F482011

General Info

Members Datasets Scaffolds Average Seq Length
815 430 755 182

Family's Representative Sequence

Representative Sequence 3300005618|Ga0068864_100468228|Ga0068864_1004682282
Length 203
Sequence VHIGHSPCSRRGFLWQIVSRLSPAMKLVILDRDGVINQDSDQFIKTPDEWHPIPGSLEAIAKLSHSGYRVVVASNQSGIGRGLLDMATLNAINDKMYKALAPLGGRIDALFYCPHPAEANCSCRKPKPGMFEDIARRFNISLNAVPSVGDSLRDMQACATAGCQPMLVLTGKGRKTLAAGDVPANTQVFEDLAEAVRKIIAAK

Samples

Sample ID Description Type Environment
1 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
2 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
3 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
4 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
5 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
6 2519103095 Burkholderia sp. KJ006 Isolate Nodule
7 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
8 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
9 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
10 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
11 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
12 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
13 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
14 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
15 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
16 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
17 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
18 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
19 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
20 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
21 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
22 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
23 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
24 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
25 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
26 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
27 2818991452 Burkholderia cepacia 561 Isolate Unclassified
28 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
29 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
30 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
31 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
32 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
33 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
34 2904564687 Burkholderia sp. 571 Isolate Unclassified
35 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
36 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
37 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
38 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
39 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
40 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
41 2928163908 Burkholderia sp. 567 Isolate Unclassified
42 2928170801 Burkholderia sp. 572 Isolate Unclassified
43 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
44 2928536128 Burkholderia sola 565 Isolate Unclassified
45 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
46 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
47 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
48 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
49 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
50 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
51 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
52 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
53 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
54 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
55 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
56 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
57 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
58 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
59 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
60 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
61 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
62 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
63 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
64 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
65 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
66 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
67 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
68 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
69 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
70 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
71 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
72 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
73 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
74 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
75 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
76 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
77 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
78 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
79 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
80 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
81 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
82 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
83 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
84 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
85 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
86 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
87 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
88 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
89 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
90 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
91 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
92 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
93 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
94 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
95 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
96 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
97 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
98 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
99 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
100 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
101 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
102 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
103 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
104 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
105 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
106 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
107 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
108 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
109 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
110 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
111 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
112 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
113 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
114 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
115 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
116 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
117 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
118 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
119 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
120 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
121 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
122 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
123 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
124 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
125 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
126 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
127 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
128 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
129 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
130 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
131 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
132 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
133 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
134 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
135 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
136 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
137 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
138 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
139 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
140 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
141 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
142 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
143 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
144 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
145 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
146 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
147 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
148 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
149 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
150 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
151 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
152 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
153 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
154 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
155 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
156 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
157 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
158 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
159 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
160 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
161 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
162 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
163 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
164 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
165 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
166 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
167 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
168 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
169 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
170 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
171 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
172 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
173 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
174 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
175 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
176 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
177 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
178 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
179 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
180 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
181 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
182 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
183 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
184 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
231 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
232 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
233 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
234 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
235 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
239 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
240 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
241 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
242 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
243 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
244 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
245 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
246 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
247 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
248 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
249 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
250 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
251 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
252 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
253 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
254 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
255 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
256 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
257 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
258 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
259 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
260 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
261 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
262 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
263 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
264 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
265 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
266 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
267 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
268 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
269 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
270 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
271 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
272 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
273 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
274 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
275 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
276 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
277 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
278 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
279 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
280 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
281 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
282 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
283 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
284 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
285 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
286 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
287 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
288 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
289 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
290 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
291 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
292 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
293 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
294 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
295 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
296 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
297 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
298 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
299 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
300 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
301 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
302 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
303 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
304 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
305 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
306 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
307 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
308 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
309 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
310 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
311 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
312 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
313 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
314 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
315 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
316 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
317 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
318 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
319 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
320 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
321 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
322 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
323 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
324 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
325 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
326 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
327 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
328 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
329 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
330 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
331 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
332 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
333 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
334 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
335 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
336 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
337 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
338 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
339 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
340 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
341 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
342 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
343 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
344 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
345 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
346 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
347 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
348 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
349 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
350 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
351 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
352 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
353 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
354 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
355 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
356 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
357 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
358 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
359 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
360 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
361 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
362 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
363 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
364 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
365 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
366 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
367 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
368 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
369 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
370 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
371 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
372 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
373 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
374 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
375 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
376 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
377 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
378 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
379 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
380 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
