F482015

General Info

Members Datasets Scaffolds Average Seq Length
815 594 552 329

Family's Representative Sequence

Representative Sequence 3300025294|Ga0209025_1002792|Ga0209025_100279212
Length 320
Sequence MRLKSLALALAGVALSAMTAVAQTAIKPAVVYDKGGKFDKSFNEGVFVGAEKFKTETGVEFRDFEPTNDAQIEQALRRFARDGHSPIIAVGFSQATALQKVAAEFPNLKFTIIDMVVELPNVQSVVFKEHEGSYLVGLLAGMDIPLIRKFACGYVQGVKAGKKDAEIFQNMTGSTPAAWNDPVKGGELAKSQIDRGADVIYHAAGGTGIGVLRAAADAGKLGIGVDSNQNMLHPGKILTSMLKRVDVAAYNSFKAARDGNWKPGVSVLGLKEDGIGWALDDNNKALITPEMKAAADKAKADIIAGTVKVHDYMSDSKCSM

Samples

Sample ID Description Type Environment
1 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
2 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
3 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
4 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
5 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
6 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
7 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
8 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
9 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
10 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
11 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
12 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
13 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
14 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
15 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
16 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
17 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
18 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
19 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
20 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
21 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
22 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
23 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
24 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
25 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
26 2519899620 Rhizobium sp. Pop5 Isolate Nodule
27 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
28 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
29 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
30 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
31 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
32 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
33 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
34 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
35 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
36 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
37 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
38 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
39 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
40 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
41 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
42 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
43 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
44 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
45 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
46 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
47 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
48 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
49 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
50 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
51 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
52 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
53 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
54 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
55 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
56 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
57 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
58 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
59 2643221599 Rhizobium sp. Root708 Isolate Unclassified
60 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
61 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
62 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
63 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
64 2643221719 Rhizobium sp. Root274 Isolate Unclassified
65 2643221734 Bosea sp. Root670 Isolate Unclassified
66 2643221736 Bosea sp. Root483D1 Isolate Unclassified
67 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
68 2718217882 Rhizobium sp. N741 Isolate Nodule
69 2718217927 Rhizobium sp. N324 Isolate Nodule
70 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
71 2718218009 Rhizobium sp. N561 Isolate Nodule
72 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
73 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
74 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
75 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
76 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
77 2718218363 Rhizobium sp. N113 Isolate Nodule
78 2718218365 Rhizobium sp. N731 Isolate Nodule
79 2718218366 Rhizobium sp. N621 Isolate Nodule
80 2718218423 Rhizobium sp. N941 Isolate Nodule
81 2721755514 Rhizobium sp. N6212 Isolate Nodule
82 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
83 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
84 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
85 2721755809 Rhizobium sp. N541 Isolate Nodule
86 2721755810 Rhizobium sp. N871 Isolate Nodule
87 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
88 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
89 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
90 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
91 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
92 2728369365 Rhizobium sp. N1341 Isolate Nodule
93 2728369397 Rhizobium sp. N1314 Isolate Nodule
94 2738541293 Rhizobium sp. GV031 Isolate Unclassified
95 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
96 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
97 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
98 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
99 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
100 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
101 2791355256 Rhizobium sp. M10 Isolate Nodule
102 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
103 2791355260 Rhizobium sp. L9 Isolate Nodule
104 2791355261 Rhizobium sp. J15 Isolate Nodule
105 2791355262 Rhizobium sp. M1 Isolate Nodule
106 2791355263 Rhizobium chutanense C5 Isolate Nodule
107 2791355264 Rhizobium sp. S9 Isolate Nodule
108 2791355265 Rhizobium sp. H4 Isolate Nodule
109 2791355266 Rhizobium sp. L43 Isolate Nodule
110 2791355267 Rhizobium sp. L18 Isolate Nodule
111 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
112 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
113 2802429633 Rhizobium anhuiense J3 Isolate Nodule
114 2802429634 Rhizobium anhuiense S10 Isolate Nodule
115 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
116 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
117 2802429637 Rhizobium anhuiense C15 Isolate Nodule
118 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
119 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
120 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
121 2818991467 Bosea vestrisii 3192 Isolate Unclassified
122 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
123 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
124 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
125 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
126 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
127 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
128 2838048938 Rhizobium pisi 27/80 Isolate Nodule
129 2838061910 Rhizobium phaseoli L15 Isolate Nodule
130 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
131 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
132 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
133 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
134 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
135 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
136 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
137 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
138 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
139 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
140 2841760612 Bosea sp. Tri-49 Isolate Nodule
141 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
142 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
143 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
144 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
145 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
146 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
147 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
148 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
149 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
150 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
151 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
152 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
153 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
154 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
155 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
156 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
157 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
158 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
159 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
160 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
161 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
162 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
163 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
164 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
165 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
166 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
167 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
168 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
169 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
170 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
171 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
172 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
173 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
174 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
175 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
176 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
177 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
178 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
179 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
180 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
181 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
182 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
183 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
184 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
185 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
186 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
187 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
188 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
189 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
190 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
191 2844104063 Bosea sp. Tri-39 Isolate Nodule
192 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
193 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
194 2851182111 Bosea sp. Tri-44 Isolate Nodule
195 2851246043 Bosea sp. Tri-54 Isolate Nodule
196 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
197 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
198 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
199 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
200 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
201 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
202 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
203 2919493220 Aeromonas salmonicida salmonicida 3466 Isolate Unclassified
204 2919543075 Aeromonas salmonicida masoucida 4076 Isolate Unclassified
205 2923525760 Aeromonas caviae SLBN-129 Isolate Rhizosphere
206 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
207 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
208 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
209 2933599457 Rhizobium phaseoli M3 Isolate Nodule
210 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
211 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
212 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
213 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
214 2936381700 Rhizobium chutanense C16 Isolate Unclassified
215 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
216 2996887358 Rhizobium sp. R711 Isolate Nodule
217 2996893221 Rhizobium sp. R635 Isolate Nodule
218 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
219 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
220 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
221 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
222 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
223 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
224 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
225 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
226 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
227 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
228 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
229 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
230 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
231 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
232 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
233 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
234 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
235 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
236 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
237 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
238 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
239 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
240 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
241 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
242 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
243 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
244 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
245 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
246 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
247 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
248 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
249 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
250 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
251 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
252 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
253 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
254 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
255 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
256 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
257 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
258 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
259 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
260 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
261 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
262 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
263 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
264 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
265 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
266 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
267 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
268 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
269 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
270 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
271 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
272 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
273 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
274 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
275 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
276 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
277 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
278 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
279 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
280 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
281 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
282 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
283 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
284 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
285 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
286 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
287 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
288 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
289 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
290 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
291 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
292 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
293 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
294 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
295 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
296 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
297 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
298 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
299 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
300 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
301 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
302 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
303 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
304 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
305 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
306 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
307 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
308 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
309 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
310 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
311 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
312 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
313 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
314 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
315 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
316 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
317 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
318 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
319 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
320 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
321 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
322 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
323 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
324 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
325 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
326 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
327 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
328 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
329 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
330 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
331 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
332 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
333 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
334 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
335 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
336 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
337 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
338 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
339 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
340 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
341 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
342 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
343 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
344 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
345 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
346 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
347 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
348 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
349 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
350 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
