||
| 1390 | Ga0495580_0026424 | |||
| 1391 | Ga0495580_0101146 | |||
| 1392 | Ga0495582_0003686 | |||
| 1393 | Ga0495582_0004168 | |||
| 1394 | Ga0495582_0033145 | |||
| 1395 | Ga0495605_0066459 | |||
| 1396 | Ga0495639_0002486 | |||
| 1397 | Ga0495639_0019251 | |||
| 1398 | Ga0495639_0095558 | |||
| 1399 | Ga0495662_0003248 | |||
| 1400 | Ga0495662_0005102 | |||
| 1401 | Ga0495664_0018878 | |||
| 1402 | Ga0495664_0061057 | |||
| 1403 | Ga0495664_0067639 | |||
| 1404 | Ga0495594_0017126 | |||
| 1405 | Ga0495596_0061427 | |||
| 1406 | Ga0495608_0010163 | |||
| 1407 | Ga0495608_0011453 | |||
| 1408 | Ga0495608_0018113 | |||
| 1409 | Ga0495608_0079918 | |||
| 1410 | Ga0495608_0445939 | |||
| 1411 | Ga0495618_0000115 | |||
| 1412 | Ga0495618_0331197 | |||
| 1413 | Ga0495618_0347145 | |||
| 1414 | Ga0495618_0454045 | |||
| 1415 | Ga0495628_0262890 | |||
| 1416 | Ga0495630_0095193 | |||
| 1417 | Ga0495630_0166820 | |||
| 1418 | Ga0495666_0009556 | |||
| 1419 | Ga0495666_0032459 | |||
| 1420 | Ga0495652_0042560 | |||
| 1421 | Ga0495665_0001332 | |||
| 1422 | Ga0495665_0004084 | |||
| 1423 | Ga0495640_0395833 | |||
| 1424 | Ga0495640_0497668 | |||
| 1425 | Ga0495586_0086592 | |||
| 1426 | Ga0495587_0033023 | |||
| 1427 | Ga0495587_0066661 | |||
| 1428 | Ga0495587_0075187 | |||
| 1429 | Ga0495645_0115284 | |||
| 1430 | Ga0495667_0013391 | |||
| 1431 | Ga0495667_0025494 | |||
| 1432 | Ga0495667_0070211 | |||
| 1433 | Ga0495667_0097878 | |||
| 1434 | Ga0495668_0219094 | |||
| 1435 | Ga0495634_0028676 | |||
| 1436 | Ga0495634_0034982 | |||
| 1437 | Ga0495635_0011984 | |||
| 1438 | Ga0495635_0045493 | |||
| 1439 | Ga0495635_0118629 | |||
| 1440 | Ga0495635_0163560 | |||
| 1441 | Ga0495588_0017324 | |||
| 1442 | Ga0495588_0314942 | |||
| 1443 | Ga0495657_0012099 | |||
| 1444 | Ga0495657_0031824 | |||
| 1445 | Ga0495599_0020820 | |||
| 1446 | Ga0495599_0130705 | |||
| 1447 | Ga0495623_0148158 | |||
| 1448 | Ga0495623_0153777 | |||
| 1449 | Ga0495646_0014007 | |||
| 1450 | Ga0495646_0080992 | |||
| 1451 | Ga0495647_0002012 | |||
| 1452 | Ga0495658_0000379 | |||
| 1453 | Ga0495613_0001753 | |||
| 1454 | Ga0495613_0013003 | |||
| 1455 | Ga0495624_0015742 | |||
| 1456 | Ga0495624_0158817 | |||
| 1457 | Ga0495624_0191385 | |||
| 1458 | Ga0495600_0008198 | |||
| 1459 | Ga0495600_0077933 | |||
| 1460 | Ga0495600_0109104 | |||
| 1461 | Ga0495581_0002043 | |||
| 1462 | Ga0495581_0005670 | |||
| 1463 | Ga0495604_0026326 | |||
| 1464 | Ga0495604_0068890 | |||
| 1465 | Ga0495674_0034090 | |||
| 1466 | Ga0495674_0039755 | |||
| 1467 | Ga0495674_0126250 | |||
| 1468 | Ga0495676_0002172 | |||