381 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
382 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
383 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
384 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
385 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
386 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
387 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
388 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
389 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
390 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
391 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
392 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
393 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
394 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
395 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
396 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
397 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
398 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
399 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
400 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
401 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
402 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
403 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
404 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
405 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
406 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
407 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
408 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
409 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
410 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
411 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
412 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
413 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
414 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
415 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
416 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
417 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
418 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
419 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
420 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
421 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
422 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
423 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
424 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
425 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
426 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
427 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
428 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
429 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
430 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 91.17
Metatranscriptomes 1.47
Isolates 7.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.99
Nodule 1.47
Rhizoplane 1.47
Rhizosphere 82.82
Stem 0
Stem Tuber 0
Unclassified 7.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1014130 3300001915 Bacteria 1339
2 JGI24740J21852_10012152 3300001979 Bacteria 3252
3 JGI24739J22299_10003573 3300001989 Bacteria 5940
4 JGI24739J22299_10047384 3300001989 Bacteria 1403
5 JGI24737J22298_10011025 3300001990 Bacteria 2968
6 JGI24735J21928_10011323 3300002067 Bacteria 2831
7 JGI24735J21928_10021649 3300002067 Bacteria 1962
8 JGI24735J21928_10031743 3300002067 Bacteria 1565
9 JGI24738J21930_10000745 3300002075 Bacteria 9375
10 JGI25156J39149_1000571 3300002705 Bacteria 21041
11 JGI25156J39149_1000951 3300002705 Bacteria 13864
12 JGI25165J46597_1001506 3300003214 Bacteria 11843
13 rootH1_10031982 3300003316 Bacteria 6597
14 rootH2_10010622 3300003320 Bacteria 2111
15 rootL2_10104888 3300003322 Bacteria 1682
16 Ga0055533_1000434 3300003756 Bacteria 15950
17 Ga0055533_1001223 3300003756 Bacteria 7136
18 Ga0055532_1000177 3300003758 Bacteria 54669
19 Ga0055532_1005023 3300003758 Bacteria 1912
20 Ga0055527_1000123 3300003760 Bacteria 54669
21 Ga0055527_1001412 3300003760 Bacteria 5077
22 Ga0055527_1001426 3300003760 Bacteria 5041
23 Ga0055535_1000268 3300003761 Bacteria 54669
24 Ga0055535_1003049 3300003761 Bacteria 5077
25 Ga0055535_1003076 3300003761 Bacteria 5041
26 Ga0055542_1000304 3300003762 Bacteria 54669
27 Ga0055542_1002898 3300003762 Bacteria 5077
28 Ga0055542_1002917 3300003762 Bacteria 5041
29 Ga0055529_1000318 3300003763 Bacteria 54669
30 Ga0055529_1000561 3300003763 Bacteria 30975
31 Ga0055529_1008936 3300003763 Bacteria 1325
32 Ga0055528_1002578 3300003790 Bacteria 9599
33 Ga0058692_1002896 3300003856 Bacteria 5553
34 Ga0070658_10173762 3300005327 Bacteria 1811
35 Ga0070658_10850993 3300005327 Bacteria 793
36 Ga0070676_10131167 3300005328 Bacteria 1585
37 Ga0070690_100016460 3300005330 Bacteria 4431
38 Ga0070690_100064896 3300005330 Bacteria 2360
39 Ga0070677_10118403 3300005333 Bacteria 1193
40 Ga0068869_100045097 3300005334 Bacteria 3173
41 Ga0070682_100033534 3300005337 Bacteria 3121
42 Ga0068868_100273686 3300005338 Bacteria 1427
43 Ga0070660_100000021 3300005339 Bacteria 97654
44 Ga0070660_100395742 3300005339 Bacteria 1142
45 Ga0070689_100000383 3300005340 Bacteria 25925
46 Ga0070689_100376195 3300005340 Bacteria 1196
47 Ga0070689_101072020 3300005340 Bacteria 719
48 Ga0070687_100227436 3300005343 Bacteria 1146
49 Ga0070661_100341453 3300005344 Bacteria 1173
50 Ga0070692_10039912 3300005345 Bacteria 2398
51 Ga0070675_100138226 3300005354 Bacteria 2081
52 Ga0070674_100301524 3300005356 Bacteria 1277
53 Ga0070674_101389668 3300005356 Bacteria 628
54 Ga0070673_100461961 3300005364 Bacteria 1143
55 Ga0070688_100192686 3300005365 Bacteria 1421
56 Ga0070659_100000061 3300005366 Bacteria 85192
57 Ga0070659_100026941 3300005366 Bacteria 4425
58 Ga0070714_100026968 3300005435 Bacteria 4753
59 Ga0070701_10007230 3300005438 Bacteria 4726
60 Ga0070705_100014965 3300005440 Bacteria 4002
61 Ga0070705_100051355 3300005440 Bacteria 2404
62 Ga0070700_100000746 3300005441 Bacteria 16006
63 Ga0070700_100023703 3300005441 Bacteria 3593
64 Ga0070694_100197852 3300005444 Bacteria 1496
65 Ga0070694_100454229 3300005444 Bacteria 1012
66 Ga0070694_100727164 3300005444 Bacteria 809
67 Ga0070708_100970904 3300005445 Bacteria 797
68 Ga0070663_100000360 3300005455 Bacteria 23909
69 Ga0070663_100136554 3300005455 Bacteria 1868
70 Ga0070678_100328657 3300005456 Bacteria 1308
71 Ga0070678_100700872 3300005456 Bacteria 912
72 Ga0070681_10496865 3300005458 Bacteria 1133
73 Ga0068867_100012966 3300005459 Bacteria 5898
74 Ga0068867_100054175 3300005459 Bacteria 2963
75 Ga0068867_100219790 3300005459 Bacteria 1530
76 Ga0070685_10056833 3300005466 Bacteria 2276
77 Ga0070707_101351132 3300005468 Bacteria 679
78 Ga0070679_100043513 3300005530 Bacteria 4473
79 Ga0070684_100230246 3300005535 Bacteria 1692
80 Ga0070684_100279389 3300005535 Bacteria 1530
81 Ga0070684_100443810 3300005535 Bacteria 1199
82 Ga0070686_100000740 3300005544 Bacteria 18920
83 Ga0070686_100499330 3300005544 Bacteria 944
84 Ga0070686_101131803 3300005544 Bacteria 648
85 Ga0070695_100016904 3300005545 Bacteria 4422
86 Ga0070696_100022306 3300005546 Bacteria 4300
87 Ga0070693_100043389 3300005547 Bacteria 2539
88 Ga0070693_100046697 3300005547 Bacteria 2461
89 Ga0070665_100081943 3300005548 Bacteria 3232
90 Ga0070665_100845125 3300005548 Bacteria 928
91 Ga0070704_100023728 3300005549 Bacteria 4013
92 Ga0070704_100217780 3300005549 Bacteria 1550
93 Ga0070704_101261052 3300005549 Bacteria 675
94 Ga0068855_100002326 3300005563 Bacteria 23485
95 Ga0068855_100024344 3300005563 Bacteria 7245
96 Ga0068855_100028419 3300005563 Bacteria 6690
97 Ga0068855_100028597 3300005563 Bacteria 6669
98 Ga0068855_100046274 3300005563 Bacteria 5144
99 Ga0068855_100046385 3300005563 Bacteria 5138
100 Ga0068857_100421323 3300005577 Bacteria 1245
101 Ga0068854_100357165 3300005578 Bacteria 1198
102 Ga0068856_100085472 3300005614 Bacteria 3134
103 Ga0068856_100296924 3300005614 Bacteria 1633
104 Ga0070702_100003111 3300005615 Bacteria 7350
105 Ga0070702_100107885 3300005615 Bacteria 1720
106 Ga0068852_100000618 3300005616 Bacteria 23320
107 Ga0068852_100003636 3300005616 Bacteria 10800
108 Ga0068852_100020421 3300005616 Bacteria 5268
109 Ga0068852_100056305 3300005616 Bacteria 3397
110 Ga0068859_100004756 3300005617 Bacteria 13806
111 Ga0068859_100023776 3300005617 Bacteria 6150
112 Ga0068864_100468228 3300005618 Bacteria 1208
113 Ga0068866_10002120 3300005718 Bacteria 8255
114 Ga0068866_10629998 3300005718 Bacteria 728
115 Ga0068861_100002984 3300005719 Bacteria 11167
116 Ga0068861_100115054 3300005719 Bacteria 2161
117 Ga0068870_10006494 3300005840 Bacteria 5158
118 Ga0068863_100123245 3300005841 Bacteria 2473
119 Ga0068863_101016923 3300005841 Bacteria 832
120 Ga0068858_100002485 3300005842 Bacteria 18611
121 Ga0068858_100011312 3300005842 Bacteria 8431
122 Ga0068858_100058823 3300005842 Bacteria 3554
123 Ga0068858_100191791 3300005842 Bacteria 1931
124 Ga0068858_100284441 3300005842 Bacteria 1575
125 Ga0068860_100052968 3300005843 Bacteria 3858
126 Ga0068860_100142242 3300005843 Bacteria 2306
127 Ga0068860_100151911 3300005843 Bacteria 2230
128 Ga0068862_100003014 3300005844 Bacteria 14687
129 Ga0081539_10042254 3300005985 Bacteria 2657
130 Ga0075363_100500112 3300006048 Bacteria 722
131 Ga0075367_10109935 3300006178 Unclassified 1691
132 Ga0075367_10137382 3300006178 Bacteria 1513
133 Ga0075369_10065991 3300006186 Bacteria 1587
134 Ga0075366_10061536 3300006195 Bacteria 2231
135 Ga0097621_100002878 3300006237 Bacteria 11808
136 Ga0097621_100121439 3300006237 Bacteria 2216
137 Ga0075370_10329171 3300006353 Bacteria 911
138 Ga0068871_100022510 3300006358 Bacteria 4860
139 Ga0068871_100047155 3300006358 Bacteria 3474
140 Ga0075428_100117828 3300006844 Bacteria 2893
141 Ga0075428_100248016 3300006844 Bacteria 1919
142 Ga0075433_10154629 3300006852 Bacteria 2041
143 Ga0075434_100128221 3300006871 Bacteria 2554
144 Ga0075429_100069353 3300006880 Bacteria 3070
145 Ga0075429_100310627 3300006880 Unclassified 1380
146 Ga0068865_100007859 3300006881 Bacteria 6579
147 Ga0068865_100067523 3300006881 Bacteria 2526
148 Ga0068865_100080405 3300006881 Bacteria 2337
149 Ga0068865_100728573 3300006881 Bacteria 850
150 Ga0075436_100003122 3300006914 Bacteria 11353
151 Ga0097620_100004756 3300006931 Bacteria 13806
152 Ga0097620_100023776 3300006931 Bacteria 6150
153 Ga0099826_10000003 3300006948 Bacteria 1067817
154 Ga0075435_100216203 3300007076 Bacteria 1627
155 Ga0099794_10243916 3300007265 Bacteria 926
156 Ga0099794_10270247 3300007265 Bacteria 878
157 Ga0105251_10000298 3300009011 Bacteria 49831
158 Ga0105250_10022197 3300009092 Bacteria 2559
159 Ga0105240_10018150 3300009093 Bacteria 9458
160 Ga0105240_10042328 3300009093 Bacteria 5804
161 Ga0105240_10088404 3300009093 Bacteria 3791
162 Ga0105240_10103873 3300009093 Bacteria 3451
163 Ga0105240_10123642 3300009093 Bacteria 3112
164 Ga0105240_10154445 3300009093 Bacteria 2731
165 Ga0105240_10158715 3300009093 Bacteria 2688
166 Ga0105240_10409570 3300009093 Bacteria 1525
167 Ga0111539_10000940 3300009094 Bacteria 38161
168 Ga0111539_10892816 3300009094 Unclassified 1034
169 Ga0105245_10005540 3300009098 Bacteria 11091
170 Ga0105245_10104392 3300009098 Bacteria 2627
171 Ga0105245_10166457 3300009098 Bacteria 2096
172 Ga0105247_10073068 3300009101 Bacteria 2148
173 Ga0105243_10004473 3300009148 Bacteria 11051
174 Ga0105241_10013590 3300009174 Bacteria 5966
175 Ga0105242_10001658 3300009176 Bacteria 17602
176 Ga0105242_10006365 3300009176 Bacteria 9089
177 Ga0105242_10126888 3300009176 Bacteria 2197
178 Ga0105242_11025498 3300009176 Bacteria 834
179 Ga0105248_10014079 3300009177 Bacteria 8803
180 Ga0105248_10127471 3300009177 Bacteria 2871
181 Ga0105248_10781248 3300009177 Bacteria 1078
182 Ga0105248_11236919 3300009177 Bacteria 844
183 Ga0105237_10169266 3300009545 Bacteria 2184
184 Ga0105238_10004061 3300009551 Bacteria 14507
185 Ga0105238_10011719 3300009551 Bacteria 8838
186 Ga0105238_10020534 3300009551 Bacteria 6726
187 Ga0105238_10116989 3300009551 Bacteria 2646
188 Ga0105238_10185285 3300009551 Bacteria 2058
189 Ga0105238_10409368 3300009551 Bacteria 1350
190 Ga0105249_10036317 3300009553 Bacteria 4469
191 Ga0105249_10267512 3300009553 Bacteria 1702
192 Ga0105239_10015271 3300010375 Bacteria 8508
193 Ga0105239_10573547 3300010375 Bacteria 1286
194 Ga0105239_10614792 3300010375 Bacteria 1240
195 Ga0105246_10076846 3300011119 Bacteria 2367
196 Ga0157371_10043128 3300013102 Bacteria 3214
197 Ga0157370_10000323 3300013104 Bacteria 59944
198 Ga0157370_10000800 3300013104 Bacteria 39630
199 Ga0157370_10131706 3300013104 Bacteria 2332
200 Ga0157370_10181073 3300013104 Bacteria 1958
201 Ga0157369_10000089 3300013105 Bacteria 127323
202 Ga0157369_10000280 3300013105 Bacteria 68583
203 Ga0157369_10005296 3300013105 Bacteria 15032
204 Ga0157369_10373347 3300013105 Bacteria 1480
205 Ga0157374_10206104 3300013296 Bacteria 1927
206 Ga0157378_10001155 3300013297 Bacteria 24013
207 Ga0157378_10011184 3300013297 Bacteria 7851
208 Ga0157378_10097287 3300013297 Bacteria 2682
209 Ga0163162_10044057 3300013306 Bacteria 4468
210 Ga0157372_10003769 3300013307 Bacteria 16282
211 Ga0157372_10189667 3300013307 Bacteria 2381
212 Ga0163163_10064988 3300014325 Bacteria 3620
213 Ga0157380_10025001 3300014326 Bacteria 4525
214 Ga0182008_10148842 3300014497 Bacteria 1174
215 Ga0182008_10174943 3300014497 Bacteria 1085
216 Ga0157377_10593855 3300014745 Bacteria 789
217 Ga0157379_10049245 3300014968 Bacteria 3762
218 Ga0157379_10073141 3300014968 Bacteria 3068
219 Ga0157379_11311114 3300014968 Bacteria 699
220 Ga0157376_10236762 3300014969 Bacteria 1699
221 Ga0157376_10858066 3300014969 Bacteria 924
222 Ga0157376_11409576 3300014969 Bacteria 728
223 Ga0182005_1022121 3300015265 Bacteria 1743
224 Ga0183361_10001 3300016635 Bacteria 908583
225 Ga0206356_10288866 3300020070 Bacteria 1079
226 Ga0206354_11251663 3300020081 Bacteria 1377
227 Ga0206353_10100041 3300020082 Bacteria 681
228 Ga0206353_11289395 3300020082 Bacteria 2049
229 Ga0209566_100212 3300025225 Bacteria 59180
230 Ga0209566_103548 3300025225 Bacteria 2356
231 Ga0209674_100005 3300025226 Bacteria 1708125
232 Ga0209674_100092 3300025226 Bacteria 172272
233 Ga0209672_100001 3300025228 Bacteria 2828210
234 Ga0209672_100046 3300025228 Bacteria 264244
235 Ga0209672_100047 3300025228 Bacteria 250925
236 Ga0209147_100001 3300025229 Bacteria 2384371
237 Ga0209147_100043 3300025229 Bacteria 300460
238 Ga0209147_100059 3300025229 Bacteria 250891
239 Ga0209147_100172 3300025229 Bacteria 84617
240 Ga0209563_101915 3300025230 Bacteria 5031
241 Ga0207427_101871 3300025231 Bacteria 6641
242 Ga0209258_100001 3300025242 Bacteria 2384269
243 Ga0209258_100023 3300025242 Bacteria 547286
244 Ga0209258_100172 3300025242 Bacteria 144895
245 Ga0209148_1000003 3300025254 Bacteria 2384288
246 Ga0209148_1000029 3300025254 Bacteria 579199
247 Ga0209148_1000353 3300025254 Bacteria 59341
248 Ga0209148_1002928 3300025254 Bacteria 5182
249 Ga0209759_1000053 3300025256 Bacteria 212789
250 Ga0209759_1000074 3300025256 Bacteria 177152
251 Ga0209759_1006543 3300025256 Bacteria 3895
252 Ga0209759_1016316 3300025256 Bacteria 1881
253 Ga0209233_1000204 3300025261 Bacteria 118907
254 Ga0209565_1004426 3300025263 Bacteria 4276
255 Ga0209455_1000001 3300025272 Bacteria 2384278
256 Ga0209455_1000064 3300025272 Bacteria 332404
257 Ga0209455_1001734 3300025272 Bacteria 9278
258 Ga0209673_1000115 3300025273 Bacteria 176939
259 Ga0209564_1012724 3300025295 Bacteria 3643
260 Ga0207656_10000780 3300025321 Bacteria 10440
261 Ga0207696_1015815 3300025711 Bacteria 2544
262 Ga0207713_1000612 3300025735 Bacteria 35126
263 Ga0207642_10002640 3300025899 Bacteria 5589
264 Ga0207680_10062975 3300025903 Bacteria 2268
265 Ga0207647_10007911 3300025904 Bacteria 7648
266 Ga0207647_10018824 3300025904 Bacteria 4657
267 Ga0207643_10004018 3300025908 Bacteria 7915
268 Ga0207705_10009017 3300025909 Bacteria 7268
269 Ga0207705_10111689 3300025909 Bacteria 2020
270 Ga0207705_10205261 3300025909 Bacteria 1494
271 Ga0207654_10039027 3300025911 Bacteria 2668
272 Ga0207654_10259136 3300025911 Bacteria 1168
273 Ga0207707_10096540 3300025912 Bacteria 2583
274 Ga0207707_10601396 3300025912 Bacteria 931
275 Ga0207695_10014762 3300025913 Bacteria 9231
276 Ga0207695_10026553 3300025913 Bacteria 6464
277 Ga0207695_10030603 3300025913 Bacteria 5922
278 Ga0207695_10046453 3300025913 Bacteria 4603
279 Ga0207695_10083723 3300025913 Bacteria 3222
280 Ga0207695_10261130 3300025913 Bacteria 1629
281 Ga0207695_10310481 3300025913 Bacteria 1467
282 Ga0207660_11097929 3300025917 Bacteria 648
283 Ga0207662_10103267 3300025918 Bacteria 1768
284 Ga0207662_10201136 3300025918 Bacteria 1289
285 Ga0207657_10000008 3300025919 Bacteria 189885
286 Ga0207657_10227078 3300025919 Bacteria 1494
287 Ga0207657_10310332 3300025919 Bacteria 1249
288 Ga0207649_10118121 3300025920 Bacteria 1783
289 Ga0207649_10283837 3300025920 Bacteria 1205
290 Ga0207652_10033789 3300025921 Bacteria 4308
291 Ga0207694_10011555 3300025924 Bacteria 6661
292 Ga0207694_10043505 3300025924 Bacteria 3467
293 Ga0207694_10140524 3300025924 Bacteria 1942
294 Ga0207694_10489804 3300025924 Bacteria 1029
295 Ga0207659_10489214 3300025926 Bacteria 1040
296 Ga0207659_10571096 3300025926 Bacteria 962
297 Ga0207687_10005161 3300025927 Bacteria 8658
298 Ga0207687_10285679 3300025927 Bacteria 1324
299 Ga0207687_10626601 3300025927 Bacteria 908
300 Ga0207644_10335181 3300025931 Bacteria 1226
301 Ga0207690_10000013 3300025932 Bacteria 266156
302 Ga0207690_10025937 3300025932 Bacteria 3687
303 Ga0207690_11143349 3300025932 Bacteria 649
304 Ga0207686_10019035 3300025934 Bacteria 3897
305 Ga0207686_10032139 3300025934 Bacteria 3121
306 Ga0207686_10135350 3300025934 Bacteria 1696
307 Ga0207686_10586233 3300025934 Bacteria 876
308 Ga0207709_10021888 3300025935 Bacteria 3622
309 Ga0207709_10050230 3300025935 Bacteria 2549
310 Ga0207670_10012625 3300025936 Bacteria 4950
311 Ga0207670_10238588 3300025936 Bacteria 1400
312 Ga0207669_10185958 3300025937 Bacteria 1494
313 Ga0207669_10245659 3300025937 Bacteria 1329
314 Ga0207704_10015507 3300025938 Bacteria 3885
315 Ga0207691_10364750 3300025940 Bacteria 1235
316 Ga0207711_10074220 3300025941 Bacteria 2958
317 Ga0207711_10083570 3300025941 Bacteria 2793
318 Ga0207711_10768462 3300025941 Bacteria 898
319 Ga0207689_10000474 3300025942 Bacteria 37756
320 Ga0207689_10253868 3300025942 Bacteria 1454
321 Ga0207667_10004312 3300025949 Bacteria 17424
322 Ga0207667_10013366 3300025949 Bacteria 9396
323 Ga0207667_10019690 3300025949 Bacteria 7523
324 Ga0207667_10020307 3300025949 Bacteria 7393
325 Ga0207667_10046287 3300025949 Bacteria 4606
326 Ga0207667_10146920 3300025949 Bacteria 2427
327 Ga0207667_10263651 3300025949 Bacteria 1762
328 Ga0207651_11030347 3300025960 Bacteria 736
329 Ga0207712_10253976 3300025961 Bacteria 1422
330 Ga0207668_10146296 3300025972 Bacteria 1824
331 Ga0207640_10553529 3300025981 Bacteria 967
332 Ga0207677_10063227 3300026023 Bacteria 2572
333 Ga0207677_10071403 3300026023 Bacteria 2450
334 Ga0207703_10007077 3300026035 Bacteria 8925
335 Ga0207703_10007310 3300026035 Bacteria 8780
336 Ga0207703_10177048 3300026035 Bacteria 1880
337 Ga0207639_10205559 3300026041 Bacteria 1692
338 Ga0207678_10000363 3300026067 Bacteria 41217
339 Ga0207678_10163228 3300026067 Bacteria 1902
340 Ga0207708_10000382 3300026075 Bacteria 34635
341 Ga0207708_10039444 3300026075 Bacteria 3598
342 Ga0207708_10162880 3300026075 Bacteria 1762
