F482003

General Info

Members Datasets Scaffolds Average Seq Length
814 411 747 328

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2969079654|2969082261
Length 382
Sequence IKLFMFQSGTQHCRYQHIRMNQGVGEHYEIPVPWFLLTHPDGFTLIDGGLAVEGLKDPSGYWGSTVSALGLGCMGLSHGYGPATDTRQAIELIRAGVERGVTFFDTAEVYGPYLNEEVVGEALKPLRERVVIATKFGFTFGNDNRQQILNSRPSHIREAVEGSLRRLKTDVIDLLYQHRVDPDVPIEDVAGTVKDLIAEGKVKHFGLSEAGAQTIRRAHAIQPVAALQSEYSMWWREPEQEILPLLEELGIGFVPFSPLGKGFLTGTIRAGSTFGEDDFRSKVPRFAAQALEANEKLVSLISVIAAENRVTPAQIALAWLLAQKPWIVPIPGTTKLHRLEENLAAAEIQLSPGELEKISRALETVKILGERYPAALQARVGR

Samples

Sample ID Description Type Environment
1 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
2 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
3 2511231004 Pseudomonas sp. GM102 Isolate Nodule
4 2511231023 Pseudomonas sp. GM80 Isolate Nodule
5 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
6 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
7 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
8 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
9 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
10 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
11 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
12 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
13 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
14 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
15 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
16 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
17 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
18 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
19 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
20 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
21 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
22 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
23 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
24 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
25 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
26 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
27 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
28 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
29 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
30 2636415599 Klebsiella variicola DX120E Isolate Unclassified
31 2643221599 Rhizobium sp. Root708 Isolate Unclassified
32 2643221615 Nocardioides sp. Root224 Isolate Unclassified
33 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
34 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
35 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
36 2739367756 Asticcacaulis sp. CF398 Isolate Unclassified
37 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
38 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
39 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
40 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
41 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
42 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
43 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
44 2857564685 Duganella sp. R-74599 Isolate Unclassified
45 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
46 2865014394 Pantoea sp. R-71966 Isolate Unclassified
47 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
48 2889415604 Paludisphaera rhizosphaerae JC665 Isolate Rhizosphere
49 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
50 2904504865 Serratia marcescens 1822 Isolate Unclassified
51 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
52 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
53 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
54 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
55 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
56 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
57 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
58 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
59 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
60 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
61 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
62 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
64 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
65 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
66 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
67 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
68 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
69 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
70 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
71 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
72 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
73 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
74 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
75 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
76 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
77 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
78 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
79 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
80 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
81 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
82 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
83 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
84 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
85 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
86 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
87 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
88 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
89 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
90 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
91 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
92 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
93 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
94 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
95 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
96 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
97 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
98 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
99 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
100 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
101 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
102 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
103 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
104 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
105 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
106 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
107 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
108 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
109 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
110 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
111 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
112 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
113 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
114 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
115 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
116 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
117 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
118 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
119 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
120 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
121 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
122 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
123 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
124 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
125 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
126 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
127 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
128 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
129 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
130 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
131 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
132 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
133 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
134 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
135 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
136 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
137 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
138 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
139 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
140 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
141 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
142 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
143 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
144 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
145 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
146 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
147 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
148 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
149 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
150 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
151 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
152 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
153 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
154 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
155 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
156 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
157 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
158 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
159 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
160 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
161 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
162 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
163 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
164 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
167 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
169 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
170 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
171 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
172 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
173 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
174 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
175 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
176 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
177 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
178 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
179 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
180 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
181 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
223 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
224 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
225 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
226 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
229 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
230 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
231 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
232 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
233 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
234 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
235 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
236 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
237 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
238 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
239 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
240 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
241 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
242 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
243 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
244 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
245 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
246 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
247 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
248 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
249 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
250 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
251 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
252 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
253 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
254 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
255 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
256 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
257 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
258 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
259 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