351 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
352 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
353 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
354 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
355 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
356 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
357 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
358 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
359 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
360 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
361 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
362 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
363 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
364 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
365 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
366 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
367 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
368 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
369 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
370 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
371 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
372 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
373 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
374 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
375 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
376 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
377 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
378 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
379 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
380 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
381 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
382 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
383 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
384 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
385 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
386 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
387 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
388 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
389 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
390 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
391 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
392 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
393 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
394 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
395 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
396 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
397 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
398 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
399 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
400 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
401 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
402 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
403 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
404 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
405 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
406 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
407 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
408 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
409 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
410 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
411 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
412 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
413 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
414 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
415 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
416 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
417 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
418 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
419 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
420 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
421 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
422 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
423 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
424 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
425 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
426 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
427 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
428 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
429 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
430 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
431 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
432 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
433 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
434 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
435 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
436 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
437 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
438 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
439 3300041510 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaT Metatranscriptome Unclassified
440 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
441 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
442 3300041907 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT_extra_run Metatranscriptome Unclassified
443 3300041916 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT_extra_run Metatranscriptome Unclassified
444 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
445 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
446 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
447 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
448 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
449 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
450 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
451 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
452 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
453 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
454 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
455 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
456 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
457 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
458 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
459 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
460 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
461 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
462 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
463 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
464 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
465 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
466 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
467 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
468 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
469 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
470 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
471 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
472 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
473 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
474 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
475 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
476 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
477 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
478 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
479 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
480 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
481 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
482 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
483 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
484 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
485 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
486 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
487 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
488 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
489 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
490 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
491 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
492 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
493 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
494 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
495 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
496 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
497 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
498 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
499 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
500 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
501 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
502 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
503 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
504 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
505 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
506 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
507 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
508 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
509 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
510 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
511 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
512 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
513 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
514 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
515 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
516 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
517 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
518 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
519 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
520 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
521 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
522 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
523 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
524 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
525 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
526 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
527 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
528 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
529 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
530 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
531 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
532 3300053127 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere Metagenome Endosphere
533 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
534 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
535 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
536 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
537 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
538 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
539 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
540 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
541 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
542 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
543 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
544 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
545 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
546 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
547 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
548 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
549 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
550 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
551 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
552 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
553 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
554 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
555 8005258706 Rhizobium sp. R693 Isolate Nodule
556 8005275841 Rhizobium sp. N4311 Isolate Nodule
557 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
558 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
559 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
560 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
561 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
562 8005321885 Rhizobium sp. R72 Isolate Nodule
563 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
564 8005382845 Rhizobium sp. R634 Isolate Nodule
565 8005395548 Rhizobium sp. R339 Isolate Nodule
566 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
567 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
568 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
569 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
570 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
571 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
572 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
573 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
574 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
575 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
576 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
577 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
578 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
579 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
580 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
581 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
582 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
583 8018176218 Rhizobium sp. N122 Isolate Nodule
584 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
585 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
586 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
587 8024501048 Rhizobium sp. H4 Isolate Nodule
588 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
589 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
590 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
591 8056382006 Rhizobium croatiense 13T Isolate Nodule
592 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule
593 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
594 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 67.12
Metatranscriptomes 0.61
Isolates 32.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.09
Nodule 22.82
Rhizoplane 0.49
Rhizosphere 41.35
Stem 0
Stem Tuber 0
Unclassified 13.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000110 3300002704 Bacteria 43893
2 JGI25156J39149_1000192 3300002705 Bacteria 44040
3 JGI25162J39368_1000302 3300002737 Bacteria 45304
4 JGI25162J39368_1001704 3300002737 Bacteria 10701
5 JGI25154J39366_1000196 3300002738 Bacteria 44040
6 JGI25157J39369_1000228 3300002741 Bacteria 44040
7 JGI25152J39213_1001971 3300002773 Bacteria 8129
8 JGI25152J39213_1003728 3300002773 Bacteria 5096
9 JGI25152J39213_1006980 3300002773 Bacteria 2979
10 JGI25152J39213_1007954 3300002773 Bacteria 2684
11 JGI25150J39212_1000261 3300002774 Bacteria 28057
12 JGI25150J39212_1012436 3300002774 Bacteria 1508
13 JGI25159J45721_1000790 3300002987 Bacteria 13778
14 JGI25159J45721_1001258 3300002987 Bacteria 10693
15 JGI25151J46595_10000359 3300003187 Bacteria 48264
16 JGI25151J46595_10002653 3300003187 Bacteria 10514
17 JGI25151J46595_10002809 3300003187 Bacteria 10061
18 JGI25151J46595_10022409 3300003187 Bacteria 2623
19 JGI25165J46597_1000390 3300003214 Bacteria 46779
20 JGI25165J46597_1001069 3300003214 Bacteria 17583
21 JGI25165J46597_1005760 3300003214 Bacteria 2318
22 JGI25153J46596_10005292 3300003215 Bacteria 6784
23 JGI25153J46596_10006944 3300003215 Bacteria 5642
24 JGI25153J46596_10013626 3300003215 Bacteria 3425
25 JGI25153J46596_10041150 3300003215 Bacteria 1424
26 rootL2_10029991 3300003322 Bacteria 4845
27 JGI25160J50197_1000044 3300003354 Bacteria 145379
28 JGI25160J50197_1005892 3300003354 Bacteria 5036
29 JGI25160J50197_1007642 3300003354 Bacteria 4212
30 JGI25160J50197_1010225 3300003354 Bacteria 3406
31 JGI25161J50226_1000028 3300003374 Bacteria 145379
32 JGI25161J50226_1000078 3300003374 Bacteria 83416
33 Ga0006562J51391_1014638 3300003578 Bacteria 3212
34 Ga0055526_1000242 3300003771 Bacteria 46203
35 Ga0055526_1002943 3300003771 Bacteria 11164
36 Ga0055526_1008596 3300003771 Bacteria 5060
37 Ga0055526_1011220 3300003771 Bacteria 4066
38 Ga0055526_1024393 3300003771 Bacteria 1979
39 Ga0055526_1027275 3300003771 Bacteria 1770
40 Ga0055524_1007816 3300003775 Bacteria 4508
41 Ga0055524_1010378 3300003775 Bacteria 3712
42 Ga0055524_1014128 3300003775 Bacteria 2975
43 Ga0055524_1026395 3300003775 Bacteria 1796
44 Ga0055524_1031439 3300003775 Bacteria 1526
45 Ga0055528_1000113 3300003790 Bacteria 65323
46 Ga0055528_1009089 3300003790 Bacteria 4189
47 Ga0055528_1016207 3300003790 Bacteria 2649
48 Ga0055528_1025007 3300003790 Bacteria 1770
49 Ga0055528_1025022 3300003790 Bacteria 1769
50 Ga0055530_10009535 3300003791 Bacteria 3714
51 Ga0055540_1009829 3300003792 Bacteria 3247
52 Ga0055540_1013267 3300003792 Bacteria 2529
53 Ga0055540_1018007 3300003792 Bacteria 1951
54 Ga0055531_10041958 3300003794 Bacteria 1316
55 JGI25405J52794_10023527 3300003911 Bacteria 1254
56 Ga0055543_1000054 3300004625 Bacteria 104176
57 Ga0055543_1000069 3300004625 Bacteria 94040
58 Ga0055543_1008099 3300004625 Bacteria 2357
59 Ga0065165_1000318 3300005262 Bacteria 78352
60 Ga0065165_1001841 3300005262 Bacteria 20687
61 Ga0065165_1009690 3300005262 Bacteria 4273
62 Ga0065707_10097784 3300005295 Bacteria 3142
63 Ga0065707_10106344 3300005295 Bacteria 2600
64 Ga0070658_10002626 3300005327 Bacteria 14968
65 Ga0070683_100044725 3300005329 Bacteria 4084
66 Ga0070670_100000105 3300005331 Bacteria 77938
67 Ga0070666_10131717 3300005335 Bacteria 1738
68 Ga0070680_100003898 3300005336 Bacteria 11155
69 Ga0070689_100118840 3300005340 Bacteria 2110
70 Ga0070691_10103671 3300005341 Bacteria 1415
71 Ga0070661_100056787 3300005344 Bacteria 2868
72 Ga0070668_100008388 3300005347 Bacteria 7674
73 Ga0070668_100367952 3300005347 Bacteria 1220
74 Ga0070669_100009624 3300005353 Bacteria 6883
75 Ga0070675_100061463 3300005354 Bacteria 3101
76 Ga0070671_100037812 3300005355 Bacteria 4005
77 Ga0070674_100007923 3300005356 Bacteria 6288
78 Ga0070674_100062032 3300005356 Bacteria 2611
79 Ga0070688_100220092 3300005365 Bacteria 1337
80 Ga0070667_100001050 3300005367 Bacteria 25206
81 Ga0070713_100019350 3300005436 Bacteria 5195
82 Ga0070708_100444427 3300005445 Bacteria 1223
83 Ga0070678_100107072 3300005456 Bacteria 2180
84 Ga0070662_100302187 3300005457 Bacteria 1300
85 Ga0070681_10039594 3300005458 Bacteria 4724
86 Ga0068867_100002992 3300005459 Bacteria 11912
87 Ga0070706_100000708 3300005467 Bacteria 37511
88 Ga0070706_100282245 3300005467 Bacteria 1550
89 Ga0070707_100057697 3300005468 Bacteria 3724
90 Ga0070698_100000987 3300005471 Bacteria 31315
91 Ga0070699_100025390 3300005518 Bacteria 5109
92 Ga0070699_100040866 3300005518 Bacteria 4014
93 Ga0070699_100450560 3300005518 Bacteria 1167
94 Ga0070679_100030405 3300005530 Bacteria 5332
95 Ga0070697_100010490 3300005536 Bacteria 7231
96 Ga0070697_100195872 3300005536 Bacteria 1716
97 Ga0068853_100290516 3300005539 Bacteria 1509
98 Ga0068853_100298914 3300005539 Bacteria 1487
99 Ga0070672_100024302 3300005543 Bacteria 4476
100 Ga0070696_100036846 3300005546 Bacteria 3374
101 Ga0070665_100025181 3300005548 Bacteria 5996
102 Ga0070665_100032009 3300005548 Bacteria 5293
103 Ga0068855_100088510 3300005563 Bacteria 3576
104 Ga0068855_100088724 3300005563 Bacteria 3572
105 Ga0068857_100122150 3300005577 Bacteria 2346
106 Ga0068857_100124930 3300005577 Bacteria 2318
107 Ga0068856_100063949 3300005614 Bacteria 3635
108 Ga0068852_100146981 3300005616 Bacteria 2187
109 Ga0068859_100089126 3300005617 Bacteria 3135
110 Ga0068859_100181250 3300005617 Bacteria 2189
111 Ga0068866_10017754 3300005718 Bacteria 3205
112 Ga0068866_10078466 3300005718 Bacteria 1767
113 Ga0068861_100000849 3300005719 Bacteria 18527
114 Ga0068861_100033362 3300005719 Bacteria 3797
115 Ga0068870_10139131 3300005840 Bacteria 1419
116 Ga0068858_100043489 3300005842 Bacteria 4165
117 Ga0068860_100004285 3300005843 Bacteria 14582
118 Ga0068860_100122017 3300005843 Bacteria 2496
119 Ga0068862_100005672 3300005844 Bacteria 10422
120 Ga0068862_100023621 3300005844 Bacteria 5153
121 Ga0081455_10001748 3300005937 Bacteria 26273
122 Ga0081455_10026351 3300005937 Bacteria 5349
123 Ga0081455_10259731 3300005937 Bacteria 1265
124 Ga0081538_10010243 3300005981 Bacteria 7701