343 Ga0207702_10218111 3300026078 Bacteria 1777
344 Ga0207641_10106722 3300026088 Bacteria 2476
345 Ga0207648_10001543 3300026089 Bacteria 25355
346 Ga0207648_10026704 3300026089 Bacteria 5129
347 Ga0207648_10064949 3300026089 Bacteria 3181
348 Ga0207648_10338815 3300026089 Bacteria 1354
349 Ga0207648_11031949 3300026089 Bacteria 770
350 Ga0207674_10210042 3300026116 Bacteria 1896
351 Ga0207675_100000178 3300026118 Bacteria 57002
352 Ga0207675_100154235 3300026118 Bacteria 2188
353 Ga0207675_100385324 3300026118 Bacteria 1379
354 Ga0207683_10205204 3300026121 Bacteria 1792
355 Ga0207683_10949433 3300026121 Bacteria 798
356 Ga0207698_10003281 3300026142 Bacteria 9722
357 Ga0207698_10010646 3300026142 Bacteria 5927
358 Ga0207698_10013611 3300026142 Bacteria 5376
359 Ga0207698_10062676 3300026142 Bacteria 2905
360 Ga0209371_1000065 3300027312 Bacteria 214464
361 Ga0209371_1012184 3300027312 Bacteria 2507
362 Ga0209999_1045218 3300027543 Bacteria 828
363 Ga0209282_1000002 3300027666 Bacteria 1067825
364 Ga0209971_1078428 3300027682 Bacteria 803
365 Ga0207428_10123033 3300027907 Bacteria 1988
366 Ga0268266_10601539 3300028379 Bacteria 1056
367 Ga0268266_11447287 3300028379 Bacteria 663
368 Ga0268265_10026191 3300028380 Bacteria 4146
369 Ga0268265_10054596 3300028380 Bacteria 3033
370 Ga0268264_10046116 3300028381 Bacteria 3620
371 Ga0268264_10079355 3300028381 Bacteria 2800
372 Ga0265338_10170388 3300028800 Bacteria 1671
373 Ga0268256_1000118 3300030500 Bacteria 115175
374 Ga0268256_1013264 3300030500 Bacteria 2507
375 Ga0265340_10251813 3300031247 Bacteria 787
376 Ga0307509_10606093 3300031507 Bacteria 767
377 Ga0307408_100138227 3300031548 Bacteria 1909
378 Ga0307408_100411781 3300031548 Bacteria 1163
379 Ga0307408_100419049 3300031548 Bacteria 1154
380 Ga0316575_10072466 3300031665 Bacteria 1385
381 Ga0316579_10000868 3300031691 Bacteria 10463
382 Ga0316576_10029816 3300031727 Bacteria 3859
383 Ga0316576_10643769 3300031727 Bacteria 771
384 Ga0316578_10000287 3300031728 Bacteria 15321
385 Ga0316578_10112401 3300031728 Bacteria 1636
386 Ga0316577_10000452 3300031733 Bacteria 16096
387 Ga0307412_10000014 3300031911 Bacteria 353795
388 Ga0307412_10236086 3300031911 Bacteria 1411
389 Ga0307416_100274273 3300032002 Bacteria 1658
390 Ga0307416_100670909 3300032002 Bacteria 1123
391 Ga0307416_101082790 3300032002 Bacteria 906
392 Ga0316583_10031499 3300032133 Bacteria 1888
393 Ga0316585_10059956 3300032137 Bacteria 1229
394 Ga0316585_10124359 3300032137 Bacteria 849
395 Ga0316580_10014936 3300032139 Bacteria 2373
396 Ga0316593_10001800 3300032168 Bacteria 4887
397 Ga0316592_1000185 3300033524 Bacteria 7403
398 Ga0316592_1014347 3300033524 Unclassified 1642
399 Ga0316592_1025935 3300033524 Unclassified 1264
400 Ga0316588_1001369 3300033528 Bacteria 3965
401 Ga0316588_1069153 3300033528 Unclassified 866
402 Ga0316596_1000042 3300033541 Bacteria 13570
403 Ga0316596_1000390 3300033541 Bacteria 7277
404 Ga0373948_0143006 3300034817 Bacteria 593
405 Ga0373939_0053240 3300035114 Bacteria 1264
406 Ga0373942_0002444 3300035207 Bacteria 4503
407 Ga0316574_0000074 3300035398 Bacteria 27344
408 Ga0316574_0123779 3300035398 Bacteria 1661
409 Ga0316574_0182225 3300035398 Bacteria 1351
410 Ga0316574_0396006 3300035398 Bacteria 870
411 Ga0373931_0227594 3300035691 Bacteria 1125
412 Ga0373931_0463909 3300035691 Bacteria 812
413 Ga0373931_0567110 3300035691 Bacteria 739
414 Ga0373935_0343024 3300035692 Bacteria 1064
415 Ga0373947_0526743 3300035725 Bacteria 804
416 Ga0373937_0169519 3300036401 Bacteria 2048
417 Ga0316582_0000999 3300036647 Bacteria 11795
418 Ga0316584_0442095 3300036712 Bacteria 921
419 Ga0395899_0000031 3300037312 Bacteria 322356
420 Ga0395899_0042832 3300037312 Bacteria 3378
421 Ga0395899_0058255 3300037312 Bacteria 2849
422 Ga0395899_0315353 3300037312 Bacteria 1055
423 Ga0395900_0000158 3300037418 Bacteria 112053
424 Ga0395900_0003337 3300037418 Bacteria 17347
425 Ga0395900_0006577 3300037418 Bacteria 12096
426 Ga0395900_0018187 3300037418 Bacteria 7170
427 Ga0395898_0000040 3300037466 Bacteria 317329
428 Ga0395898_0003196 3300037466 Bacteria 18447
429 Ga0395898_0016977 3300037466 Bacteria 7433
430 Ga0395905_0013205 3300037471 Bacteria 7926
431 Ga0395901_0000002 3300038443 Bacteria 761045
432 Ga0395901_0000059 3300038443 Bacteria 152667
433 Ga0395901_0000196 3300038443 Bacteria 77048
434 Ga0395901_0051787 3300038443 Bacteria 4268
435 Ga0395901_0557232 3300038443 Bacteria 1161
436 Ga0400490_16935 3300038726 Bacteria 14185
437 Ga0400487_51885 3300039110 Bacteria 77480
438 Ga0436365_1241889 3300039437 Bacteria 5207
439 Ga0436365_1461145 3300039437 Bacteria 2839
440 Ga0436360_0835901 3300039438 Bacteria 1346
441 Ga0439441_001275 3300042001 Bacteria 3236
442 Ga0439444_0101316 3300042437 Bacteria 653
443 Ga0466969_0016591 3300044656 Bacteria 3852
444 Ga0466977_0000619 3300044666 Bacteria 12277
445 Ga0466966_0000271 3300044684 Bacteria 33899
446 Ga0466966_0000465 3300044684 Bacteria 25971
447 Ga0466966_0036011 3300044684 Bacteria 3197
448 Ga0466966_0168392 3300044684 Bacteria 1332
449 Ga0466961_0000552 3300044693 Bacteria 23841
450 Ga0466961_0047304 3300044693 Bacteria 2751
451 Ga0466963_0004798 3300044694 Bacteria 7885
452 Ga0453684_0001497 3300044712 Bacteria 65811
453 Ga0466971_0016881 3300044719 Bacteria 3225
454 Ga0466971_0209040 3300044719 Bacteria 922
455 Ga0466957_0012884 3300044842 Bacteria 4846
456 Ga0466957_0024533 3300044842 Bacteria 3569
457 Ga0466957_0158076 3300044842 Bacteria 1470
458 Ga0466957_0576827 3300044842 Bacteria 786
459 Ga0466959_0003757 3300045049 Bacteria 10047
460 Ga0466959_0263943 3300045049 Bacteria 1185
461 Ga0466959_0297290 3300045049 Bacteria 1106
462 Ga0451576_0459654 3300045051 Bacteria 1337
463 Ga0466958_0000134 3300045836 Bacteria 24891
464 Ga0466958_0016502 3300045836 Bacteria 4253
465 Ga0466958_0077757 3300045836 Bacteria 2038
466 Ga0466958_0107714 3300045836 Bacteria 1738
467 Ga0466967_0194921 3300045976 Bacteria 1916
468 Ga0466967_0211233 3300045976 Bacteria 1841
469 Ga0466967_0510331 3300045976 Bacteria 1181
470 Ga0495592_0001159 3300046454 Bacteria 18286
471 Ga0495592_0038803 3300046454 Bacteria 3581
472 Ga0495592_0145136 3300046454 Bacteria 1646
473 Ga0495603_0167400 3300046455 Bacteria 1273
474 Ga0495603_0293811 3300046455 Bacteria 933
475 Ga0495590_0011142 3300046457 Bacteria 3367
476 Ga0495590_0026463 3300046457 Bacteria 2036
477 Ga0495591_000961 3300046458 Bacteria 19683
478 Ga0495629_0000147 3300046459 Bacteria 61514
479 Ga0495629_0003838 3300046459 Bacteria 11336
480 Ga0495629_0008409 3300046459 Bacteria 7592
481 Ga0495629_0027982 3300046459 Bacteria 4003
482 Ga0495638_0011209 3300046460 Bacteria 6188
483 Ga0495641_0052781 3300046461 Bacteria 1852
484 Ga0495641_0126250 3300046461 Bacteria 1141
485 Ga0495651_0000955 3300046462 Bacteria 22358
486 Ga0495651_0117189 3300046462 Bacteria 1961
487 Ga0495651_0139799 3300046462 Bacteria 1757
488 Ga0495653_0000355 3300046463 Bacteria 37058
489 Ga0495653_0174570 3300046463 Bacteria 1480
490 Ga0495653_0259491 3300046463 Bacteria 1149
491 Ga0495653_0557342 3300046463 Bacteria 708
492 Ga0495653_0644420 3300046463 Bacteria 647
493 Ga0495650_0001394 3300046471 Bacteria 23768
494 Ga0495650_0008493 3300046471 Bacteria 5980
495 Ga0495650_0027190 3300046471 Bacteria 2648
496 Ga0495650_0046169 3300046471 Bacteria 1829
497 Ga0495650_0079938 3300046471 Bacteria 1263
498 Ga0495650_0246766 3300046471 Bacteria 608
499 Ga0495580_0000541 3300046472 Bacteria 31897
500 Ga0495580_0000912 3300046472 Bacteria 25774
501 Ga0495580_0002115 3300046472 Bacteria 17430
502 Ga0495580_0006853 3300046472 Bacteria 9222
503 Ga0495580_0024558 3300046472 Bacteria 4410
504 Ga0495580_0286378 3300046472 Bacteria 1123
505 Ga0495582_0001753 3300046473 Bacteria 12248
506 Ga0495582_0014292 3300046473 Bacteria 4366
507 Ga0495582_0050896 3300046473 Bacteria 2283
508 Ga0495605_0020730 3300046474 Bacteria 3491
509 Ga0495605_0035003 3300046474 Bacteria 2540
510 Ga0495662_0057213 3300046476 Bacteria 1883
511 Ga0495662_0093675 3300046476 Bacteria 1466
512 Ga0495664_0011112 3300046477 Bacteria 5066
513 Ga0495664_0037595 3300046477 Bacteria 2857
514 Ga0495594_0364728 3300046499 Bacteria 822
515 Ga0495596_0000982 3300046500 Bacteria 16980
516 Ga0495596_0013170 3300046500 Bacteria 3518
517 Ga0495596_0015181 3300046500 Bacteria 3232
518 Ga0495596_0077853 3300046500 Bacteria 1287
519 Ga0495607_0028850 3300046501 Bacteria 3418
520 Ga0495583_0003596 3300046506 Bacteria 11632
521 Ga0495606_0218575 3300046507 Bacteria 1075
522 Ga0495608_0000869 3300046511 Bacteria 21090
523 Ga0495608_0006410 3300046511 Bacteria 8356
524 Ga0495610_0005866 3300046512 Bacteria 8620
525 Ga0495618_0004312 3300046514 Bacteria 8753
526 Ga0495618_0011962 3300046514 Bacteria 5266
527 Ga0495618_0029276 3300046514 Bacteria 3435
528 Ga0495618_0064048 3300046514 Bacteria 2335
529 Ga0495620_0015676 3300046515 Bacteria 3819
530 Ga0495620_0082926 3300046515 Bacteria 1295
531 Ga0495628_0008297 3300046516 Bacteria 8926
532 Ga0495628_0025593 3300046516 Bacteria 4820
533 Ga0495628_0027989 3300046516 Bacteria 4583
534 Ga0495628_0060537 3300046516 Bacteria 2970
535 Ga0495628_0093840 3300046516 Bacteria 2320
536 Ga0495628_0171730 3300046516 Bacteria 1643
537 Ga0495628_0236376 3300046516 Bacteria 1368
538 Ga0495630_0008073 3300046517 Bacteria 7567
539 Ga0495630_0009649 3300046517 Bacteria 6942
540 Ga0495630_0067609 3300046517 Bacteria 2686
541 Ga0495630_0584111 3300046517 Bacteria 856
542 Ga0495632_0198053 3300046519 Bacteria 916
543 Ga0495643_0052370 3300046522 Bacteria 2192
544 Ga0495648_0020557 3300046524 Bacteria 4599
545 Ga0495648_0035144 3300046524 Bacteria 3251
546 Ga0495648_0043923 3300046524 Bacteria 2794
547 Ga0495666_0000266 3300046526 Bacteria 22595
548 Ga0495666_0003295 3300046526 Bacteria 8153
549 Ga0495666_0033743 3300046526 Bacteria 2498
550 Ga0495666_0047506 3300046526 Bacteria 2067
551 Ga0495642_0170941 3300046528 Bacteria 944
552 Ga0495652_0029801 3300046529 Bacteria 4790
553 Ga0495652_0041513 3300046529 Bacteria 3970
554 Ga0495652_0070444 3300046529 Bacteria 2922
555 Ga0495654_0157719 3300046530 Bacteria 999
556 Ga0495665_0005766 3300046531 Bacteria 6684
557 Ga0495665_0034674 3300046531 Bacteria 2698
558 Ga0495665_0034894 3300046531 Bacteria 2689
559 Ga0495665_0096157 3300046531 Bacteria 1555
560 Ga0495640_0004554 3300046533 Bacteria 11050
561 Ga0495640_0029879 3300046533 Bacteria 3906
562 Ga0495640_0058885 3300046533 Bacteria 2618
563 Ga0495586_0005854 3300046535 Bacteria 6569
564 Ga0495586_0072791 3300046535 Bacteria 1879
565 Ga0495586_0132550 3300046535 Bacteria 1395
566 Ga0495587_0002232 3300046536 Bacteria 12950
567 Ga0495587_0002649 3300046536 Bacteria 11956
568 Ga0495587_0294681 3300046536 Bacteria 908
569 Ga0495598_0042104 3300046537 Bacteria 1339
570 Ga0495609_0043956 3300046538 Bacteria 2005
571 Ga0495621_0017865 3300046539 Bacteria 2298
572 Ga0495597_0049239 3300046542 Bacteria 1863
573 Ga0495645_0054557 3300046543 Bacteria 2903
574 Ga0495622_0002432 3300046557 Bacteria 9035
575 Ga0495667_0049295 3300046559 Bacteria 2780
576 Ga0495667_0153351 3300046559 Bacteria 1483
577 Ga0495668_0292950 3300046616 Bacteria 892
578 Ga0495634_0011146 3300046642 Bacteria 6557
579 Ga0495634_0016716 3300046642 Bacteria 5242
580 Ga0495634_0059012 3300046642 Bacteria 2556
581 Ga0495611_0026130 3300046648 Bacteria 2547
582 Ga0495611_0039779 3300046648 Bacteria 2094
583 Ga0495625_0067430 3300046660 Bacteria 2518
584 Ga0495635_0002508 3300046663 Bacteria 12548
585 Ga0495635_0007855 3300046663 Bacteria 7450
586 Ga0495635_0126161 3300046663 Bacteria 1745
587 Ga0495661_0006883 3300046665 Bacteria 7949
588 Ga0495661_0027877 3300046665 Bacteria 3622
589 Ga0495661_0053466 3300046665 Bacteria 2428
590 Ga0495588_0037475 3300046674 Bacteria 2464
591 Ga0495657_0041820 3300046675 Bacteria 3134
592 Ga0495657_0044901 3300046675 Bacteria 3001
593 Ga0495599_0022115 3300046678 Bacteria 3969
594 Ga0495599_0486585 3300046678 Bacteria 727
595 Ga0495623_0002158 3300046679 Bacteria 13140
596 Ga0495623_0104906 3300046679 Bacteria 1718
597 Ga0495623_0186666 3300046679 Bacteria 1200
598 Ga0495646_0002595 3300046680 Bacteria 11133
599 Ga0495646_0003268 3300046680 Bacteria 10086
600 Ga0495646_0023036 3300046680 Bacteria 3922
601 Ga0495646_0028757 3300046680 Bacteria 3479
602 Ga0495646_0137019 3300046680 Bacteria 1372
603 Ga0495646_0137730 3300046680 Bacteria 1368
604 Ga0495669_0075172 3300046684 Bacteria 1545
605 Ga0495613_0026567 3300046689 Bacteria 4311
606 Ga0495613_0161515 3300046689 Bacteria 1593
607 Ga0495613_0342540 3300046689 Bacteria 1028
608 Ga0495624_0004472 3300046690 Bacteria 10227
609 Ga0495624_0011607 3300046690 Bacteria 6051
610 Ga0495624_0014820 3300046690 Bacteria 5280
611 Ga0495624_0034815 3300046690 Bacteria 3254
612 Ga0495624_0054474 3300046690 Bacteria 2521
613 Ga0495671_0086235 3300046692 Bacteria 1538
614 Ga0495649_0058452 3300046694 Bacteria 2077
615 Ga0495649_0062548 3300046694 Bacteria 2000
616 Ga0495649_0205208 3300046694 Bacteria 1022
617 Ga0495589_0001698 3300046794 Bacteria 12565
618 Ga0495589_0074709 3300046794 Bacteria 1653
619 Ga0495589_0109009 3300046794 Bacteria 1337
620 Ga0495600_0014180 3300046809 Bacteria 5020
621 Ga0495600_0036521 3300046809 Bacteria 3193
622 Ga0495600_0370684 3300046809 Bacteria 894
623 Ga0495660_0065446 3300046810 Bacteria 1940
624 Ga0495581_0021485 3300047315 Bacteria 3740
625 Ga0495604_0051457 3300047317 Bacteria 3192
626 Ga0495604_0092279 3300047317 Bacteria 2243
627 Ga0495604_0156072 3300047317 Bacteria 1616
628 Ga0495604_0263095 3300047317 Bacteria 1171
629 Ga0495674_0026860 3300047319 Bacteria 5265
630 Ga0495674_0220553 3300047319 Bacteria 1567
631 Ga0495672_0050089 3300047320 Bacteria 2468
632 Ga0495672_0132827 3300047320 Bacteria 1307
633 Ga0495676_0023757 3300047321 Bacteria 5315
634 Ga0495680_0034791 3300047322 Bacteria 4064
635 Ga0495680_0059708 3300047322 Bacteria 2942
636 Ga0495680_0119103 3300047322 Bacteria 1950
637 Ga0495683_0008360 3300047323 Bacteria 5544
638 Ga0495683_0016402 3300047323 Bacteria 3847
639 Ga0495683_0036102 3300047323 Bacteria 2510
640 Ga0495687_003598 3300047443 Bacteria 11098
641 Ga0495687_019609 3300047443 Bacteria 3313
642 Ga0495687_023030 3300047443 Bacteria 2981
643 Ga0495675_0033433 3300047444 Bacteria 3283
644 Ga0495675_0559502 3300047444 Bacteria 651
645 Ga0495679_000007 3300047446 Bacteria 401482
646 Ga0495679_000777 3300047446 Bacteria 20199
647 Ga0495679_001594 3300047446 Bacteria 12757
648 Ga0495684_0031855 3300047471 Bacteria 4050
649 Ga0495684_0097697 3300047471 Bacteria 2221
650 Ga0495686_0000014 3300047472 Bacteria 474014
651 Ga0495686_0041678 3300047472 Bacteria 2922
652 Ga0495593_0001969 3300047673 Bacteria 12233
653 Ga0495593_0051260 3300047673 Bacteria 2184
654 Ga0495602_0046894 3300048088 Bacteria 3898
655 Ga0495602_0108452 3300048088 Bacteria 2260
656 Ga0495602_0113357 3300048088 Bacteria 2197
657 Ga0495602_0136196 3300048088 Bacteria 1950
658 Ga0495602_0308502 3300048088 Bacteria 1155
659 Ga0495614_0004727 3300048089 Bacteria 6140
660 Ga0495614_0010107 3300048089 Bacteria 4165
661 Ga0495614_0015034 3300048089 Bacteria 3378
662 Ga0495626_0016381 3300048091 Bacteria 3765
663 Ga0495626_0027635 3300048091 Bacteria 2757
664 Ga0496102_0037779 3300048905 Bacteria 4357
665 Ga0496102_1236989 3300048905 Bacteria 666
666 Ga0496103_0006243 3300048906 Bacteria 7122
667 Ga0496104_0049450 3300048907 Bacteria 3965
668 Ga0496104_0572575 3300048907 Bacteria 1040
669 Ga0496106_0058018 3300048909 Bacteria 2929
670 Ga0496111_0253469 3300048914 Bacteria 1306
671 Ga0496116_0092416 3300048919 Bacteria 1835
672 Ga0496116_0159197 3300048919 Bacteria 1241
673 Ga0496116_0187770 3300048919 Bacteria 1098
674 Ga0496117_0005194 3300048920 Bacteria 13859
675 Ga0496117_0026344 3300048920 Bacteria 4551
676 Ga0496117_0029092 3300048920 Bacteria 4265
677 Ga0496117_0055022 3300048920 Bacteria 2783
678 Ga0496117_0094191 3300048920 Bacteria 1918
679 Ga0496118_0000282 3300048921 Bacteria 89232
680 Ga0496118_0002992 3300048921 Bacteria 21847
681 Ga0496118_0015903 3300048921 Bacteria 6934
682 Ga0496118_0068145 3300048921 Bacteria 2586
683 Ga0496118_0123823 3300048921 Bacteria 1678
684 Ga0496118_0312544 3300048921 Bacteria 856
685 Ga0496121_0051751 3300048924 Bacteria 3456
686 Ga0496121_0468271 3300048924 Bacteria 808
687 Ga0496126_0000061 3300048929 Bacteria 261515
688 Ga0496126_0001519 3300048929 Bacteria 35767
689 Ga0496126_0524237 3300048929 Bacteria 944
690 Ga0495678_033374 3300049459 Bacteria 2125
691 Ga0495678_037703 3300049459 Bacteria 1961
692 Ga0495682_0049331 3300049460 Bacteria 1534
693 Ga0501299_084914 3300049522 Bacteria 710
694 Ga0501034_0000456 3300049571 Bacteria 67493
695 Ga0501034_0040175 3300049571 Bacteria 4737
696 Ga0501034_0191279 3300049571 Bacteria 2008
697 Ga0501036_0718154 3300049572 Bacteria 825
698 Ga0501037_0001334 3300049573 Bacteria 18109
699 Ga0501038_0064136 3300049574 Bacteria 3133
700 Ga0501039_0137223 3300049575 Bacteria 1921
701 Ga0501039_0264960 3300049575 Bacteria 1350
702 Ga0501043_0334329 3300049579 Bacteria 1153
703 Ga0501046_0012661 3300049580 Bacteria 7172
704 Ga0501047_0025488 3300049581 Bacteria 5685
705 Ga0501047_0144232 3300049581 Bacteria 2259
706 Ga0501048_0320806 3300049582 Bacteria 1104
707 Ga0501068_0022173 3300049584 Bacteria 3711
708 Ga0501068_0460653 3300049584 Bacteria 823
709 Ga0501069_0009654 3300049585 Bacteria 5098
710 Ga0501070_0028182 3300049586 Bacteria 4710
711 Ga0501070_0035410 3300049586 Bacteria 4171
712 Ga0501070_0042923 3300049586 Bacteria 3765
713 Ga0501070_0521436 3300049586 Bacteria 953
714 Ga0501070_1131760 3300049586 Bacteria 603
715 Ga0501072_0016094 3300049588 Bacteria 5736
716 Ga0501073_0004611 3300049589 Bacteria 10355
717 Ga0501073_0008127 3300049589 Bacteria 7782
718 Ga0501074_0000309 3300049590 Bacteria 28271
719 Ga0501074_0011687 3300049590 Bacteria 6380
720 Ga0501074_0031959 3300049590 Bacteria 3815
721 Ga0501077_0408491 3300049593 Bacteria 868
722 Ga0501079_0021387 3300049741 Bacteria 4948
723 Ga0501079_0466548 3300049741 Bacteria 992
724 Ga0501080_0030890 3300049742 Bacteria 4991
725 Ga0501080_0119289 3300049742 Bacteria 2445
726 Ga0501080_0268733 3300049742 Bacteria 1552
727 Ga0501080_0328759 3300049742 Bacteria 1383
728 Ga0501080_0509019 3300049742 Bacteria 1075
729 Ga0501081_0051842 3300049743 Bacteria 2830
730 Ga0501083_0005715 3300049744 Bacteria 8802
731 Ga0501083_0017673 3300049744 Bacteria 4972
732 Ga0501083_0050134 3300049744 Bacteria 2811
733 Ga0501035_0218285 3300049822 Bacteria 1629
734 Ga0501035_0397289 3300049822 Bacteria 1147
735 Ga0501035_0905348 3300049822 Bacteria 698
736 Ga0501044_0065144 3300049823 Bacteria 3717
737 Ga0501044_0561789 3300049823 Bacteria 1037
738 nmdc:mga03n38_472095_c1 3300050490 Bacteria 700
739 nmdc:mga0k408_201082_c1 3300050493 Bacteria 1189
740 nmdc:mga0k408_33042_c1 3300050493 Bacteria 2957
741 nmdc:mga06z11_127541_c1 3300050494 Bacteria 1425
742 nmdc:mga07m45_158782_c1 3300050496 Bacteria 1312
743 nmdc:mga06r32_552569_c1 3300050510 Bacteria 1125
744 nmdc:mga08y16_1758_c1 3300050511 Bacteria 21960
745 nmdc:mga0n895_1797163_c1 3300050512 Bacteria 574
746 nmdc:mga0n895_74366_c1 3300050512 Bacteria 3375
747 nmdc:mga0rr50_56142_c1 3300050513 Bacteria 2941
748 nmdc:mga08x19_22420_c1 3300050514 Bacteria 3911
749 nmdc:mga0a205_220133_c1 3300050515 Bacteria 1784
750 nmdc:mga0sz30_109693_c1 3300050516 Bacteria 1209
751 Ga0590077_021760 3300059426 Bacteria 1367
752 Ga0501082_0590995 3300060353 Bacteria 971
753 Ga0466962_0002291 3300061719 Bacteria 9077
754 Ga0466962_0042464 3300061719 Bacteria 2176
755 Ga0466962_0169886 3300061719 Bacteria 1062