260 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
261 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
262 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
263 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
264 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
265 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
266 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
267 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
268 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
269 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
270 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
271 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
272 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
273 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
274 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
275 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
276 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
277 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
278 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
279 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
280 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
281 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
282 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
283 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
284 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
285 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
286 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
287 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
288 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
289 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
290 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
291 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
292 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
293 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
294 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
295 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
296 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
297 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
298 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
299 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
300 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
301 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
302 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
303 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
304 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
305 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
306 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
307 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
308 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
309 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
310 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
311 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
312 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
313 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
314 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
315 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
316 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
317 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
318 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
319 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
320 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
321 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
322 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
323 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
324 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
325 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
326 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
327 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
328 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
329 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
330 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
331 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
332 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
333 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
334 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
335 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
336 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
337 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
338 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
339 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
340 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
341 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
342 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
343 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
344 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
345 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
346 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
347 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
348 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
349 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
350 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
351 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
352 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
353 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
354 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
355 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
356 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
357 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
358 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
359 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
360 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
361 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
362 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
363 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
364 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
365 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
366 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
367 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
368 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
369 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
370 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
371 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
372 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
373 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
374 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
375 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
376 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
377 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
378 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
379 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
380 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
381 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
382 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
383 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
384 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
385 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
386 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
387 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
388 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
389 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
390 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
391 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
392 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
393 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
394 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
395 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
396 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
397 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
398 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
399 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
400 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
401 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
402 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
403 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
404 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
405 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
406 8018176218 Rhizobium sp. N122 Isolate Nodule
407 8018221730 Enterobacter sp. CM29 Isolate Unclassified
408 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
409 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
410 8055693939 Hafnia alvei A23BA Isolate Rhizosphere
411 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.77
Metatranscriptomes 0
Isolates 8.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.86
Nodule 1.47
Rhizoplane 6.39
Rhizosphere 76.17
Stem 0
Stem Tuber 0
Unclassified 8.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10011974 3300002067 Bacteria 2744
2 JGI24735J21928_10017115 3300002067 Bacteria 2243
3 JGI25162J39368_1000002 3300002737 Bacteria 663004
4 JGI25163J39215_1000043 3300002771 Bacteria 55468
5 JGI25164J39214_1000066 3300002772 Bacteria 106367
6 JGI25406J46586_10001789 3300003203 Bacteria 10099
7 JGI25406J46586_10026758 3300003203 Bacteria 2219
8 Ga0055538_1000003 3300003751 Bacteria 663004
9 Ga0055539_1000003 3300003752 Bacteria 663004
10 Ga0055539_1000836 3300003752 Bacteria 7216
11 Ga0055533_1000005 3300003756 Bacteria 663004
12 Ga0055533_1007646 3300003756 Bacteria 1448
13 Ga0055525_1000005 3300003759 Bacteria 663004
14 Ga0055527_1000037 3300003760 Bacteria 124590
15 Ga0055535_1000059 3300003761 Bacteria 124595
16 Ga0055542_1000086 3300003762 Bacteria 124594
17 Ga0055529_1000231 3300003763 Bacteria 70928
18 Ga0055540_1019204 3300003792 Bacteria 1847
19 Ga0055531_10049763 3300003794 Bacteria 1116
20 Ga0055541_1000003 3300003841 Bacteria 663004
21 Ga0058692_1001201 3300003856 Bacteria 9924
22 Ga0058692_1009243 3300003856 Bacteria 2497
23 Ga0065704_10003190 3300005289 Bacteria 4277
24 Ga0065704_10190575 3300005289 Bacteria 1184
25 Ga0070658_10041386 3300005327 Bacteria 3717
26 Ga0070683_100142390 3300005329 Unclassified 2272
27 Ga0070690_100279182 3300005330 Bacteria 1191
28 Ga0070670_100146788 3300005331 Bacteria 2041
29 Ga0070666_10000003 3300005335 Bacteria 463666
30 Ga0070666_10154762 3300005335 Bacteria 1600
31 Ga0070682_100083490 3300005337 Bacteria 2073
32 Ga0070689_100007811 3300005340 Bacteria 7495
33 Ga0070689_100008890 3300005340 Bacteria 7101
34 Ga0070687_100209289 3300005343 Bacteria 1187
35 Ga0070661_100018950 3300005344 Bacteria 4901
36 Ga0070671_100092107 3300005355 Bacteria 2539
37 Ga0070671_100284442 3300005355 Bacteria 1407
38 Ga0070673_100040702 3300005364 Bacteria 3567
39 Ga0070714_100019059 3300005435 Bacteria 5583
40 Ga0070714_100049176 3300005435 Bacteria 3589
41 Ga0070714_100054675 3300005435 Bacteria 3411
42 Ga0070713_100000524 3300005436 Bacteria 24320
43 Ga0070713_100272651 3300005436 Bacteria 1550
44 Ga0070711_100108597 3300005439 Bacteria 2033
45 Ga0070700_100058445 3300005441 Bacteria 2423
46 Ga0070708_100288993 3300005445 Bacteria 1543
47 Ga0070663_100006248 3300005455 Bacteria 7142
48 Ga0070663_100024663 3300005455 Bacteria 4052
49 Ga0070681_10028764 3300005458 Bacteria 5586
50 Ga0070685_10042375 3300005466 Bacteria 2598
51 Ga0070685_10062077 3300005466 Bacteria 2190
52 Ga0070706_100161445 3300005467 Bacteria 2093
53 Ga0070706_100301189 3300005467 Bacteria 1496
54 Ga0070707_100258966 3300005468 Bacteria 1692
55 Ga0070707_100541745 3300005468 Bacteria 1126
56 Ga0070699_100229057 3300005518 Bacteria 1657
57 Ga0070679_100191321 3300005530 Bacteria 2015
58 Ga0070684_100040485 3300005535 Bacteria 4013
59 Ga0070684_100182823 3300005535 Bacteria 1906
60 Ga0068853_100000635 3300005539 Bacteria 24029
61 Ga0070696_100004816 3300005546 Bacteria 9020
62 Ga0070696_100034637 3300005546 Bacteria 3475
63 Ga0070693_100008068 3300005547 Bacteria 5170
64 Ga0070665_100027074 3300005548 Bacteria 5774
65 Ga0070665_100065899 3300005548 Bacteria 3632
66 Ga0070704_100038993 3300005549 Bacteria 3259
67 Ga0070704_100182506 3300005549 Bacteria 1680
68 Ga0068855_100004022 3300005563 Bacteria 17947
69 Ga0068855_100012713 3300005563 Bacteria 10153
70 Ga0070664_100059919 3300005564 Bacteria 3240
71 Ga0068857_100016940 3300005577 Bacteria 6385
72 Ga0068854_100014963 3300005578 Bacteria 5126
73 Ga0068856_100001530 3300005614 Bacteria 24235
74 Ga0068856_100003746 3300005614 Bacteria 15243
75 Ga0068856_100012673 3300005614 Bacteria 8163
76 Ga0068856_100079820 3300005614 Bacteria 3245
77 Ga0068852_100000234 3300005616 Bacteria 37575
78 Ga0068852_100130625 3300005616 Bacteria 2313