125 Ga0081538_10129361 3300005981 Bacteria 1191
126 Ga0081540_1009139 3300005983 Bacteria 6841
127 Ga0081540_1050186 3300005983 Bacteria 2074
128 Ga0081539_10002734 3300005985 Bacteria 23839
129 Ga0081539_10044159 3300005985 Bacteria 2575
130 Ga0075365_10002194 3300006038 Bacteria 9413
131 Ga0075365_10009158 3300006038 Bacteria 5672
132 Ga0075365_10132854 3300006038 Bacteria 1723
133 Ga0075364_10165295 3300006051 Bacteria 1495
134 Ga0070712_100168158 3300006175 Bacteria 1699
135 Ga0075362_10114791 3300006177 Bacteria 1271
136 Ga0075367_10056918 3300006178 Bacteria 2324
137 Ga0075367_10119885 3300006178 Bacteria 1620
138 Ga0075367_10134136 3300006178 Bacteria 1531
139 Ga0075369_10021432 3300006186 Bacteria 2656
140 Ga0075366_10007808 3300006195 Bacteria 5921
141 Ga0075366_10065212 3300006195 Bacteria 2166
142 Ga0075366_10175270 3300006195 Bacteria 1302
143 Ga0075370_10005472 3300006353 Bacteria 6318
144 Ga0075370_10036990 3300006353 Bacteria 2744
145 Ga0075431_100001768 3300006847 Bacteria 20366
146 Ga0075429_100058767 3300006880 Bacteria 3349
147 Ga0068865_100002258 3300006881 Bacteria 11344
148 Ga0068865_100051171 3300006881 Bacteria 2858
149 Ga0097620_100089125 3300006931 Bacteria 3135
150 Ga0097620_100181249 3300006931 Bacteria 2189
151 Ga0099794_10042247 3300007265 Bacteria 2173
152 Ga0105240_10001468 3300009093 Bacteria 40305
153 Ga0105240_10009499 3300009093 Bacteria 13770
154 Ga0111539_10000042 3300009094 Bacteria 129513
155 Ga0111539_10179738 3300009094 Bacteria 2471
156 Ga0111539_10481012 3300009094 Bacteria 1446
157 Ga0105245_10301045 3300009098 Bacteria 1573
158 Ga0105245_10319723 3300009098 Bacteria 1528
159 Ga0114129_10002929 3300009147 Bacteria 23872
160 Ga0105248_10019677 3300009177 Bacteria 7471
161 Ga0105248_10214978 3300009177 Bacteria 2166
162 Ga0105237_10004445 3300009545 Bacteria 16237
163 Ga0105238_10027122 3300009551 Bacteria 5839
164 Ga0105249_10365488 3300009553 Bacteria 1465
165 Ga0105249_10488272 3300009553 Bacteria 1275
166 Ga0105249_10559291 3300009553 Bacteria 1195
167 Ga0123341_1000017 3300009765 Bacteria 82963
168 Ga0099796_10014736 3300010159 Bacteria 2267
169 Ga0105239_10012629 3300010375 Bacteria 9398
170 Ga0157322_1000006 3300012490 Bacteria 3670
171 Ga0157373_10017731 3300013100 Bacteria 5183
172 Ga0157373_10212350 3300013100 Bacteria 1365
173 Ga0157370_10001796 3300013104 Bacteria 26445
174 Ga0157370_10241175 3300013104 Bacteria 1672
175 Ga0157370_10269875 3300013104 Bacteria 1572
176 Ga0171462_1013 3300013250 Bacteria 202864
177 Ga0157378_10004470 3300013297 Bacteria 12280
178 Ga0163162_10056123 3300013306 Bacteria 3967
179 Ga0163162_10122458 3300013306 Bacteria 2706
180 Ga0163162_10452500 3300013306 Bacteria 1416
181 Ga0157372_10048084 3300013307 Bacteria 4742
182 Ga0157375_10138727 3300013308 Bacteria 2557
183 Ga0157375_10656686 3300013308 Bacteria 1205
184 Ga0157380_10006304 3300014326 Bacteria 8334
185 Ga0157379_10027342 3300014968 Bacteria 5079
186 Ga0163161_10169229 3300017792 Bacteria 1670
187 Ga0213874_10031175 3300021377 Bacteria 1541
188 Ga0213876_10001403 3300021384 Bacteria 15016
189 Ga0213876_10008021 3300021384 Bacteria 5724
190 Ga0213876_10033662 3300021384 Bacteria 2701
191 Ga0213875_10003372 3300021388 Bacteria 9106
192 Ga0209435_100087 3300025206 Bacteria 44093
193 Ga0209436_100268 3300025208 Bacteria 23804
194 Ga0209437_100050 3300025233 Bacteria 394010
195 Ga0209437_100205 3300025233 Bacteria 115669
196 Ga0209437_103334 3300025233 Bacteria 2921
197 Ga0207425_1000052 3300025245 Bacteria 162123
198 Ga0207425_1000527 3300025245 Bacteria 23314
199 Ga0207425_1000665 3300025245 Bacteria 18864
200 Ga0207425_1005861 3300025245 Bacteria 3439
201 Ga0209646_1000285 3300025246 Bacteria 44093
202 Ga0209026_1000347 3300025250 Bacteria 44093
203 Ga0209148_1002865 3300025254 Bacteria 5294
204 Ga0209759_1000482 3300025256 Bacteria 44093
205 Ga0209129_1000041 3300025258 Bacteria 307590
206 Ga0209129_1000066 3300025258 Bacteria 226820
207 Ga0209129_1000141 3300025258 Bacteria 119150
208 Ga0209129_1001099 3300025258 Bacteria 15766
209 Ga0209129_1003016 3300025258 Bacteria 7660
210 Ga0209129_1011192 3300025258 Bacteria 2163
211 Ga0209129_1017206 3300025258 Bacteria 1426
212 Ga0209233_1000037 3300025261 Bacteria 554620
213 Ga0209233_1000187 3300025261 Bacteria 133091
214 Ga0209233_1000232 3300025261 Bacteria 96361
215 Ga0209455_1001248 3300025272 Bacteria 11977
216 Ga0209673_1000024 3300025273 Bacteria 409632
217 Ga0209673_1000911 3300025273 Bacteria 37766
218 Ga0209673_1012356 3300025273 Bacteria 3445
219 Ga0209673_1013782 3300025273 Bacteria 3171
220 Ga0209673_1043372 3300025273 Bacteria 1256
221 Ga0209130_1000002 3300025284 Bacteria 722648
222 Ga0209130_1000093 3300025284 Bacteria 145707
223 Ga0209130_1000422 3300025284 Bacteria 45627
224 Ga0209676_1019999 3300025292 Bacteria 2287
225 Ga0209025_1000053 3300025294 Bacteria 317600
226 Ga0209025_1000144 3300025294 Bacteria 181446
227 Ga0209025_1000274 3300025294 Bacteria 119322
228 Ga0209025_1000275 3300025294 Bacteria 119220
229 Ga0209025_1002792 3300025294 Bacteria 17614
230 Ga0209025_1003887 3300025294 Bacteria 13492
231 Ga0209025_1013651 3300025294 Bacteria 5082
232 Ga0209025_1022384 3300025294 Bacteria 3354
233 Ga0209564_1000029 3300025295 Bacteria 505995
234 Ga0209564_1000043 3300025295 Bacteria 388153
235 Ga0209564_1000262 3300025295 Bacteria 112256
236 Ga0209564_1000474 3300025295 Bacteria 67143
237 Ga0209564_1000486 3300025295 Bacteria 66011
238 Ga0209758_1000043 3300025297 Bacteria 402310
239 Ga0209758_1000057 3300025297 Bacteria 333111
240 Ga0209758_1000229 3300025297 Bacteria 119657
241 Ga0209758_1000466 3300025297 Bacteria 66920
242 Ga0209758_1002556 3300025297 Bacteria 18318
243 Ga0209758_1017231 3300025297 Bacteria 3612
244 Ga0209050_1000149 3300025298 Bacteria 163252
245 Ga0209050_1010764 3300025298 Bacteria 4454
246 Ga0209256_1000868 3300025299 Bacteria 37527
247 Ga0209256_1001436 3300025299 Bacteria 24668
248 Ga0209256_1003327 3300025299 Bacteria 11402
249 Ga0209256_1011918 3300025299 Bacteria 3407
250 Ga0209256_1013244 3300025299 Bacteria 3074
251 Ga0207426_1000012 3300025302 Bacteria 730942
252 Ga0207426_1000013 3300025302 Bacteria 721897
253 Ga0207426_1000142 3300025302 Bacteria 194023
254 Ga0207426_1000198 3300025302 Bacteria 146241
255 Ga0207426_1002097 3300025302 Bacteria 13739
256 Ga0207426_1021381 3300025302 Bacteria 2237
257 Ga0209051_1000170 3300025303 Bacteria 119026
258 Ga0209051_1010621 3300025303 Bacteria 4624
259 Ga0209051_1014264 3300025303 Bacteria 3718
260 Ga0209051_1027331 3300025303 Bacteria 2276
261 Ga0209257_1027182 3300025304 Bacteria 1909
262 Ga0207656_10075949 3300025321 Bacteria 1502
263 Ga0207642_10038830 3300025899 Bacteria 2064
264 Ga0207688_10102761 3300025901 Bacteria 1652
265 Ga0207688_10211085 3300025901 Bacteria 1166
266 Ga0207680_10049806 3300025903 Bacteria 2496
267 Ga0207645_10052145 3300025907 Bacteria 2614
268 Ga0207645_10076364 3300025907 Bacteria 2145
269 Ga0207705_10280623 3300025909 Bacteria 1275
270 Ga0207684_10066252 3300025910 Bacteria 3067
271 Ga0207707_10019725 3300025912 Bacteria 5885
272 Ga0207707_10386837 3300025912 Bacteria 1202
273 Ga0207695_10000427 3300025913 Bacteria 93089
274 Ga0207695_10126172 3300025913 Bacteria 2521
275 Ga0207671_10002841 3300025914 Bacteria 18002
276 Ga0207693_10033704 3300025915 Bacteria 4040
277 Ga0207652_10048257 3300025921 Bacteria 3639
278 Ga0207646_10190607 3300025922 Bacteria 1852
279 Ga0207681_10012222 3300025923 Bacteria 5294
280 Ga0207681_10013114 3300025923 Bacteria 5124
281 Ga0207681_10070454 3300025923 Bacteria 2435
282 Ga0207694_10078016 3300025924 Bacteria 2596
283 Ga0207650_10000302 3300025925 Bacteria 48702
284 Ga0207687_10036195 3300025927 Bacteria 3361
285 Ga0207700_10084832 3300025928 Bacteria 2484
286 Ga0207644_10022013 3300025931 Bacteria 4349
287 Ga0207706_10209385 3300025933 Bacteria 1709
288 Ga0207670_10071609 3300025936 Bacteria 2398
289 Ga0207669_10202397 3300025937 Bacteria 1442
290 Ga0207704_10006660 3300025938 Bacteria 5408
291 Ga0207704_10032588 3300025938 Bacteria 2951
292 Ga0207704_10037628 3300025938 Bacteria 2797
293 Ga0207691_10009293 3300025940 Bacteria 9434
294 Ga0207711_10078855 3300025941 Bacteria 2874
295 Ga0207661_10031766 3300025944 Bacteria 4083
296 Ga0207667_10022968 3300025949 Bacteria 6877
297 Ga0207668_10038371 3300025972 Bacteria 3214
298 Ga0207658_10000576 3300025986 Bacteria 33039
299 Ga0207658_10028202 3300025986 Bacteria 3952
300 Ga0207677_10369710 3300026023 Bacteria 1207
301 Ga0207703_10021969 3300026035 Bacteria 4997
302 Ga0207639_10252353 3300026041 Bacteria 1539
303 Ga0207678_10041986 3300026067 Bacteria 3964
304 Ga0207708_10047648 3300026075 Bacteria 3262
305 Ga0207702_10038579 3300026078 Bacteria 4000
306 Ga0207702_10052722 3300026078 Bacteria 3443
307 Ga0207702_10081555 3300026078 Bacteria 2809
308 Ga0207648_10009516 3300026089 Bacteria 9298
309 Ga0207674_10048582 3300026116 Bacteria 4342
310 Ga0207674_10145686 3300026116 Bacteria 2327
311 Ga0207675_100002512 3300026118 Bacteria 18156
312 Ga0207675_100020788 3300026118 Bacteria 6119
313 Ga0207675_100144260 3300026118 Bacteria 2263
314 Ga0207683_10005865 3300026121 Bacteria 10533
315 Ga0207683_10095318 3300026121 Bacteria 2653
316 Ga0207683_10248498 3300026121 Bacteria 1623
317 Ga0209371_1002100 3300027312 Bacteria 11818
318 Ga0207428_10000092 3300027907 Bacteria 123897
319 Ga0207428_10055437 3300027907 Bacteria 3152
320 Ga0268266_10004190 3300028379 Bacteria 13898
321 Ga0268266_10099248 3300028379 Bacteria 2563
322 Ga0268265_10013241 3300028380 Bacteria 5605
323 Ga0268265_10026643 3300028380 Bacteria 4115
324 Ga0268264_10001072 3300028381 Bacteria 27190
325 Ga0268264_10479516 3300028381 Bacteria 1210
326 Ga0265334_10005584 3300028573 Bacteria 5495
327 Ga0307517_10000922 3300028786 Bacteria 49832
328 Ga0307517_10101384 3300028786 Bacteria 2266
329 Ga0307515_10000306 3300028794 Bacteria 121448
330 Ga0307515_10008185 3300028794 Bacteria 20462
331 Ga0307515_10301336 3300028794 Bacteria 1287
332 Ga0268256_1005033 3300030500 Bacteria 5299
333 Ga0307512_10034912 3300030522 Bacteria 4295
334 Ga0265331_10011765 3300031250 Bacteria 4777
335 Ga0265316_10073853 3300031344 Bacteria 2626
336 Ga0307513_10113027 3300031456 Bacteria 2704
337 Ga0307513_10166937 3300031456 Bacteria 2084
338 Ga0307513_10212882 3300031456 Bacteria 1762
339 Ga0307509_10000041 3300031507 Bacteria 182302
340 Ga0307509_10003895 3300031507 Bacteria 22089
341 Ga0265313_10053406 3300031595 Bacteria 1923
342 Ga0307508_10000113 3300031616 Bacteria 95378
343 Ga0307508_10036513 3300031616 Bacteria 4424
344 Ga0307514_10008015 3300031649 Bacteria 9040
345 Ga0307516_10041776 3300031730 Bacteria 4554
346 Ga0307405_10001044 3300031731 Bacteria 11205
347 Ga0307413_10040277 3300031824 Bacteria 2725
348 Ga0307413_10217504 3300031824 Bacteria 1393
349 Ga0307406_10006383 3300031901 Bacteria 6507
350 Ga0307406_10085735 3300031901 Bacteria 2107
351 Ga0307407_10100207 3300031903 Bacteria 1796
352 Ga0307407_10182785 3300031903 Bacteria 1391
353 Ga0307412_10002606 3300031911 Bacteria 10018
354 Ga0307409_100025293 3300031995 Bacteria 4160
355 Ga0307415_100134848 3300032126 Bacteria 1876
356 Ga0307510_10011906 3300033180 Bacteria 10314
357 Ga0307510_10027735 3300033180 Bacteria 6481
358 Ga0307510_10037985 3300033180 Bacteria 5330
359 Ga0307510_10045419 3300033180 Bacteria 4743
360 Ga0307510_10167569 3300033180 Bacteria 1781
361 Ga0373929_0009326 3300035085 Bacteria 1819
362 Ga0373939_0078319 3300035114 Bacteria 1092
363 Ga0373931_0146349 3300035691 Bacteria 1373
364 Ga0373935_0209583 3300035692 Bacteria 1350
365 Ga0373927_0098951 3300035695 Bacteria 1896
366 Ga0373947_0153017 3300035725 Bacteria 1486
367 Ga0373925_0003621 3300037068 Bacteria 11900
368 Ga0373925_0182507 3300037068 Bacteria 1662
369 Ga0395900_0011631 3300037418 Bacteria 9005
370 Ga0395900_0019809 3300037418 Bacteria 6856
371 Ga0395900_0061251 3300037418 Bacteria 3869
372 Ga0395898_0017238 3300037466 Bacteria 7375
373 Ga0395898_0252071 3300037466 Bacteria 1683
374 Ga0395905_0054137 3300037471 Bacteria 3755
375 Ga0436364_0677535 3300037853 Bacteria 1663
376 Ga0395901_0001404 3300038443 Bacteria 25152
377 Ga0395901_0006779 3300038443 Bacteria 11568
378 Ga0395901_0069622 3300038443 Bacteria 3664
379 Ga0436365_0021793 3300039437 Bacteria 95854
380 Ga0436365_0184712 3300039437 Bacteria 51527
381 Ga0436365_1374407 3300039437 Bacteria 13805
382 Ga0436360_1291673 3300039438 Bacteria 4533
383 Ga0436363_0337627 3300039450 Bacteria 26810
384 Ga0436363_1409112 3300039450 Bacteria 2275
385 Ga0436362_0108458 3300039453 Bacteria 1902
386 Ga0436362_1202906 3300039453 Bacteria 2577
387 Ga0451800_0415455 3300041459 Bacteria 2466
388 Ga0451804_0831358 3300041463 Bacteria 2263
389 Ga0451839_0183003 3300041496 Bacteria 2071
390 Ga0451851_0442598 3300041507 Bacteria 3682
391 Ga0451843_0766251 3300041509 Bacteria 1440
392 Ga0451854_34019 3300041510 Bacteria 2174
393 Ga0451855_0326464 3300041511 Bacteria 1109
394 Ga0451853_1746300 3300041512 Bacteria 1792
395 Ga0452268_37843 3300041907 Bacteria 1681
396 Ga0452271_05939 3300041916 Bacteria 2042
397 Ga0439431_0019793 3300041997 Bacteria 1603
398 Ga0439448_0038522 3300042005 Bacteria 1539
399 Ga0439449_0024843 3300042007 Bacteria 2240
400 Ga0450894_006327 3300042131 Bacteria 1528
401 Ga0439435_0001104 3300042436 Bacteria 4813
402 Ga0439460_0025686 3300042461 Bacteria 1642
403 Ga0466969_0031481 3300044656 Bacteria 2700
404 Ga0466961_0172707 3300044693 Bacteria 1344
405 Ga0466963_0080558 3300044694 Bacteria 2204
406 Ga0453684_0111102 3300044712 Bacteria 3330
407 Ga0466960_0063410 3300044901 Bacteria 1819
408 Ga0466959_0091715 3300045049 Bacteria 2181
409 Ga0451576_0006848 3300045051 Bacteria 13825
410 Ga0451576_0132046 3300045051 Bacteria 2603
411 Ga0466967_0014017 3300045976 Bacteria 6224
412 Ga0466967_0585001 3300045976 Bacteria 1101
413 Ga0495592_0000942 3300046454 Bacteria 20230
414 Ga0495638_0001022 3300046460 Bacteria 27790
415 Ga0495638_0154329 3300046460 Bacteria 1330
416 Ga0495585_0038200 3300046492 Bacteria 2702
417 Ga0495610_0007299 3300046512 Bacteria 7393
418 Ga0495610_0008615 3300046512 Bacteria 6579
419 Ga0495632_0004698 3300046519 Bacteria 9227
420 Ga0495632_0005440 3300046519 Bacteria 8421
421 Ga0495632_0039431 3300046519 Bacteria 2384
422 Ga0495643_0023147 3300046522 Bacteria 3534
423 Ga0495643_0030815 3300046522 Bacteria 2991
424 Ga0495642_0052531 3300046528 Bacteria 1678
425 Ga0495654_0022823 3300046530 Bacteria 3245
426 Ga0495597_0011802 3300046542 Bacteria 4230
427 Ga0495656_0020512 3300046615 Bacteria 2564
428 Ga0495668_0036483 3300046616 Bacteria 2754
429 Ga0495625_0088888 3300046660 Bacteria 2139
430 Ga0495646_0101016 3300046680 Bacteria 1654
431 Ga0495671_0053401 3300046692 Bacteria 2006
432 Ga0495600_0025245 3300046809 Bacteria 3829
433 Ga0495660_0015916 3300046810 Bacteria 4340
434 Ga0495683_0031177 3300047323 Bacteria 2717
435 Ga0495685_049203 3300047447 Bacteria 1432
436 Ga0495686_0033227 3300047472 Bacteria 3332
437 Ga0495686_0088798 3300047472 Bacteria 1879
438 Ga0496106_0005047 3300048909 Bacteria 9765
439 Ga0496116_0007488 3300048919 Bacteria 9665
440 Ga0496117_0035780 3300048920 Bacteria 3723
441 Ga0496117_0085263 3300048920 Bacteria 2057
442 Ga0496118_0017292 3300048921 Bacteria 6574
443 Ga0496121_0005879 3300048924 Bacteria 15533
444 Ga0496121_0091173 3300048924 Bacteria 2380
445 Ga0496122_0072947 3300048925 Bacteria 2437
446 Ga0496122_0110837 3300048925 Bacteria 1801
447 Ga0496123_0036381 3300048926 Bacteria 3493
448 Ga0496123_0038564 3300048926 Bacteria 3355
449 Ga0496124_0005332 3300048927 Bacteria 14517
450 Ga0496124_0009932 3300048927 Bacteria 9726
451 Ga0496124_0100512 3300048927 Bacteria 2344
452 Ga0496124_0121213 3300048927 Bacteria 2089
453 Ga0496125_0120455 3300048928 Bacteria 1873
454 Ga0496126_0038443 3300048929 Bacteria 4453
455 Ga0496126_0261458 3300048929 Bacteria 1439
456 Ga0496126_0298649 3300048929 Bacteria 1330
457 Ga0495678_009804 3300049459 Bacteria 4704
458 Ga0495682_0034235 3300049460 Bacteria 1874
459 Ga0501032_0010551 3300049569 Bacteria 6659
460 Ga0501032_0094432 3300049569 Bacteria 1983
461 Ga0501033_0003346 3300049570 Bacteria 13239
462 Ga0501034_0001155 3300049571 Bacteria 36610
463 Ga0501034_0001184 3300049571 Bacteria 36033
464 Ga0501034_0050984 3300049571 Bacteria 4173
465 Ga0501034_0082348 3300049571 Bacteria 3220
466 Ga0501036_0003819 3300049572 Bacteria 12086
467 Ga0501037_0032773 3300049573 Bacteria 3838
468 Ga0501038_0027793 3300049574 Bacteria 5028
469 Ga0501039_0173614 3300049575 Bacteria 1695
470 Ga0501043_0005235 3300049579 Bacteria 10487
471 Ga0501043_0094246 3300049579 Bacteria 2354
472 Ga0501046_0006691 3300049580 Bacteria 10178
473 Ga0501046_0280718 3300049580 Bacteria 1220
474 Ga0501047_0008841 3300049581 Bacteria 9500
475 Ga0501047_0153097 3300049581 Bacteria 2181
476 Ga0501048_0311097 3300049582 Bacteria 1121
477 Ga0501067_0016526 3300049583 Bacteria 4077
478 Ga0501068_0003406 3300049584 Bacteria 8553
479 Ga0501068_0013434 3300049584 Bacteria 4659
480 Ga0501069_0001256 3300049585 Bacteria 12419
481 Ga0501070_0007366 3300049586 Bacteria 9343
482 Ga0501072_0071160 3300049588 Bacteria 2748
483 Ga0501072_0138969 3300049588 Bacteria 1937
484 Ga0501073_0007895 3300049589 Bacteria 7895
485 Ga0501074_0022480 3300049590 Bacteria 4582
486 Ga0501074_0032660 3300049590 Bacteria 3770
487 Ga0501206_011512 3300049653 Bacteria 1195
488 Ga0501257_011803 3300049686 Bacteria 1997
489 Ga0501080_0002543 3300049742 Bacteria 15958
490 Ga0501083_0079471 3300049744 Bacteria 2174
491 Ga0501044_0008176 3300049823 Bacteria 11483
492 Ga0501044_0038523 3300049823 Bacteria 4992
493 nmdc:mga03683_100597_c1 3300050489 Bacteria 1270
494 nmdc:mga03n38_47757_c1 3300050490 Bacteria 1896
495 nmdc:mga00v17_103364_c1 3300050491 Bacteria 1800
496 nmdc:mga0yw44_266293_c1 3300050492 Bacteria 1143
497 nmdc:mga0yw44_56616_c1 3300050492 Bacteria 2390
498 nmdc:mga0k408_102585_c1 3300050493 Bacteria 1687
499 nmdc:mga0k408_121234_c1 3300050493 Bacteria 1549
500 nmdc:mga0k408_42625_c1 3300050493 Bacteria 2614
501 nmdc:mga0k408_97866_c1 3300050493 Bacteria 1728
502 nmdc:mga06z11_11845_c1 3300050494 Bacteria 3773
503 nmdc:mga06z11_134282_c1 3300050494 Bacteria 1393
504 nmdc:mga07m45_11762_c1 3300050496 Bacteria 2014
505 nmdc:mga07m45_30780_c1 3300050496 Bacteria 2974
506 nmdc:mga05p37_31046_c1 3300050507 Bacteria 6524
507 nmdc:mga05p37_320098_c1 3300050507 Bacteria 1836
508 nmdc:mga09592_61927_c1 3300050508 Bacteria 3165
509 nmdc:mga06r32_21551_c1 3300050510 Bacteria 5949
510 nmdc:mga08y16_428007_c1 3300050511 Bacteria 1352
511 nmdc:mga08y16_46_c1 3300050511 Bacteria 112050
512 nmdc:mga08y16_51467_c1 3300050511 Bacteria 4309
513 nmdc:mga0sz30_3471_c1 3300050516 Bacteria 5681
514 nmdc:mga0sz30_47533_c1 3300050516 Bacteria 1813
515 Ga0495612_0077768 3300053078 Bacteria 1391
516 Ga0500578_0000011 3300053086 Bacteria 217243
517 Ga0500578_0238126 3300053086 Bacteria 1100
518 Ga0500644_0006020 3300053088 Bacteria 3089
519 Ga0500646_0009446 3300053090 Bacteria 2496
520 Ga0500647_0080266 3300053091 Bacteria 1565
521 Ga0500651_0009464 3300053093 Bacteria 5793
522 Ga0500651_0030780 3300053093 Bacteria 3377
523 Ga0500641_0000382 3300053096 Bacteria 16395
524 Ga0500594_0014610 3300053118 Bacteria 1882
525 Ga0500623_083455 3300053127 Bacteria 1513
526 Ga0500628_001535 3300053129 Bacteria 3931
527 Ga0500642_0013263 3300053130 Bacteria 3022
528 Ga0500642_0058475 3300053130 Bacteria 1724
529 Ga0500652_000495 3300053131 Bacteria 13817
530 Ga0500655_004188 3300053133 Bacteria 2597
531 Ga0500658_0001766 3300053134 Bacteria 8525
532 Ga0500559_0000175 3300053136 Bacteria 50886
533 Ga0500568_0067092 3300053139 Bacteria 1379
534 Ga0500577_0023036 3300053142 Bacteria 2075
535 Ga0500590_058104 3300053148 Bacteria 1950
536 Ga0500604_0072238 3300053151 Bacteria 1102
537 Ga0500616_0002146 3300053153 Bacteria 17079
538 Ga0500616_0007056 3300053153 Bacteria 7207
539 Ga0500616_0046348 3300053153 Bacteria 2311
540 Ga0500622_0000689 3300053156 Bacteria 29849
541 Ga0500622_0001214 3300053156 Bacteria 21209
542 Ga0500622_0003093 3300053156 Bacteria 11464
543 Ga0500627_0141133 3300053158 Bacteria 1088
544 Ga0500636_0097121 3300053177 Bacteria 1680
545 Ga0500552_006428 3300053733 Bacteria 1318
546 Ga0500587_001344 3300053739 Bacteria 3457
547 Ga0501084_0006097 3300054114 Bacteria 9911
548 Ga0590077_016072 3300059426 Bacteria 1568
549 Ga0587073_0020941 3300059492 Bacteria 1252
550 Ga0501082_0003890 3300060353 Bacteria 13040
551 Ga0501082_0159757 3300060353 Bacteria 1958
552 Ga0501082_0484692 3300060353 Bacteria 1081