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005337 Ga0070682_100033534 Ga0070682_1000335343 173
2 3300035114 Ga0373939_0053240 Ga0373939_0053240_398_928 173
3 3300035691 Ga0373931_0567110 Ga0373931_0567110_160_690 173
4 3300006178 Ga0075367_10109935 Ga0075367_101099352 175
5 iso_pu_bacteria 2887375801 2887379846 175
6 3300005328 Ga0070676_10131167 Ga0070676_101311672 177
7 3300005330 Ga0070690_100016460 Ga0070690_1000164602 177
8 3300005334 Ga0068869_100045097 Ga0068869_1000450973 177
9 3300005338 Ga0068868_100273686 Ga0068868_1002736862 177
10 3300005340 Ga0070689_100000383 Ga0070689_10000038320 177
11 3300005345 Ga0070692_10039912 Ga0070692_100399122 177
12 3300005356 Ga0070674_101389668 Ga0070674_1013896681 177
13 3300005364 Ga0070673_100461961 Ga0070673_1004619612 177
14 3300005438 Ga0070701_10007230 Ga0070701_100072302 177
15 3300005440 Ga0070705_100014965 Ga0070705_1000149652 177
16 3300005441 Ga0070700_100000746 Ga0070700_1000007468 177
17 3300005441 Ga0070700_100023703 Ga0070700_1000237035 177
18 3300005444 Ga0070694_100197852 Ga0070694_1001978522 177
19 3300005444 Ga0070694_100727164 Ga0070694_1007271642 177
20 3300005456 Ga0070678_100700872 Ga0070678_1007008722 177
21 3300005458 Ga0070681_10496865 Ga0070681_104968652 177
22 3300005459 Ga0068867_100012966 Ga0068867_1000129663 177
23 3300005459 Ga0068867_100054175 Ga0068867_1000541753 177
24 3300005466 Ga0070685_10056833 Ga0070685_100568332 177
25 3300005544 Ga0070686_100000740 Ga0070686_10000074011 177
26 3300005545 Ga0070695_100016904 Ga0070695_1000169045 177
27 3300005546 Ga0070696_100022306 Ga0070696_1000223063 177
28 3300005547 Ga0070693_100046697 Ga0070693_1000466972 177
29 3300005549 Ga0070704_100217780 Ga0070704_1002177802 177
30 3300005549 Ga0070704_101261052 Ga0070704_1012610522 177
31 3300005615 Ga0070702_100003111 Ga0070702_1000031115 177
32 3300005617 Ga0068859_100004756 Ga0068859_1000047566 177
33 3300005718 Ga0068866_10002120 Ga0068866_100021205 177
34 3300005719 Ga0068861_100002984 Ga0068861_1000029849 177
35 3300005840 Ga0068870_10006494 Ga0068870_100064942 177
36 3300005842 Ga0068858_100002485 Ga0068858_1000024856 177
37 3300005843 Ga0068860_100052968 Ga0068860_1000529683 177
38 3300005844 Ga0068862_100003014 Ga0068862_1000030142 177
39 3300006237 Ga0097621_100002878 Ga0097621_1000028784 177
40 3300006358 Ga0068871_100047155 Ga0068871_1000471552 177
41 3300006844 Ga0075428_100117828 Ga0075428_1001178283 177
42 3300006880 Ga0075429_100310627 Ga0075429_1003106272 177
43 3300006881 Ga0068865_100007859 Ga0068865_1000078592 177
44 3300006881 Ga0068865_100067523 Ga0068865_1000675232 177
45 3300006931 Ga0097620_100004756 Ga0097620_1000047566 177
46 3300007265 Ga0099794_10243916 Ga0099794_102439162 177
47 3300009094 Ga0111539_10892816 Ga0111539_108928161 177
48 3300009098 Ga0105245_10005540 Ga0105245_100055402 177
49 3300009148 Ga0105243_10004473 Ga0105243_1000447311 177
50 3300009176 Ga0105242_10006365 Ga0105242_100063652 177
51 3300009176 Ga0105242_11025498 Ga0105242_110254982 177
52 3300009553 Ga0105249_10036317 Ga0105249_100363174 177
53 3300013297 Ga0157378_10001155 Ga0157378_100011558 177
54 3300013297 Ga0157378_10011184 Ga0157378_100111846 177
55 3300014326 Ga0157380_10025001 Ga0157380_100250012 177
56 3300014968 Ga0157379_10073141 Ga0157379_100731412 177
57 3300025899 Ga0207642_10002640 Ga0207642_100026403 177
58 3300025908 Ga0207643_10004018 Ga0207643_100040187 177
59 3300025912 Ga0207707_10096540 Ga0207707_100965402 177
60 3300025917 Ga0207660_11097929 Ga0207660_110979291 177
61 3300025927 Ga0207687_10005161 Ga0207687_100051612 177
62 3300025934 Ga0207686_10019035 Ga0207686_100190352 177
63 3300025934 Ga0207686_10586233 Ga0207686_105862332 177
64 3300025935 Ga0207709_10021888 Ga0207709_100218883 177
65 3300025935 Ga0207709_10050230 Ga0207709_100502302 177
66 3300025936 Ga0207670_10012625 Ga0207670_100126255 177
67 3300025938 Ga0207704_10015507 Ga0207704_100155072 177
68 3300025942 Ga0207689_10000474 Ga0207689_1000047420 177
69 3300025961 Ga0207712_10253976 Ga0207712_102539762 177
70 3300026035 Ga0207703_10007310 Ga0207703_100073102 177
71 3300026075 Ga0207708_10000382 Ga0207708_1000038216 177
72 3300026075 Ga0207708_10039444 Ga0207708_100394445 177
73 3300026089 Ga0207648_10001543 Ga0207648_1000154319 177
74 3300026089 Ga0207648_10338815 Ga0207648_103388152 177
75 3300026118 Ga0207675_100000178 Ga0207675_10000017820 177
76 3300026121 Ga0207683_10949433 Ga0207683_109494332 177
77 3300028380 Ga0268265_10026191 Ga0268265_100261915 177
78 3300028381 Ga0268264_10046116 Ga0268264_100461165 177
79 3300035207 Ga0373942_0002444 Ga0373942_0002444_3927_4460 177
80 3300048909 Ga0496106_0058018 Ga0496106_0058018_1171_1707 177
81 3300049571 Ga0501034_0000456 Ga0501034_0000456_7724_8257 177
82 3300049571 Ga0501034_0040175 Ga0501034_0040175_875_1408 177
83 3300049579 Ga0501043_0334329 Ga0501043_0334329_16_549 177
84 3300049584 Ga0501068_0022173 Ga0501068_0022173_2852_3385 177
85 3300049584 Ga0501068_0460653 Ga0501068_0460653_98_631 177
86 3300049586 Ga0501070_0042923 Ga0501070_0042923_502_1035 177
87 3300049588 Ga0501072_0016094 Ga0501072_0016094_4054_4587 177
88 3300049589 Ga0501073_0008127 Ga0501073_0008127_4086_4619 177
89 3300049590 Ga0501074_0031959 Ga0501074_0031959_410_943 177
90 3300049593 Ga0501077_0408491 Ga0501077_0408491_45_578 177
91 3300049742 Ga0501080_0268733 Ga0501080_0268733_693_1226 177
92 3300049742 Ga0501080_0509019 Ga0501080_0509019_39_572 177
93 3300049744 Ga0501083_0017673 Ga0501083_0017673_3279_3812 177
94 3300049744 Ga0501083_0050134 Ga0501083_0050134_682_1215 177
95 3300060353 Ga0501082_0590995 Ga0501082_0590995_157_690 177
96 3300005327 Ga0070658_10850993 Ga0070658_108509932 178
97 3300005577 Ga0068857_100421323 Ga0068857_1004213232 178
98 3300005615 Ga0070702_100107885 Ga0070702_1001078852 178
99 3300006844 Ga0075428_100248016 Ga0075428_1002480161 178
100 3300006880 Ga0075429_100069353 Ga0075429_1000693532 178
101 3300009094 Ga0111539_10000940 Ga0111539_100009406 178
102 3300014969 Ga0157376_10858066 Ga0157376_108580662 178
103 3300027543 Ga0209999_1045218 Ga0209999_10452181 178
104 3300027682 Ga0209971_1078428 Ga0209971_10784281 178
105 3300027907 Ga0207428_10123033 Ga0207428_101230332 178
106 3300031548 Ga0307408_100419049 Ga0307408_1004190492 178
107 3300032002 Ga0307416_100274273 Ga0307416_1002742732 178
108 3300032002 Ga0307416_101082790 Ga0307416_1010827901 178
109 3300039437 Ga0436365_1241889 Ga0436365_1241889_3600_4136 178
110 3300042001 Ga0439441_001275 Ga0439441_001275_1142_1678 178
111 3300042437 Ga0439444_0101316 Ga0439444_0101316_75_611 178
112 3300050511 nmdc:mga08y16_1758_c1 nmdc:mga08y16_1758_c1_14242_14778 178
113 3300005327 Ga0070658_10173762 Ga0070658_101737622 179
114 3300005330 Ga0070690_100064896 Ga0070690_1000648962 179
115 3300005333 Ga0070677_10118403 Ga0070677_101184032 179
116 3300005340 Ga0070689_101072020 Ga0070689_1010720201 179
117 3300005354 Ga0070675_100138226 Ga0070675_1001382262 179
118 3300005356 Ga0070674_100301524 Ga0070674_1003015242 179
119 3300005365 Ga0070688_100192686 Ga0070688_1001926862 179
120 3300005435 Ga0070714_100026968 Ga0070714_1000269687 179
121 3300005444 Ga0070694_100454229 Ga0070694_1004542292 179
122 3300005445 Ga0070708_100970904 Ga0070708_1009709041 179
123 3300005459 Ga0068867_100219790 Ga0068867_1002197902 179
124 3300005530 Ga0070679_100043513 Ga0070679_1000435135 179
125 3300005535 Ga0070684_100279389 Ga0070684_1002793891 179
126 3300005535 Ga0070684_100443810 Ga0070684_1004438102 179
127 3300005544 Ga0070686_100499330 Ga0070686_1004993302 179
128 3300005544 Ga0070686_101131803 Ga0070686_1011318031 179
129 3300005547 Ga0070693_100043389 Ga0070693_1000433891 179
130 3300005548 Ga0070665_100081943 Ga0070665_1000819432 179
131 3300005548 Ga0070665_100845125 Ga0070665_1008451252 179
132 3300005563 Ga0068855_100024344 Ga0068855_1000243446 179
133 3300005563 Ga0068855_100028419 Ga0068855_1000284196 179
134 3300005563 Ga0068855_100028597 Ga0068855_1000285975 179
135 3300005563 Ga0068855_100046385 Ga0068855_1000463854 179
136 3300005578 Ga0068854_100357165 Ga0068854_1003571652 179
137 3300005614 Ga0068856_100085472 Ga0068856_1000854722 179
138 3300005614 Ga0068856_100296924 Ga0068856_1002969242 179
139 3300005616 Ga0068852_100003636 Ga0068852_1000036368 179
140 3300005616 Ga0068852_100056305 Ga0068852_1000563052 179
141 3300005718 Ga0068866_10629998 Ga0068866_106299982 179
142 3300005841 Ga0068863_100123245 Ga0068863_1001232452 179
143 3300005841 Ga0068863_101016923 Ga0068863_1010169232 179
144 3300005842 Ga0068858_100011312 Ga0068858_1000113123 179
145 3300005842 Ga0068858_100058823 Ga0068858_1000588232 179
146 3300005843 Ga0068860_100142242 Ga0068860_1001422422 179
147 3300005985 Ga0081539_10042254 Ga0081539_100422542 179
148 3300006048 Ga0075363_100500112 Ga0075363_1005001121 179
149 3300006353 Ga0075370_10329171 Ga0075370_103291712 179
150 3300006358 Ga0068871_100022510 Ga0068871_1000225103 179
151 3300006852 Ga0075433_10154629 Ga0075433_101546292 179
152 3300006871 Ga0075434_100128221 Ga0075434_1001282214 179
153 3300006881 Ga0068865_100080405 Ga0068865_1000804052 179
154 3300006881 Ga0068865_100728573 Ga0068865_1007285732 179
155 3300006914 Ga0075436_100003122 Ga0075436_1000031228 179
156 3300007076 Ga0075435_100216203 Ga0075435_1002162033 179
157 3300009093 Ga0105240_10018150 Ga0105240_1001815010 179
158 3300009093 Ga0105240_10042328 Ga0105240_100423285 179
159 3300009098 Ga0105245_10104392 Ga0105245_101043922 179
160 3300009101 Ga0105247_10073068 Ga0105247_100730682 179
161 3300009174 Ga0105241_10013590 Ga0105241_100135906 179
162 3300009176 Ga0105242_10001658 Ga0105242_1000165819 179
163 3300009176 Ga0105242_10126888 Ga0105242_101268882 179
164 3300009177 Ga0105248_10014079 Ga0105248_100140792 179
165 3300009177 Ga0105248_10127471 Ga0105248_101274712 179
166 3300009177 Ga0105248_10781248 Ga0105248_107812482 179
167 3300009551 Ga0105238_10004061 Ga0105238_1000406114 179
168 3300009551 Ga0105238_10011719 Ga0105238_100117199 179
169 3300009551 Ga0105238_10116989 Ga0105238_101169894 179
170 3300009551 Ga0105238_10185285 Ga0105238_101852852 179
171 3300011119 Ga0105246_10076846 Ga0105246_100768463 179
172 3300013104 Ga0157370_10000800 Ga0157370_1000080028 179
173 3300013104 Ga0157370_10181073 Ga0157370_101810732 179
174 3300013105 Ga0157369_10005296 Ga0157369_1000529615 179
175 3300013306 Ga0163162_10044057 Ga0163162_100440574 179
176 3300013307 Ga0157372_10003769 Ga0157372_1000376915 179
177 3300013307 Ga0157372_10189667 Ga0157372_101896673 179
178 3300014325 Ga0163163_10064988 Ga0163163_100649883 179
179 3300014968 Ga0157379_10049245 Ga0157379_100492452 179
180 3300014969 Ga0157376_10236762 Ga0157376_102367622 179
181 3300014969 Ga0157376_11409576 Ga0157376_114095762 179
182 3300020070 Ga0206356_10288866 Ga0206356_102888662 179
183 3300020082 Ga0206353_10100041 Ga0206353_101000411 179
184 3300025903 Ga0207680_10062975 Ga0207680_100629752 179
185 3300025909 Ga0207705_10111689 Ga0207705_101116892 179
186 3300025909 Ga0207705_10205261 Ga0207705_102052612 179
187 3300025911 Ga0207654_10039027 Ga0207654_100390272 179
188 3300025912 Ga0207707_10601396 Ga0207707_106013962 179
189 3300025913 Ga0207695_10030603 Ga0207695_100306035 179
190 3300025913 Ga0207695_10083723 Ga0207695_100837232 179
191 3300025919 Ga0207657_10310332 Ga0207657_103103322 179
192 3300025920 Ga0207649_10283837 Ga0207649_102838372 179
193 3300025921 Ga0207652_10033789 Ga0207652_100337892 179
194 3300025924 Ga0207694_10043505 Ga0207694_100435052 179
195 3300025924 Ga0207694_10140524 Ga0207694_101405242 179
196 3300025924 Ga0207694_10489804 Ga0207694_104898042 179
197 3300025926 Ga0207659_10489214 Ga0207659_104892142 179
198 3300025926 Ga0207659_10571096 Ga0207659_105710962 179
199 3300025927 Ga0207687_10285679 Ga0207687_102856792 179
200 3300025932 Ga0207690_11143349 Ga0207690_111433491 179
201 3300025934 Ga0207686_10032139 Ga0207686_100321392 179
202 3300025934 Ga0207686_10135350 Ga0207686_101353503 179
203 3300025937 Ga0207669_10185958 Ga0207669_101859582 179
204 3300025937 Ga0207669_10245659 Ga0207669_102456592 179
205 3300025940 Ga0207691_10364750 Ga0207691_103647502 179
206 3300025941 Ga0207711_10074220 Ga0207711_100742202 179
207 3300025949 Ga0207667_10013366 Ga0207667_100133669 179