79 Ga0068859_100013483 3300005617 Bacteria 8196
80 Ga0068859_100031068 3300005617 Bacteria 5361
81 Ga0068859_100084260 3300005617 Unclassified 3224
82 Ga0068859_100123275 3300005617 Bacteria 2659
83 Ga0068859_100320371 3300005617 Bacteria 1644
84 Ga0068864_100004501 3300005618 Bacteria 11462
85 Ga0068864_100128708 3300005618 Bacteria 2272
86 Ga0068864_100382674 3300005618 Bacteria 1334
87 Ga0068863_100108984 3300005841 Bacteria 2636
88 Ga0068858_100061121 3300005842 Bacteria 3482
89 Ga0068860_100283232 3300005843 Bacteria 1620
90 Ga0081538_10059932 3300005981 Bacteria 2194
91 Ga0081540_1118328 3300005983 Bacteria 1105
92 Ga0081539_10000045 3300005985 Bacteria 277027
93 Ga0081539_10037914 3300005985 Bacteria 2863
94 Ga0070716_100225132 3300006173 Bacteria 1262
95 Ga0070712_100092352 3300006175 Bacteria 2220
96 Ga0097621_100000417 3300006237 Bacteria 29675
97 Ga0097621_100016407 3300006237 Bacteria 5600
98 Ga0068871_100000652 3300006358 Bacteria 23848
99 Ga0068871_100111404 3300006358 Bacteria 2302
100 Ga0068871_100560307 3300006358 Bacteria 1036
101 Ga0075428_100161311 3300006844 Bacteria 2433
102 Ga0075428_100469038 3300006844 Bacteria 1348
103 Ga0075434_100078047 3300006871 Bacteria 3307
104 Ga0075434_100317955 3300006871 Bacteria 1577
105 Ga0068865_100008092 3300006881 Bacteria 6488
106 Ga0068865_100142372 3300006881 Bacteria 1809
107 Ga0068865_100236845 3300006881 Bacteria 1434
108 Ga0075436_100031864 3300006914 Bacteria 3632
109 Ga0075436_100049846 3300006914 Bacteria 2890
110 Ga0075436_100121580 3300006914 Bacteria 1827
111 Ga0097620_100013483 3300006931 Bacteria 8196
112 Ga0097620_100031068 3300006931 Bacteria 5361
113 Ga0097620_100084262 3300006931 Unclassified 3224
114 Ga0097620_100123274 3300006931 Bacteria 2659
115 Ga0097620_100320356 3300006931 Bacteria 1644
116 Ga0079104_1000014 3300006946 Bacteria 337362
117 Ga0079104_1000203 3300006946 Bacteria 83190
118 Ga0079104_1000357 3300006946 Bacteria 55345
119 Ga0075435_100091397 3300007076 Bacteria 2512
120 Ga0105251_10000086 3300009011 Bacteria 88725
121 Ga0105251_10000529 3300009011 Bacteria 36039
122 Ga0105251_10005219 3300009011 Bacteria 8562
123 Ga0105251_10013602 3300009011 Bacteria 4546
124 Ga0105251_10027030 3300009011 Bacteria 2914
125 Ga0105251_10068242 3300009011 Bacteria 1659
126 Ga0105251_10080345 3300009011 Bacteria 1508
127 Ga0105244_10001832 3300009036 Bacteria 16628
128 Ga0105244_10006109 3300009036 Bacteria 7865
129 Ga0105244_10006547 3300009036 Bacteria 7514
130 Ga0105244_10009564 3300009036 Bacteria 5946
131 Ga0105244_10032598 3300009036 Bacteria 2756
132 Ga0105244_10045867 3300009036 Bacteria 2247
133 Ga0105244_10058537 3300009036 Bacteria 1944
134 Ga0105250_10000002 3300009092 Bacteria 566949
135 Ga0105250_10000070 3300009092 Bacteria 96227
136 Ga0105250_10000616 3300009092 Bacteria 23145
137 Ga0105250_10001404 3300009092 Bacteria 13014
138 Ga0105250_10001622 3300009092 Bacteria 12022
139 Ga0105250_10002655 3300009092 Bacteria 8867
140 Ga0105250_10008467 3300009092 Bacteria 4367
141 Ga0105240_10003365 3300009093 Bacteria 24874
142 Ga0105240_10004201 3300009093 Bacteria 22030
143 Ga0105240_10006437 3300009093 Bacteria 17263
144 Ga0105240_10098903 3300009093 Bacteria 3552
145 Ga0105240_10180679 3300009093 Bacteria 2490
146 Ga0105240_10269666 3300009093 Bacteria 1960
147 Ga0105245_10007338 3300009098 Bacteria 9654
148 Ga0114129_10004675 3300009147 Bacteria 19333
149 Ga0105243_10050400 3300009148 Bacteria 3289
150 Ga0105241_10000383 3300009174 Bacteria 33616
151 Ga0105241_10012596 3300009174 Bacteria 6204
152 Ga0105241_10019513 3300009174 Bacteria 4999
153 Ga0105241_10027715 3300009174 Bacteria 4218
154 Ga0105241_10039319 3300009174 Bacteria 3568
155 Ga0105242_10116979 3300009176 Bacteria 2282
156 Ga0105248_10005255 3300009177 Bacteria 14254
157 Ga0105248_10029774 3300009177 Bacteria 6092
158 Ga0105248_10303395 3300009177 Bacteria 1798
159 Ga0105237_10016153 3300009545 Bacteria 7765
160 Ga0105237_10040970 3300009545 Bacteria 4671
161 Ga0105237_10121831 3300009545 Bacteria 2603
162 Ga0105238_10002982 3300009551 Bacteria 16898
163 Ga0105238_10004919 3300009551 Bacteria 13224
164 Ga0105238_10015258 3300009551 Bacteria 7778
165 Ga0105238_10170473 3300009551 Bacteria 2152
166 Ga0105238_10184975 3300009551 Bacteria 2060
167 Ga0105249_10160098 3300009553 Bacteria 2175
168 Ga0105239_10007680 3300010375 Bacteria 12350
169 Ga0105239_10017583 3300010375 Bacteria 7908
170 Ga0105239_10202198 3300010375 Bacteria 2226
171 Ga0105246_10000013 3300011119 Bacteria 67142
172 Ga0105246_10002258 3300011119 Bacteria 11631
173 Ga0157373_10001081 3300013100 Bacteria 20989
174 Ga0157371_10000092 3300013102 Bacteria 141282
175 Ga0157371_10003279 3300013102 Bacteria 14838
176 Ga0157370_10000596 3300013104 Bacteria 45119
177 Ga0157370_10012653 3300013104 Bacteria 8740
178 Ga0157369_10005321 3300013105 Bacteria 14997
179 Ga0157369_10005711 3300013105 Bacteria 14453
180 Ga0157369_10047903 3300013105 Bacteria 4639
181 Ga0157369_10050166 3300013105 Bacteria 4522
182 Ga0157374_10000955 3300013296 Bacteria 25080
183 Ga0157374_10002768 3300013296 Bacteria 14718
184 Ga0157374_10033334 3300013296 Bacteria 4699
185 Ga0157374_10104431 3300013296 Bacteria 2720
186 Ga0157374_10171631 3300013296 Bacteria 2116
187 Ga0157378_10015715 3300013297 Bacteria 6629
188 Ga0157378_10047021 3300013297 Bacteria 3836
189 Ga0157378_10158133 3300013297 Bacteria 2117
190 Ga0163162_10000378 3300013306 Bacteria 40518
191 Ga0163162_10003202 3300013306 Bacteria 15655
192 Ga0163162_10108982 3300013306 Bacteria 2866
193 Ga0157372_10004147 3300013307 Bacteria 15519
194 Ga0157372_10013100 3300013307 Bacteria 8847
195 Ga0157372_10015595 3300013307 Bacteria 8147
196 Ga0157372_10041549 3300013307 Bacteria 5085
197 Ga0157372_10053886 3300013307 Bacteria 4485
198 Ga0157372_10099595 3300013307 Bacteria 3315
199 Ga0157372_10104030 3300013307 Bacteria 3245
200 Ga0157372_10161897 3300013307 Bacteria 2586
201 Ga0157375_10006430 3300013308 Bacteria 10240
202 Ga0157375_10186084 3300013308 Bacteria 2230
203 Ga0163163_10000075 3300014325 Bacteria 109545
204 Ga0163163_10002698 3300014325 Bacteria 15003
205 Ga0163163_10130540 3300014325 Bacteria 2552
206 Ga0163163_10272001 3300014325 Bacteria 1745
207 Ga0163163_10347819 3300014325 Bacteria 1538
208 Ga0157380_10010450 3300014326 Bacteria 6679
209 Ga0157380_10068862 3300014326 Bacteria 2854
210 Ga0157377_10052336 3300014745 Unclassified 2305
211 Ga0157379_10151341 3300014968 Bacteria 2093
212 Ga0157379_10182204 3300014968 Bacteria 1897
213 Ga0157379_10327801 3300014968 Bacteria 1399
214 Ga0182005_1007744 3300015265 Bacteria 3205
215 Ga0183369_1003 3300015685 Bacteria 726443
216 Ga0163161_10018993 3300017792 Bacteria 4818
217 Ga0163161_10075363 3300017792 Bacteria 2476
218 Ga0163161_10169251 3300017792 Bacteria 1670
219 Ga0213875_10002238 3300021388 Bacteria 11743
220 Ga0213875_10010744 3300021388 Bacteria 4578
221 Ga0209760_100005 3300025207 Bacteria 238315
222 Ga0209784_100001 3300025224 Bacteria 3600592
223 Ga0209566_100001 3300025225 Bacteria 3600765
224 Ga0209674_100002 3300025226 Bacteria 3600592
225 Ga0209672_100074 3300025228 Bacteria 159792
226 Ga0209563_100002 3300025230 Bacteria 2045675
227 Ga0207427_100009 3300025231 Bacteria 663036
228 Ga0209437_100001 3300025233 Bacteria 2045675
229 Ga0209258_100004 3300025242 Bacteria 1376422
230 Ga0209258_100008 3300025242 Bacteria 1009355
231 Ga0209677_100002 3300025253 Bacteria 2045675
232 Ga0209148_1000041 3300025254 Bacteria 469323
233 Ga0209455_1000007 3300025272 Bacteria 1157983
234 Ga0209455_1012340 3300025272 Bacteria 2050
235 Ga0209673_1001925 3300025273 Bacteria 16472
236 Ga0209676_1000026 3300025292 Bacteria 574599
237 Ga0209025_1015065 3300025294 Bacteria 4693
238 Ga0209758_1005968 3300025297 Bacteria 9024
239 Ga0209758_1012168 3300025297 Bacteria 4854
240 Ga0209050_1002021 3300025298 Bacteria 18884
241 Ga0209051_1000151 3300025303 Bacteria 131835
242 Ga0209051_1001926 3300025303 Bacteria 16030
243 Ga0209257_1006118 3300025304 Bacteria 7982
244 Ga0207696_1000038 3300025711 Bacteria 328221
245 Ga0207696_1000239 3300025711 Bacteria 75936
246 Ga0207696_1000304 3300025711 Bacteria 56311
247 Ga0207696_1000409 3300025711 Bacteria 40065
248 Ga0207696_1001046 3300025711 Bacteria 16401
249 Ga0207696_1007415 3300025711 Bacteria 4297
250 Ga0207696_1009567 3300025711 Bacteria 3607
251 Ga0207696_1009725 3300025711 Bacteria 3569
252 Ga0207696_1016060 3300025711 Bacteria 2516
253 Ga0207655_1000002 3300025728 Bacteria 1148694
254 Ga0207655_1000050 3300025728 Bacteria 294923
255 Ga0207655_1006728 3300025728 Bacteria 7570
256 Ga0207655_1006972 3300025728 Bacteria 7402
257 Ga0207655_1010748 3300025728 Bacteria 5523
258 Ga0207655_1010981 3300025728 Bacteria 5438
259 Ga0207655_1014723 3300025728 Bacteria 4398
260 Ga0207655_1020027 3300025728 Bacteria 3465
261 Ga0207655_1035278 3300025728 Bacteria 2235
262 Ga0207655_1040444 3300025728 Bacteria 2011
263 Ga0207713_1000002 3300025735 Bacteria 1061749
264 Ga0207713_1000155 3300025735 Bacteria 102677
265 Ga0207713_1000191 3300025735 Bacteria 85634
266 Ga0207713_1002314 3300025735 Bacteria 13998
267 Ga0207713_1002406 3300025735 Bacteria 13664
268 Ga0207713_1005935 3300025735 Bacteria 7537
269 Ga0207713_1013106 3300025735 Bacteria 4390
270 Ga0207713_1013798 3300025735 Bacteria 4234
271 Ga0207713_1021959 3300025735 Bacteria 3045
272 Ga0207680_10000006 3300025903 Bacteria 635950
273 Ga0207680_10051574 3300025903 Bacteria 2461
274 Ga0207705_10022230 3300025909 Bacteria 4524
275 Ga0207684_10152884 3300025910 Bacteria 1986
276 Ga0207684_10257587 3300025910 Bacteria 1505
277 Ga0207654_10000689 3300025911 Bacteria 18808
278 Ga0207654_10000731 3300025911 Bacteria 18271
279 Ga0207654_10019740 3300025911 Bacteria 3563
280 Ga0207654_10031820 3300025911 Bacteria 2909
281 Ga0207707_10031433 3300025912 Bacteria 4645
282 Ga0207695_10000637 3300025913 Bacteria 70175
283 Ga0207695_10002224 3300025913 Bacteria 29144
284 Ga0207695_10004845 3300025913 Bacteria 18166
285 Ga0207695_10005481 3300025913 Bacteria 16806
286 Ga0207695_10089305 3300025913 Bacteria 3099
287 Ga0207671_10000935 3300025914 Bacteria 36496
288 Ga0207671_10007610 3300025914 Bacteria 9372
289 Ga0207663_10087888 3300025916 Bacteria 2054
290 Ga0207663_10166018 3300025916 Bacteria 1563
291 Ga0207649_10063286 3300025920 Bacteria 2335
292 Ga0207646_10181601 3300025922 Bacteria 1900
293 Ga0207681_10014667 3300025923 Bacteria 4878
294 Ga0207694_10000249 3300025924 Bacteria 51431
295 Ga0207694_10001221 3300025924 Bacteria 22261
296 Ga0207694_10027998 3300025924 Bacteria 4296
297 Ga0207694_10148923 3300025924 Bacteria 1885
298 Ga0207650_10311494 3300025925 Unclassified 1288
299 Ga0207659_10114596 3300025926 Bacteria 2055
300 Ga0207687_10013607 3300025927 Bacteria 5311
301 Ga0207700_10000060 3300025928 Bacteria 68678
302 Ga0207700_10091875 3300025928 Bacteria 2399
303 Ga0207700_10232259 3300025928 Bacteria 1569
304 Ga0207664_10011276 3300025929 Bacteria 6341
305 Ga0207664_10114864 3300025929 Bacteria 2244
306 Ga0207664_10138853 3300025929 Bacteria 2053
307 Ga0207644_10239124 3300025931 Bacteria 1445
308 Ga0207665_10104037 3300025939 Bacteria 1986
309 Ga0207691_10078331 3300025940 Bacteria 2975
310 Ga0207711_10014531 3300025941 Bacteria 6544
311 Ga0207711_10032837 3300025941 Bacteria 4390
312 Ga0207711_10050081 3300025941 Bacteria 3576
313 Ga0207711_10150749 3300025941 Bacteria 2098
314 Ga0207661_10218812 3300025944 Bacteria 1682
315 Ga0207661_10236552 3300025944 Unclassified 1619
316 Ga0207679_10016801 3300025945 Bacteria 4865
317 Ga0207667_10001916 3300025949 Bacteria 26137
318 Ga0207667_10004385 3300025949 Bacteria 17283
319 Ga0207651_10027598 3300025960 Bacteria 3568
320 Ga0207668_10094625 3300025972 Bacteria 2203
321 Ga0207640_10010117 3300025981 Bacteria 5303
322 Ga0207658_10128700 3300025986 Bacteria 2031
323 Ga0207677_10056750 3300026023 Bacteria 2685
324 Ga0207677_10070454 3300026023 Bacteria 2464
325 Ga0207703_10038574 3300026035 Bacteria 3813
326 Ga0207703_10049144 3300026035 Bacteria 3409
327 Ga0207639_10000605 3300026041 Bacteria 24765
328 Ga0207639_10520976 3300026041 Bacteria 1089
329 Ga0207678_10022979 3300026067 Bacteria 5457
330 Ga0207678_10249812 3300026067 Bacteria 1519
331 Ga0207708_10015907 3300026075 Bacteria 5649
332 Ga0207702_10001049 3300026078 Bacteria 28307
333 Ga0207702_10001070 3300026078 Bacteria 28050
334 Ga0207702_10076091 3300026078 Bacteria 2901
335 Ga0207702_10124682 3300026078 Bacteria 2310
336 Ga0207641_10058811 3300026088 Bacteria 3272
337 Ga0207676_10001466 3300026095 Bacteria 17524
338 Ga0207676_10126349 3300026095 Bacteria 2166
339 Ga0207683_10312502 3300026121 Bacteria 1438
340 Ga0207698_10000623 3300026142 Bacteria 20591
341 Ga0209281_1000032 3300027111 Bacteria 401727
342 Ga0209281_1000338 3300027111 Bacteria 79936