| 1469 | Ga0495676_0043365 | |||
| 1470 | Ga0495676_0419586 | |||
| 1471 | Ga0495680_0012431 | |||
| 1472 | Ga0495680_0050186 | |||
| 1473 | Ga0495680_0167091 | |||
| 1474 | Ga0495675_0084336 | |||
| 1475 | Ga0495675_0140167 | |||
| 1476 | Ga0495684_0005173 | |||
| 1477 | Ga0495684_0097315 | |||
| 1478 | Ga0495684_0470612 | |||
| 1479 | Ga0495593_0010191 | |||
| 1480 | Ga0495593_0019130 | |||
| 1481 | Ga0495602_0052414 | |||
| 1482 | Ga0495602_0070809 | |||
| 1483 | Ga0495602_0197369 | |||
| 1484 | Ga0495614_0007391 | |||
| 1485 | Ga0495614_0050939 | |||
| 1486 | Ga0495614_0142344 | |||
| 1487 | Ga0496100_0014411 | |||
| 1488 | Ga0496100_0015773 | |||
| 1489 | Ga0496100_0076332 | |||
| 1490 | Ga0496100_0087868 | |||
| 1491 | Ga0496100_0185109 | |||
| 1492 | Ga0496100_0410136 | |||
| 1493 | Ga0496101_0002875 | |||
| 1494 | Ga0496101_0018591 | |||
| 1495 | Ga0496101_0024995 | |||
| 1496 | Ga0496101_0038693 | |||
| 1497 | Ga0496101_0047663 | |||
| 1498 | Ga0496102_0006393 | |||
| 1499 | Ga0496102_0007158 | |||
| 1500 | Ga0496102_0057760 | |||
| 1501 | Ga0496102_0178118 | |||
| 1502 | Ga0496102_0713538 | |||
| 1503 | Ga0496103_0004333 | |||
| 1504 | Ga0496103_0065673 | |||
| 1505 | Ga0496103_0108037 | |||
| 1506 | Ga0496104_0003577 | |||
| 1507 | Ga0496104_1132038 | |||
| 1508 | Ga0496105_0004361 | |||
| 1509 | Ga0496105_0007507 | |||
| 1510 | Ga0496105_0049383 | |||
| 1511 | Ga0496105_0250894 | |||
| 1512 | Ga0496106_0004788 | |||
| 1513 | Ga0496106_0005708 | |||
| 1514 | Ga0496106_0040068 | |||
| 1515 | Ga0496106_0068056 | |||
| 1516 | Ga0496106_0079533 | |||
| 1517 | Ga0496107_0002187 | |||
| 1518 | Ga0496107_0051696 | |||
| 1519 | Ga0496107_0059666 | |||
| 1520 | Ga0496107_0206967 | |||
| 1521 | Ga0496108_0007095 | |||
| 1522 | Ga0496108_0189520 | |||
| 1523 | Ga0496108_0568863 | |||
| 1524 | Ga0496109_0004651 | |||
| 1525 | Ga0496109_0018187 | |||
| 1526 | Ga0496109_0063728 | |||
| 1527 | Ga0496109_0300102 | |||
| 1528 | Ga0496110_0058749 | |||
| 1529 | Ga0496110_0073010 | |||
| 1530 | Ga0496111_0005981 | |||
| 1531 | Ga0496111_0012824 | |||
| 1532 | Ga0496111_0049942 | |||
| 1533 | Ga0496111_0171945 | |||
| 1534 | Ga0496112_0000025 | |||
| 1535 | Ga0496112_0001450 | |||
| 1536 | Ga0496112_0006292 | |||
| 1537 | Ga0496112_0026743 | |||
| 1538 | Ga0496112_0408848 | |||
| 1539 | Ga0496112_0700134 | |||
| 1540 | Ga0496113_0017566 | |||
| 1541 | Ga0496114_0001055 | |||
| 1542 | Ga0496114_0029665 | |||
| 1543 | Ga0496114_0131618 | |||
| 1544 | Ga0496114_0383888 | |||
| 1545 | Ga0496115_0001930 | |||
| 1546 | Ga0496115_0004249 | |||