208 3300025949 Ga0207667_10019690 Ga0207667_100196907 179
209 3300025949 Ga0207667_10046287 Ga0207667_100462874 179
210 3300025949 Ga0207667_10146920 Ga0207667_101469202 179
211 3300025949 Ga0207667_10263651 Ga0207667_102636512 179
212 3300025960 Ga0207651_11030347 Ga0207651_110303472 179
213 3300025972 Ga0207668_10146296 Ga0207668_101462962 179
214 3300025981 Ga0207640_10553529 Ga0207640_105535292 179
215 3300026023 Ga0207677_10063227 Ga0207677_100632273 179
216 3300026035 Ga0207703_10007077 Ga0207703_100070773 179
217 3300026075 Ga0207708_10162880 Ga0207708_101628803 179
218 3300026088 Ga0207641_10106722 Ga0207641_101067222 179
219 3300026089 Ga0207648_10026704 Ga0207648_100267043 179
220 3300026089 Ga0207648_10064949 Ga0207648_100649492 179
221 3300026121 Ga0207683_10205204 Ga0207683_102052042 179
222 3300026142 Ga0207698_10013611 Ga0207698_100136112 179
223 3300026142 Ga0207698_10062676 Ga0207698_100626763 179
224 3300028379 Ga0268266_10601539 Ga0268266_106015392 179
225 3300028379 Ga0268266_11447287 Ga0268266_114472871 179
226 3300028380 Ga0268265_10054596 Ga0268265_100545962 179
227 3300031247 Ga0265340_10251813 Ga0265340_102518132 179
228 3300031548 Ga0307408_100138227 Ga0307408_1001382272 179
229 3300031548 Ga0307408_100411781 Ga0307408_1004117812 179
230 3300031665 Ga0316575_10072466 Ga0316575_100724662 179
231 3300031911 Ga0307412_10236086 Ga0307412_102360862 179
232 3300032002 Ga0307416_100670909 Ga0307416_1006709092 179
233 3300033524 Ga0316592_1014347 Ga0316592_10143472 179
234 3300033541 Ga0316596_1000390 Ga0316596_10003905 179
235 3300034817 Ga0373948_0143006 Ga0373948_0143006_20_559 179
236 3300035398 Ga0316574_0123779 Ga0316574_0123779_661_1203 179
237 3300035398 Ga0316574_0182225 Ga0316574_0182225_392_931 179
238 3300035691 Ga0373931_0227594 Ga0373931_0227594_396_935 179
239 3300035692 Ga0373935_0343024 Ga0373935_0343024_199_738 179
240 3300035725 Ga0373947_0526743 Ga0373947_0526743_28_567 179
241 3300037312 Ga0395899_0315353 Ga0395899_0315353_211_750 179
242 3300037471 Ga0395905_0013205 Ga0395905_0013205_280_819 179
243 3300038443 Ga0395901_0557232 Ga0395901_0557232_306_845 179
244 3300038726 Ga0400490_16935 Ga0400490_16935_11763_12317 179
245 3300039110 Ga0400487_51885 Ga0400487_51885_32897_33451 179
246 3300044684 Ga0466966_0036011 Ga0466966_0036011_2159_2698 179
247 3300044693 Ga0466961_0047304 Ga0466961_0047304_834_1373 179
248 3300044712 Ga0453684_0001497 Ga0453684_0001497_20178_20732 179
249 3300044842 Ga0466957_0158076 Ga0466957_0158076_148_687 179
250 3300045049 Ga0466959_0263943 Ga0466959_0263943_193_732 179
251 3300045051 Ga0451576_0459654 Ga0451576_0459654_648_1187 179
252 3300045836 Ga0466958_0077757 Ga0466958_0077757_1381_1920 179
253 3300045976 Ga0466967_0510331 Ga0466967_0510331_267_806 179
254 3300046539 Ga0495621_0017865 Ga0495621_0017865_831_1370 179
255 3300049522 Ga0501299_084914 Ga0501299_084914_62_601 179
256 3300049571 Ga0501034_0191279 Ga0501034_0191279_71_610 179
257 3300049572 Ga0501036_0718154 Ga0501036_0718154_241_780 179
258 3300049573 Ga0501037_0001334 Ga0501037_0001334_7803_8342 179
259 3300049574 Ga0501038_0064136 Ga0501038_0064136_291_830 179
260 3300049575 Ga0501039_0137223 Ga0501039_0137223_1333_1872 179
261 3300049575 Ga0501039_0264960 Ga0501039_0264960_679_1218 179
262 3300049580 Ga0501046_0012661 Ga0501046_0012661_4724_5263 179
263 3300049581 Ga0501047_0025488 Ga0501047_0025488_1997_2536 179
264 3300049581 Ga0501047_0144232 Ga0501047_0144232_282_821 179
265 3300049585 Ga0501069_0009654 Ga0501069_0009654_2730_3269 179
266 3300049586 Ga0501070_0028182 Ga0501070_0028182_2802_3341 179
267 3300049586 Ga0501070_0035410 Ga0501070_0035410_929_1468 179
268 3300049586 Ga0501070_0521436 Ga0501070_0521436_111_650 179
269 3300049589 Ga0501073_0004611 Ga0501073_0004611_6924_7463 179
270 3300049590 Ga0501074_0011687 Ga0501074_0011687_4031_4570 179
271 3300049741 Ga0501079_0021387 Ga0501079_0021387_2585_3124 179
272 3300049741 Ga0501079_0466548 Ga0501079_0466548_400_939 179
273 3300049742 Ga0501080_0030890 Ga0501080_0030890_1748_2287 179
274 3300049742 Ga0501080_0328759 Ga0501080_0328759_518_1057 179
275 3300049743 Ga0501081_0051842 Ga0501081_0051842_114_653 179
276 3300049744 Ga0501083_0005715 Ga0501083_0005715_6270_6809 179
277 3300049822 Ga0501035_0218285 Ga0501035_0218285_1011_1550 179
278 3300049822 Ga0501035_0397289 Ga0501035_0397289_165_704 179
279 3300049822 Ga0501035_0905348 Ga0501035_0905348_93_632 179
280 3300049823 Ga0501044_0065144 Ga0501044_0065144_1880_2419 179
281 3300049823 Ga0501044_0561789 Ga0501044_0561789_429_968 179
282 3300050490 nmdc:mga03n38_472095_c1 nmdc:mga03n38_472095_c1_25_564 179
283 3300050493 nmdc:mga0k408_201082_c1 nmdc:mga0k408_201082_c1_174_713 179
284 3300050496 nmdc:mga07m45_158782_c1 nmdc:mga07m45_158782_c1_759_1298 179
285 3300050512 nmdc:mga0n895_1797163_c1 nmdc:mga0n895_1797163_c1_12_551 179
286 3300050512 nmdc:mga0n895_74366_c1 nmdc:mga0n895_74366_c1_1003_1542 179
287 3300050513 nmdc:mga0rr50_56142_c1 nmdc:mga0rr50_56142_c1_1510_2049 179
288 3300050514 nmdc:mga08x19_22420_c1 nmdc:mga08x19_22420_c1_700_1239 179
289 3300050515 nmdc:mga0a205_220133_c1 nmdc:mga0a205_220133_c1_452_991 179
290 3300059426 Ga0590077_021760 Ga0590077_021760_331_870 179
291 3300061719 Ga0466962_0169886 Ga0466962_0169886_279_818 179
292 3300005340 Ga0070689_100376195 Ga0070689_1003761952 180
293 3300005343 Ga0070687_100227436 Ga0070687_1002274362 180
294 3300005440 Ga0070705_100051355 Ga0070705_1000513552 180
295 3300005456 Ga0070678_100328657 Ga0070678_1003286572 180
296 3300005549 Ga0070704_100023728 Ga0070704_1000237282 180
297 3300005617 Ga0068859_100023776 Ga0068859_1000237762 180
298 3300005719 Ga0068861_100115054 Ga0068861_1001150543 180
299 3300005842 Ga0068858_100284441 Ga0068858_1002844412 180
300 3300005843 Ga0068860_100151911 Ga0068860_1001519113 180
301 3300006178 Ga0075367_10137382 Ga0075367_101373822 180
302 3300006186 Ga0075369_10065991 Ga0075369_100659912 180
303 3300006195 Ga0075366_10061536 Ga0075366_100615363 180
304 3300006931 Ga0097620_100023776 Ga0097620_1000237767 180
305 3300009177 Ga0105248_11236919 Ga0105248_112369191 180
306 3300009553 Ga0105249_10267512 Ga0105249_102675123 180
307 3300013297 Ga0157378_10097287 Ga0157378_100972872 180
308 3300014745 Ga0157377_10593855 Ga0157377_105938552 180
309 3300014968 Ga0157379_11311114 Ga0157379_113111141 180
310 3300025918 Ga0207662_10103267 Ga0207662_101032674 180
311 3300025918 Ga0207662_10201136 Ga0207662_102011362 180
312 3300025927 Ga0207687_10626601 Ga0207687_106266012 180
313 3300025936 Ga0207670_10238588 Ga0207670_102385882 180
314 3300025941 Ga0207711_10768462 Ga0207711_107684622 180
315 3300025942 Ga0207689_10253868 Ga0207689_102538682 180
316 3300026035 Ga0207703_10177048 Ga0207703_101770482 180
317 3300026089 Ga0207648_11031949 Ga0207648_110319492 180
318 3300026118 Ga0207675_100154235 Ga0207675_1001542352 180
319 3300026118 Ga0207675_100385324 Ga0207675_1003853242 180
320 3300028381 Ga0268264_10079355 Ga0268264_100793553 180
321 3300031507 Ga0307509_10606093 Ga0307509_106060932 180
322 3300031728 Ga0316578_10112401 Ga0316578_101124011 180
323 3300033524 Ga0316592_1025935 Ga0316592_10259352 180
324 3300033528 Ga0316588_1069153 Ga0316588_10691532 180
325 3300035398 Ga0316574_0396006 Ga0316574_0396006_162_719 180
326 3300035691 Ga0373931_0463909 Ga0373931_0463909_109_651 180
327 3300036401 Ga0373937_0169519 Ga0373937_0169519_784_1326 180
328 3300037418 Ga0395900_0003337 Ga0395900_0003337_4230_4790 180
329 3300046537 Ga0495598_0042104 Ga0495598_0042104_14_556 180
330 3300049582 Ga0501048_0320806 Ga0501048_0320806_153_695 180
331 3300049586 Ga0501070_1131760 Ga0501070_1131760_43_585 180
332 3300050493 nmdc:mga0k408_33042_c1 nmdc:mga0k408_33042_c1_38_583 180
333 3300050494 nmdc:mga06z11_127541_c1 nmdc:mga06z11_127541_c1_597_1142 180
334 3300050510 nmdc:mga06r32_552569_c1 nmdc:mga06r32_552569_c1_144_686 180
335 3300050516 nmdc:mga0sz30_109693_c1 nmdc:mga0sz30_109693_c1_144_689 180
336 iso_pu_bacteria 2508501125 2509129335 180
337 iso_pu_bacteria 2510065045 2510253292 180
338 iso_pu_bacteria 2512047030 2512347467 180
339 iso_pu_bacteria 2513237151 2513962513 180
340 iso_pu_bacteria 2515154122 2515679472 180
341 iso_pu_bacteria 2526164713 2527079247 180
342 iso_pu_bacteria 2718217991 2719639081 180
343 iso_pu_bacteria 2738541296 2738820167 180
344 iso_pu_bacteria 2738541298 2738832647 180
345 iso_pu_bacteria 2738541306 2738874174 180
346 iso_pu_bacteria 2738543002 2739185804 180
347 iso_pu_bacteria 2738543008 2739220772 180
348 iso_pu_bacteria 2751185846 2753565833 180
349 iso_pu_bacteria 2885270888 2885277372 180
350 iso_pu_bacteria 2902682994 2902689247 180
351 iso_pu_bacteria 2904483920 2904488638 180
352 iso_pu_bacteria 2919527303 2919532250 180
353 iso_pu_bacteria 2928108538 2928109620 180
354 iso_pu_bacteria 2928135762 2928136926 180
355 iso_pu_bacteria 2928503688 2928506454 180
356 iso_pu_bacteria 2945934425 2945935372 180
357 iso_pu_bacteria 2990703756 2990704077 180
358 iso_pu_bacteria 641736151 642422234 180
359 iso_pu_bacteria 8055266321 8055266754 180
360 iso_pu_bacteria 8055301274 8055303975 180
361 3300005616 Ga0068852_100020421 Ga0068852_1000204213 181
362 3300006237 Ga0097621_100121439 Ga0097621_1001214393 181
363 3300006948 Ga0099826_10000003 Ga0099826_10000003536 181
364 3300007265 Ga0099794_10270247 Ga0099794_102702472 181
365 3300009093 Ga0105240_10103873 Ga0105240_101038732 181
366 3300009098 Ga0105245_10166457 Ga0105245_101664572 181
367 3300010375 Ga0105239_10573547 Ga0105239_105735472 181
368 3300013296 Ga0157374_10206104 Ga0157374_102061043 181
369 3300025321 Ga0207656_10000780 Ga0207656_100007803 181
370 3300025913 Ga0207695_10046453 Ga0207695_100464535 181
371 3300025931 Ga0207644_10335181 Ga0207644_103351812 181
372 3300026023 Ga0207677_10071403 Ga0207677_100714032 181
373 3300026142 Ga0207698_10010646 Ga0207698_100106466 181
374 3300027666 Ga0209282_1000002 Ga0209282_1000002462 181
375 3300048907 Ga0496104_0049450 Ga0496104_0049450_2801_3352 181
376 3300048914 Ga0496111_0253469 Ga0496111_0253469_745_1296 181
377 3300049590 Ga0501074_0000309 Ga0501074_0000309_4883_5455 181
378 3300049742 Ga0501080_0119289 Ga0501080_0119289_293_865 181
379 iso_pu_bacteria 2791355137 2792834583 181
380 iso_pu_bacteria 2904615490 2904620484 181
381 3300031691 Ga0316579_10000868 Ga0316579_100008685 182
382 3300031727 Ga0316576_10029816 Ga0316576_100298164 182
383 3300031727 Ga0316576_10643769 Ga0316576_106437692 182
384 3300031728 Ga0316578_10000287 Ga0316578_100002878 182
385 3300031733 Ga0316577_10000452 Ga0316577_1000045211 182
386 3300032133 Ga0316583_10031499 Ga0316583_100314993 182
387 3300032137 Ga0316585_10124359 Ga0316585_101243592 182
388 3300032139 Ga0316580_10014936 Ga0316580_100149363 182
389 3300032168 Ga0316593_10001800 Ga0316593_100018004 182
390 3300033524 Ga0316592_1000185 Ga0316592_10001853 182
391 3300033528 Ga0316588_1001369 Ga0316588_10013694 182
392 3300033541 Ga0316596_1000042 Ga0316596_10000428 182
393 3300035398 Ga0316574_0000074 Ga0316574_0000074_19848_20405 182
394 3300036647 Ga0316582_0000999 Ga0316582_0000999_10044_10601 182
395 3300003316 rootH1_10031982 rootH1_100319822 183
396 3300005618 Ga0068864_100468228 Ga0068864_1004682282 183
397 3300046516 Ga0495628_0236376 Ga0495628_0236376_112_663 183
398 3300046680 Ga0495646_0137730 Ga0495646_0137730_632_1183 183
399 iso_pu_bacteria 2519103095 2519459735 183
400 iso_pu_bacteria 2582581311 2585291313 183
401 iso_pu_bacteria 2599185239 2599739909 183
402 iso_pu_bacteria 2599185240 2599748101 183
403 iso_pu_bacteria 2599185355 2600210029 183
404 iso_pu_bacteria 2675903129 2676746373 183
405 iso_pu_bacteria 2808606384 2808968221 183
406 iso_pu_bacteria 2808606390 2809003052 183
407 iso_pu_bacteria 2808606391 2809010329 183
408 iso_pu_bacteria 2816332253 2817262009 183
409 iso_pu_bacteria 2816332256 2817279727 183
410 iso_pu_bacteria 2816332286 2817453904 183
411 iso_pu_bacteria 2818991452 2819633813 183
412 iso_pu_bacteria 2863421361 2863426979 183
413 iso_pu_bacteria 2870068957 2870070228 183
414 iso_pu_bacteria 2904564687 2904570455 183
415 iso_pu_bacteria 2904571731 2904577632 183
416 iso_pu_bacteria 2928157003 2928161160 183
417 iso_pu_bacteria 2928163908 2928169397 183
418 iso_pu_bacteria 2928170801 2928175575 183