343 Ga0209389_1000103 3300027296 Bacteria 75590
344 Ga0209371_1000017 3300027312 Bacteria 625776
345 Ga0209371_1000577 3300027312 Bacteria 32935
346 Ga0209371_1001607 3300027312 Bacteria 14687
347 Ga0207428_10005919 3300027907 Bacteria 11322
348 Ga0207428_10026747 3300027907 Bacteria 4809
349 Ga0268266_10000021 3300028379 Bacteria 522453
350 Ga0268266_10034222 3300028379 Bacteria 4321
351 Ga0268266_10114872 3300028379 Bacteria 2389
352 Ga0268264_10081099 3300028381 Bacteria 2772
353 Ga0268264_10192436 3300028381 Bacteria 1860
354 Ga0265338_10018014 3300028800 Bacteria 7582
355 Ga0268256_1000036 3300030500 Bacteria 370250
356 Ga0268256_1000819 3300030500 Bacteria 22302
357 Ga0268256_1001390 3300030500 Bacteria 14687
358 Ga0265325_10043684 3300031241 Bacteria 2337
359 Ga0265339_10044702 3300031249 Bacteria 2441
360 Ga0265316_10132332 3300031344 Bacteria 1878
361 Ga0307509_10000004 3300031507 Bacteria 535507
362 Ga0307408_100095864 3300031548 Bacteria 2249
363 Ga0265313_10027776 3300031595 Bacteria 2957
364 Ga0307508_10080456 3300031616 Bacteria 2840
365 Ga0316575_10012714 3300031665 Bacteria 3136
366 Ga0265314_10010456 3300031711 Bacteria 7742
367 Ga0307412_10001266 3300031911 Bacteria 14173
368 Ga0307412_10044273 3300031911 Bacteria 2903
369 Ga0307412_10049883 3300031911 Bacteria 2759
370 Ga0307409_100100442 3300031995 Bacteria 2398
371 Ga0373959_0000450 3300034820 Bacteria 7685
372 Ga0316574_0005675 3300035398 Bacteria 6676
373 Ga0373935_0041032 3300035692 Bacteria 2906
374 Ga0373927_0038275 3300035695 Bacteria 3114
375 Ga0373937_0019256 3300036401 Bacteria 6109
376 Ga0395899_0035576 3300037312 Bacteria 3738
377 Ga0395900_0026896 3300037418 Bacteria 5888
378 Ga0395900_0191019 3300037418 Bacteria 2077
379 Ga0395905_0000769 3300037471 Bacteria 42306
380 Ga0395905_0169447 3300037471 Bacteria 2051
381 Ga0436364_0471524 3300037853 Bacteria 6420
382 Ga0436364_0613787 3300037853 Bacteria 13985
383 Ga0395901_0003843 3300038443 Bacteria 15134
384 Ga0395901_0085074 3300038443 Bacteria 3306
385 Ga0395901_0387040 3300038443 Bacteria 1438
386 Ga0395901_0430218 3300038443 Bacteria 1352
387 Ga0436365_0203066 3300039437 Bacteria 111457
388 Ga0436361_0462153 3300039447 Bacteria 6697
389 Ga0439438_016041 3300041405 Bacteria 2186
390 Ga0439447_000503 3300041407 Bacteria 14536
391 Ga0439447_007866 3300041407 Bacteria 3342
392 Ga0439466_0008252 3300041411 Bacteria 3924
393 Ga0439465_0019909 3300041413 Bacteria 2099
394 Ga0439463_000015 3300042016 Bacteria 36632
395 Ga0439464_0011013 3300042439 Bacteria 2391
396 Ga0466966_0021607 3300044684 Bacteria 4226
397 Ga0466963_0015844 3300044694 Bacteria 4679
398 Ga0453684_0000065 3300044712 Bacteria 468481
399 Ga0453684_0003037 3300044712 Bacteria 39031
400 Ga0453684_0123407 3300044712 Bacteria 3122
401 Ga0453684_0265918 3300044712 Bacteria 1962
402 Ga0453684_0297727 3300044712 Bacteria 1835
403 Ga0466968_0036004 3300044735 Bacteria 2073
404 Ga0466970_0058034 3300044765 Bacteria 2071
405 Ga0451576_0000325 3300045051 Bacteria 115644
406 Ga0451576_0004373 3300045051 Bacteria 18423
407 Ga0451576_0165107 3300045051 Bacteria 2311
408 Ga0451576_0507514 3300045051 Bacteria 1267
409 Ga0466958_0066902 3300045836 Bacteria 2194
410 Ga0466967_0007112 3300045976 Bacteria 8031
411 Ga0466967_0064875 3300045976 Bacteria 3249
412 Ga0495617_000166 3300046452 Bacteria 42074
413 Ga0495617_000972 3300046452 Bacteria 13311
414 Ga0495617_009939 3300046452 Bacteria 3262
415 Ga0495617_013456 3300046452 Bacteria 2785
416 Ga0495617_036485 3300046452 Bacteria 1648
417 Ga0495617_048588 3300046452 Bacteria 1412
418 Ga0495603_0000025 3300046455 Bacteria 62985
419 Ga0495590_0000306 3300046457 Bacteria 25686
420 Ga0495591_000002 3300046458 Bacteria 455013
421 Ga0495591_000049 3300046458 Bacteria 138951
422 Ga0495591_000076 3300046458 Bacteria 111124
423 Ga0495591_000545 3300046458 Bacteria 28926
424 Ga0495591_016191 3300046458 Bacteria 2608
425 Ga0495638_0000373 3300046460 Bacteria 55670
426 Ga0495638_0000477 3300046460 Bacteria 48044
427 Ga0495638_0001957 3300046460 Bacteria 17643
428 Ga0495638_0092687 3300046460 Bacteria 1818
429 Ga0495638_0179805 3300046460 Bacteria 1207
430 Ga0495653_0003212 3300046463 Bacteria 13091
431 Ga0495653_0006291 3300046463 Bacteria 9741
432 Ga0495653_0044424 3300046463 Bacteria 3447
433 Ga0495650_0000031 3300046471 Bacteria 433811
434 Ga0495650_0001378 3300046471 Bacteria 23968
435 Ga0495650_0004885 3300046471 Bacteria 8968
436 Ga0495650_0006455 3300046471 Bacteria 7298
437 Ga0495650_0006668 3300046471 Bacteria 7155
438 Ga0495580_0000005 3300046472 Bacteria 107243
439 Ga0495580_0004911 3300046472 Bacteria 11183
440 Ga0495580_0005902 3300046472 Bacteria 10048
441 Ga0495580_0014041 3300046472 Bacteria 6091
442 Ga0495605_0000517 3300046474 Bacteria 32881
443 Ga0495605_0001304 3300046474 Bacteria 16517
444 Ga0495605_0003775 3300046474 Bacteria 8987
445 Ga0495605_0014986 3300046474 Bacteria 4227
446 Ga0495605_0051067 3300046474 Bacteria 2014
447 Ga0495664_0012766 3300046477 Bacteria 4759
448 Ga0495584_0036972 3300046491 Bacteria 2466
449 Ga0495585_0002349 3300046492 Bacteria 13593
450 Ga0495585_0004774 3300046492 Bacteria 8719
451 Ga0495585_0021020 3300046492 Bacteria 3748
452 Ga0495585_0062695 3300046492 Bacteria 2042
453 Ga0495594_0062851 3300046499 Bacteria 2056
454 Ga0495596_0000087 3300046500 Bacteria 64252
455 Ga0495607_0003007 3300046501 Bacteria 13165
456 Ga0495607_0021248 3300046501 Bacteria 4086
457 Ga0495607_0078103 3300046501 Bacteria 1827
458 Ga0495607_0175416 3300046501 Bacteria 1079
459 Ga0495583_0000059 3300046506 Bacteria 199575
460 Ga0495583_0003963 3300046506 Bacteria 10932
461 Ga0495583_0010191 3300046506 Bacteria 5514
462 Ga0495583_0031047 3300046506 Bacteria 2595
463 Ga0495583_0066259 3300046506 Bacteria 1598
464 Ga0495606_0001321 3300046507 Bacteria 33870
465 Ga0495606_0117543 3300046507 Bacteria 1595
466 Ga0495606_0142562 3300046507 Bacteria 1413
467 Ga0495606_0191427 3300046507 Bacteria 1172
468 Ga0495608_0001348 3300046511 Bacteria 17514
469 Ga0495608_0065502 3300046511 Bacteria 2380
470 Ga0495610_0000848 3300046512 Bacteria 28487
471 Ga0495610_0001087 3300046512 Bacteria 24865
472 Ga0495610_0001982 3300046512 Bacteria 17467
473 Ga0495610_0022283 3300046512 Bacteria 3468
474 Ga0495616_0000165 3300046513 Bacteria 57822
475 Ga0495616_0023716 3300046513 Bacteria 3298
476 Ga0495620_0001627 3300046515 Bacteria 13296
477 Ga0495620_0004873 3300046515 Bacteria 7532
478 Ga0495620_0054395 3300046515 Bacteria 1691
479 Ga0495628_0001615 3300046516 Bacteria 20645
480 Ga0495628_0312991 3300046516 Bacteria 1160
481 Ga0495630_0055415 3300046517 Bacteria 2971
482 Ga0495630_0091075 3300046517 Bacteria 2304
483 Ga0495630_0163812 3300046517 Bacteria 1692
484 Ga0495630_0189494 3300046517 Bacteria 1569
485 Ga0495631_0000031 3300046518 Bacteria 85555
486 Ga0495631_0005399 3300046518 Bacteria 6686
487 Ga0495631_0007732 3300046518 Bacteria 5454
488 Ga0495632_0016673 3300046519 Bacteria 4078
489 Ga0495632_0028749 3300046519 Bacteria 2899
490 Ga0495632_0038410 3300046519 Bacteria 2424
491 Ga0495637_0000365 3300046520 Bacteria 34448
492 Ga0495637_0003162 3300046520 Bacteria 8788
493 Ga0495637_0021867 3300046520 Bacteria 2925
494 Ga0495643_0000284 3300046522 Bacteria 72435
495 Ga0495643_0093138 3300046522 Bacteria 1552
496 Ga0495648_0001897 3300046524 Bacteria 19952
497 Ga0495648_0004024 3300046524 Bacteria 12700
498 Ga0495648_0026190 3300046524 Bacteria 3929
499 Ga0495648_0049774 3300046524 Bacteria 2565
500 Ga0495648_0148890 3300046524 Bacteria 1223
501 Ga0495663_0067576 3300046525 Bacteria 1133
502 Ga0495666_0009884 3300046526 Bacteria 4765
503 Ga0495652_0000812 3300046529 Bacteria 36015
504 Ga0495652_0048359 3300046529 Bacteria 3645
505 Ga0495652_0144169 3300046529 Bacteria 1869
506 Ga0495654_0000069 3300046530 Bacteria 120853
507 Ga0495654_0000079 3300046530 Bacteria 109816
508 Ga0495654_0005114 3300046530 Bacteria 7664
509 Ga0495654_0021836 3300046530 Bacteria 3329
510 Ga0495654_0054102 3300046530 Bacteria 1948
511 Ga0495654_0105631 3300046530 Bacteria 1290
512 Ga0495665_0020274 3300046531 Bacteria 3572
513 Ga0495640_0114021 3300046533 Bacteria 1763
514 Ga0495587_0001718 3300046536 Bacteria 14619
515 Ga0495621_0001317 3300046539 Bacteria 6415
516 Ga0495597_0001260 3300046542 Bacteria 18706
517 Ga0495597_0062640 3300046542 Bacteria 1617
518 Ga0495645_0016029 3300046543 Bacteria 5342
519 Ga0495622_0000011 3300046557 Bacteria 201507
520 Ga0495622_0001980 3300046557 Bacteria 10037
521 Ga0495633_0011667 3300046558 Bacteria 4719
522 Ga0495633_0076960 3300046558 Bacteria 1554
523 Ga0495633_0078976 3300046558 Bacteria 1532
524 Ga0495633_0143891 3300046558 Bacteria 1102
525 Ga0495667_0000215 3300046559 Bacteria 38593
526 Ga0495656_0015779 3300046615 Bacteria 2857
527 Ga0495668_0002790 3300046616 Bacteria 13912
528 Ga0495668_0007922 3300046616 Bacteria 6704
529 Ga0495668_0025823 3300046616 Bacteria 3336
530 Ga0495668_0065237 3300046616 Bacteria 2004
531 Ga0495634_0000347 3300046642 Bacteria 44864
532 Ga0495611_0001754 3300046648 Bacteria 10495
533 Ga0495611_0006671 3300046648 Bacteria 4911
534 Ga0495611_0054525 3300046648 Bacteria 1807
535 Ga0495625_0001743 3300046660 Bacteria 25161
536 Ga0495625_0003377 3300046660 Bacteria 16005
537 Ga0495625_0005641 3300046660 Bacteria 11340
538 Ga0495625_0005925 3300046660 Bacteria 10995
539 Ga0495625_0015936 3300046660 Bacteria 5930
540 Ga0495625_0245233 3300046660 Bacteria 1165
541 Ga0495635_0046015 3300046663 Bacteria 3010
542 Ga0495661_0000861 3300046665 Bacteria 28277
543 Ga0495588_0001410 3300046674 Bacteria 10267
544 Ga0495657_0006599 3300046675 Bacteria 9063
545 Ga0495599_0078903 3300046678 Bacteria 2056
546 Ga0495623_0002958 3300046679 Bacteria 11177
547 Ga0495623_0011387 3300046679 Bacteria 5755
548 Ga0495646_0023944 3300046680 Bacteria 3845
549 Ga0495646_0046615 3300046680 Bacteria 2641
550 Ga0495613_0102040 3300046689 Bacteria 2072
551 Ga0495624_0016322 3300046690 Bacteria 4998
552 Ga0495624_0028114 3300046690 Bacteria 3677
553 Ga0495670_0004284 3300046691 Bacteria 6989
554 Ga0495670_0004799 3300046691 Bacteria 6640
555 Ga0495671_0000446 3300046692 Bacteria 32728
556 Ga0495671_0002224 3300046692 Bacteria 12335
557 Ga0495671_0074469 3300046692 Bacteria 1665
558 Ga0495649_0000245 3300046694 Bacteria 47917
559 Ga0495649_0006297 3300046694 Bacteria 7386
560 Ga0495649_0008701 3300046694 Bacteria 6090
561 Ga0495649_0019004 3300046694 Bacteria 3861
562 Ga0495649_0021669 3300046694 Bacteria 3600
563 Ga0495649_0025203 3300046694 Bacteria 3312
564 Ga0495649_0188377 3300046694 Bacteria 1074
565 Ga0495589_0011590 3300046794 Bacteria 4577
566 Ga0495589_0024759 3300046794 Bacteria 3049
567 Ga0495589_0046180 3300046794 Bacteria 2163
568 Ga0495600_0029338 3300046809 Bacteria 3561
569 Ga0495660_0000016 3300046810 Bacteria 321859
570 Ga0495660_0000153 3300046810 Bacteria 74797
571 Ga0495660_0000302 3300046810 Bacteria 44594
572 Ga0495660_0002788 3300046810 Bacteria 11013
573 Ga0495660_0020164 3300046810 Bacteria 3822
574 Ga0495660_0022024 3300046810 Bacteria 3643
575 Ga0495660_0053672 3300046810 Bacteria 2187
576 Ga0495660_0095053 3300046810 Bacteria 1542
577 Ga0495604_0019379 3300047317 Bacteria 5445
578 Ga0495604_0022082 3300047317 Bacteria 5079
579 Ga0495604_0057310 3300047317 Bacteria 2995
580 Ga0495674_0000271 3300047319 Bacteria 44227
581 Ga0495674_0008422 3300047319 Bacteria 9823
582 Ga0495674_0017477 3300047319 Bacteria 6674
583 Ga0495674_0048003 3300047319 Bacteria 3781
584 Ga0495672_0000001 3300047320 Bacteria 1458820
585 Ga0495672_0000037 3300047320 Bacteria 278588
586 Ga0495672_0000062 3300047320 Bacteria 211745
587 Ga0495672_0002052 3300047320 Bacteria 18929
588 Ga0495680_0002950 3300047322 Bacteria 17024
589 Ga0495680_0029851 3300047322 Bacteria 4460
590 Ga0495683_0002439 3300047323 Bacteria 11240
591 Ga0495687_013230 3300047443 Bacteria 4318
592 Ga0495687_027145 3300047443 Bacteria 2683
593 Ga0495675_0000354 3300047444 Bacteria 32123
594 Ga0495675_0046475 3300047444 Bacteria 2763
595 Ga0495679_000590 3300047446 Bacteria 24982
596 Ga0495679_017874 3300047446 Bacteria 2529
597 Ga0495679_022488 3300047446 Bacteria 2156
598 Ga0495673_0000191 3300047469 Bacteria 96817
599 Ga0495673_0000358 3300047469 Bacteria 56024
600 Ga0495673_0000753 3300047469 Bacteria 30736
601 Ga0495681_0000527 3300047470 Bacteria 29212
602 Ga0495681_0006810 3300047470 Bacteria 7434
603 Ga0495681_0009252 3300047470 Bacteria 6091
604 Ga0495681_0017092 3300047470 Bacteria 4041
605 Ga0495684_0002068 3300047471 Bacteria 16129
606 Ga0495684_0020764 3300047471 Bacteria 5060
607 Ga0495686_0000047 3300047472 Bacteria 280086
608 Ga0495686_0002819 3300047472 Bacteria 15756
609 Ga0495593_0013628 3300047673 Bacteria 4633
610 Ga0495602_0059737 3300048088 Bacteria 3326
611 Ga0495626_0000057 3300048091 Bacteria 148288
612 Ga0495626_0000374 3300048091 Bacteria 46701