| 1547 | Ga0496115_0010743 | |||
| 1548 | Ga0496115_0012929 | |||
| 1549 | Ga0496115_0062843 | |||
| 1550 | Ga0496115_0108678 | |||
| 1551 | Ga0496115_0113367 | |||
| 1552 | Ga0496115_0403600 | |||
| 1553 | Ga0496115_0790097 | |||
| 1554 | Ga0496115_1002982 | |||
| 1555 | Ga0501033_0580846 | |||
| 1556 | Ga0501034_0322439 | |||
| 1557 | Ga0501038_0153573 | |||
| 1558 | Ga0501040_0008267 | |||
| 1559 | Ga0501041_0072853 | |||
| 1560 | Ga0501043_0411786 | |||
| 1561 | Ga0501046_0262668 | |||
| 1562 | Ga0501047_0398062 | |||
| 1563 | Ga0501048_0654663 | |||
| 1564 | Ga0501067_0079231 | |||
| 1565 | Ga0501067_0222096 | |||
| 1566 | Ga0501068_0031718 | |||
| 1567 | Ga0501069_0001571 | |||
| 1568 | Ga0501070_0375354 | |||
| 1569 | Ga0501070_0782567 | |||
| 1570 | Ga0501071_0142715 | |||
| 1571 | Ga0501071_0267675 | |||
| 1572 | Ga0501072_0185730 | |||
| 1573 | Ga0501074_0144407 | |||
| 1574 | Ga0501074_0175987 | |||
| 1575 | Ga0501075_0052651 | |||
| 1576 | Ga0501075_0492098 | |||
| 1577 | Ga0501075_0602307 | |||
| 1578 | Ga0501076_0011471 | |||
| 1579 | Ga0501076_0067739 | |||
| 1580 | Ga0501076_0190511 | |||
| 1581 | Ga0501077_0250484 | |||
| 1582 | Ga0501079_0075417 | |||
| 1583 | Ga0501079_0573460 | |||
| 1584 | Ga0501080_0524243 | |||
| 1585 | Ga0501080_0638987 | |||
| 1586 | Ga0501081_0124824 | |||
| 1587 | Ga0501081_0474083 | |||
| 1588 | Ga0501083_0390038 | |||
| 1589 | Ga0501083_0391518 | |||
| 1590 | Ga0501035_0181960 | |||
| 1591 | Ga0501044_0507847 | |||
| 1592 | Ga0501045_0127714 | |||
| 1593 | Ga0501045_0318987 | |||
| 1594 | nmdc:mga00v17_762364_c1 | |||
| 1595 | nmdc:mga0yw44_21256_c1 | |||
| 1596 | nmdc:mga05p37_386141_c1 | |||
| 1597 | nmdc:mga05p37_526501_c1 | |||
| 1598 | nmdc:mga05p37_667065_c1 | |||
| 1599 | nmdc:mga09592_71762_c1 | |||
| 1600 | nmdc:mga0qj67_5244_c1 | |||
| 1601 | nmdc:mga06r32_142833_c1 | |||
| 1602 | nmdc:mga06r32_78564_c1 | |||
| 1603 | nmdc:mga0n895_1128341_c1 | |||
| 1604 | nmdc:mga0n895_4747_c1 | |||
| 1605 | nmdc:mga0n895_66521_c1 | |||
| 1606 | nmdc:mga0rr50_101221_c1 | |||
| 1607 | nmdc:mga0rr50_10604_c1 | |||
| 1608 | nmdc:mga0rr50_8707_c1 | |||
| 1609 | nmdc:mga0a205_20179_c1 | |||
| 1610 | Ga0495601_0017039 | |||
| 1611 | Ga0495601_0215016 | |||
| 1612 | Ga0495601_0347772 | |||
| 1613 | Ga0495612_0119095 | |||
| 1614 | Ga0495655_0085734 | |||
| 1615 | Ga0495595_0019206 | |||
| 1616 | Ga0495595_0030992 | |||
| 1617 | Ga0495619_0000008 | |||
| 1618 | Ga0495619_0006528 | |||
| 1619 | Ga0495619_0010424 | |||
| 1620 | Ga0495619_0039047 | |||
| 1621 | Ga0495619_0043227 | |||
| 1622 | Ga0501084_0311744 | |||