419 iso_pu_bacteria 2928536128 2928542730 183
420 iso_pu_bacteria 2981990288 2981992686 183
421 iso_pu_bacteria 641736154 642416181 183
422 iso_pu_bacteria 8018845410 8018851608 183
423 iso_pu_bacteria 8020807995 8020813328 183
424 iso_pu_bacteria 8020938398 8020945189 183
425 iso_pu_bacteria 8020945358 8020948920 183
426 iso_pu_bacteria 8020953355 8020955726 183
427 iso_pu_bacteria 8021120328 8021125669 183
428 iso_pu_bacteria 8039098773 8039101019 183
429 iso_pu_bacteria 8040167225 8040169764 183
430 iso_pu_bacteria 8040173305 8040178006 183
431 3300001989 JGI24739J22299_10003573 JGI24739J22299_100035732 184
432 3300001990 JGI24737J22298_10011025 JGI24737J22298_100110252 184
433 3300002067 JGI24735J21928_10011323 JGI24735J21928_100113233 184
434 3300002067 JGI24735J21928_10021649 JGI24735J21928_100216492 184
435 3300002075 JGI24738J21930_10000745 JGI24738J21930_100007455 184
436 3300002705 JGI25156J39149_1000571 JGI25156J39149_100057110 184
437 3300002705 JGI25156J39149_1000951 JGI25156J39149_10009514 184
438 3300003214 JGI25165J46597_1001506 JGI25165J46597_10015067 184
439 3300003322 rootL2_10104888 rootL2_101048882 184
440 3300003756 Ga0055533_1000434 Ga0055533_100043410 184
441 3300003756 Ga0055533_1001223 Ga0055533_10012233 184
442 3300003758 Ga0055532_1000177 Ga0055532_10001778 184
443 3300003760 Ga0055527_1000123 Ga0055527_10001238 184
444 3300003761 Ga0055535_1000268 Ga0055535_10002688 184
445 3300003762 Ga0055542_1000304 Ga0055542_10003048 184
446 3300003763 Ga0055529_1000318 Ga0055529_10003188 184
447 3300005339 Ga0070660_100395742 Ga0070660_1003957422 184
448 3300005366 Ga0070659_100026941 Ga0070659_1000269412 184
449 3300005455 Ga0070663_100136554 Ga0070663_1001365542 184
450 3300005468 Ga0070707_101351132 Ga0070707_1013511321 184
451 3300005563 Ga0068855_100002326 Ga0068855_10000232610 184
452 3300009011 Ga0105251_10000298 Ga0105251_1000029823 184
453 3300009093 Ga0105240_10088404 Ga0105240_100884043 184
454 3300009093 Ga0105240_10123642 Ga0105240_101236424 184
455 3300009093 Ga0105240_10158715 Ga0105240_101587152 184
456 3300009551 Ga0105238_10409368 Ga0105238_104093682 184
457 3300010375 Ga0105239_10614792 Ga0105239_106147922 184
458 3300013102 Ga0157371_10043128 Ga0157371_100431282 184
459 3300013104 Ga0157370_10000323 Ga0157370_1000032327 184
460 3300013104 Ga0157370_10131706 Ga0157370_101317062 184
461 3300013105 Ga0157369_10000089 Ga0157369_10000089117 184
462 3300013105 Ga0157369_10000280 Ga0157369_1000028039 184
463 3300013105 Ga0157369_10373347 Ga0157369_103733472 184
464 3300014497 Ga0182008_10148842 Ga0182008_101488422 184
465 3300014497 Ga0182008_10174943 Ga0182008_101749432 184
466 3300016635 Ga0183361_10001 Ga0183361_10001105 184
467 3300020081 Ga0206354_11251663 Ga0206354_112516632 184
468 3300020082 Ga0206353_11289395 Ga0206353_112893952 184
469 3300025225 Ga0209566_103548 Ga0209566_1035482 184
470 3300025226 Ga0209674_100005 Ga0209674_1000051442 184
471 3300025226 Ga0209674_100092 Ga0209674_1000929 184
472 3300025228 Ga0209672_100001 Ga0209672_1000011840 184
473 3300025229 Ga0209147_100001 Ga0209147_1000011840 184
474 3300025230 Ga0209563_101915 Ga0209563_1019156 184
475 3300025231 Ga0207427_101871 Ga0207427_1018714 184
476 3300025242 Ga0209258_100001 Ga0209258_1000011840 184
477 3300025254 Ga0209148_1000003 Ga0209148_10000031840 184
478 3300025256 Ga0209759_1000053 Ga0209759_1000053147 184
479 3300025256 Ga0209759_1000074 Ga0209759_100007475 184
480 3300025256 Ga0209759_1016316 Ga0209759_10163162 184
481 3300025261 Ga0209233_1000204 Ga0209233_100020442 184
482 3300025272 Ga0209455_1000001 Ga0209455_10000011840 184
483 3300025735 Ga0207713_1000612 Ga0207713_100061214 184
484 3300025904 Ga0207647_10018824 Ga0207647_100188244 184
485 3300025909 Ga0207705_10009017 Ga0207705_100090173 184
486 3300025911 Ga0207654_10259136 Ga0207654_102591361 184
487 3300025913 Ga0207695_10261130 Ga0207695_102611302 184
488 3300025913 Ga0207695_10310481 Ga0207695_103104812 184
489 3300025919 Ga0207657_10227078 Ga0207657_102270782 184
490 3300025932 Ga0207690_10025937 Ga0207690_100259373 184
491 3300025941 Ga0207711_10083570 Ga0207711_100835702 184
492 3300025949 Ga0207667_10004312 Ga0207667_100043122 184
493 3300026067 Ga0207678_10163228 Ga0207678_101632282 184
494 3300027312 Ga0209371_1012184 Ga0209371_10121842 184
495 3300028800 Ga0265338_10170388 Ga0265338_101703882 184
496 3300030500 Ga0268256_1013264 Ga0268256_10132642 184
497 3300031911 Ga0307412_10000014 Ga0307412_1000001440 184
498 3300032137 Ga0316585_10059956 Ga0316585_100599561 184
499 3300036712 Ga0316584_0442095 Ga0316584_0442095_121_720 184
500 3300037312 Ga0395899_0000031 Ga0395899_0000031_59980_60537 184
501 3300037312 Ga0395899_0042832 Ga0395899_0042832_84_641 184
502 3300037312 Ga0395899_0058255 Ga0395899_0058255_362_919 184
503 3300037418 Ga0395900_0000158 Ga0395900_0000158_11593_12150 184
504 3300037418 Ga0395900_0006577 Ga0395900_0006577_8422_8979 184
505 3300037418 Ga0395900_0018187 Ga0395900_0018187_5537_6094 184
506 3300037466 Ga0395898_0000040 Ga0395898_0000040_54998_55555 184
507 3300037466 Ga0395898_0003196 Ga0395898_0003196_2578_3135 184
508 3300037466 Ga0395898_0016977 Ga0395898_0016977_3576_4133 184
509 3300038443 Ga0395901_0000002 Ga0395901_0000002_218849_219406 184
510 3300038443 Ga0395901_0000059 Ga0395901_0000059_74401_74958 184
511 3300038443 Ga0395901_0000196 Ga0395901_0000196_32833_33390 184
512 3300038443 Ga0395901_0051787 Ga0395901_0051787_3284_3841 184
513 3300039438 Ga0436360_0835901 Ga0436360_0835901_186_740 184
514 3300044684 Ga0466966_0000271 Ga0466966_0000271_3542_4099 184
515 3300044684 Ga0466966_0000465 Ga0466966_0000465_19587_20144 184
516 3300044684 Ga0466966_0168392 Ga0466966_0168392_53_607 184
517 3300044693 Ga0466961_0000552 Ga0466961_0000552_696_1253 184
518 3300044694 Ga0466963_0004798 Ga0466963_0004798_3408_3965 184
519 3300044719 Ga0466971_0016881 Ga0466971_0016881_73_630 184
520 3300044719 Ga0466971_0209040 Ga0466971_0209040_345_902 184
521 3300044842 Ga0466957_0012884 Ga0466957_0012884_3572_4129 184
522 3300044842 Ga0466957_0024533 Ga0466957_0024533_1932_2489 184
523 3300044842 Ga0466957_0576827 Ga0466957_0576827_40_594 184
524 3300045049 Ga0466959_0003757 Ga0466959_0003757_2189_2746 184
525 3300045049 Ga0466959_0297290 Ga0466959_0297290_394_951 184
526 3300045836 Ga0466958_0000134 Ga0466958_0000134_21812_22369 184
527 3300045836 Ga0466958_0016502 Ga0466958_0016502_759_1316 184
528 3300045836 Ga0466958_0107714 Ga0466958_0107714_954_1511 184
529 3300045976 Ga0466967_0194921 Ga0466967_0194921_850_1407 184
530 3300045976 Ga0466967_0211233 Ga0466967_0211233_570_1127 184
531 3300046454 Ga0495592_0001159 Ga0495592_0001159_9789_10343 184
532 3300046454 Ga0495592_0038803 Ga0495592_0038803_1813_2367 184
533 3300046454 Ga0495592_0145136 Ga0495592_0145136_203_757 184
534 3300046455 Ga0495603_0167400 Ga0495603_0167400_571_1125 184
535 3300046455 Ga0495603_0293811 Ga0495603_0293811_317_871 184
536 3300046457 Ga0495590_0011142 Ga0495590_0011142_666_1220 184
537 3300046457 Ga0495590_0026463 Ga0495590_0026463_715_1269 184
538 3300046458 Ga0495591_000961 Ga0495591_000961_11447_12001 184
539 3300046459 Ga0495629_0000147 Ga0495629_0000147_23969_24523 184
540 3300046459 Ga0495629_0003838 Ga0495629_0003838_3387_3941 184
541 3300046459 Ga0495629_0008409 Ga0495629_0008409_6655_7209 184
542 3300046459 Ga0495629_0027982 Ga0495629_0027982_3286_3840 184
543 3300046460 Ga0495638_0011209 Ga0495638_0011209_958_1512 184
544 3300046461 Ga0495641_0052781 Ga0495641_0052781_1105_1659 184
545 3300046461 Ga0495641_0126250 Ga0495641_0126250_385_939 184
546 3300046462 Ga0495651_0000955 Ga0495651_0000955_17709_18263 184
547 3300046462 Ga0495651_0117189 Ga0495651_0117189_219_773 184
548 3300046462 Ga0495651_0139799 Ga0495651_0139799_662_1216 184
549 3300046463 Ga0495653_0000355 Ga0495653_0000355_8323_8877 184
550 3300046463 Ga0495653_0174570 Ga0495653_0174570_804_1358 184
551 3300046463 Ga0495653_0259491 Ga0495653_0259491_574_1128 184
552 3300046463 Ga0495653_0557342 Ga0495653_0557342_20_574 184
553 3300046463 Ga0495653_0644420 Ga0495653_0644420_68_622 184
554 3300046471 Ga0495650_0001394 Ga0495650_0001394_6031_6585 184
555 3300046471 Ga0495650_0008493 Ga0495650_0008493_4762_5316 184
556 3300046471 Ga0495650_0027190 Ga0495650_0027190_1015_1569 184
557 3300046471 Ga0495650_0046169 Ga0495650_0046169_900_1454 184
558 3300046471 Ga0495650_0246766 Ga0495650_0246766_11_565 184
559 3300046472 Ga0495580_0000541 Ga0495580_0000541_25362_25916 184
560 3300046472 Ga0495580_0000912 Ga0495580_0000912_18647_19201 184
561 3300046472 Ga0495580_0002115 Ga0495580_0002115_14207_14761 184
562 3300046472 Ga0495580_0006853 Ga0495580_0006853_2312_2866 184
563 3300046472 Ga0495580_0024558 Ga0495580_0024558_3685_4239 184
564 3300046472 Ga0495580_0286378 Ga0495580_0286378_38_592 184
565 3300046473 Ga0495582_0001753 Ga0495582_0001753_9827_10381 184
566 3300046473 Ga0495582_0014292 Ga0495582_0014292_1270_1824 184
567 3300046473 Ga0495582_0050896 Ga0495582_0050896_376_930 184
568 3300046474 Ga0495605_0020730 Ga0495605_0020730_577_1131 184
569 3300046474 Ga0495605_0035003 Ga0495605_0035003_992_1546 184
570 3300046476 Ga0495662_0057213 Ga0495662_0057213_410_964 184
571 3300046476 Ga0495662_0093675 Ga0495662_0093675_265_819 184
572 3300046477 Ga0495664_0011112 Ga0495664_0011112_2948_3502 184
573 3300046477 Ga0495664_0037595 Ga0495664_0037595_1680_2234 184
574 3300046499 Ga0495594_0364728 Ga0495594_0364728_120_674 184
575 3300046500 Ga0495596_0000982 Ga0495596_0000982_16173_16727 184
576 3300046500 Ga0495596_0013170 Ga0495596_0013170_364_918 184
577 3300046500 Ga0495596_0015181 Ga0495596_0015181_1931_2485 184
578 3300046500 Ga0495596_0077853 Ga0495596_0077853_496_1050 184
579 3300046506 Ga0495583_0003596 Ga0495583_0003596_5966_6520 184
580 3300046507 Ga0495606_0218575 Ga0495606_0218575_46_600 184
581 3300046511 Ga0495608_0000869 Ga0495608_0000869_19796_20350 184
582 3300046511 Ga0495608_0006410 Ga0495608_0006410_7201_7755 184
583 3300046512 Ga0495610_0005866 Ga0495610_0005866_699_1253 184
584 3300046514 Ga0495618_0004312 Ga0495618_0004312_6201_6755 184
585 3300046514 Ga0495618_0011962 Ga0495618_0011962_2018_2572 184
586 3300046514 Ga0495618_0029276 Ga0495618_0029276_40_594 184
587 3300046514 Ga0495618_0064048 Ga0495618_0064048_863_1417 184
588 3300046515 Ga0495620_0015676 Ga0495620_0015676_2468_3022 184
589 3300046515 Ga0495620_0082926 Ga0495620_0082926_324_878 184
590 3300046516 Ga0495628_0025593 Ga0495628_0025593_571_1125 184
591 3300046516 Ga0495628_0027989 Ga0495628_0027989_3563_4117 184
592 3300046516 Ga0495628_0060537 Ga0495628_0060537_662_1216 184
593 3300046516 Ga0495628_0093840 Ga0495628_0093840_882_1436 184
594 3300046516 Ga0495628_0171730 Ga0495628_0171730_807_1361 184
595 3300046517 Ga0495630_0008073 Ga0495630_0008073_616_1170 184
596 3300046517 Ga0495630_0009649 Ga0495630_0009649_969_1523 184
597 3300046517 Ga0495630_0067609 Ga0495630_0067609_1214_1768 184
598 3300046517 Ga0495630_0584111 Ga0495630_0584111_253_807 184
599 3300046519 Ga0495632_0198053 Ga0495632_0198053_91_645 184
600 3300046522 Ga0495643_0052370 Ga0495643_0052370_818_1372 184
601 3300046524 Ga0495648_0020557 Ga0495648_0020557_763_1317 184
602 3300046524 Ga0495648_0035144 Ga0495648_0035144_1784_2338 184
603 3300046524 Ga0495648_0043923 Ga0495648_0043923_1958_2512 184
604 3300046526 Ga0495666_0000266 Ga0495666_0000266_21196_21750 184
605 3300046526 Ga0495666_0003295 Ga0495666_0003295_6729_7283 184
606 3300046526 Ga0495666_0033743 Ga0495666_0033743_481_1035 184
607 3300046526 Ga0495666_0047506 Ga0495666_0047506_1235_1789 184
608 3300046528 Ga0495642_0170941 Ga0495642_0170941_104_658 184
609 3300046529 Ga0495652_0029801 Ga0495652_0029801_3157_3711 184
610 3300046529 Ga0495652_0041513 Ga0495652_0041513_255_809 184
611 3300046529 Ga0495652_0070444 Ga0495652_0070444_2318_2872 184
612 3300046530 Ga0495654_0157719 Ga0495654_0157719_234_788 184
613 3300046531 Ga0495665_0005766 Ga0495665_0005766_5257_5811 184
614 3300046531 Ga0495665_0034674 Ga0495665_0034674_1519_2073 184
615 3300046531 Ga0495665_0034894 Ga0495665_0034894_422_976 184
616 3300046531 Ga0495665_0096157 Ga0495665_0096157_686_1240 184
617 3300046533 Ga0495640_0004554 Ga0495640_0004554_5175_5729 184
618 3300046533 Ga0495640_0029879 Ga0495640_0029879_2375_2929 184