613 Ga0495626_0005649 3300048091 Bacteria 7245
614 Ga0496100_0024105 3300048903 Bacteria 3706
615 Ga0496100_0065169 3300048903 Bacteria 2413
616 Ga0496101_0008350 3300048904 Bacteria 6767
617 Ga0496101_0022200 3300048904 Bacteria 4367
618 Ga0496101_0051243 3300048904 Bacteria 2974
619 Ga0496101_0089574 3300048904 Bacteria 2287
620 Ga0496102_0000444 3300048905 Bacteria 47025
621 Ga0496102_0005013 3300048905 Bacteria 11214
622 Ga0496102_0059670 3300048905 Bacteria 3489
623 Ga0496102_0119593 3300048905 Bacteria 2460
624 Ga0496102_0281788 3300048905 Bacteria 1567
625 Ga0496102_0331593 3300048905 Bacteria 1433
626 Ga0496103_0000290 3300048906 Bacteria 47006
627 Ga0496103_0046510 3300048906 Bacteria 2679
628 Ga0496104_0006840 3300048907 Bacteria 10049
629 Ga0496104_0202072 3300048907 Bacteria 1899
630 Ga0496105_0049651 3300048908 Bacteria 3464
631 Ga0496105_0179163 3300048908 Bacteria 1735
632 Ga0496105_0252066 3300048908 Bacteria 1430
633 Ga0496106_0090721 3300048909 Bacteria 2358
634 Ga0496107_0011893 3300048910 Bacteria 6079
635 Ga0496107_0028942 3300048910 Bacteria 3940
636 Ga0496107_0162996 3300048910 Bacteria 1653
637 Ga0496108_0069625 3300048911 Bacteria 2969
638 Ga0496108_0349892 3300048911 Bacteria 1289
639 Ga0496109_0010551 3300048912 Bacteria 7898
640 Ga0496109_0422889 3300048912 Bacteria 1258
641 Ga0496110_0010902 3300048913 Bacteria 7411
642 Ga0496110_0016914 3300048913 Bacteria 6096
643 Ga0496110_0153019 3300048913 Bacteria 2089
644 Ga0496114_0021179 3300048917 Bacteria 5287
645 Ga0496114_0095352 3300048917 Bacteria 2532
646 Ga0496114_0132976 3300048917 Bacteria 2150
647 Ga0496114_0161162 3300048917 Bacteria 1951
648 Ga0496115_0001021 3300048918 Bacteria 20300
649 Ga0496115_0015041 3300048918 Bacteria 5865
650 Ga0496115_0109155 3300048918 Bacteria 2272
651 Ga0496116_0000394 3300048919 Bacteria 63846
652 Ga0496116_0015807 3300048919 Bacteria 5944
653 Ga0496116_0035428 3300048919 Bacteria 3505
654 Ga0496116_0055403 3300048919 Bacteria 2604
655 Ga0496117_0001290 3300048920 Bacteria 36931
656 Ga0496117_0002386 3300048920 Bacteria 23895
657 Ga0496117_0008509 3300048920 Bacteria 9730
658 Ga0496117_0032627 3300048920 Bacteria 3953
659 Ga0496117_0062710 3300048920 Bacteria 2545
660 Ga0496118_0000048 3300048921 Bacteria 253404
661 Ga0496118_0000491 3300048921 Bacteria 65587
662 Ga0496118_0005120 3300048921 Bacteria 15061
663 Ga0496118_0039071 3300048921 Bacteria 3792
664 Ga0496118_0082682 3300048921 Bacteria 2248
665 Ga0496119_0005301 3300048922 Bacteria 12414
666 Ga0496120_0085256 3300048923 Bacteria 1701
667 Ga0496121_0000055 3300048924 Bacteria 304572
668 Ga0496121_0001253 3300048924 Bacteria 43985
669 Ga0496121_0008653 3300048924 Bacteria 11901
670 Ga0496122_0000810 3300048925 Bacteria 59986
671 Ga0496123_0001426 3300048926 Bacteria 33426
672 Ga0496124_0000390 3300048927 Bacteria 79997
673 Ga0496124_0000445 3300048927 Bacteria 72989
674 Ga0496124_0000634 3300048927 Bacteria 58255
675 Ga0496124_0005976 3300048927 Bacteria 13440
676 Ga0496124_0006685 3300048927 Bacteria 12486
677 Ga0496124_0009020 3300048927 Bacteria 10319
678 Ga0496124_0010485 3300048927 Bacteria 9377
679 Ga0496124_0023815 3300048927 Bacteria 5580
680 Ga0496125_0000232 3300048928 Bacteria 114025
681 Ga0496125_0005805 3300048928 Bacteria 13555
682 Ga0496125_0009714 3300048928 Bacteria 9824
683 Ga0496125_0011442 3300048928 Bacteria 8873
684 Ga0496125_0101591 3300048928 Bacteria 2116
685 Ga0496126_0069447 3300048929 Bacteria 3143
686 Ga0496126_0073802 3300048929 Bacteria 3032
687 Ga0496126_0120620 3300048929 Bacteria 2274
688 Ga0496126_0161928 3300048929 Bacteria 1911
689 Ga0496126_0299154 3300048929 Bacteria 1328
690 Ga0495678_000091 3300049459 Bacteria 114504
691 Ga0495678_002781 3300049459 Bacteria 11428
692 Ga0495678_027486 3300049459 Bacteria 2413
693 Ga0495682_0000001 3300049460 Bacteria 1559116
694 Ga0495682_0000152 3300049460 Bacteria 59145
695 Ga0495682_0000232 3300049460 Bacteria 43870
696 Ga0495682_0004828 3300049460 Bacteria 5692
697 Ga0495682_0007557 3300049460 Bacteria 4316
698 Ga0495682_0023301 3300049460 Bacteria 2311
699 Ga0495682_0051776 3300049460 Bacteria 1493
700 Ga0501034_0101163 3300049571 Bacteria 2876
701 Ga0501037_0176986 3300049573 Bacteria 1515
702 Ga0501046_0350519 3300049580 Bacteria 1072
703 Ga0501047_0228330 3300049581 Bacteria 1716
704 Ga0501070_0040644 3300049586 Bacteria 3878
705 Ga0501070_0166386 3300049586 Bacteria 1817
706 Ga0501249_000065 3300049679 Bacteria 38092
707 Ga0501080_0033932 3300049742 Bacteria 4764
708 Ga0501080_0313469 3300049742 Bacteria 1421
709 Ga0501083_0105627 3300049744 Bacteria 1854
710 Ga0501044_0160648 3300049823 Bacteria 2224
711 Ga0501204_003614 3300049850 Bacteria 1636
712 nmdc:mga00v17_4678_c1 3300050491 Bacteria 7149
713 nmdc:mga05p37_3097_c1 3300050507 Bacteria 19323
714 nmdc:mga05p37_4683_c1 3300050507 Bacteria 15978
715 nmdc:mga09592_14038_c1 3300050508 Bacteria 6540
716 nmdc:mga0n895_104802_c1 3300050512 Bacteria 2840
717 nmdc:mga0n895_352619_c1 3300050512 Bacteria 1490
718 nmdc:mga0rr50_38934_c1 3300050513 Bacteria 3445
719 nmdc:mga08x19_17316_c1 3300050514 Bacteria 4407
720 nmdc:mga08x19_25250_c1 3300050514 Bacteria 3700
721 nmdc:mga08x19_34963_c1 3300050514 Bacteria 3178
722 Ga0495601_0076363 3300053077 Bacteria 2145
723 Ga0500610_0075796 3300053079 Bacteria 1754
724 Ga0495619_0036206 3300053085 Bacteria 3212
725 Ga0500578_0131726 3300053086 Bacteria 1568
726 Ga0500643_000024 3300053087 Bacteria 265935
727 Ga0500644_0000126 3300053088 Bacteria 47091
728 Ga0500555_020364 3300053103 Bacteria 1910
729 Ga0500569_016973 3300053109 Bacteria 1853
730 Ga0500594_0000563 3300053118 Bacteria 8009
731 Ga0500594_0000661 3300053118 Bacteria 7332
732 Ga0500594_0003332 3300053118 Bacteria 3519
733 Ga0500618_000116 3300053125 Bacteria 64971
734 Ga0500618_000269 3300053125 Bacteria 40125
735 Ga0500618_000344 3300053125 Bacteria 33227
736 Ga0500621_000002 3300053126 Bacteria 849473
737 Ga0500658_0046104 3300053134 Bacteria 1764
738 Ga0500659_0004513 3300053135 Bacteria 7941
739 Ga0500559_0061927 3300053136 Bacteria 1670
740 Ga0500568_0000168 3300053139 Bacteria 56752
741 Ga0500568_0053025 3300053139 Bacteria 1590
742 Ga0500616_0001366 3300053153 Bacteria 23717
743 Ga0500634_0000185 3300053161 Bacteria 20592
744 Ga0500636_0001796 3300053177 Bacteria 11746
745 Ga0500636_0028376 3300053177 Bacteria 3306
746 Ga0500609_000501 3300053731 Bacteria 5862
747 Ga0500661_003130 3300055283 Bacteria 3109

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046660 Ga0495625_0245233 Ga0495625_0245233_42_926 291
2 3300034820 Ga0373959_0000450 Ga0373959_0000450_4335_5327 302
3 3300009148 Ga0105243_10050400 Ga0105243_100504006 305
4 3300035692 Ga0373935_0041032 Ga0373935_0041032_1443_2363 305
5 3300037418 Ga0395900_0191019 Ga0395900_0191019_182_1108 305
6 3300038443 Ga0395901_0430218 Ga0395901_0430218_162_1088 305
7 iso_pu_bacteria 2585427531 2585563712 305
8 3300005546 Ga0070696_100034637 Ga0070696_1000346372 306
9 3300005549 Ga0070704_100038993 Ga0070704_1000389932 306
10 3300014968 Ga0157379_10182204 Ga0157379_101822044 306
11 3300046507 Ga0495606_0191427 Ga0495606_0191427_51_974 306
12 3300046558 Ga0495633_0143891 Ga0495633_0143891_30_962 306
13 3300047469 Ga0495673_0000191 Ga0495673_0000191_77142_78068 306
14 3300053177 Ga0500636_0001796 Ga0500636_0001796_6106_7044 306
15 3300009011 Ga0105251_10005219 Ga0105251_100052193 307
16 3300009011 Ga0105251_10013602 Ga0105251_100136024 307
17 3300009092 Ga0105250_10002655 Ga0105250_100026559 307
18 3300009092 Ga0105250_10008467 Ga0105250_100084674 307
19 3300009551 Ga0105238_10015258 Ga0105238_100152584 307
20 3300037471 Ga0395905_0169447 Ga0395905_0169447_1101_2039 307
21 3300046458 Ga0495591_000049 Ga0495591_000049_50222_51151 307
22 3300046460 Ga0495638_0179805 Ga0495638_0179805_245_1174 307
23 3300046471 Ga0495650_0006455 Ga0495650_0006455_3875_4804 307
24 3300046474 Ga0495605_0051067 Ga0495605_0051067_252_1181 307
25 3300046500 Ga0495596_0000087 Ga0495596_0000087_17562_18491 307
26 3300046501 Ga0495607_0175416 Ga0495607_0175416_21_950 307
27 3300046517 Ga0495630_0163812 Ga0495630_0163812_333_1262 307
28 3300046520 Ga0495637_0003162 Ga0495637_0003162_850_1779 307
29 3300046524 Ga0495648_0049774 Ga0495648_0049774_1136_2065 307
30 3300046524 Ga0495648_0148890 Ga0495648_0148890_180_1109 307
31 3300046530 Ga0495654_0105631 Ga0495654_0105631_65_994 307
32 3300046557 Ga0495622_0000011 Ga0495622_0000011_66405_67334 307
33 3300046642 Ga0495634_0000347 Ga0495634_0000347_27616_28545 307
34 3300046692 Ga0495671_0074469 Ga0495671_0074469_81_1010 307
35 3300046694 Ga0495649_0188377 Ga0495649_0188377_81_1010 307
36 3300047319 Ga0495674_0017477 Ga0495674_0017477_3710_4639 307
37 3300047320 Ga0495672_0000062 Ga0495672_0000062_210784_211713 307
38 3300047470 Ga0495681_0000527 Ga0495681_0000527_333_1262 307
39 3300048091 Ga0495626_0000057 Ga0495626_0000057_46528_47457 307
40 3300048904 Ga0496101_0089574 Ga0496101_0089574_427_1356 307
41 3300048905 Ga0496102_0000444 Ga0496102_0000444_27303_28232 307
42 3300048905 Ga0496102_0281788 Ga0496102_0281788_376_1314 307
43 3300048905 Ga0496102_0331593 Ga0496102_0331593_141_1070 307
44 3300048906 Ga0496103_0000290 Ga0496103_0000290_26807_27736 307
45 3300048907 Ga0496104_0006840 Ga0496104_0006840_2274_3203 307
46 3300048908 Ga0496105_0049651 Ga0496105_0049651_1414_2343 307
47 3300048913 Ga0496110_0016914 Ga0496110_0016914_5109_6038 307
48 3300048919 Ga0496116_0015807 Ga0496116_0015807_4574_5503 307
49 3300048919 Ga0496116_0035428 Ga0496116_0035428_1514_2443 307
50 3300048920 Ga0496117_0002386 Ga0496117_0002386_4151_5080 307
51 3300048921 Ga0496118_0005120 Ga0496118_0005120_3741_4670 307
52 3300048922 Ga0496119_0005301 Ga0496119_0005301_2308_3237 307
53 3300048923 Ga0496120_0085256 Ga0496120_0085256_537_1466 307
54 3300048927 Ga0496124_0006685 Ga0496124_0006685_9137_10066 307
55 3300048927 Ga0496124_0010485 Ga0496124_0010485_7588_8517 307
56 3300048927 Ga0496124_0023815 Ga0496124_0023815_298_1227 307
57 3300048928 Ga0496125_0000232 Ga0496125_0000232_39620_40549 307
58 3300048928 Ga0496125_0005805 Ga0496125_0005805_3474_4403 307
59 3300053135 Ga0500659_0004513 Ga0500659_0004513_4627_5556 307
60 3300009093 Ga0105240_10269666 Ga0105240_102696663 308
61 3300045051 Ga0451576_0165107 Ga0451576_0165107_939_1874 308
62 3300049679 Ga0501249_000065 Ga0501249_000065_33741_34730 309
63 3300049850 Ga0501204_003614 Ga0501204_003614_325_1314 309
64 3300044735 Ga0466968_0036004 Ga0466968_0036004_1029_2030 311
65 3300005344 Ga0070661_100018950 Ga0070661_1000189504 313
66 3300005535 Ga0070684_100040485 Ga0070684_1000404854 313
67 3300005539 Ga0068853_100000635 Ga0068853_10000063514 313
68 3300005563 Ga0068855_100012713 Ga0068855_1000127138 313
69 3300005614 Ga0068856_100012673 Ga0068856_1000126737 313
70 3300005616 Ga0068852_100000234 Ga0068852_10000023417 313
71 3300009093 Ga0105240_10004201 Ga0105240_1000420113 313
72 3300009174 Ga0105241_10000383 Ga0105241_1000038314 313
73 3300009545 Ga0105237_10040970 Ga0105237_100409702 313
74 3300010375 Ga0105239_10017583 Ga0105239_100175837 313
75 3300013307 Ga0157372_10013100 Ga0157372_100131005 313
76 3300025911 Ga0207654_10000689 Ga0207654_100006892 313
77 3300025913 Ga0207695_10000637 Ga0207695_1000063714 313
78 3300025914 Ga0207671_10000935 Ga0207671_1000093516 313
79 3300025920 Ga0207649_10063286 Ga0207649_100632862 313
80 3300025924 Ga0207694_10000249 Ga0207694_1000024930 313
81 3300025949 Ga0207667_10001916 Ga0207667_100019168 313
82 3300026041 Ga0207639_10000605 Ga0207639_1000060518 313
83 3300026078 Ga0207702_10001049 Ga0207702_1000104916 313
84 3300026142 Ga0207698_10000623 Ga0207698_1000062314 313
85 3300006881 Ga0068865_100142372 Ga0068865_1001423722 314
86 3300035398 Ga0316574_0005675 Ga0316574_0005675_2979_4055 314
87 3300046452 Ga0495617_000972 Ga0495617_000972_8239_9231 316
88 3300037312 Ga0395899_0035576 Ga0395899_0035576_2636_3616 317
89 3300037418 Ga0395900_0026896 Ga0395900_0026896_3664_4644 317
90 3300037471 Ga0395905_0000769 Ga0395905_0000769_10508_11488 317
91 3300038443 Ga0395901_0003843 Ga0395901_0003843_12290_13270 317
92 iso_pu_bacteria 643348564 643603760 317
93 3300005436 Ga0070713_100272651 Ga0070713_1002726512 318
94 3300005329 Ga0070683_100142390 Ga0070683_1001423903 319
95 3300005331 Ga0070670_100146788 Ga0070670_1001467881 319
96 3300005340 Ga0070689_100008890 Ga0070689_1000088902 319
97 3300005435 Ga0070714_100054675 Ga0070714_1000546754 319
98 3300005617 Ga0068859_100084260 Ga0068859_1000842601 319
99 3300005618 Ga0068864_100004501 Ga0068864_1000045017 319
100 3300006931 Ga0097620_100084262 Ga0097620_1000842624 319
101 3300013296 Ga0157374_10000955 Ga0157374_1000095521 319
102 3300014325 Ga0163163_10000075 Ga0163163_1000007560 319
103 3300014745 Ga0157377_10052336 Ga0157377_100523363 319