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005844 Ga0068862_100023621 Ga0068862_1000236213 293
2 3300049582 Ga0501048_0311097 Ga0501048_0311097_125_1036 296
3 3300006051 Ga0075364_10165295 Ga0075364_101652952 315
4 3300005262 Ga0065165_1001841 Ga0065165_10018417 316
5 3300053078 Ga0495612_0077768 Ga0495612_0077768_236_1189 316
6 3300053139 Ga0500568_0067092 Ga0500568_0067092_50_1051 316
7 3300025294 Ga0209025_1002792 Ga0209025_100279212 317
8 3300035085 Ga0373929_0009326 Ga0373929_0009326_737_1741 317
9 3300009177 Ga0105248_10214978 Ga0105248_102149782 318
10 3300013306 Ga0163162_10122458 Ga0163162_101224583 318
11 3300017792 Ga0163161_10169229 Ga0163161_101692292 318
12 3300031824 Ga0307413_10217504 Ga0307413_102175042 318
13 3300031903 Ga0307407_10182785 Ga0307407_101827852 318
14 3300044712 Ga0453684_0111102 Ga0453684_0111102_640_1614 318
15 3300045051 Ga0451576_0006848 Ga0451576_0006848_9425_10399 318
16 3300050493 nmdc:mga0k408_121234_c1 nmdc:mga0k408_121234_c1_83_1054 318
17 3300009098 Ga0105245_10319723 Ga0105245_103197232 319
18 3300025909 Ga0207705_10280623 Ga0207705_102806231 319
19 3300026023 Ga0207677_10369710 Ga0207677_103697101 319
20 3300045051 Ga0451576_0132046 Ga0451576_0132046_667_1629 319
21 3300050511 nmdc:mga08y16_46_c1 nmdc:mga08y16_46_c1_4582_5562 319
22 iso_pu_bacteria 2643221654 2644305782 319
23 3300003322 rootL2_10029991 rootL2_100299914 320
24 3300005295 Ga0065707_10097784 Ga0065707_100977842 320
25 3300005353 Ga0070669_100009624 Ga0070669_1000096242 320
26 3300005356 Ga0070674_100062032 Ga0070674_1000620322 320
27 3300005367 Ga0070667_100001050 Ga0070667_1000010505 320
28 3300005456 Ga0070678_100107072 Ga0070678_1001070722 320
29 3300005459 Ga0068867_100002992 Ga0068867_1000029923 320
30 3300005467 Ga0070706_100000708 Ga0070706_10000070812 320
31 3300005518 Ga0070699_100025390 Ga0070699_1000253904 320
32 3300005543 Ga0070672_100024302 Ga0070672_1000243023 320
33 3300005617 Ga0068859_100089126 Ga0068859_1000891262 320
34 3300005718 Ga0068866_10017754 Ga0068866_100177542 320
35 3300005719 Ga0068861_100000849 Ga0068861_1000008493 320
36 3300005842 Ga0068858_100043489 Ga0068858_1000434893 320
37 3300005843 Ga0068860_100004285 Ga0068860_10000428511 320
38 3300005844 Ga0068862_100005672 Ga0068862_1000056728 320
39 3300006178 Ga0075367_10119885 Ga0075367_101198851 320
40 3300006195 Ga0075366_10007808 Ga0075366_100078086 320
41 3300006195 Ga0075366_10175270 Ga0075366_101752702 320
42 3300006881 Ga0068865_100002258 Ga0068865_1000022589 320
43 3300006931 Ga0097620_100089125 Ga0097620_1000891252 320
44 3300009098 Ga0105245_10301045 Ga0105245_103010452 320
45 3300013297 Ga0157378_10004470 Ga0157378_100044702 320
46 3300013306 Ga0163162_10056123 Ga0163162_100561233 320
47 3300013308 Ga0157375_10138727 Ga0157375_101387272 320
48 3300013308 Ga0157375_10656686 Ga0157375_106566861 320
49 3300014326 Ga0157380_10006304 Ga0157380_100063043 320
50 3300014968 Ga0157379_10027342 Ga0157379_100273422 320
51 3300025907 Ga0207645_10052145 Ga0207645_100521452 320
52 3300025910 Ga0207684_10066252 Ga0207684_100662523 320
53 3300025923 Ga0207681_10013114 Ga0207681_100131143 320
54 3300025927 Ga0207687_10036195 Ga0207687_100361952 320
55 3300025937 Ga0207669_10202397 Ga0207669_102023971 320
56 3300025938 Ga0207704_10006660 Ga0207704_100066603 320
57 3300025940 Ga0207691_10009293 Ga0207691_100092936 320
58 3300025986 Ga0207658_10000576 Ga0207658_1000057617 320
59 3300025986 Ga0207658_10028202 Ga0207658_100282023 320
60 3300026035 Ga0207703_10021969 Ga0207703_100219692 320
61 3300026075 Ga0207708_10047648 Ga0207708_100476482 320
62 3300026089 Ga0207648_10009516 Ga0207648_100095167 320
63 3300026118 Ga0207675_100002512 Ga0207675_10000251214 320
64 3300026121 Ga0207683_10095318 Ga0207683_100953182 320
65 3300028379 Ga0268266_10099248 Ga0268266_100992482 320
66 3300028380 Ga0268265_10013241 Ga0268265_100132413 320
67 3300028381 Ga0268264_10001072 Ga0268264_100010723 320
68 3300028786 Ga0307517_10000922 Ga0307517_1000092240 320
69 3300028794 Ga0307515_10000306 Ga0307515_1000030685 320
70 3300028794 Ga0307515_10008185 Ga0307515_100081852 320
71 3300030522 Ga0307512_10034912 Ga0307512_100349122 320
72 3300031456 Ga0307513_10113027 Ga0307513_101130272 320
73 3300031507 Ga0307509_10000041 Ga0307509_1000004166 320
74 3300031507 Ga0307509_10003895 Ga0307509_100038951 320
75 3300031616 Ga0307508_10000113 Ga0307508_1000011338 320
76 3300031649 Ga0307514_10008015 Ga0307514_100080159 320
77 3300033180 Ga0307510_10011906 Ga0307510_100119063 320
78 3300033180 Ga0307510_10027735 Ga0307510_100277356 320
79 3300033180 Ga0307510_10037985 Ga0307510_100379852 320
80 3300033180 Ga0307510_10167569 Ga0307510_101675692 320
81 3300035695 Ga0373927_0098951 Ga0373927_0098951_379_1347 320
82 3300035725 Ga0373947_0153017 Ga0373947_0153017_379_1347 320
83 3300037068 Ga0373925_0003621 Ga0373925_0003621_176_1144 320
84 3300042131 Ga0450894_006327 Ga0450894_006327_92_1060 320
85 3300044656 Ga0466969_0031481 Ga0466969_0031481_1068_2072 320
86 3300045049 Ga0466959_0091715 Ga0466959_0091715_1007_2011 320
87 3300046454 Ga0495592_0000942 Ga0495592_0000942_3646_4620 320
88 3300046460 Ga0495638_0154329 Ga0495638_0154329_282_1256 320
89 3300046528 Ga0495642_0052531 Ga0495642_0052531_475_1443 320
90 3300046615 Ga0495656_0020512 Ga0495656_0020512_174_1142 320
91 3300046680 Ga0495646_0101016 Ga0495646_0101016_597_1571 320
92 3300047447 Ga0495685_049203 Ga0495685_049203_49_1017 320
93 3300047472 Ga0495686_0088798 Ga0495686_0088798_785_1759 320
94 3300049460 Ga0495682_0034235 Ga0495682_0034235_71_1045 320
95 3300049653 Ga0501206_011512 Ga0501206_011512_106_1074 320
96 3300050493 nmdc:mga0k408_42625_c1 nmdc:mga0k408_42625_c1_1131_2108 320
97 3300050493 nmdc:mga0k408_97866_c1 nmdc:mga0k408_97866_c1_272_1246 320
98 3300050496 nmdc:mga07m45_30780_c1 nmdc:mga07m45_30780_c1_426_1403 320
99 3300053088 Ga0500644_0006020 Ga0500644_0006020_1827_2801 320
100 3300053093 Ga0500651_0009464 Ga0500651_0009464_375_1349 320
101 3300053118 Ga0500594_0014610 Ga0500594_0014610_17_991 320
102 3300053136 Ga0500559_0000175 Ga0500559_0000175_13723_14697 320
103 3300053148 Ga0500590_058104 Ga0500590_058104_367_1335 320
104 3300053151 Ga0500604_0072238 Ga0500604_0072238_15_989 320
105 3300053156 Ga0500622_0001214 Ga0500622_0001214_16706_17680 320
106 3300053177 Ga0500636_0097121 Ga0500636_0097121_173_1147 320
107 3300053739 Ga0500587_001344 Ga0500587_001344_2101_3075 320
108 3300025254 Ga0209148_1002865 Ga0209148_10028653 321
109 3300025272 Ga0209455_1001248 Ga0209455_10012483 321
110 3300049579 Ga0501043_0094246 Ga0501043_0094246_1282_2259 321
111 iso_pu_bacteria 2585428057 2587730362 321
112 iso_pu_bacteria 2585428058 2587736867 321
113 iso_pu_bacteria 2588253510 2588291771 321
114 iso_pu_bacteria 2643221592 2643972405 321
115 iso_pu_bacteria 2643221625 2644138587 321
116 iso_pu_bacteria 2643221648 2644272913 321
117 3300005617 Ga0068859_100181250 Ga0068859_1001812503 322
118 3300006177 Ga0075362_10114791 Ga0075362_101147911 322
119 3300006931 Ga0097620_100181249 Ga0097620_1001812493 322
120 3300039453 Ga0436362_0108458 Ga0436362_0108458_11_982 322
121 3300005356 Ga0070674_100007923 Ga0070674_1000079235 323
122 3300005718 Ga0068866_10078466 Ga0068866_100784661 323
123 3300005719 Ga0068861_100033362 Ga0068861_1000333622 323
124 3300005981 Ga0081538_10010243 Ga0081538_100102432 323
125 3300006881 Ga0068865_100051171 Ga0068865_1000511714 323
126 3300009094 Ga0111539_10000042 Ga0111539_1000004251 323
127 3300025899 Ga0207642_10038830 Ga0207642_100388302 323
128 3300025923 Ga0207681_10012222 Ga0207681_100122225 323
129 3300025938 Ga0207704_10037628 Ga0207704_100376282 323
130 3300026118 Ga0207675_100020788 Ga0207675_1000207882 323
131 3300027907 Ga0207428_10000092 Ga0207428_1000009297 323
132 3300028380 Ga0268265_10026643 Ga0268265_100266431 323
133 3300031824 Ga0307413_10040277 Ga0307413_100402772 323
134 3300031901 Ga0307406_10085735 Ga0307406_100857352 323
135 3300031903 Ga0307407_10100207 Ga0307407_101002072 323
136 3300031995 Ga0307409_100025293 Ga0307409_1000252934 323
137 3300032126 Ga0307415_100134848 Ga0307415_1001348481 323
138 3300049569 Ga0501032_0010551 Ga0501032_0010551_2088_3080 323
139 3300049570 Ga0501033_0003346 Ga0501033_0003346_3912_4904 323
140 3300049572 Ga0501036_0003819 Ga0501036_0003819_9007_9999 323
141 3300049573 Ga0501037_0032773 Ga0501037_0032773_2137_3129 323
142 3300049574 Ga0501038_0027793 Ga0501038_0027793_745_1737 323
143 3300049579 Ga0501043_0005235 Ga0501043_0005235_7045_8037 323
144 3300049580 Ga0501046_0006691 Ga0501046_0006691_160_1152 323
145 3300049581 Ga0501047_0008841 Ga0501047_0008841_6237_7229 323
146 3300049583 Ga0501067_0016526 Ga0501067_0016526_1874_2866 323
147 3300049584 Ga0501068_0013434 Ga0501068_0013434_3066_4058 323
148 3300049585 Ga0501069_0001256 Ga0501069_0001256_5488_6480 323
149 3300049586 Ga0501070_0007366 Ga0501070_0007366_1667_2659 323
150 3300049588 Ga0501072_0071160 Ga0501072_0071160_29_1021 323
151 3300049589 Ga0501073_0007895 Ga0501073_0007895_4816_5808 323
152 3300049590 Ga0501074_0032660 Ga0501074_0032660_2119_3111 323
153 3300049742 Ga0501080_0002543 Ga0501080_0002543_5939_6931 323
154 3300049823 Ga0501044_0008176 Ga0501044_0008176_8122_9114 323
155 3300050507 nmdc:mga05p37_320098_c1 nmdc:mga05p37_320098_c1_428_1420 323
156 3300054114 Ga0501084_0006097 Ga0501084_0006097_1943_2935 323
157 3300059426 Ga0590077_016072 Ga0590077_016072_353_1345 323
158 3300060353 Ga0501082_0003890 Ga0501082_0003890_4690_5682 323
159 3300060353 Ga0501082_0484692 Ga0501082_0484692_49_1041 323
160 3300005295 Ga0065707_10106344 Ga0065707_101063444 324
161 3300005344 Ga0070661_100056787 Ga0070661_1000567872 324
162 3300005354 Ga0070675_100061463 Ga0070675_1000614635 324
163 3300005457 Ga0070662_100302187 Ga0070662_1003021872 324
164 3300005539 Ga0068853_100298914 Ga0068853_1002989142 324
165 3300005563 Ga0068855_100088510 Ga0068855_1000885102 324
166 3300005577 Ga0068857_100122150 Ga0068857_1001221502 324
167 3300005616 Ga0068852_100146981 Ga0068852_1001469812 324
168 3300009094 Ga0111539_10179738 Ga0111539_101797382 324
169 3300009553 Ga0105249_10559291 Ga0105249_105592912 324
170 3300013100 Ga0157373_10017731 Ga0157373_100177313 324
171 3300013104 Ga0157370_10269875 Ga0157370_102698752 324
172 3300013306 Ga0163162_10452500 Ga0163162_104525002 324
173 3300013307 Ga0157372_10048084 Ga0157372_100480842 324
174 3300025901 Ga0207688_10102761 Ga0207688_101027612 324
175 3300025907 Ga0207645_10076364 Ga0207645_100763642 324
176 3300025912 Ga0207707_10386837 Ga0207707_103868371 324
177 3300025913 Ga0207695_10126172 Ga0207695_101261722 324
178 3300025933 Ga0207706_10209385 Ga0207706_102093852 324
179 3300025944 Ga0207661_10031766 Ga0207661_100317662 324
180 3300026078 Ga0207702_10038579 Ga0207702_100385793 324
181 3300026116 Ga0207674_10048582 Ga0207674_100485823 324
182 3300027907 Ga0207428_10055437 Ga0207428_100554372 324
183 3300031616 Ga0307508_10036513 Ga0307508_100365133 324
184 3300033180 Ga0307510_10045419 Ga0307510_100454193 324
185 3300037418 Ga0395900_0011631 Ga0395900_0011631_4139_5128 324
186 3300037853 Ga0436364_0677535 Ga0436364_0677535_649_1641 324
187 3300038443 Ga0395901_0069622 Ga0395901_0069622_489_1478 324
188 3300039450 Ga0436363_1409112 Ga0436363_1409112_1240_2256 324
189 3300042436 Ga0439435_0001104 Ga0439435_0001104_2839_3831 324
190 3300042461 Ga0439460_0025686 Ga0439460_0025686_279_1271 324
191 3300044901 Ga0466960_0063410 Ga0466960_0063410_681_1685 324