619 3300046533 Ga0495640_0058885 Ga0495640_0058885_1731_2285 184
620 3300046535 Ga0495586_0005854 Ga0495586_0005854_5761_6315 184
621 3300046535 Ga0495586_0072791 Ga0495586_0072791_1126_1680 184
622 3300046535 Ga0495586_0132550 Ga0495586_0132550_238_792 184
623 3300046536 Ga0495587_0002232 Ga0495587_0002232_6081_6635 184
624 3300046536 Ga0495587_0002649 Ga0495587_0002649_6138_6692 184
625 3300046536 Ga0495587_0294681 Ga0495587_0294681_37_591 184
626 3300046538 Ga0495609_0043956 Ga0495609_0043956_1357_1911 184
627 3300046542 Ga0495597_0049239 Ga0495597_0049239_651_1205 184
628 3300046543 Ga0495645_0054557 Ga0495645_0054557_1759_2313 184
629 3300046557 Ga0495622_0002432 Ga0495622_0002432_6972_7526 184
630 3300046559 Ga0495667_0049295 Ga0495667_0049295_1728_2282 184
631 3300046559 Ga0495667_0153351 Ga0495667_0153351_249_803 184
632 3300046616 Ga0495668_0292950 Ga0495668_0292950_149_703 184
633 3300046642 Ga0495634_0011146 Ga0495634_0011146_592_1146 184
634 3300046642 Ga0495634_0016716 Ga0495634_0016716_4361_4915 184
635 3300046642 Ga0495634_0059012 Ga0495634_0059012_1050_1604 184
636 3300046648 Ga0495611_0026130 Ga0495611_0026130_754_1308 184
637 3300046648 Ga0495611_0039779 Ga0495611_0039779_1002_1556 184
638 3300046660 Ga0495625_0067430 Ga0495625_0067430_996_1550 184
639 3300046663 Ga0495635_0002508 Ga0495635_0002508_5398_5952 184
640 3300046663 Ga0495635_0007855 Ga0495635_0007855_100_654 184
641 3300046663 Ga0495635_0126161 Ga0495635_0126161_254_808 184
642 3300046665 Ga0495661_0006883 Ga0495661_0006883_6340_6894 184
643 3300046665 Ga0495661_0027877 Ga0495661_0027877_398_952 184
644 3300046665 Ga0495661_0053466 Ga0495661_0053466_1168_1722 184
645 3300046674 Ga0495588_0037475 Ga0495588_0037475_1646_2200 184
646 3300046675 Ga0495657_0041820 Ga0495657_0041820_1026_1580 184
647 3300046675 Ga0495657_0044901 Ga0495657_0044901_1506_2060 184
648 3300046678 Ga0495599_0022115 Ga0495599_0022115_1989_2543 184
649 3300046678 Ga0495599_0486585 Ga0495599_0486585_93_647 184
650 3300046679 Ga0495623_0002158 Ga0495623_0002158_10501_11055 184
651 3300046679 Ga0495623_0104906 Ga0495623_0104906_43_597 184
652 3300046679 Ga0495623_0186666 Ga0495623_0186666_493_1047 184
653 3300046680 Ga0495646_0002595 Ga0495646_0002595_4259_4813 184
654 3300046680 Ga0495646_0003268 Ga0495646_0003268_3052_3606 184
655 3300046680 Ga0495646_0023036 Ga0495646_0023036_3122_3676 184
656 3300046680 Ga0495646_0028757 Ga0495646_0028757_2012_2566 184
657 3300046680 Ga0495646_0137019 Ga0495646_0137019_100_654 184
658 3300046684 Ga0495669_0075172 Ga0495669_0075172_611_1165 184
659 3300046689 Ga0495613_0026567 Ga0495613_0026567_482_1036 184
660 3300046689 Ga0495613_0161515 Ga0495613_0161515_121_675 184
661 3300046689 Ga0495613_0342540 Ga0495613_0342540_27_581 184
662 3300046690 Ga0495624_0004472 Ga0495624_0004472_8408_8962 184
663 3300046690 Ga0495624_0011607 Ga0495624_0011607_3980_4534 184
664 3300046690 Ga0495624_0014820 Ga0495624_0014820_4007_4561 184
665 3300046690 Ga0495624_0034815 Ga0495624_0034815_1182_1736 184
666 3300046690 Ga0495624_0054474 Ga0495624_0054474_1475_2029 184
667 3300046692 Ga0495671_0086235 Ga0495671_0086235_720_1274 184
668 3300046694 Ga0495649_0058452 Ga0495649_0058452_567_1121 184
669 3300046694 Ga0495649_0062548 Ga0495649_0062548_822_1376 184
670 3300046694 Ga0495649_0205208 Ga0495649_0205208_425_979 184
671 3300046794 Ga0495589_0001698 Ga0495589_0001698_5040_5594 184
672 3300046794 Ga0495589_0074709 Ga0495589_0074709_434_988 184
673 3300046794 Ga0495589_0109009 Ga0495589_0109009_169_723 184
674 3300046809 Ga0495600_0014180 Ga0495600_0014180_4057_4611 184
675 3300046809 Ga0495600_0036521 Ga0495600_0036521_1235_1789 184
676 3300046809 Ga0495600_0370684 Ga0495600_0370684_70_624 184
677 3300046810 Ga0495660_0065446 Ga0495660_0065446_616_1170 184
678 3300047315 Ga0495581_0021485 Ga0495581_0021485_2853_3407 184
679 3300047317 Ga0495604_0051457 Ga0495604_0051457_1687_2241 184
680 3300047317 Ga0495604_0092279 Ga0495604_0092279_624_1178 184
681 3300047317 Ga0495604_0156072 Ga0495604_0156072_212_766 184
682 3300047317 Ga0495604_0263095 Ga0495604_0263095_51_605 184
683 3300047319 Ga0495674_0026860 Ga0495674_0026860_707_1261 184
684 3300047319 Ga0495674_0220553 Ga0495674_0220553_62_616 184
685 3300047320 Ga0495672_0050089 Ga0495672_0050089_1638_2192 184
686 3300047320 Ga0495672_0132827 Ga0495672_0132827_550_1104 184
687 3300047321 Ga0495676_0023757 Ga0495676_0023757_1055_1609 184
688 3300047322 Ga0495680_0034791 Ga0495680_0034791_1187_1741 184
689 3300047322 Ga0495680_0059708 Ga0495680_0059708_1309_1863 184
690 3300047322 Ga0495680_0119103 Ga0495680_0119103_1248_1802 184
691 3300047323 Ga0495683_0008360 Ga0495683_0008360_2799_3353 184
692 3300047323 Ga0495683_0016402 Ga0495683_0016402_1013_1567 184
693 3300047323 Ga0495683_0036102 Ga0495683_0036102_1933_2487 184
694 3300047443 Ga0495687_003598 Ga0495687_003598_1923_2477 184
695 3300047443 Ga0495687_019609 Ga0495687_019609_1700_2254 184
696 3300047443 Ga0495687_023030 Ga0495687_023030_1744_2298 184
697 3300047444 Ga0495675_0033433 Ga0495675_0033433_872_1426 184
698 3300047444 Ga0495675_0559502 Ga0495675_0559502_11_565 184
699 3300047446 Ga0495679_000007 Ga0495679_000007_13674_14228 184
700 3300047446 Ga0495679_000777 Ga0495679_000777_11067_11621 184
701 3300047446 Ga0495679_001594 Ga0495679_001594_6111_6665 184
702 3300047471 Ga0495684_0031855 Ga0495684_0031855_1039_1593 184
703 3300047471 Ga0495684_0097697 Ga0495684_0097697_868_1422 184
704 3300047472 Ga0495686_0041678 Ga0495686_0041678_637_1191 184
705 3300047673 Ga0495593_0001969 Ga0495593_0001969_9661_10215 184
706 3300047673 Ga0495593_0051260 Ga0495593_0051260_679_1233 184
707 3300048088 Ga0495602_0046894 Ga0495602_0046894_1146_1700 184
708 3300048088 Ga0495602_0108452 Ga0495602_0108452_346_900 184
709 3300048088 Ga0495602_0113357 Ga0495602_0113357_283_837 184
710 3300048088 Ga0495602_0136196 Ga0495602_0136196_1248_1802 184
711 3300048088 Ga0495602_0308502 Ga0495602_0308502_35_589 184
712 3300048089 Ga0495614_0004727 Ga0495614_0004727_3577_4131 184
713 3300048089 Ga0495614_0010107 Ga0495614_0010107_1172_1726 184
714 3300048089 Ga0495614_0015034 Ga0495614_0015034_858_1412 184
715 3300048091 Ga0495626_0016381 Ga0495626_0016381_2207_2761 184
716 3300048091 Ga0495626_0027635 Ga0495626_0027635_1850_2404 184
717 3300048905 Ga0496102_0037779 Ga0496102_0037779_1391_1945 184
718 3300048905 Ga0496102_1236989 Ga0496102_1236989_61_618 184
719 3300048906 Ga0496103_0006243 Ga0496103_0006243_402_956 184
720 3300048907 Ga0496104_0572575 Ga0496104_0572575_326_880 184
721 3300048919 Ga0496116_0092416 Ga0496116_0092416_1168_1722 184
722 3300048919 Ga0496116_0159197 Ga0496116_0159197_16_573 184
723 3300048919 Ga0496116_0187770 Ga0496116_0187770_292_846 184
724 3300048920 Ga0496117_0005194 Ga0496117_0005194_1375_1929 184
725 3300048920 Ga0496117_0029092 Ga0496117_0029092_1413_1967 184
726 3300048920 Ga0496117_0055022 Ga0496117_0055022_1875_2429 184
727 3300048920 Ga0496117_0094191 Ga0496117_0094191_561_1118 184
728 3300048921 Ga0496118_0000282 Ga0496118_0000282_42641_43195 184
729 3300048921 Ga0496118_0002992 Ga0496118_0002992_7753_8307 184
730 3300048921 Ga0496118_0068145 Ga0496118_0068145_1875_2429 184
731 3300048921 Ga0496118_0123823 Ga0496118_0123823_592_1146 184
732 3300048921 Ga0496118_0312544 Ga0496118_0312544_191_748 184
733 3300048924 Ga0496121_0051751 Ga0496121_0051751_2231_2785 184
734 3300048924 Ga0496121_0468271 Ga0496121_0468271_155_709 184
735 3300048929 Ga0496126_0001519 Ga0496126_0001519_34920_35474 184
736 3300048929 Ga0496126_0524237 Ga0496126_0524237_146_703 184
737 3300049459 Ga0495678_033374 Ga0495678_033374_918_1472 184
738 3300049459 Ga0495678_037703 Ga0495678_037703_135_689 184
739 3300049460 Ga0495682_0049331 Ga0495682_0049331_730_1284 184
740 3300061719 Ga0466962_0002291 Ga0466962_0002291_2221_2778 184
741 3300061719 Ga0466962_0042464 Ga0466962_0042464_1152_1709 184
742 3300046501 Ga0495607_0028850 Ga0495607_0028850_1647_2234 185
743 3300001915 JGI24741J21665_1014130 JGI24741J21665_10141302 187
744 3300001979 JGI24740J21852_10012152 JGI24740J21852_100121522 187
745 3300001989 JGI24739J22299_10047384 JGI24739J22299_100473842 187
746 3300002067 JGI24735J21928_10031743 JGI24735J21928_100317432 187
747 3300003320 rootH2_10010622 rootH2_100106222 187
748 3300003758 Ga0055532_1005023 Ga0055532_10050232 187
749 3300003760 Ga0055527_1001412 Ga0055527_10014123 187
750 3300003760 Ga0055527_1001426 Ga0055527_10014263 187
751 3300003761 Ga0055535_1003049 Ga0055535_10030493 187
752 3300003761 Ga0055535_1003076 Ga0055535_10030763 187
753 3300003762 Ga0055542_1002898 Ga0055542_10028983 187
754 3300003762 Ga0055542_1002917 Ga0055542_10029173 187
755 3300003763 Ga0055529_1000561 Ga0055529_100056114 187
756 3300003763 Ga0055529_1008936 Ga0055529_10089362 187
757 3300003790 Ga0055528_1002578 Ga0055528_10025785 187
758 3300003856 Ga0058692_1002896 Ga0058692_10028965 187
759 3300005339 Ga0070660_100000021 Ga0070660_10000002116 187
760 3300005344 Ga0070661_100341453 Ga0070661_1003414532 187
761 3300005366 Ga0070659_100000061 Ga0070659_10000006178 187
762 3300005455 Ga0070663_100000360 Ga0070663_1000003603 187
763 3300005535 Ga0070684_100230246 Ga0070684_1002302462 187
764 3300005563 Ga0068855_100046274 Ga0068855_1000462745 187
765 3300005616 Ga0068852_100000618 Ga0068852_10000061819 187
766 3300005842 Ga0068858_100191791 Ga0068858_1001917912 187
767 3300009092 Ga0105250_10022197 Ga0105250_100221972 187
768 3300009093 Ga0105240_10154445 Ga0105240_101544452 187
769 3300009093 Ga0105240_10409570 Ga0105240_104095702 187
770 3300009545 Ga0105237_10169266 Ga0105237_101692662 187
771 3300009551 Ga0105238_10020534 Ga0105238_100205344 187
772 3300010375 Ga0105239_10015271 Ga0105239_100152714 187
773 3300015265 Ga0182005_1022121 Ga0182005_10221212 187
774 3300025225 Ga0209566_100212 Ga0209566_10021247 187
775 3300025228 Ga0209672_100046 Ga0209672_100046183 187
776 3300025228 Ga0209672_100047 Ga0209672_100047166 187
777 3300025229 Ga0209147_100043 Ga0209147_10004381 187
778 3300025229 Ga0209147_100059 Ga0209147_100059166 187
779 3300025229 Ga0209147_100172 Ga0209147_10017211 187
780 3300025242 Ga0209258_100023 Ga0209258_100023281 187
781 3300025242 Ga0209258_100172 Ga0209258_10017264 187
782 3300025254 Ga0209148_1000029 Ga0209148_1000029347 187
783 3300025254 Ga0209148_1000353 Ga0209148_100035336 187
784 3300025254 Ga0209148_1002928 Ga0209148_10029284 187
785 3300025256 Ga0209759_1006543 Ga0209759_10065433 187
786 3300025263 Ga0209565_1004426 Ga0209565_10044263 187
787 3300025272 Ga0209455_1000064 Ga0209455_100006476 187
788 3300025272 Ga0209455_1001734 Ga0209455_10017349 187
789 3300025273 Ga0209673_1000115 Ga0209673_100011599 187
790 3300025295 Ga0209564_1012724 Ga0209564_10127242 187
791 3300025711 Ga0207696_1015815 Ga0207696_10158152 187
792 3300025904 Ga0207647_10007911 Ga0207647_100079115 187
793 3300025913 Ga0207695_10014762 Ga0207695_100147623 187
794 3300025913 Ga0207695_10026553 Ga0207695_100265532 187
795 3300025919 Ga0207657_10000008 Ga0207657_1000000897 187
796 3300025920 Ga0207649_10118121 Ga0207649_101181213 187
797 3300025924 Ga0207694_10011555 Ga0207694_100115555 187
798 3300025932 Ga0207690_10000013 Ga0207690_1000001375 187
799 3300025949 Ga0207667_10020307 Ga0207667_100203075 187
800 3300026041 Ga0207639_10205559 Ga0207639_102055592 187
801 3300026067 Ga0207678_10000363 Ga0207678_1000036312 187
802 3300026078 Ga0207702_10218111 Ga0207702_102181112 187
803 3300026116 Ga0207674_10210042 Ga0207674_102100422 187
804 3300026142 Ga0207698_10003281 Ga0207698_100032814 187
805 3300027312 Ga0209371_1000065 Ga0209371_100006557 187
806 3300030500 Ga0268256_1000118 Ga0268256_100011857 187
807 3300039437 Ga0436365_1461145 Ga0436365_1461145_956_1519 187
808 3300044656 Ga0466969_0016591 Ga0466969_0016591_1184_1777 187
809 3300044666 Ga0466977_0000619 Ga0466977_0000619_4117_4710 187
810 3300046471 Ga0495650_0079938 Ga0495650_0079938_31_594 187
811 3300046516 Ga0495628_0008297 Ga0495628_0008297_4851_5414 187
812 3300047472 Ga0495686_0000014 Ga0495686_0000014_412251_412814 187
813 3300048920 Ga0496117_0026344 Ga0496117_0026344_1977_2540 187
814 3300048921 Ga0496118_0015903 Ga0496118_0015903_4360_4923 187
815 3300048929 Ga0496126_0000061 Ga0496126_0000061_46546_47121 187