104 3300025925 Ga0207650_10311494 Ga0207650_103114942 319
105 3300025926 Ga0207659_10114596 Ga0207659_101145962 319
106 3300025929 Ga0207664_10138853 Ga0207664_101388532 319
107 3300025944 Ga0207661_10236552 Ga0207661_102365521 319
108 3300025945 Ga0207679_10016801 Ga0207679_100168014 319
109 3300026095 Ga0207676_10001466 Ga0207676_100014667 319
110 3300046506 Ga0495583_0066259 Ga0495583_0066259_403_1434 319
111 3300046691 Ga0495670_0004799 Ga0495670_0004799_5440_6471 319
112 iso_pu_bacteria 2510917030 2511195577 320
113 iso_pu_bacteria 2585427530 2585553970 320
114 iso_pu_bacteria 2585427594 2585848029 320
115 iso_pu_bacteria 2643221599 2644003296 320
116 iso_pu_bacteria 2842922631 2842925267 320
117 iso_pu_bacteria 2855386786 2855387097 320
118 3300039447 Ga0436361_0462153 Ga0436361_0462153_3851_4831 321
119 3300044712 Ga0453684_0000065 Ga0453684_0000065_348380_349369 321
120 3300044712 Ga0453684_0003037 Ga0453684_0003037_7053_8033 321
121 3300044712 Ga0453684_0297727 Ga0453684_0297727_360_1334 321
122 3300045051 Ga0451576_0000325 Ga0451576_0000325_11804_12784 321
123 3300048903 Ga0496100_0065169 Ga0496100_0065169_1282_2259 321
124 3300048904 Ga0496101_0051243 Ga0496101_0051243_778_1755 321
125 3300048905 Ga0496102_0005013 Ga0496102_0005013_6556_7533 321
126 3300048906 Ga0496103_0046510 Ga0496103_0046510_1609_2586 321
127 3300048917 Ga0496114_0021179 Ga0496114_0021179_3419_4396 321
128 3300048924 Ga0496121_0008653 Ga0496121_0008653_3118_4092 321
129 iso_pu_bacteria 2513237138 2513868976 321
130 iso_pu_bacteria 2524023207 2524452122 321
131 iso_pu_bacteria 2585427530 2585555122 321
132 iso_pu_bacteria 2643221615 2644089906 321
133 iso_pu_bacteria 2643221657 2644319751 321
134 iso_pu_bacteria 2842871566 2842875173 321
135 3300009553 Ga0105249_10160098 Ga0105249_101600982 322
136 3300014326 Ga0157380_10010450 Ga0157380_100104504 322
137 3300028379 Ga0268266_10114872 Ga0268266_101148722 322
138 3300044712 Ga0453684_0265918 Ga0453684_0265918_622_1596 322
139 3300048927 Ga0496124_0000390 Ga0496124_0000390_5464_6447 322
140 iso_pu_bacteria 2511231004 2511257805 322
141 iso_pu_bacteria 2511231023 2511371659 322
142 iso_pu_bacteria 2511231035 2511433105 322
143 iso_pu_bacteria 2511231035 2511437259 322
144 iso_pu_bacteria 2511231156 2511825122 322
145 iso_pu_bacteria 2599185169 2599409392 322
146 iso_pu_bacteria 2600255287 2601643728 322
147 iso_pu_bacteria 2600255291 2601663552 322
148 iso_pu_bacteria 2600255298 2601696567 322
149 iso_pu_bacteria 2600255299 2601701184 322
150 iso_pu_bacteria 2600255303 2601721591 322
151 iso_pu_bacteria 2600255307 2601739932 322
152 iso_pu_bacteria 2600255309 2601750421 322
153 iso_pu_bacteria 2600255392 2602017674 322
154 iso_pu_bacteria 2602042052 2603660938 322
155 iso_pu_bacteria 2602042053 2603666212 322
156 iso_pu_bacteria 2602042066 2603697914 322
157 iso_pu_bacteria 2602042111 2603877025 322
158 iso_pu_bacteria 2603880184 2606070645 322
159 iso_pu_bacteria 2636415599 2637225288 322
160 iso_pu_bacteria 2643221689 2644498200 322
161 iso_pu_bacteria 2675903046 2676406537 322
162 iso_pu_bacteria 2739367756 2739793002 322
163 iso_pu_bacteria 2806310673 2807176779 322
164 iso_pu_bacteria 2818991461 2819683018 322
165 iso_pu_bacteria 2844528606 2844529751 322
166 iso_pu_bacteria 2852103415 2852108096 322
167 iso_pu_bacteria 2857564685 2857567803 322
168 iso_pu_bacteria 2865014394 2865014704 322
169 iso_pu_bacteria 2888373701 2888374792 322
170 iso_pu_bacteria 2904504865 2904508657 322
171 iso_pu_bacteria 2908669403 2908673891 322
172 iso_pu_bacteria 2919456309 2919461241 322
173 iso_pu_bacteria 2939573065 2939573338 322
174 iso_pu_bacteria 3007614139 3007614439 322
175 iso_pu_bacteria 8018176218 8018179758 322
176 iso_pu_bacteria 8018221730 8018222226 322
177 iso_pu_bacteria 8055087960 8055090080 322
178 iso_pu_bacteria 8055092621 8055093110 322
179 iso_pu_bacteria 8055693939 8055695740 322
180 iso_pu_bacteria 8056177738 8056182471 322
181 3300005981 Ga0081538_10059932 Ga0081538_100599323 323
182 3300021388 Ga0213875_10002238 Ga0213875_100022387 323
183 3300031616 Ga0307508_10080456 Ga0307508_100804563 323
184 3300037853 Ga0436364_0613787 Ga0436364_0613787_9705_10688 323
185 3300038443 Ga0395901_0085074 Ga0395901_0085074_1862_2845 323
186 3300045976 Ga0466967_0064875 Ga0466967_0064875_2022_2996 323
187 3300046472 Ga0495580_0014041 Ga0495580_0014041_4505_5488 323
188 3300046499 Ga0495594_0062851 Ga0495594_0062851_710_1693 323
189 3300046526 Ga0495666_0009884 Ga0495666_0009884_3051_4034 323
190 3300046531 Ga0495665_0020274 Ga0495665_0020274_2132_3115 323
191 3300046690 Ga0495624_0028114 Ga0495624_0028114_201_1184 323
192 3300047317 Ga0495604_0057310 Ga0495604_0057310_564_1547 323
193 iso_pu_bacteria 2510917022 2511131630 323
194 iso_pu_bacteria 2582581307 2585275104 323
195 iso_pu_bacteria 2585427531 2585561182 323
196 iso_pu_bacteria 2585427608 2585900045 323
197 iso_pu_bacteria 2585427609 2585908224 323
198 iso_pu_bacteria 2585428125 2587983741 323
199 iso_pu_bacteria 2857740372 2857743625 323
200 iso_pu_bacteria 2889415604 2889421354 323
201 iso_pu_bacteria 2904497146 2904500801 323
202 iso_pu_bacteria 2910809715 2910812536 323
203 iso_pu_bacteria 2939674588 2939675912 323
204 3300003794 Ga0055531_10049763 Ga0055531_100497631 324
205 3300005441 Ga0070700_100058445 Ga0070700_1000584452 324
206 3300005466 Ga0070685_10042375 Ga0070685_100423753 324
207 3300005578 Ga0068854_100014963 Ga0068854_1000149633 324
208 3300005985 Ga0081539_10037914 Ga0081539_100379143 324
209 3300006173 Ga0070716_100225132 Ga0070716_1002251322 324
210 3300006871 Ga0075434_100078047 Ga0075434_1000780473 324
211 3300006881 Ga0068865_100008092 Ga0068865_1000080925 324
212 3300006946 Ga0079104_1000014 Ga0079104_1000014174 324
213 3300009176 Ga0105242_10116979 Ga0105242_101169792 324
214 3300014325 Ga0163163_10347819 Ga0163163_103478191 324
215 3300014326 Ga0157380_10068862 Ga0157380_100688622 324
216 3300015685 Ga0183369_1003 Ga0183369_1003465 324
217 3300021388 Ga0213875_10010744 Ga0213875_100107443 324
218 3300025273 Ga0209673_1001925 Ga0209673_10019257 324
219 3300025292 Ga0209676_1000026 Ga0209676_100002687 324
220 3300025294 Ga0209025_1015065 Ga0209025_10150652 324
221 3300025297 Ga0209758_1012168 Ga0209758_10121686 324
222 3300025298 Ga0209050_1002021 Ga0209050_100202120 324
223 3300025303 Ga0209051_1001926 Ga0209051_10019265 324
224 3300025304 Ga0209257_1006118 Ga0209257_10061184 324
225 3300025940 Ga0207691_10078331 Ga0207691_100783312 324
226 3300025981 Ga0207640_10010117 Ga0207640_100101174 324
227 3300026075 Ga0207708_10015907 Ga0207708_100159072 324
228 3300027111 Ga0209281_1000032 Ga0209281_1000032174 324
229 3300028381 Ga0268264_10081099 Ga0268264_100810992 324
230 3300031911 Ga0307412_10001266 Ga0307412_1000126618 324
231 3300035695 Ga0373927_0038275 Ga0373927_0038275_89_1069 324
232 3300037853 Ga0436364_0471524 Ga0436364_0471524_4006_4989 324
233 3300038443 Ga0395901_0387040 Ga0395901_0387040_204_1193 324
234 3300041413 Ga0439465_0019909 Ga0439465_0019909_894_1877 324
235 3300044684 Ga0466966_0021607 Ga0466966_0021607_1150_2130 324
236 3300045836 Ga0466958_0066902 Ga0466958_0066902_1139_2119 324
237 3300046452 Ga0495617_009939 Ga0495617_009939_2198_3181 324
238 3300046460 Ga0495638_0000373 Ga0495638_0000373_12587_13570 324
239 3300046474 Ga0495605_0014986 Ga0495605_0014986_838_1821 324
240 3300046492 Ga0495585_0062695 Ga0495585_0062695_182_1165 324
241 3300046506 Ga0495583_0031047 Ga0495583_0031047_20_1003 324
242 3300046513 Ga0495616_0023716 Ga0495616_0023716_617_1600 324
243 3300046515 Ga0495620_0054395 Ga0495620_0054395_130_1113 324
244 3300046518 Ga0495631_0007732 Ga0495631_0007732_3076_4059 324
245 3300046519 Ga0495632_0038410 Ga0495632_0038410_457_1440 324
246 3300046525 Ga0495663_0067576 Ga0495663_0067576_104_1087 324
247 3300046616 Ga0495668_0007922 Ga0495668_0007922_4346_5329 324
248 3300046660 Ga0495625_0003377 Ga0495625_0003377_8867_9850 324
249 3300046810 Ga0495660_0022024 Ga0495660_0022024_714_1697 324
250 3300048911 Ga0496108_0069625 Ga0496108_0069625_1225_2205 324
251 3300048917 Ga0496114_0095352 Ga0496114_0095352_74_1054 324
252 3300048924 Ga0496121_0001253 Ga0496121_0001253_32955_33962 324
253 3300048928 Ga0496125_0009714 Ga0496125_0009714_5821_6810 324
254 3300049571 Ga0501034_0101163 Ga0501034_0101163_458_1462 324
255 3300050512 nmdc:mga0n895_104802_c1 nmdc:mga0n895_104802_c1_1658_2647 324
256 3300053079 Ga0500610_0075796 Ga0500610_0075796_347_1330 324
257 3300053109 Ga0500569_016973 Ga0500569_016973_59_1042 324
258 3300053118 Ga0500594_0000563 Ga0500594_0000563_6855_7838 324
259 3300053136 Ga0500559_0061927 Ga0500559_0061927_391_1374 324
260 3300053139 Ga0500568_0000168 Ga0500568_0000168_11459_12442 324
261 3300053153 Ga0500616_0001366 Ga0500616_0001366_10649_11632 324
262 3300003792 Ga0055540_1019204 Ga0055540_10192041 325
263 3300005327 Ga0070658_10041386 Ga0070658_100413862 325
264 3300005335 Ga0070666_10000003 Ga0070666_10000003248 325
265 3300005337 Ga0070682_100083490 Ga0070682_1000834903 325
266 3300005364 Ga0070673_100040702 Ga0070673_1000407023 325
267 3300005468 Ga0070707_100541745 Ga0070707_1005417451 325
268 3300006237 Ga0097621_100000417 Ga0097621_10000041715 325
269 3300006358 Ga0068871_100000652 Ga0068871_10000065220 325
270 3300009174 Ga0105241_10039319 Ga0105241_100393193 325
271 3300009551 Ga0105238_10002982 Ga0105238_100029824 325
272 3300009551 Ga0105238_10170473 Ga0105238_101704732 325
273 3300013296 Ga0157374_10171631 Ga0157374_101716312 325
274 3300013306 Ga0163162_10000378 Ga0163162_1000037841 325
275 3300025303 Ga0209051_1000151 Ga0209051_1000151114 325
276 3300025903 Ga0207680_10000006 Ga0207680_10000006395 325
277 3300025909 Ga0207705_10022230 Ga0207705_100222303 325
278 3300025911 Ga0207654_10019740 Ga0207654_100197402 325
279 3300025916 Ga0207663_10166018 Ga0207663_101660182 325
280 3300025924 Ga0207694_10148923 Ga0207694_101489232 325
281 3300025960 Ga0207651_10027598 Ga0207651_100275982 325
282 3300025986 Ga0207658_10128700 Ga0207658_101287001 325
283 3300026041 Ga0207639_10520976 Ga0207639_105209762 325
284 3300028379 Ga0268266_10000021 Ga0268266_10000021429 325
285 3300031507 Ga0307509_10000004 Ga0307509_10000004102 325
286 3300031665 Ga0316575_10012714 Ga0316575_100127143 325
287 3300044765 Ga0466970_0058034 Ga0466970_0058034_53_1039 325
288 3300046452 Ga0495617_048588 Ga0495617_048588_225_1247 325
289 3300046458 Ga0495591_016191 Ga0495591_016191_942_1934 325
290 3300046474 Ga0495605_0003775 Ga0495605_0003775_7717_8721 325
291 3300046501 Ga0495607_0078103 Ga0495607_0078103_796_1800 325
292 3300046518 Ga0495631_0005399 Ga0495631_0005399_4633_5637 325
293 3300046519 Ga0495632_0028749 Ga0495632_0028749_1674_2678 325
294 3300046524 Ga0495648_0004024 Ga0495648_0004024_8074_9066 325
295 3300046558 Ga0495633_0011667 Ga0495633_0011667_898_1890 325
296 3300046558 Ga0495633_0078976 Ga0495633_0078976_122_1108 325
297 3300046616 Ga0495668_0025823 Ga0495668_0025823_1235_2239 325
298 3300046648 Ga0495611_0001754 Ga0495611_0001754_6056_7060 325
299 3300046660 Ga0495625_0005925 Ga0495625_0005925_868_1872 325
300 3300046665 Ga0495661_0000861 Ga0495661_0000861_15622_16614 325
301 3300046810 Ga0495660_0053672 Ga0495660_0053672_626_1630 325
302 3300048904 Ga0496101_0008350 Ga0496101_0008350_4549_5529 325
303 3300048905 Ga0496102_0059670 Ga0496102_0059670_1213_2193 325
304 3300048910 Ga0496107_0162996 Ga0496107_0162996_288_1268 325
305 3300048918 Ga0496115_0001021 Ga0496115_0001021_6939_7919 325
306 3300048928 Ga0496125_0101591 Ga0496125_0101591_1087_2070 325
307 3300048929 Ga0496126_0299154 Ga0496126_0299154_168_1151 325
308 3300049573 Ga0501037_0176986 Ga0501037_0176986_79_1080 325
309 3300049580 Ga0501046_0350519 Ga0501046_0350519_60_1049 325
310 3300049581 Ga0501047_0228330 Ga0501047_0228330_320_1309 325
311 3300049586 Ga0501070_0166386 Ga0501070_0166386_489_1478 325
312 3300049742 Ga0501080_0313469 Ga0501080_0313469_25_1014 325
313 3300049744 Ga0501083_0105627 Ga0501083_0105627_469_1458 325
314 3300049823 Ga0501044_0160648 Ga0501044_0160648_379_1368 325
315 3300053086 Ga0500578_0131726 Ga0500578_0131726_483_1487 325
316 3300053088 Ga0500644_0000126 Ga0500644_0000126_16318_17304 325
317 3300053118 Ga0500594_0003332 Ga0500594_0003332_1440_2444 325
318 3300053125 Ga0500618_000344 Ga0500618_000344_20978_21964 325
319 3300053161 Ga0500634_0000185 Ga0500634_0000185_15592_16584 325
320 iso_pu_bacteria 2969079654 2969082261 325
321 3300002067 JGI24735J21928_10017115 JGI24735J21928_100171153 326
322 3300002737 JGI25162J39368_1000002 JGI25162J39368_100000296 326
323 3300002771 JGI25163J39215_1000043 JGI25163J39215_100004337 326
324 3300002772 JGI25164J39214_1000066 JGI25164J39214_100006621 326
325 3300003203 JGI25406J46586_10001789 JGI25406J46586_100017896 326
326 3300003751 Ga0055538_1000003 Ga0055538_100000396 326