192 3300050511 nmdc:mga08y16_51467_c1 nmdc:mga08y16_51467_c1_2221_3213 324
193 3300003215 JGI25153J46596_10005292 JGI25153J46596_100052925 325
194 3300003791 Ga0055530_10009535 Ga0055530_100095353 325
195 3300005365 Ga0070688_100220092 Ga0070688_1002200922 325
196 3300005546 Ga0070696_100036846 Ga0070696_1000368462 325
197 3300005548 Ga0070665_100032009 Ga0070665_1000320093 325
198 3300005840 Ga0068870_10139131 Ga0068870_101391312 325
199 3300006175 Ga0070712_100168158 Ga0070712_1001681582 325
200 3300006195 Ga0075366_10065212 Ga0075366_100652122 325
201 3300006353 Ga0075370_10036990 Ga0075370_100369902 325
202 3300025258 Ga0209129_1017206 Ga0209129_10172061 325
203 3300025297 Ga0209758_1000057 Ga0209758_1000057209 325
204 3300025298 Ga0209050_1000149 Ga0209050_1000149131 325
205 3300025302 Ga0207426_1021381 Ga0207426_10213812 325
206 3300025303 Ga0209051_1027331 Ga0209051_10273312 325
207 3300025901 Ga0207688_10211085 Ga0207688_102110851 325
208 3300025915 Ga0207693_10033704 Ga0207693_100337043 325
209 3300025936 Ga0207670_10071609 Ga0207670_100716092 325
210 3300025938 Ga0207704_10032588 Ga0207704_100325881 325
211 3300026121 Ga0207683_10005865 Ga0207683_100058653 325
212 3300026121 Ga0207683_10248498 Ga0207683_102484982 325
213 3300028379 Ga0268266_10004190 Ga0268266_100041902 325
214 3300037471 Ga0395905_0054137 Ga0395905_0054137_1873_2865 325
215 3300041459 Ga0451800_0415455 Ga0451800_0415455_318_1298 325
216 3300041463 Ga0451804_0831358 Ga0451804_0831358_1155_2135 325
217 3300042005 Ga0439448_0038522 Ga0439448_0038522_327_1322 325
218 3300044694 Ga0466963_0080558 Ga0466963_0080558_512_1507 325
219 3300045976 Ga0466967_0014017 Ga0466967_0014017_541_1536 325
220 3300046519 Ga0495632_0004698 Ga0495632_0004698_1334_2314 325
221 3300049571 Ga0501034_0001155 Ga0501034_0001155_9881_10873 325
222 3300049571 Ga0501034_0001184 Ga0501034_0001184_10308_11300 325
223 3300049571 Ga0501034_0082348 Ga0501034_0082348_790_1782 325
224 3300049580 Ga0501046_0280718 Ga0501046_0280718_127_1119 325
225 3300049581 Ga0501047_0153097 Ga0501047_0153097_44_1036 325
226 3300049584 Ga0501068_0003406 Ga0501068_0003406_137_1129 325
227 3300049588 Ga0501072_0138969 Ga0501072_0138969_863_1855 325
228 3300049686 Ga0501257_011803 Ga0501257_011803_909_1901 325
229 3300049823 Ga0501044_0038523 Ga0501044_0038523_2260_3252 325
230 3300050496 nmdc:mga07m45_11762_c1 nmdc:mga07m45_11762_c1_520_1500 325
231 3300053086 Ga0500578_0000011 Ga0500578_0000011_121793_122773 325
232 3300053090 Ga0500646_0009446 Ga0500646_0009446_670_1650 325
233 3300053093 Ga0500651_0030780 Ga0500651_0030780_1954_2934 325
234 3300053127 Ga0500623_083455 Ga0500623_083455_526_1503 325
235 3300053129 Ga0500628_001535 Ga0500628_001535_1610_2590 325
236 3300053130 Ga0500642_0013263 Ga0500642_0013263_455_1435 325
237 3300053131 Ga0500652_000495 Ga0500652_000495_1799_2779 325
238 3300053133 Ga0500655_004188 Ga0500655_004188_253_1233 325
239 3300053142 Ga0500577_0023036 Ga0500577_0023036_998_1978 325
240 3300053156 Ga0500622_0000689 Ga0500622_0000689_1282_2262 325
241 3300053158 Ga0500627_0141133 Ga0500627_0141133_92_1069 325
242 iso_pu_bacteria 2919493220 2919496510 325
243 iso_pu_bacteria 2919543075 2919546894 325
244 iso_pu_bacteria 2923525760 2923526553 325
245 3300002773 JGI25152J39213_1001971 JGI25152J39213_10019712 326
246 3300003215 JGI25153J46596_10006944 JGI25153J46596_100069443 326
247 3300003771 Ga0055526_1011220 Ga0055526_10112203 326
248 3300025245 Ga0207425_1000665 Ga0207425_100066513 326
249 3300025258 Ga0209129_1000041 Ga0209129_1000041214 326
250 3300025273 Ga0209673_1043372 Ga0209673_10433722 326
251 3300025295 Ga0209564_1000029 Ga0209564_1000029360 326
252 3300025297 Ga0209758_1000043 Ga0209758_100004380 326
253 iso_pu_bacteria 2509276021 2509388999 326
254 iso_pu_bacteria 2509276033 2509444589 326
255 iso_pu_bacteria 2510065019 2510135664 326
256 iso_pu_bacteria 2510461076 2510897137 326
257 iso_pu_bacteria 2510917028 2511185331 326
258 iso_pu_bacteria 2510917030 2511200527 326
259 iso_pu_bacteria 2513237084 2513570825 326
260 iso_pu_bacteria 2513237085 2513574960 326
261 iso_pu_bacteria 2513237088 2513595608 326
262 iso_pu_bacteria 2513237093 2513633744 326
263 iso_pu_bacteria 2513237103 2513707591 326
264 iso_pu_bacteria 2513237138 2513865367 326
265 iso_pu_bacteria 2513237144 2513910993 326
266 iso_pu_bacteria 2513237146 2513924301 326
267 iso_pu_bacteria 2513237162 2514023675 326
268 iso_pu_bacteria 2515075009 2515114828 326
269 iso_pu_bacteria 2515154113 2515635815 326
270 iso_pu_bacteria 2515154114 2515641429 326
271 iso_pu_bacteria 2515154116 2515659318 326
272 iso_pu_bacteria 2515154134 2515741187 326
273 iso_pu_bacteria 2516653077 2517038446 326
274 iso_pu_bacteria 2516653085 2517078722 326
275 iso_pu_bacteria 2517093000 2517097464 326
276 iso_pu_bacteria 2517287029 2517408920 326
277 iso_pu_bacteria 2519899620 2520379186 326
278 iso_pu_bacteria 2529292951 2530648349 326
279 iso_pu_bacteria 2534681796 2535514579 326
280 iso_pu_bacteria 2582581294 2585201276 326
281 iso_pu_bacteria 2582581298 2585223254 326
282 iso_pu_bacteria 2582581304 2585256419 326
283 iso_pu_bacteria 2582581867 2585399095 326
284 iso_pu_bacteria 2585427526 2585523963 326
285 iso_pu_bacteria 2585427528 2585542107 326
286 iso_pu_bacteria 2585427529 2585546150 326
287 iso_pu_bacteria 2585427590 2585818755 326
288 iso_pu_bacteria 2585427593 2585840683 326
289 iso_pu_bacteria 2585427594 2585843699 326
290 iso_pu_bacteria 2599185170 2599419741 326
291 iso_pu_bacteria 2615840624 2616293966 326
292 iso_pu_bacteria 2643221599 2644004422 326
293 iso_pu_bacteria 2643221653 2644298206 326
294 iso_pu_bacteria 2643221719 2644656458 326
295 iso_pu_bacteria 2718217882 2719183327 326
296 iso_pu_bacteria 2718217927 2719388087 326
297 iso_pu_bacteria 2718217997 2719667710 326
298 iso_pu_bacteria 2718218009 2719734044 326
299 iso_pu_bacteria 2718218199 2720494130 326
300 iso_pu_bacteria 2718218232 2720615593 326
301 iso_pu_bacteria 2718218233 2720622376 326
302 iso_pu_bacteria 2718218235 2720633730 326
303 iso_pu_bacteria 2718218269 2720777430 326
304 iso_pu_bacteria 2718218363 2721149439 326
305 iso_pu_bacteria 2718218365 2721160842 326
306 iso_pu_bacteria 2718218366 2721166276 326
307 iso_pu_bacteria 2718218423 2721401720 326
308 iso_pu_bacteria 2721755514 2722842446 326
309 iso_pu_bacteria 2721755556 2723029027 326
310 iso_pu_bacteria 2721755684 2723562644 326
311 iso_pu_bacteria 2721755685 2723569337 326
312 iso_pu_bacteria 2721755809 2724040534 326
313 iso_pu_bacteria 2721755810 2724046800 326
314 iso_pu_bacteria 2721755819 2724092037 326
315 iso_pu_bacteria 2721755822 2724106602 326
316 iso_pu_bacteria 2721755823 2724112410 326
317 iso_pu_bacteria 2724679232 2725949672 326
318 iso_pu_bacteria 2728369352 2730109963 326
319 iso_pu_bacteria 2728369365 2730166562 326
320 iso_pu_bacteria 2728369397 2730300474 326
321 iso_pu_bacteria 2738541293 2738800774 326
322 iso_pu_bacteria 2738541317 2738946696 326
323 iso_pu_bacteria 2738541333 2739037356 326
324 iso_pu_bacteria 2765235942 2766067166 326
325 iso_pu_bacteria 2775507049 2776915985 326
326 iso_pu_bacteria 2791355253 2793283108 326
327 iso_pu_bacteria 2791355256 2793298455 326
328 iso_pu_bacteria 2791355259 2793315705 326
329 iso_pu_bacteria 2791355260 2793323488 326
330 iso_pu_bacteria 2791355261 2793327566 326
331 iso_pu_bacteria 2791355262 2793335637 326
332 iso_pu_bacteria 2791355263 2793341031 326
333 iso_pu_bacteria 2791355264 2793350292 326
334 iso_pu_bacteria 2791355265 2793354767 326
335 iso_pu_bacteria 2791355266 2793358536 326
336 iso_pu_bacteria 2791355267 2793368988 326
337 iso_pu_bacteria 2802429605 2805928912 326
338 iso_pu_bacteria 2802429606 2805934533 326
339 iso_pu_bacteria 2802429633 2806047083 326
340 iso_pu_bacteria 2802429634 2806054918 326
341 iso_pu_bacteria 2802429635 2806061854 326
342 iso_pu_bacteria 2802429636 2806069623 326
343 iso_pu_bacteria 2802429637 2806076006 326
344 iso_pu_bacteria 2818991272 2819244213 326
345 iso_pu_bacteria 2821443989 2821444385 326
346 iso_pu_bacteria 2838016132 2838020937 326
347 iso_pu_bacteria 2838022645 2838026840 326
348 iso_pu_bacteria 2838035591 2838039726 326
349 iso_pu_bacteria 2838042994 2838044861 326
350 iso_pu_bacteria 2838048938 2838052914 326
351 iso_pu_bacteria 2838061910 2838064707 326
352 iso_pu_bacteria 2838068647 2838070516 326
353 iso_pu_bacteria 2838661181 2838664004 326
354 iso_pu_bacteria 2838668709 2838672536 326
355 iso_pu_bacteria 2838680041 2838685579 326
356 iso_pu_bacteria 2838686498 2838689845 326
357 iso_pu_bacteria 2838694306 2838695965 326
358 iso_pu_bacteria 2838701080 2838705141 326
359 iso_pu_bacteria 2838707686 2838713364 326
360 iso_pu_bacteria 2838729681 2838731459 326
361 iso_pu_bacteria 2838742623 2838744400 326
362 iso_pu_bacteria 2841851746 2841852940 326
363 iso_pu_bacteria 2841864319 2841870215 326
364 iso_pu_bacteria 2842077413 2842082598 326
365 iso_pu_bacteria 2842110456 2842112753 326
366 iso_pu_bacteria 2842118031 2842123843 326
367 iso_pu_bacteria 2842146304 2842150135 326
368 iso_pu_bacteria 2842156927 2842160267 326
369 iso_pu_bacteria 2842163707 2842165755 326
370 iso_pu_bacteria 2842180545 2842184067 326
371 iso_pu_bacteria 2842192696 2842196369 326
372 iso_pu_bacteria 2842198810 2842202443 326
373 iso_pu_bacteria 2842205361 2842208905 326
374 iso_pu_bacteria 2842217011 2842219431 326
375 iso_pu_bacteria 2842229732 2842231649 326
376 iso_pu_bacteria 2842237096 2842242898 326
377 iso_pu_bacteria 2842243621 2842245882 326
378 iso_pu_bacteria 2842250916 2842254821 326
379 iso_pu_bacteria 2842257432 2842260260 326
380 iso_pu_bacteria 2842264693 2842267148 326
381 iso_pu_bacteria 2842271015 2842273671 326
382 iso_pu_bacteria 2842278818 2842282405 326
383 iso_pu_bacteria 2842285085 2842290055 326
384 iso_pu_bacteria 2842291075 2842296971 326
385 iso_pu_bacteria 2842304105 2842308477 326
386 iso_pu_bacteria 2842311132 2842312219 326
387 iso_pu_bacteria 2842317721 2842321813 326
388 iso_pu_bacteria 2842341865 2842344661 326
389 iso_pu_bacteria 2842363717 2842367764 326
390 iso_pu_bacteria 2842370503 2842376035 326
391 iso_pu_bacteria 2842377471 2842383245 326
392 iso_pu_bacteria 2842384541 2842390378 326
393 iso_pu_bacteria 2842395702 2842397846 326
394 iso_pu_bacteria 2842402390 2842407665 326
395 iso_pu_bacteria 2842409023 2842414296 326
396 iso_pu_bacteria 2842415677 2842420844 326
397 iso_pu_bacteria 2842422224 2842424130 326
398 iso_pu_bacteria 2842428310 2842431156 326
399 iso_pu_bacteria 2842434925 2842437491 326
400 iso_pu_bacteria 2842441272 2842444306 326
401 iso_pu_bacteria 2842447887 2842451267 326
402 iso_pu_bacteria 2842462802 2842465299 326
403 iso_pu_bacteria 2842469257 2842472232 326
404 iso_pu_bacteria 2842489311 2842494103 326
405 iso_pu_bacteria 2842495871 2842501252 326
406 iso_pu_bacteria 2844454524 2844456593 326
407 iso_pu_bacteria 2844533157 2844539642 326
408 iso_pu_bacteria 2857516855 2857520889 326
409 iso_pu_bacteria 2913308742 2913311946 326
410 iso_pu_bacteria 2919100787 2919101867 326
411 iso_pu_bacteria 2923556063 2923556186 326
412 iso_pu_bacteria 2933570622 2933574926 326
413 iso_pu_bacteria 2933586486 2933588358 326
414 iso_pu_bacteria 2933599457 2933601321 326
415 iso_pu_bacteria 2935894831 2935899983 326
416 iso_pu_bacteria 2935901341 2935902320 326
417 iso_pu_bacteria 2936367885 2936369546 326
418 iso_pu_bacteria 2936375103 2936380287 326
419 iso_pu_bacteria 2936381700 2936385256 326