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13242

Hydrolase_like

HAD-hyrolase-like

122

195

0.97

PF13419

HAD_2

Haloacid dehalogenase-like hydrolase

117

168

0.91

PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

12

162

0.8

PF08645

PNK3P

Polynucleotide kinase 3 phosphatase

26

158

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
3l8h-assembly4.cif.gz_D crystal structure of d,d-heptose 1.7-bisphosphate phosphatase from b. bronchiseptica complexed with magnesium and phosphate 0.9951 8 184
3l8h-assembly4.cif.gz_D crystal structure of d,d-heptose 1.7-bisphosphate phosphatase from b. bronchiseptica complexed with magnesium and phosphate 0.9786 8 184
4pnh-assembly1.cif.gz_A crystal structure of d,d-heptose 1,7-bisphosphate phosphatase from burkholderia thailandensis 0.939 8 183
4pnh-assembly1.cif.gz_A crystal structure of d,d-heptose 1,7-bisphosphate phosphatase from burkholderia thailandensis 0.9216 8 183
2fps-assembly1.cif.gz_B crystal structure of the n-terminal domain of e.coli hisb- apo ca model. 0.8805 8 145
ID Description Score Start End Superfamily
3l8hD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.993 8 184 3.40.50.1000
3l8hD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9817 8 184 3.40.50.1000
4jyrA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9383 8 183 3.40.50.1000
4jyrA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.921 8 183 3.40.50.1000
af_P9WMV3_2_164_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9183 4 145 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A103RRL9-F1-model_v4 D,D-heptose 1,7-bisphosphate phosphatase 1.002 30 187 GO:0005737
GO:0005975
GO:0016791
GO:0046872
AF-A0A3D2R1F9-F1-model_v4 D-glycero-beta-D-manno-heptose-1,7-bisphosphate 7-phosphatase 1.001 8 96 GO:0005975
GO:0016791
AF-A0A3B0Z8E0-F1-model_v4 D,D-heptose 1,7-bisphosphate phosphatase 0.9991 8 114 GO:0005737
GO:0005975
GO:0016791
AF-A0A7W8M8T6-F1-model_v4 D,D-heptose 1,7-bisphosphate phosphatase (EC 3.1.3.-) 0.999 8 181 GO:0005737
GO:0005975
GO:0034200
GO:0046872
AF-A0A1I9YHL5-F1-model_v4 D,D-heptose 1,7-bisphosphate phosphatase (EC 3.1.3.-) 0.9988 5 187 GO:0005737
GO:0005975
GO:0016791
GO:0046872

Feature Viewer

pLDDT pTM Quality
93.43 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map