327 3300003752 Ga0055539_1000003 Ga0055539_1000003521 326
328 3300003752 Ga0055539_1000836 Ga0055539_10008369 326
329 3300003756 Ga0055533_1000005 Ga0055533_1000005521 326
330 3300003756 Ga0055533_1007646 Ga0055533_10076461 326
331 3300003759 Ga0055525_1000005 Ga0055525_100000596 326
332 3300003760 Ga0055527_1000037 Ga0055527_10000377 326
333 3300003761 Ga0055535_1000059 Ga0055535_10000597 326
334 3300003762 Ga0055542_1000086 Ga0055542_100008689 326
335 3300003763 Ga0055529_1000231 Ga0055529_100023147 326
336 3300003841 Ga0055541_1000003 Ga0055541_100000396 326
337 3300003856 Ga0058692_1001201 Ga0058692_10012017 326
338 3300003856 Ga0058692_1009243 Ga0058692_10092435 326
339 3300005289 Ga0065704_10003190 Ga0065704_100031906 326
340 3300005289 Ga0065704_10190575 Ga0065704_101905751 326
341 3300005330 Ga0070690_100279182 Ga0070690_1002791821 326
342 3300005335 Ga0070666_10154762 Ga0070666_101547621 326
343 3300005340 Ga0070689_100007811 Ga0070689_1000078113 326
344 3300005355 Ga0070671_100092107 Ga0070671_1000921072 326
345 3300005355 Ga0070671_100284442 Ga0070671_1002844421 326
346 3300005435 Ga0070714_100019059 Ga0070714_1000190595 326
347 3300005436 Ga0070713_100000524 Ga0070713_1000005242 326
348 3300005439 Ga0070711_100108597 Ga0070711_1001085972 326
349 3300005445 Ga0070708_100288993 Ga0070708_1002889932 326
350 3300005455 Ga0070663_100006248 Ga0070663_1000062487 326
351 3300005458 Ga0070681_10028764 Ga0070681_100287645 326
352 3300005466 Ga0070685_10062077 Ga0070685_100620772 326
353 3300005467 Ga0070706_100161445 Ga0070706_1001614452 326
354 3300005530 Ga0070679_100191321 Ga0070679_1001913212 326
355 3300005547 Ga0070693_100008068 Ga0070693_1000080683 326
356 3300005548 Ga0070665_100027074 Ga0070665_1000270744 326
357 3300005548 Ga0070665_100065899 Ga0070665_1000658994 326
358 3300005549 Ga0070704_100182506 Ga0070704_1001825062 326
359 3300005563 Ga0068855_100004022 Ga0068855_1000040224 326
360 3300005577 Ga0068857_100016940 Ga0068857_1000169406 326
361 3300005614 Ga0068856_100001530 Ga0068856_10000153010 326
362 3300005614 Ga0068856_100003746 Ga0068856_1000037465 326
363 3300005614 Ga0068856_100079820 Ga0068856_1000798202 326
364 3300005617 Ga0068859_100013483 Ga0068859_1000134838 326
365 3300005617 Ga0068859_100123275 Ga0068859_1001232753 326
366 3300005617 Ga0068859_100320371 Ga0068859_1003203712 326
367 3300005618 Ga0068864_100128708 Ga0068864_1001287082 326
368 3300005841 Ga0068863_100108984 Ga0068863_1001089844 326
369 3300005842 Ga0068858_100061121 Ga0068858_1000611213 326
370 3300005983 Ga0081540_1118328 Ga0081540_11183281 326
371 3300005985 Ga0081539_10000045 Ga0081539_100000458 326
372 3300006175 Ga0070712_100092352 Ga0070712_1000923522 326
373 3300006237 Ga0097621_100016407 Ga0097621_1000164075 326
374 3300006358 Ga0068871_100111404 Ga0068871_1001114042 326
375 3300006358 Ga0068871_100560307 Ga0068871_1005603071 326
376 3300006844 Ga0075428_100469038 Ga0075428_1004690382 326
377 3300006871 Ga0075434_100317955 Ga0075434_1003179552 326
378 3300006931 Ga0097620_100013483 Ga0097620_1000134838 326
379 3300006931 Ga0097620_100123274 Ga0097620_1001232742 326
380 3300006931 Ga0097620_100320356 Ga0097620_1003203562 326
381 3300006946 Ga0079104_1000203 Ga0079104_100020352 326
382 3300006946 Ga0079104_1000357 Ga0079104_100035723 326
383 3300007076 Ga0075435_100091397 Ga0075435_1000913972 326
384 3300009011 Ga0105251_10000086 Ga0105251_1000008614 326
385 3300009011 Ga0105251_10000529 Ga0105251_1000052932 326
386 3300009011 Ga0105251_10027030 Ga0105251_100270302 326
387 3300009011 Ga0105251_10068242 Ga0105251_100682422 326
388 3300009011 Ga0105251_10080345 Ga0105251_100803452 326
389 3300009036 Ga0105244_10001832 Ga0105244_100018329 326
390 3300009036 Ga0105244_10006109 Ga0105244_100061098 326
391 3300009036 Ga0105244_10006547 Ga0105244_100065475 326
392 3300009036 Ga0105244_10009564 Ga0105244_100095642 326
393 3300009036 Ga0105244_10032598 Ga0105244_100325982 326
394 3300009036 Ga0105244_10045867 Ga0105244_100458672 326
395 3300009036 Ga0105244_10058537 Ga0105244_100585372 326
396 3300009092 Ga0105250_10000002 Ga0105250_1000000275 326
397 3300009092 Ga0105250_10000070 Ga0105250_1000007086 326
398 3300009092 Ga0105250_10000616 Ga0105250_100006164 326
399 3300009092 Ga0105250_10001404 Ga0105250_1000140410 326
400 3300009092 Ga0105250_10001622 Ga0105250_100016228 326
401 3300009093 Ga0105240_10003365 Ga0105240_1000336525 326
402 3300009093 Ga0105240_10006437 Ga0105240_1000643712 326
403 3300009093 Ga0105240_10098903 Ga0105240_100989031 326
404 3300009093 Ga0105240_10180679 Ga0105240_101806792 326
405 3300009098 Ga0105245_10007338 Ga0105245_100073384 326
406 3300009147 Ga0114129_10004675 Ga0114129_1000467516 326
407 3300009174 Ga0105241_10012596 Ga0105241_100125967 326
408 3300009174 Ga0105241_10019513 Ga0105241_100195132 326
409 3300009174 Ga0105241_10027715 Ga0105241_100277153 326
410 3300009177 Ga0105248_10005255 Ga0105248_1000525513 326
411 3300009177 Ga0105248_10029774 Ga0105248_100297744 326
412 3300009177 Ga0105248_10303395 Ga0105248_103033952 326
413 3300009545 Ga0105237_10016153 Ga0105237_100161538 326
414 3300009551 Ga0105238_10004919 Ga0105238_1000491912 326
415 3300009551 Ga0105238_10184975 Ga0105238_101849752 326
416 3300010375 Ga0105239_10007680 Ga0105239_100076809 326
417 3300010375 Ga0105239_10202198 Ga0105239_102021983 326
418 3300011119 Ga0105246_10000013 Ga0105246_1000001339 326
419 3300011119 Ga0105246_10002258 Ga0105246_100022589 326
420 3300013100 Ga0157373_10001081 Ga0157373_1000108113 326
421 3300013102 Ga0157371_10000092 Ga0157371_10000092113 326
422 3300013102 Ga0157371_10003279 Ga0157371_1000327913 326
423 3300013104 Ga0157370_10000596 Ga0157370_1000059613 326
424 3300013104 Ga0157370_10012653 Ga0157370_100126533 326
425 3300013105 Ga0157369_10005321 Ga0157369_100053212 326
426 3300013105 Ga0157369_10005711 Ga0157369_100057113 326
427 3300013105 Ga0157369_10050166 Ga0157369_100501662 326
428 3300013296 Ga0157374_10002768 Ga0157374_1000276813 326
429 3300013297 Ga0157378_10015715 Ga0157378_100157153 326
430 3300013297 Ga0157378_10047021 Ga0157378_100470213 326
431 3300013306 Ga0163162_10003202 Ga0163162_1000320212 326
432 3300013307 Ga0157372_10004147 Ga0157372_1000414713 326
433 3300013307 Ga0157372_10015595 Ga0157372_100155956 326
434 3300013307 Ga0157372_10041549 Ga0157372_100415494 326
435 3300013307 Ga0157372_10161897 Ga0157372_101618972 326
436 3300013308 Ga0157375_10006430 Ga0157375_100064305 326
437 3300013308 Ga0157375_10186084 Ga0157375_101860843 326
438 3300014325 Ga0163163_10002698 Ga0163163_100026983 326
439 3300014325 Ga0163163_10130540 Ga0163163_101305402 326
440 3300014968 Ga0157379_10327801 Ga0157379_103278011 326
441 3300015265 Ga0182005_1007744 Ga0182005_10077443 326
442 3300017792 Ga0163161_10075363 Ga0163161_100753633 326
443 3300017792 Ga0163161_10169251 Ga0163161_101692512 326
444 3300025207 Ga0209760_100005 Ga0209760_10000594 326
445 3300025224 Ga0209784_100001 Ga0209784_1000013279 326
446 3300025225 Ga0209566_100001 Ga0209566_1000013279 326
447 3300025226 Ga0209674_100002 Ga0209674_1000023279 326
448 3300025228 Ga0209672_100074 Ga0209672_10007487 326
449 3300025230 Ga0209563_100002 Ga0209563_1000021814 326
450 3300025231 Ga0207427_100009 Ga0207427_10000994 326
451 3300025233 Ga0209437_100001 Ga0209437_1000011814 326
452 3300025242 Ga0209258_100004 Ga0209258_1000041227 326
453 3300025242 Ga0209258_100008 Ga0209258_100008852 326
454 3300025253 Ga0209677_100002 Ga0209677_1000021814 326
455 3300025254 Ga0209148_1000041 Ga0209148_1000041354 326
456 3300025272 Ga0209455_1000007 Ga0209455_1000007972 326
457 3300025272 Ga0209455_1012340 Ga0209455_10123402 326
458 3300025297 Ga0209758_1005968 Ga0209758_100596810 326
459 3300025711 Ga0207696_1000038 Ga0207696_100003870 326
460 3300025711 Ga0207696_1000239 Ga0207696_100023940 326
461 3300025711 Ga0207696_1000304 Ga0207696_100030427 326
462 3300025711 Ga0207696_1000409 Ga0207696_10004094 326
463 3300025711 Ga0207696_1001046 Ga0207696_100104610 326
464 3300025711 Ga0207696_1007415 Ga0207696_10074155 326
465 3300025711 Ga0207696_1009567 Ga0207696_10095674 326
466 3300025711 Ga0207696_1009725 Ga0207696_10097253 326
467 3300025711 Ga0207696_1016060 Ga0207696_10160602 326
468 3300025728 Ga0207655_1000002 Ga0207655_10000021052 326
469 3300025728 Ga0207655_1000050 Ga0207655_1000050268 326
470 3300025728 Ga0207655_1006728 Ga0207655_10067289 326
471 3300025728 Ga0207655_1006972 Ga0207655_10069724 326
472 3300025728 Ga0207655_1010748 Ga0207655_10107486 326
473 3300025728 Ga0207655_1010981 Ga0207655_10109812 326
474 3300025728 Ga0207655_1014723 Ga0207655_10147235 326
475 3300025728 Ga0207655_1020027 Ga0207655_10200273 326
476 3300025728 Ga0207655_1035278 Ga0207655_10352783 326
477 3300025728 Ga0207655_1040444 Ga0207655_10404442 326
478 3300025735 Ga0207713_1000002 Ga0207713_1000002222 326
479 3300025735 Ga0207713_1000155 Ga0207713_100015572 326
480 3300025735 Ga0207713_1000191 Ga0207713_100019176 326
481 3300025735 Ga0207713_1002314 Ga0207713_10023148 326
482 3300025735 Ga0207713_1002406 Ga0207713_10024062 326
483 3300025735 Ga0207713_1005935 Ga0207713_10059358 326
484 3300025735 Ga0207713_1013106 Ga0207713_10131068 326
485 3300025735 Ga0207713_1013798 Ga0207713_10137982 326
486 3300025735 Ga0207713_1021959 Ga0207713_10219593 326
487 3300025903 Ga0207680_10051574 Ga0207680_100515742 326
488 3300025910 Ga0207684_10152884 Ga0207684_101528842 326
489 3300025911 Ga0207654_10000731 Ga0207654_100007319 326
490 3300025911 Ga0207654_10031820 Ga0207654_100318203 326
491 3300025912 Ga0207707_10031433 Ga0207707_100314332 326
492 3300025913 Ga0207695_10002224 Ga0207695_1000222415 326
493 3300025913 Ga0207695_10004845 Ga0207695_100048457 326
494 3300025913 Ga0207695_10005481 Ga0207695_100054816 326
495 3300025913 Ga0207695_10089305 Ga0207695_100893052 326
496 3300025914 Ga0207671_10007610 Ga0207671_100076109 326
497 3300025916 Ga0207663_10087888 Ga0207663_100878882 326
498 3300025922 Ga0207646_10181601 Ga0207646_101816012 326
499 3300025923 Ga0207681_10014667 Ga0207681_100146672 326
500 3300025924 Ga0207694_10001221 Ga0207694_1000122115 326
501 3300025924 Ga0207694_10027998 Ga0207694_100279982 326
502 3300025927 Ga0207687_10013607 Ga0207687_100136075 326
503 3300025928 Ga0207700_10000060 Ga0207700_1000006029 326
504 3300025928 Ga0207700_10091875 Ga0207700_100918751 326
505 3300025928 Ga0207700_10232259 Ga0207700_102322592 326
506 3300025929 Ga0207664_10011276 Ga0207664_100112765 326
507 3300025931 Ga0207644_10239124 Ga0207644_102391241 326
508 3300025939 Ga0207665_10104037 Ga0207665_101040372 326
509 3300025941 Ga0207711_10032837 Ga0207711_100328373 326
510 3300025941 Ga0207711_10050081 Ga0207711_100500811 326
511 3300025941 Ga0207711_10150749 Ga0207711_101507492 326
512 3300025944 Ga0207661_10218812 Ga0207661_102188122 326
513 3300025949 Ga0207667_10004385 Ga0207667_100043858 326
514 3300025972 Ga0207668_10094625 Ga0207668_100946252 326
515 3300026023 Ga0207677_10056750 Ga0207677_100567502 326
516 3300026035 Ga0207703_10049144 Ga0207703_100491443 326
517 3300026067 Ga0207678_10249812 Ga0207678_102498122 326
518 3300026078 Ga0207702_10001070 Ga0207702_1000107026 326
519 3300026078 Ga0207702_10076091 Ga0207702_100760911 326
520 3300026078 Ga0207702_10124682 Ga0207702_101246822 326
521 3300026088 Ga0207641_10058811 Ga0207641_100588113 326
522 3300026095 Ga0207676_10126349 Ga0207676_101263492 326
523 3300026121 Ga0207683_10312502 Ga0207683_103125022 326
524 3300027111 Ga0209281_1000338 Ga0209281_100033827 326
525 3300027296 Ga0209389_1000103 Ga0209389_10001031 326
526 3300027312 Ga0209371_1000017 Ga0209371_1000017153 326
527 3300027312 Ga0209371_1000577 Ga0209371_100057710 326
528 3300027312 Ga0209371_1001607 Ga0209371_100160710 326
529 3300028379 Ga0268266_10034222 Ga0268266_100342222 326
530 3300030500 Ga0268256_1000036 Ga0268256_1000036216 326
531 3300030500 Ga0268256_1000819 Ga0268256_100081914 326
532 3300030500 Ga0268256_1001390 Ga0268256_100139010 326
533 3300031241 Ga0265325_10043684 Ga0265325_100436842 326
534 3300031249 Ga0265339_10044702 Ga0265339_100447023 326
535 3300031548 Ga0307408_100095864 Ga0307408_1000958642 326
536 3300031595 Ga0265313_10027776 Ga0265313_100277764 326
537 3300031711 Ga0265314_10010456 Ga0265314_100104562 326
538 3300031911 Ga0307412_10044273 Ga0307412_100442732 326
539 3300036401 Ga0373937_0019256 Ga0373937_0019256_1726_2709 326
540 3300039437 Ga0436365_0203066 Ga0436365_0203066_106831_107820 326
541 3300041405 Ga0439438_016041 Ga0439438_016041_396_1385 326
542 3300041407 Ga0439447_000503 Ga0439447_000503_4952_5941 326
543 3300041407 Ga0439447_007866 Ga0439447_007866_2084_3073 326
544 3300041411 Ga0439466_0008252 Ga0439466_0008252_2183_3172 326
545 3300042016 Ga0439463_000015 Ga0439463_000015_19590_20579 326
546 3300042439 Ga0439464_0011013 Ga0439464_0011013_987_1976 326