420 iso_pu_bacteria 2989776772 2989776836 326
421 iso_pu_bacteria 2996887358 2996887973 326
422 iso_pu_bacteria 2996893221 2996897594 326
423 iso_pu_bacteria 3005409236 3005410630 326
424 iso_pu_bacteria 3005445848 3005450091 326
425 iso_pu_bacteria 3005452660 3005456338 326
426 iso_pu_bacteria 639633055 639646063 326
427 iso_pu_bacteria 8005246636 8005247881 326
428 iso_pu_bacteria 8005258706 8005261461 326
429 iso_pu_bacteria 8005275841 8005278289 326
430 iso_pu_bacteria 8005282627 8005282677 326
431 iso_pu_bacteria 8005289223 8005291653 326
432 iso_pu_bacteria 8005307578 8005310250 326
433 iso_pu_bacteria 8005321885 8005322500 326
434 iso_pu_bacteria 8005376324 8005378103 326
435 iso_pu_bacteria 8005382845 8005384113 326
436 iso_pu_bacteria 8005395548 8005399609 326
437 iso_pu_bacteria 8005430974 8005433798 326
438 iso_pu_bacteria 8005460587 8005465524 326
439 iso_pu_bacteria 8005497431 8005498107 326
440 iso_pu_bacteria 8005542996 8005543239 326
441 iso_pu_bacteria 8005556819 8005559974 326
442 iso_pu_bacteria 8005563573 8005564532 326
443 iso_pu_bacteria 8005570704 8005571218 326
444 iso_pu_bacteria 8005619151 8005619316 326
445 iso_pu_bacteria 8005626139 8005627881 326
446 iso_pu_bacteria 8005668836 8005669515 326
447 iso_pu_bacteria 8005695170 8005701462 326
448 iso_pu_bacteria 8018127388 8018132532 326
449 iso_pu_bacteria 8018163183 8018167608 326
450 iso_pu_bacteria 8018176218 8018176621 326
451 iso_pu_bacteria 8023680758 8023681273 326
452 iso_pu_bacteria 8024479707 8024481896 326
453 iso_pu_bacteria 8024501048 8024506332 326
454 iso_pu_bacteria 8056375014 8056381191 326
455 iso_pu_bacteria 8056382006 8056382684 326
456 iso_pu_bacteria 8057874678 8057878702 326
457 3300005329 Ga0070683_100044725 Ga0070683_1000447253 327
458 3300005518 Ga0070699_100450560 Ga0070699_1004505601 327
459 3300005937 Ga0081455_10259731 Ga0081455_102597311 327
460 3300005983 Ga0081540_1050186 Ga0081540_10501863 327
461 3300006847 Ga0075431_100001768 Ga0075431_1000017685 327
462 3300006880 Ga0075429_100058767 Ga0075429_1000587673 327
463 3300009094 Ga0111539_10481012 Ga0111539_104810122 327
464 3300009147 Ga0114129_10002929 Ga0114129_1000292919 327
465 3300009553 Ga0105249_10488272 Ga0105249_104882721 327
466 3300028786 Ga0307517_10101384 Ga0307517_101013842 327
467 3300031250 Ga0265331_10011765 Ga0265331_100117653 327
468 3300031456 Ga0307513_10166937 Ga0307513_101669371 327
469 3300031595 Ga0265313_10053406 Ga0265313_100534062 327
470 3300031730 Ga0307516_10041776 Ga0307516_100417764 327
471 3300035114 Ga0373939_0078319 Ga0373939_0078319_44_1033 327
472 3300037418 Ga0395900_0019809 Ga0395900_0019809_5616_6617 327
473 3300037466 Ga0395898_0252071 Ga0395898_0252071_528_1529 327
474 3300038443 Ga0395901_0001404 Ga0395901_0001404_8373_9377 327
475 3300038443 Ga0395901_0006779 Ga0395901_0006779_1054_2055 327
476 3300049590 Ga0501074_0022480 Ga0501074_0022480_1316_2311 327
477 3300050507 nmdc:mga05p37_31046_c1 nmdc:mga05p37_31046_c1_3716_4711 327
478 3300050508 nmdc:mga09592_61927_c1 nmdc:mga09592_61927_c1_99_1094 327
479 3300050510 nmdc:mga06r32_21551_c1 nmdc:mga06r32_21551_c1_2087_3082 327
480 3300050511 nmdc:mga08y16_428007_c1 nmdc:mga08y16_428007_c1_128_1147 327
481 iso_pu_bacteria 2510917022 2511137157 327
482 iso_pu_bacteria 2524023209 2524461876 327
483 iso_pu_bacteria 2582581307 2585273453 327
484 iso_pu_bacteria 2582581308 2585283165 327
485 iso_pu_bacteria 2582581315 2585328206 327
486 iso_pu_bacteria 2582581316 2585330618 327
487 iso_pu_bacteria 2585427527 2585536013 327
488 iso_pu_bacteria 2585427530 2585556659 327
489 iso_pu_bacteria 2585427531 2585564019 327
490 iso_pu_bacteria 2585427608 2585900311 327
491 iso_pu_bacteria 2585427609 2585909273 327
492 iso_pu_bacteria 2585428125 2587984625 327
493 iso_pu_bacteria 2615840626 2616311192 327
494 iso_pu_bacteria 2615840698 2616556074 327
495 iso_pu_bacteria 2617270742 2617380727 327
496 iso_pu_bacteria 2667528174 2671115841 327
497 iso_pu_bacteria 2775507266 2778179502 327
498 iso_pu_bacteria 2818991448 2819608885 327
499 iso_pu_bacteria 2818991453 2819643310 327
500 iso_pu_bacteria 2818991467 2819720523 327
501 iso_pu_bacteria 2838029111 2838033950 327
502 iso_pu_bacteria 2842298080 2842299942 327
503 iso_pu_bacteria 2842357229 2842359536 327
504 iso_pu_bacteria 2842475841 2842480696 327
505 iso_pu_bacteria 2842482326 2842487260 327
506 iso_pu_bacteria 2842502639 2842507261 327
507 iso_pu_bacteria 2842509118 2842514535 327
508 iso_pu_bacteria 2852387548 2852387859 327
509 iso_pu_bacteria 2919408235 2919408323 327
510 iso_pu_bacteria 3005416602 3005423304 327
511 iso_pu_bacteria 8005314921 8005315631 327
512 iso_pu_bacteria 8005484373 8005484462 327
513 iso_pu_bacteria 8005645114 8005647382 327
514 iso_pu_bacteria 8005682033 8005687462 327
515 iso_pu_bacteria 8024486573 8024488596 327
516 iso_pu_bacteria 8046767195 8046768686 327
517 iso_pu_bacteria 8055431914 8055433776 327
518 iso_pu_bacteria 8057575449 8057582461 327
519 3300003911 JGI25405J52794_10023527 JGI25405J52794_100235271 328
520 3300005340 Ga0070689_100118840 Ga0070689_1001188402 328
521 3300005347 Ga0070668_100367952 Ga0070668_1003679521 328
522 3300005436 Ga0070713_100019350 Ga0070713_1000193502 328
523 3300005445 Ga0070708_100444427 Ga0070708_1004444272 328
524 3300005467 Ga0070706_100282245 Ga0070706_1002822451 328
525 3300005468 Ga0070707_100057697 Ga0070707_1000576972 328
526 3300005471 Ga0070698_100000987 Ga0070698_10000098724 328
527 3300005518 Ga0070699_100040866 Ga0070699_1000408662 328
528 3300005536 Ga0070697_100010490 Ga0070697_1000104903 328
529 3300005536 Ga0070697_100195872 Ga0070697_1001958722 328
530 3300005577 Ga0068857_100124930 Ga0068857_1001249302 328
531 3300005843 Ga0068860_100122017 Ga0068860_1001220172 328
532 3300005937 Ga0081455_10001748 Ga0081455_100017485 328
533 3300005937 Ga0081455_10026351 Ga0081455_100263513 328
534 3300005981 Ga0081538_10129361 Ga0081538_101293611 328
535 3300005985 Ga0081539_10002734 Ga0081539_1000273418 328
536 3300005985 Ga0081539_10044159 Ga0081539_100441592 328
537 3300006038 Ga0075365_10009158 Ga0075365_100091581 328
538 3300006038 Ga0075365_10132854 Ga0075365_101328541 328
539 3300006178 Ga0075367_10056918 Ga0075367_100569182 328
540 3300006178 Ga0075367_10134136 Ga0075367_101341361 328
541 3300007265 Ga0099794_10042247 Ga0099794_100422472 328
542 3300009551 Ga0105238_10027122 Ga0105238_100271227 328
543 3300010159 Ga0099796_10014736 Ga0099796_100147361 328
544 3300013104 Ga0157370_10241175 Ga0157370_102411752 328
545 3300021384 Ga0213876_10033662 Ga0213876_100336622 328
546 3300025922 Ga0207646_10190607 Ga0207646_101906072 328
547 3300025928 Ga0207700_10084832 Ga0207700_100848322 328
548 3300026116 Ga0207674_10145686 Ga0207674_101456862 328
549 3300026118 Ga0207675_100144260 Ga0207675_1001442602 328
550 3300028381 Ga0268264_10479516 Ga0268264_104795162 328
551 3300028573 Ga0265334_10005584 Ga0265334_100055842 328
552 3300031344 Ga0265316_10073853 Ga0265316_100738531 328
553 3300035691 Ga0373931_0146349 Ga0373931_0146349_270_1274 328
554 3300035692 Ga0373935_0209583 Ga0373935_0209583_26_1027 328
555 3300037068 Ga0373925_0182507 Ga0373925_0182507_264_1331 328
556 3300037418 Ga0395900_0061251 Ga0395900_0061251_2264_3268 328
557 3300037466 Ga0395898_0017238 Ga0395898_0017238_2659_3663 328
558 3300039437 Ga0436365_1374407 Ga0436365_1374407_4186_5187 328
559 3300039438 Ga0436360_1291673 Ga0436360_1291673_1912_2925 328
560 3300048929 Ga0496126_0261458 Ga0496126_0261458_52_1053 328
561 3300048929 Ga0496126_0298649 Ga0496126_0298649_39_1037 328
562 3300050489 nmdc:mga03683_100597_c1 nmdc:mga03683_100597_c1_220_1221 328
563 3300050491 nmdc:mga00v17_103364_c1 nmdc:mga00v17_103364_c1_451_1452 328
564 3300050492 nmdc:mga0yw44_266293_c1 nmdc:mga0yw44_266293_c1_125_1126 328
565 3300050492 nmdc:mga0yw44_56616_c1 nmdc:mga0yw44_56616_c1_363_1364 328
566 3300050493 nmdc:mga0k408_102585_c1 nmdc:mga0k408_102585_c1_407_1408 328
567 3300050494 nmdc:mga06z11_11845_c1 nmdc:mga06z11_11845_c1_86_1087 328
568 3300050494 nmdc:mga06z11_134282_c1 nmdc:mga06z11_134282_c1_172_1173 328
569 3300050516 nmdc:mga0sz30_3471_c1 nmdc:mga0sz30_3471_c1_902_1903 328
570 3300053096 Ga0500641_0000382 Ga0500641_0000382_13867_14868 328
571 3300053130 Ga0500642_0058475 Ga0500642_0058475_414_1415 328
572 3300053153 Ga0500616_0002146 Ga0500616_0002146_11810_12811 328
573 3300053733 Ga0500552_006428 Ga0500552_006428_214_1215 328
574 iso_pu_bacteria 2643221734 2644737562 328
575 iso_pu_bacteria 2643221736 2644743829 328
576 iso_pu_bacteria 2841760612 2841764853 328
577 iso_pu_bacteria 2844104063 2844107699 328
578 iso_pu_bacteria 2851182111 2851183540 328
579 iso_pu_bacteria 2851246043 2851249805 328
580 iso_pu_bacteria 2884298095 2884301201 328
581 iso_pu_bacteria 2917699015 2917702918 328
582 iso_pu_bacteria 8057529695 8057533124 328
583 3300005327 Ga0070658_10002626 Ga0070658_100026267 329
584 3300005336 Ga0070680_100003898 Ga0070680_1000038988 329
585 3300005341 Ga0070691_10103671 Ga0070691_101036712 329
586 3300005458 Ga0070681_10039594 Ga0070681_100395942 329
587 3300005530 Ga0070679_100030405 Ga0070679_1000304053 329
588 3300005614 Ga0068856_100063949 Ga0068856_1000639492 329
589 3300009093 Ga0105240_10009499 Ga0105240_100094993 329
590 3300025912 Ga0207707_10019725 Ga0207707_100197252 329
591 3300025921 Ga0207652_10048257 Ga0207652_100482572 329
592 3300025924 Ga0207694_10078016 Ga0207694_100780162 329
593 3300025949 Ga0207667_10022968 Ga0207667_100229682 329
594 3300026078 Ga0207702_10081555 Ga0207702_100815552 329
595 3300048920 Ga0496117_0035780 Ga0496117_0035780_932_1930 329
596 3300048925 Ga0496122_0110837 Ga0496122_0110837_514_1512 329
597 3300048926 Ga0496123_0036381 Ga0496123_0036381_1880_2878 329
598 3300053091 Ga0500647_0080266 Ga0500647_0080266_400_1404 329
599 3300002773 JGI25152J39213_1003728 JGI25152J39213_10037282 330
600 3300002773 JGI25152J39213_1006980 JGI25152J39213_10069802 330
601 3300002773 JGI25152J39213_1007954 JGI25152J39213_10079541 330
602 3300002774 JGI25150J39212_1000261 JGI25150J39212_100026131 330
603 3300002774 JGI25150J39212_1012436 JGI25150J39212_10124361 330
604 3300002987 JGI25159J45721_1001258 JGI25159J45721_10012587 330
605 3300003187 JGI25151J46595_10000359 JGI25151J46595_100003592 330
606 3300003187 JGI25151J46595_10002653 JGI25151J46595_100026534 330
607 3300003187 JGI25151J46595_10002809 JGI25151J46595_1000280912 330
608 3300003187 JGI25151J46595_10022409 JGI25151J46595_100224091 330
609 3300003215 JGI25153J46596_10013626 JGI25153J46596_100136262 330
610 3300003215 JGI25153J46596_10041150 JGI25153J46596_100411502 330
611 3300003354 JGI25160J50197_1005892 JGI25160J50197_10058925 330
612 3300003354 JGI25160J50197_1007642 JGI25160J50197_10076425 330
613 3300003354 JGI25160J50197_1010225 JGI25160J50197_10102254 330
614 3300003374 JGI25161J50226_1000078 JGI25161J50226_100007832 330
615 3300003578 Ga0006562J51391_1014638 Ga0006562J51391_10146381 330
616 3300003771 Ga0055526_1000242 Ga0055526_100024222 330
617 3300003771 Ga0055526_1002943 Ga0055526_10029434 330
618 3300003771 Ga0055526_1008596 Ga0055526_10085965 330
619 3300003771 Ga0055526_1024393 Ga0055526_10243932 330
620 3300003771 Ga0055526_1027275 Ga0055526_10272751 330
621 3300003775 Ga0055524_1007816 Ga0055524_10078162 330
622 3300003775 Ga0055524_1010378 Ga0055524_10103784 330
623 3300003775 Ga0055524_1014128 Ga0055524_10141282 330
624 3300003775 Ga0055524_1026395 Ga0055524_10263952 330