| 1623 | Ga0501082_0173602 | |||
| 1624 | Ga0501082_0233475 | |||
| 1625 | Ga0501082_0778473 | |||
| 1626 | Ga0466962_0000708 | |||
| 1627 | Ga0466962_0009518 | |||
| 1628 | Ga0466962_0031519 | |||
| 1629 | Ga0466962_0090002 | |||
| 1630 | Ga0466962_0093762 | |||
| 1631 | Ga0466962_0140990 | |||
| 1632 | Ga0466962_0328212 | |||
| 1633 | Ga0466962_0496178 | |||
| 1634 | Ga0530510_0141877 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7yki-assembly1.cif.gz_A | crystal structure of magi2 pdz0-gk domain in complex with phospho-sapap1 gbr3 peptide | 0.9188 | 19 | 68 |
| 1ex7-assembly1.cif.gz_A | crystal structure of yeast guanylate kinase in complex with guanosine-5'-monophosphate | 0.8989 | 2 | 163 |
| 1z6g-assembly1.cif.gz_A | crystal structure of guanylate kinase from plasmodium falciparum | 0.8951 | 2 | 164 |
| 2an9-assembly1.cif.gz_A | crystal structure of oligomeric e.coli guanylate kinase in complex with gdp | 0.8841 | 2 | 167 |
| 2an9-assembly1.cif.gz_A | crystal structure of oligomeric e.coli guanylate kinase in complex with gdp | 0.8744 | 2 | 167 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q94JM2_119_167_3.30.63.10 | Alpha Beta;2-Layer Sandwich;Guanylate Kinase phosphate binding domain;Guanylate Kinase phosphate binding domain | 1.001 | 20 | 65 | 3.30.63.10 |
| 2qorA02 | Alpha Beta;2-Layer Sandwich;Guanylate Kinase phosphate binding domain;Guanylate Kinase phosphate binding domain | 0.9718 | 20 | 72 | 3.30.63.10 |
| af_Q2QPW1_160_210_3.30.63.10 | Alpha Beta;2-Layer Sandwich;Guanylate Kinase phosphate binding domain;Guanylate Kinase phosphate binding domain | 0.9661 | 20 | 68 | 3.30.63.10 |
| 1s4qA02 | Alpha Beta;2-Layer Sandwich;Guanylate Kinase phosphate binding domain;Guanylate Kinase phosphate binding domain | 0.9637 | 20 | 72 | 3.30.63.10 |
| 1s96B02 | Alpha Beta;2-Layer Sandwich;Guanylate Kinase phosphate binding domain;Guanylate Kinase phosphate binding domain | 0.9635 | 20 | 72 | 3.30.63.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A358ARE9-F1-model_v4 | Guanylate kinase (EC 2.7.4.8) (GMP kinase) | 0.9671 | 2 | 163 |
GO:0004385
GO:0005524 GO:0005829 |
| AF-A0A2V7K455-F1-model_v4 | Guanylate kinase | 0.9567 | 2 | 95 |
GO:0004385
GO:0005829 |
| AF-A0A838IBH2-F1-model_v4 | Guanylate kinase (EC 2.7.4.8) (GMP kinase) | 0.9559 | 2 | 143 |
GO:0004385
GO:0005524 GO:0005829 |
| AF-A0A538IMD3-F1-model_v4 | Guanylate kinase (EC 2.7.4.8) (GMP kinase) | 0.9558 | 2 | 120 |
GO:0004385
GO:0005524 GO:0005829 |
| AF-A0A7V4KMV4-F1-model_v4 | Guanylate kinase (EC 2.7.4.8) (GMP kinase) | 0.9544 | 2 | 166 |
GO:0004385
GO:0005524 GO:0005829 |