625 3300003775 Ga0055524_1031439 Ga0055524_10314391 330
626 3300003790 Ga0055528_1000113 Ga0055528_100011343 330
627 3300003790 Ga0055528_1009089 Ga0055528_10090895 330
628 3300003790 Ga0055528_1016207 Ga0055528_10162071 330
629 3300003790 Ga0055528_1025007 Ga0055528_10250071 330
630 3300003790 Ga0055528_1025022 Ga0055528_10250221 330
631 3300003792 Ga0055540_1009829 Ga0055540_10098292 330
632 3300003792 Ga0055540_1013267 Ga0055540_10132672 330
633 3300003792 Ga0055540_1018007 Ga0055540_10180072 330
634 3300003794 Ga0055531_10041958 Ga0055531_100419582 330
635 3300004625 Ga0055543_1000069 Ga0055543_100006978 330
636 3300004625 Ga0055543_1008099 Ga0055543_10080992 330
637 3300005262 Ga0065165_1009690 Ga0065165_10096902 330
638 3300005331 Ga0070670_100000105 Ga0070670_10000010528 330
639 3300005335 Ga0070666_10131717 Ga0070666_101317172 330
640 3300005347 Ga0070668_100008388 Ga0070668_1000083885 330
641 3300005355 Ga0070671_100037812 Ga0070671_1000378125 330
642 3300005539 Ga0068853_100290516 Ga0068853_1002905162 330
643 3300005983 Ga0081540_1009139 Ga0081540_10091394 330
644 3300006038 Ga0075365_10002194 Ga0075365_100021942 330
645 3300006186 Ga0075369_10021432 Ga0075369_100214322 330
646 3300006353 Ga0075370_10005472 Ga0075370_100054722 330
647 3300009177 Ga0105248_10019677 Ga0105248_100196772 330
648 3300009553 Ga0105249_10365488 Ga0105249_103654882 330
649 3300009765 Ga0123341_1000017 Ga0123341_10000172 330
650 3300012490 Ga0157322_1000006 Ga0157322_10000063 330
651 3300013100 Ga0157373_10212350 Ga0157373_102123501 330
652 3300013250 Ga0171462_1013 Ga0171462_1013102 330
653 3300021377 Ga0213874_10031175 Ga0213874_100311752 330
654 3300021384 Ga0213876_10001403 Ga0213876_1000140311 330
655 3300021384 Ga0213876_10008021 Ga0213876_100080216 330
656 3300021388 Ga0213875_10003372 Ga0213875_100033726 330
657 3300025208 Ga0209436_100268 Ga0209436_10026820 330
658 3300025245 Ga0207425_1000052 Ga0207425_1000052144 330
659 3300025245 Ga0207425_1000527 Ga0207425_100052724 330
660 3300025245 Ga0207425_1005861 Ga0207425_10058613 330
661 3300025258 Ga0209129_1000066 Ga0209129_1000066168 330
662 3300025258 Ga0209129_1000141 Ga0209129_100014174 330
663 3300025258 Ga0209129_1001099 Ga0209129_10010994 330
664 3300025258 Ga0209129_1003016 Ga0209129_10030166 330
665 3300025258 Ga0209129_1011192 Ga0209129_10111922 330
666 3300025273 Ga0209673_1000024 Ga0209673_100002496 330
667 3300025273 Ga0209673_1000911 Ga0209673_100091139 330
668 3300025273 Ga0209673_1012356 Ga0209673_10123564 330
669 3300025273 Ga0209673_1013782 Ga0209673_10137822 330
670 3300025284 Ga0209130_1000002 Ga0209130_1000002591 330
671 3300025284 Ga0209130_1000422 Ga0209130_100042220 330
672 3300025292 Ga0209676_1019999 Ga0209676_10199992 330
673 3300025294 Ga0209025_1000053 Ga0209025_1000053114 330
674 3300025294 Ga0209025_1000144 Ga0209025_100014452 330
675 3300025294 Ga0209025_1000274 Ga0209025_100027438 330
676 3300025294 Ga0209025_1000275 Ga0209025_100027571 330
677 3300025294 Ga0209025_1003887 Ga0209025_10038873 330
678 3300025294 Ga0209025_1013651 Ga0209025_10136517 330
679 3300025294 Ga0209025_1022384 Ga0209025_10223843 330
680 3300025295 Ga0209564_1000043 Ga0209564_1000043147 330
681 3300025295 Ga0209564_1000262 Ga0209564_100026289 330
682 3300025295 Ga0209564_1000474 Ga0209564_100047450 330
683 3300025295 Ga0209564_1000486 Ga0209564_100048621 330
684 3300025297 Ga0209758_1000229 Ga0209758_100022952 330
685 3300025297 Ga0209758_1000466 Ga0209758_100046615 330
686 3300025297 Ga0209758_1002556 Ga0209758_10025569 330
687 3300025297 Ga0209758_1017231 Ga0209758_10172313 330
688 3300025298 Ga0209050_1010764 Ga0209050_10107642 330
689 3300025299 Ga0209256_1000868 Ga0209256_100086811 330
690 3300025299 Ga0209256_1001436 Ga0209256_100143625 330
691 3300025299 Ga0209256_1003327 Ga0209256_100332712 330
692 3300025299 Ga0209256_1011918 Ga0209256_10119183 330
693 3300025299 Ga0209256_1013244 Ga0209256_10132442 330
694 3300025302 Ga0207426_1000013 Ga0207426_1000013591 330
695 3300025302 Ga0207426_1000142 Ga0207426_1000142116 330
696 3300025302 Ga0207426_1000198 Ga0207426_100019898 330
697 3300025302 Ga0207426_1002097 Ga0207426_100209710 330
698 3300025303 Ga0209051_1000170 Ga0209051_100017081 330
699 3300025303 Ga0209051_1010621 Ga0209051_10106213 330
700 3300025303 Ga0209051_1014264 Ga0209051_10142642 330
701 3300025304 Ga0209257_1027182 Ga0209257_10271822 330
702 3300025903 Ga0207680_10049806 Ga0207680_100498062 330
703 3300025923 Ga0207681_10070454 Ga0207681_100704542 330
704 3300025925 Ga0207650_10000302 Ga0207650_1000030229 330
705 3300025931 Ga0207644_10022013 Ga0207644_100220134 330
706 3300025941 Ga0207711_10078855 Ga0207711_100788552 330
707 3300025972 Ga0207668_10038371 Ga0207668_100383713 330
708 3300026041 Ga0207639_10252353 Ga0207639_102523532 330
709 3300026067 Ga0207678_10041986 Ga0207678_100419862 330
710 3300028794 Ga0307515_10301336 Ga0307515_103013361 330
711 3300031456 Ga0307513_10212882 Ga0307513_102128822 330
712 3300031731 Ga0307405_10001044 Ga0307405_100010448 330
713 3300031901 Ga0307406_10006383 Ga0307406_100063831 330
714 3300031911 Ga0307412_10002606 Ga0307412_100026064 330
715 3300039437 Ga0436365_0021793 Ga0436365_0021793_82333_83337 330
716 3300039437 Ga0436365_0184712 Ga0436365_0184712_7753_8772 330
717 3300039450 Ga0436363_0337627 Ga0436363_0337627_2484_3488 330
718 3300039453 Ga0436362_1202906 Ga0436362_1202906_337_1356 330
719 3300041496 Ga0451839_0183003 Ga0451839_0183003_125_1117 330
720 3300041507 Ga0451851_0442598 Ga0451851_0442598_2106_3098 330
721 3300041509 Ga0451843_0766251 Ga0451843_0766251_100_1092 330
722 3300041510 Ga0451854_34019 Ga0451854_34019_875_1867 330
723 3300041511 Ga0451855_0326464 Ga0451855_0326464_35_1027 330
724 3300041512 Ga0451853_1746300 Ga0451853_1746300_446_1438 330
725 3300041907 Ga0452268_37843 Ga0452268_37843_249_1241 330
726 3300041916 Ga0452271_05939 Ga0452271_05939_83_1075 330
727 3300041997 Ga0439431_0019793 Ga0439431_0019793_358_1353 330
728 3300042007 Ga0439449_0024843 Ga0439449_0024843_125_1177 330
729 3300044693 Ga0466961_0172707 Ga0466961_0172707_139_1146 330
730 3300045976 Ga0466967_0585001 Ga0466967_0585001_32_1027 330
731 3300046460 Ga0495638_0001022 Ga0495638_0001022_1320_2312 330
732 3300046492 Ga0495585_0038200 Ga0495585_0038200_1022_2014 330
733 3300046512 Ga0495610_0007299 Ga0495610_0007299_1275_2267 330
734 3300046512 Ga0495610_0008615 Ga0495610_0008615_1641_2636 330
735 3300046519 Ga0495632_0005440 Ga0495632_0005440_5978_6970 330
736 3300046519 Ga0495632_0039431 Ga0495632_0039431_1200_2192 330
737 3300046522 Ga0495643_0023147 Ga0495643_0023147_1471_2463 330
738 3300046522 Ga0495643_0030815 Ga0495643_0030815_644_1636 330
739 3300046530 Ga0495654_0022823 Ga0495654_0022823_307_1299 330
740 3300046542 Ga0495597_0011802 Ga0495597_0011802_2418_3410 330
741 3300046616 Ga0495668_0036483 Ga0495668_0036483_1182_2174 330
742 3300046660 Ga0495625_0088888 Ga0495625_0088888_263_1255 330
743 3300046692 Ga0495671_0053401 Ga0495671_0053401_884_1876 330
744 3300046810 Ga0495660_0015916 Ga0495660_0015916_384_1376 330
745 3300047323 Ga0495683_0031177 Ga0495683_0031177_805_1797 330
746 3300047472 Ga0495686_0033227 Ga0495686_0033227_2155_3147 330
747 3300048909 Ga0496106_0005047 Ga0496106_0005047_1334_2326 330
748 3300048919 Ga0496116_0007488 Ga0496116_0007488_1890_2882 330
749 3300048920 Ga0496117_0085263 Ga0496117_0085263_546_1547 330
750 3300048924 Ga0496121_0091173 Ga0496121_0091173_704_1696 330
751 3300048925 Ga0496122_0072947 Ga0496122_0072947_1375_2367 330
752 3300048926 Ga0496123_0038564 Ga0496123_0038564_1491_2483 330
753 3300048927 Ga0496124_0009932 Ga0496124_0009932_65_1057 330
754 3300048927 Ga0496124_0100512 Ga0496124_0100512_113_1105 330
755 3300048927 Ga0496124_0121213 Ga0496124_0121213_65_1057 330
756 3300048928 Ga0496125_0120455 Ga0496125_0120455_811_1803 330
757 3300049459 Ga0495678_009804 Ga0495678_009804_787_1779 330
758 3300049569 Ga0501032_0094432 Ga0501032_0094432_391_1383 330
759 3300049571 Ga0501034_0050984 Ga0501034_0050984_3102_4094 330
760 3300049575 Ga0501039_0173614 Ga0501039_0173614_249_1241 330
761 3300049744 Ga0501083_0079471 Ga0501083_0079471_673_1665 330
762 3300050490 nmdc:mga03n38_47757_c1 nmdc:mga03n38_47757_c1_816_1808 330
763 3300050516 nmdc:mga0sz30_47533_c1 nmdc:mga0sz30_47533_c1_647_1639 330
764 3300053086 Ga0500578_0238126 Ga0500578_0238126_20_1012 330
765 3300053134 Ga0500658_0001766 Ga0500658_0001766_6025_7017 330
766 3300053153 Ga0500616_0007056 Ga0500616_0007056_1072_2064 330
767 3300053153 Ga0500616_0046348 Ga0500616_0046348_72_1064 330
768 3300053156 Ga0500622_0003093 Ga0500622_0003093_1248_2240 330
769 3300059492 Ga0587073_0020941 Ga0587073_0020941_161_1153 330
770 3300060353 Ga0501082_0159757 Ga0501082_0159757_691_1683 330
771 iso_pu_bacteria 8005301065 8005305474 330
772 iso_pu_bacteria 8005688590 8005692774 330
773 3300002704 JGI25155J39150_1000110 JGI25155J39150_100011039 331
774 3300002705 JGI25156J39149_1000192 JGI25156J39149_100019240 331
775 3300002737 JGI25162J39368_1000302 JGI25162J39368_10003026 331
776 3300002737 JGI25162J39368_1001704 JGI25162J39368_100170413 331
777 3300002738 JGI25154J39366_1000196 JGI25154J39366_10001965 331
778 3300002741 JGI25157J39369_1000228 JGI25157J39369_10002285 331
779 3300002987 JGI25159J45721_1000790 JGI25159J45721_100079011 331
780 3300003214 JGI25165J46597_1000390 JGI25165J46597_100039013 331
781 3300003214 JGI25165J46597_1001069 JGI25165J46597_100106922 331
782 3300003214 JGI25165J46597_1005760 JGI25165J46597_10057602 331
783 3300003354 JGI25160J50197_1000044 JGI25160J50197_100004497 331
784 3300003374 JGI25161J50226_1000028 JGI25161J50226_100002842 331
785 3300004625 Ga0055543_1000054 Ga0055543_100005437 331
786 3300005262 Ga0065165_1000318 Ga0065165_100031836 331
787 3300005548 Ga0070665_100025181 Ga0070665_1000251816 331
788 3300005563 Ga0068855_100088724 Ga0068855_1000887242 331
789 3300009093 Ga0105240_10001468 Ga0105240_1000146817 331
790 3300009545 Ga0105237_10004445 Ga0105237_100044455 331
791 3300010375 Ga0105239_10012629 Ga0105239_100126293 331
792 3300013104 Ga0157370_10001796 Ga0157370_1000179617 331
793 3300025206 Ga0209435_100087 Ga0209435_1000875 331
794 3300025233 Ga0209437_100050 Ga0209437_10005072 331
795 3300025233 Ga0209437_100205 Ga0209437_10020575 331
796 3300025233 Ga0209437_103334 Ga0209437_1033342 331
797 3300025246 Ga0209646_1000285 Ga0209646_10002855 331
798 3300025250 Ga0209026_1000347 Ga0209026_10003475 331
799 3300025256 Ga0209759_1000482 Ga0209759_10004825 331
800 3300025261 Ga0209233_1000037 Ga0209233_1000037114 331
801 3300025261 Ga0209233_1000187 Ga0209233_100018795 331
802 3300025261 Ga0209233_1000232 Ga0209233_100023252 331
803 3300025284 Ga0209130_1000093 Ga0209130_100009397 331
804 3300025302 Ga0207426_1000012 Ga0207426_1000012620 331
805 3300025321 Ga0207656_10075949 Ga0207656_100759491 331
806 3300025913 Ga0207695_10000427 Ga0207695_1000042778 331
807 3300025914 Ga0207671_10002841 Ga0207671_100028417 331
808 3300026078 Ga0207702_10052722 Ga0207702_100527222 331
809 3300027312 Ga0209371_1002100 Ga0209371_10021002 331
810 3300030500 Ga0268256_1005033 Ga0268256_10050334 331
811 3300046809 Ga0495600_0025245 Ga0495600_0025245_1693_2688 331
812 3300048921 Ga0496118_0017292 Ga0496118_0017292_4566_5561 331
813 3300048924 Ga0496121_0005879 Ga0496121_0005879_9916_10911 331
814 3300048927 Ga0496124_0005332 Ga0496124_0005332_9897_10892 331
815 3300048929 Ga0496126_0038443 Ga0496126_0038443_2386_3381 331

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02608

Bmp

ABC transporter substrate-binding protein PnrA-like

26

311

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
7x0r-assembly1.cif.gz_A crystal structure of substrate binding protein lbp complexed wtih guanosine from clostridium thermocellum 0.931 23 331
2fqy-assembly1.cif.gz_A pnra from treponema pallidum complexed with adenosine. 0.9137 21 320
6shu-assembly1.cif.gz_A borrelia burgdorferi bmpd nucleoside binding protein bound to adenosine 0.9078 23 321
6yab-assembly3.cif.gz_BBB crystal structure of pnra from s. pneumoniae in complex with uridine 0.8959 23 320
2hqb-assembly1.cif.gz_A crystal structure of a transcriptional activator of comk gene from bacillus halodurans 0.8946 23 320
ID Description Score Start End Superfamily
4iilA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8654 126 320 3.40.50.2300
4iilA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8562 126 320 3.40.50.2300
2fqwA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8518 126 320 3.40.50.2300
2hqbA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8159 130 329 3.40.50.2300
2fqwA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8077 126 320 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A349KVF0-F1-model_v4 BMP family ABC transporter substrate-binding protein 0.966 26 202 GO:0005886
AF-A0A0S2SMB5-F1-model_v4 Periplasmic component/surface lipoprotein 0.9631 137 329 GO:0005886
AF-A0A212JPP1-F1-model_v4 Nucleoside-binding protein 0.963 20 321 GO:0005886
AF-A0A357T2I1-F1-model_v4 BMP family ABC transporter substrate-binding protein 0.963 70 180 GO:0005886
AF-A0A1W9UHM6-F1-model_v4 ABC transporter substrate-binding protein PnrA-like domain-containing protein 0.961 27 320 GO:0005886

Feature Viewer

pLDDT pTM Quality
92.28 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map