547 3300044694 Ga0466963_0015844 Ga0466963_0015844_3656_4645 326
548 3300045051 Ga0451576_0004373 Ga0451576_0004373_4181_5167 326
549 3300045976 Ga0466967_0007112 Ga0466967_0007112_3481_4470 326
550 3300046452 Ga0495617_000166 Ga0495617_000166_7366_8355 326
551 3300046452 Ga0495617_013456 Ga0495617_013456_1769_2758 326
552 3300046452 Ga0495617_036485 Ga0495617_036485_246_1235 326
553 3300046455 Ga0495603_0000025 Ga0495603_0000025_7355_8374 326
554 3300046457 Ga0495590_0000306 Ga0495590_0000306_10395_11384 326
555 3300046458 Ga0495591_000002 Ga0495591_000002_149896_150885 326
556 3300046458 Ga0495591_000076 Ga0495591_000076_69467_70456 326
557 3300046458 Ga0495591_000545 Ga0495591_000545_2209_3219 326
558 3300046460 Ga0495638_0000477 Ga0495638_0000477_9720_10709 326
559 3300046460 Ga0495638_0001957 Ga0495638_0001957_1002_1991 326
560 3300046460 Ga0495638_0092687 Ga0495638_0092687_414_1403 326
561 3300046463 Ga0495653_0003212 Ga0495653_0003212_2998_3987 326
562 3300046463 Ga0495653_0044424 Ga0495653_0044424_2286_3275 326
563 3300046471 Ga0495650_0000031 Ga0495650_0000031_5798_6808 326
564 3300046471 Ga0495650_0001378 Ga0495650_0001378_12395_13384 326
565 3300046471 Ga0495650_0004885 Ga0495650_0004885_5132_6142 326
566 3300046471 Ga0495650_0006668 Ga0495650_0006668_602_1591 326
567 3300046472 Ga0495580_0000005 Ga0495580_0000005_50793_51782 326
568 3300046472 Ga0495580_0004911 Ga0495580_0004911_6537_7526 326
569 3300046472 Ga0495580_0005902 Ga0495580_0005902_760_1770 326
570 3300046474 Ga0495605_0000517 Ga0495605_0000517_5270_6412 326
571 3300046474 Ga0495605_0001304 Ga0495605_0001304_7273_8262 326
572 3300046491 Ga0495584_0036972 Ga0495584_0036972_342_1487 326
573 3300046492 Ga0495585_0002349 Ga0495585_0002349_11649_12638 326
574 3300046492 Ga0495585_0004774 Ga0495585_0004774_630_1619 326
575 3300046492 Ga0495585_0021020 Ga0495585_0021020_1917_2906 326
576 3300046501 Ga0495607_0003007 Ga0495607_0003007_5329_6336 326
577 3300046501 Ga0495607_0021248 Ga0495607_0021248_826_1815 326
578 3300046506 Ga0495583_0000059 Ga0495583_0000059_45452_46441 326
579 3300046506 Ga0495583_0003963 Ga0495583_0003963_6077_7066 326
580 3300046506 Ga0495583_0010191 Ga0495583_0010191_3121_4110 326
581 3300046507 Ga0495606_0001321 Ga0495606_0001321_27031_28020 326
582 3300046507 Ga0495606_0117543 Ga0495606_0117543_389_1378 326
583 3300046507 Ga0495606_0142562 Ga0495606_0142562_312_1301 326
584 3300046511 Ga0495608_0065502 Ga0495608_0065502_972_1961 326
585 3300046512 Ga0495610_0000848 Ga0495610_0000848_4750_5739 326
586 3300046512 Ga0495610_0001087 Ga0495610_0001087_9376_10365 326
587 3300046512 Ga0495610_0001982 Ga0495610_0001982_12628_13773 326
588 3300046512 Ga0495610_0022283 Ga0495610_0022283_2152_3141 326
589 3300046513 Ga0495616_0000165 Ga0495616_0000165_5483_6472 326
590 3300046515 Ga0495620_0001627 Ga0495620_0001627_2007_2996 326
591 3300046515 Ga0495620_0004873 Ga0495620_0004873_6422_7411 326
592 3300046516 Ga0495628_0312991 Ga0495628_0312991_154_1143 326
593 3300046517 Ga0495630_0091075 Ga0495630_0091075_421_1440 326
594 3300046517 Ga0495630_0189494 Ga0495630_0189494_175_1158 326
595 3300046518 Ga0495631_0000031 Ga0495631_0000031_28489_29478 326
596 3300046519 Ga0495632_0016673 Ga0495632_0016673_602_1747 326
597 3300046520 Ga0495637_0000365 Ga0495637_0000365_28242_29231 326
598 3300046520 Ga0495637_0021867 Ga0495637_0021867_898_1887 326
599 3300046522 Ga0495643_0000284 Ga0495643_0000284_38055_39044 326
600 3300046522 Ga0495643_0093138 Ga0495643_0093138_87_1232 326
601 3300046524 Ga0495648_0001897 Ga0495648_0001897_17827_18969 326
602 3300046524 Ga0495648_0026190 Ga0495648_0026190_317_1306 326
603 3300046529 Ga0495652_0048359 Ga0495652_0048359_2451_3440 326
604 3300046529 Ga0495652_0144169 Ga0495652_0144169_475_1458 326
605 3300046530 Ga0495654_0000069 Ga0495654_0000069_30036_31046 326
606 3300046530 Ga0495654_0000079 Ga0495654_0000079_48162_49151 326
607 3300046530 Ga0495654_0005114 Ga0495654_0005114_5638_6780 326
608 3300046530 Ga0495654_0021836 Ga0495654_0021836_464_1609 326
609 3300046530 Ga0495654_0054102 Ga0495654_0054102_690_1679 326
610 3300046533 Ga0495640_0114021 Ga0495640_0114021_162_1145 326
611 3300046539 Ga0495621_0001317 Ga0495621_0001317_2339_3328 326
612 3300046542 Ga0495597_0001260 Ga0495597_0001260_16791_17780 326
613 3300046542 Ga0495597_0062640 Ga0495597_0062640_272_1261 326
614 3300046557 Ga0495622_0001980 Ga0495622_0001980_5481_6500 326
615 3300046558 Ga0495633_0076960 Ga0495633_0076960_113_1102 326
616 3300046615 Ga0495656_0015779 Ga0495656_0015779_136_1125 326
617 3300046616 Ga0495668_0002790 Ga0495668_0002790_6729_7718 326
618 3300046616 Ga0495668_0065237 Ga0495668_0065237_236_1225 326
619 3300046648 Ga0495611_0006671 Ga0495611_0006671_2576_3565 326
620 3300046648 Ga0495611_0054525 Ga0495611_0054525_736_1725 326
621 3300046660 Ga0495625_0001743 Ga0495625_0001743_19249_20238 326
622 3300046660 Ga0495625_0005641 Ga0495625_0005641_7865_8854 326
623 3300046660 Ga0495625_0015936 Ga0495625_0015936_1817_2806 326
624 3300046674 Ga0495588_0001410 Ga0495588_0001410_5633_6652 326
625 3300046678 Ga0495599_0078903 Ga0495599_0078903_460_1449 326
626 3300046679 Ga0495623_0002958 Ga0495623_0002958_2899_3888 326
627 3300046679 Ga0495623_0011387 Ga0495623_0011387_1900_2883 326
628 3300046680 Ga0495646_0023944 Ga0495646_0023944_2742_3725 326
629 3300046680 Ga0495646_0046615 Ga0495646_0046615_1480_2469 326
630 3300046689 Ga0495613_0102040 Ga0495613_0102040_151_1134 326
631 3300046690 Ga0495624_0016322 Ga0495624_0016322_2666_3649 326
632 3300046691 Ga0495670_0004284 Ga0495670_0004284_2155_3144 326
633 3300046692 Ga0495671_0000446 Ga0495671_0000446_28369_29358 326
634 3300046692 Ga0495671_0002224 Ga0495671_0002224_318_1307 326
635 3300046694 Ga0495649_0000245 Ga0495649_0000245_22044_23033 326
636 3300046694 Ga0495649_0006297 Ga0495649_0006297_5769_6758 326
637 3300046694 Ga0495649_0008701 Ga0495649_0008701_1761_2750 326
638 3300046694 Ga0495649_0019004 Ga0495649_0019004_961_1971 326
639 3300046694 Ga0495649_0021669 Ga0495649_0021669_141_1286 326
640 3300046694 Ga0495649_0025203 Ga0495649_0025203_1299_2288 326
641 3300046794 Ga0495589_0011590 Ga0495589_0011590_1884_2873 326
642 3300046794 Ga0495589_0024759 Ga0495589_0024759_1107_2117 326
643 3300046794 Ga0495589_0046180 Ga0495589_0046180_130_1119 326
644 3300046809 Ga0495600_0029338 Ga0495600_0029338_1746_2735 326
645 3300046810 Ga0495660_0000016 Ga0495660_0000016_295944_296954 326
646 3300046810 Ga0495660_0000153 Ga0495660_0000153_40467_41456 326
647 3300046810 Ga0495660_0000302 Ga0495660_0000302_102_1091 326
648 3300046810 Ga0495660_0002788 Ga0495660_0002788_4009_5151 326
649 3300046810 Ga0495660_0020164 Ga0495660_0020164_1711_2700 326
650 3300046810 Ga0495660_0095053 Ga0495660_0095053_143_1132 326
651 3300047317 Ga0495604_0019379 Ga0495604_0019379_4300_5283 326
652 3300047317 Ga0495604_0022082 Ga0495604_0022082_592_1581 326
653 3300047319 Ga0495674_0008422 Ga0495674_0008422_7884_8873 326
654 3300047319 Ga0495674_0048003 Ga0495674_0048003_1054_2037 326
655 3300047320 Ga0495672_0000001 Ga0495672_0000001_525978_526988 326
656 3300047320 Ga0495672_0000037 Ga0495672_0000037_75339_76328 326
657 3300047320 Ga0495672_0002052 Ga0495672_0002052_6743_7732 326
658 3300047322 Ga0495680_0029851 Ga0495680_0029851_1834_2817 326
659 3300047323 Ga0495683_0002439 Ga0495683_0002439_3702_4721 326
660 3300047443 Ga0495687_013230 Ga0495687_013230_2798_3787 326
661 3300047443 Ga0495687_027145 Ga0495687_027145_315_1304 326
662 3300047444 Ga0495675_0046475 Ga0495675_0046475_799_1788 326
663 3300047446 Ga0495679_000590 Ga0495679_000590_11660_12649 326
664 3300047446 Ga0495679_017874 Ga0495679_017874_1320_2309 326
665 3300047446 Ga0495679_022488 Ga0495679_022488_568_1557 326
666 3300047469 Ga0495673_0000358 Ga0495673_0000358_46834_47823 326
667 3300047469 Ga0495673_0000753 Ga0495673_0000753_22040_23029 326
668 3300047470 Ga0495681_0006810 Ga0495681_0006810_34_1023 326
669 3300047470 Ga0495681_0009252 Ga0495681_0009252_1238_2383 326
670 3300047470 Ga0495681_0017092 Ga0495681_0017092_746_1735 326
671 3300047471 Ga0495684_0002068 Ga0495684_0002068_7443_8432 326
672 3300047472 Ga0495686_0000047 Ga0495686_0000047_15027_16016 326
673 3300047472 Ga0495686_0002819 Ga0495686_0002819_10914_12059 326
674 3300047673 Ga0495593_0013628 Ga0495593_0013628_1394_2413 326
675 3300048091 Ga0495626_0000374 Ga0495626_0000374_18835_19824 326
676 3300048091 Ga0495626_0005649 Ga0495626_0005649_3559_4548 326
677 3300048903 Ga0496100_0024105 Ga0496100_0024105_908_1891 326
678 3300048904 Ga0496101_0022200 Ga0496101_0022200_1569_2552 326
679 3300048905 Ga0496102_0119593 Ga0496102_0119593_416_1405 326
680 3300048907 Ga0496104_0202072 Ga0496104_0202072_600_1628 326
681 3300048908 Ga0496105_0252066 Ga0496105_0252066_361_1389 326
682 3300048909 Ga0496106_0090721 Ga0496106_0090721_1170_2213 326
683 3300048910 Ga0496107_0011893 Ga0496107_0011893_3417_4400 326
684 3300048910 Ga0496107_0028942 Ga0496107_0028942_123_1112 326
685 3300048911 Ga0496108_0349892 Ga0496108_0349892_155_1159 326
686 3300048912 Ga0496109_0422889 Ga0496109_0422889_36_1040 326
687 3300048913 Ga0496110_0010902 Ga0496110_0010902_3013_4002 326
688 3300048913 Ga0496110_0153019 Ga0496110_0153019_425_1414 326
689 3300048917 Ga0496114_0132976 Ga0496114_0132976_99_1082 326
690 3300048917 Ga0496114_0161162 Ga0496114_0161162_154_1137 326
691 3300048918 Ga0496115_0015041 Ga0496115_0015041_3744_4727 326
692 3300048918 Ga0496115_0109155 Ga0496115_0109155_976_1965 326
693 3300048919 Ga0496116_0000394 Ga0496116_0000394_29516_30505 326
694 3300048919 Ga0496116_0055403 Ga0496116_0055403_1038_2027 326
695 3300048920 Ga0496117_0001290 Ga0496117_0001290_32650_33639 326
696 3300048920 Ga0496117_0008509 Ga0496117_0008509_496_1485 326
697 3300048920 Ga0496117_0032627 Ga0496117_0032627_765_1754 326
698 3300048920 Ga0496117_0062710 Ga0496117_0062710_69_1058 326
699 3300048921 Ga0496118_0000048 Ga0496118_0000048_53522_54511 326
700 3300048921 Ga0496118_0000491 Ga0496118_0000491_29515_30504 326
701 3300048921 Ga0496118_0039071 Ga0496118_0039071_605_1594 326
702 3300048921 Ga0496118_0082682 Ga0496118_0082682_1191_2180 326
703 3300048924 Ga0496121_0000055 Ga0496121_0000055_240949_241938 326
704 3300048925 Ga0496122_0000810 Ga0496122_0000810_23914_24903 326
705 3300048926 Ga0496123_0001426 Ga0496123_0001426_29516_30505 326
706 3300048927 Ga0496124_0000445 Ga0496124_0000445_33342_34331 326
707 3300048927 Ga0496124_0000634 Ga0496124_0000634_44153_45142 326
708 3300048927 Ga0496124_0005976 Ga0496124_0005976_3628_4617 326
709 3300048927 Ga0496124_0009020 Ga0496124_0009020_1554_2543 326
710 3300048928 Ga0496125_0011442 Ga0496125_0011442_5975_6964 326
711 3300048929 Ga0496126_0069447 Ga0496126_0069447_455_1444 326
712 3300048929 Ga0496126_0073802 Ga0496126_0073802_776_1765 326
713 3300048929 Ga0496126_0120620 Ga0496126_0120620_815_1804 326
714 3300048929 Ga0496126_0161928 Ga0496126_0161928_609_1598 326
715 3300049459 Ga0495678_000091 Ga0495678_000091_28843_29853 326
716 3300049459 Ga0495678_002781 Ga0495678_002781_5371_6360 326
717 3300049459 Ga0495678_027486 Ga0495678_027486_75_1064 326
718 3300049460 Ga0495682_0000001 Ga0495682_0000001_572816_573826 326
719 3300049460 Ga0495682_0000152 Ga0495682_0000152_5478_6467 326
720 3300049460 Ga0495682_0000232 Ga0495682_0000232_23822_24811 326
721 3300049460 Ga0495682_0004828 Ga0495682_0004828_3281_4270 326
722 3300049460 Ga0495682_0007557 Ga0495682_0007557_757_1746 326
723 3300049460 Ga0495682_0023301 Ga0495682_0023301_1093_2112 326
724 3300049460 Ga0495682_0051776 Ga0495682_0051776_376_1365 326
725 3300049586 Ga0501070_0040644 Ga0501070_0040644_1868_2857 326
726 3300049742 Ga0501080_0033932 Ga0501080_0033932_3507_4496 326
727 3300050491 nmdc:mga00v17_4678_c1 nmdc:mga00v17_4678_c1_4187_5176 326
728 3300050507 nmdc:mga05p37_3097_c1 nmdc:mga05p37_3097_c1_1117_2106 326
729 3300050507 nmdc:mga05p37_4683_c1 nmdc:mga05p37_4683_c1_12635_13624 326
730 3300050508 nmdc:mga09592_14038_c1 nmdc:mga09592_14038_c1_3764_4753 326
731 3300050512 nmdc:mga0n895_352619_c1 nmdc:mga0n895_352619_c1_76_1065 326
732 3300050513 nmdc:mga0rr50_38934_c1 nmdc:mga0rr50_38934_c1_1224_2213 326
733 3300053077 Ga0495601_0076363 Ga0495601_0076363_238_1221 326
734 3300053085 Ga0495619_0036206 Ga0495619_0036206_1179_2162 326
735 3300053087 Ga0500643_000024 Ga0500643_000024_219699_220688 326
736 3300053118 Ga0500594_0000661 Ga0500594_0000661_2029_3018 326
737 3300053125 Ga0500618_000116 Ga0500618_000116_24222_25211 326
738 3300053125 Ga0500618_000269 Ga0500618_000269_11625_12614 326
739 3300053126 Ga0500621_000002 Ga0500621_000002_580257_581267 326
740 3300053139 Ga0500568_0053025 Ga0500568_0053025_515_1507 326
741 3300053177 Ga0500636_0028376 Ga0500636_0028376_1651_2640 326
742 3300055283 Ga0500661_003130 Ga0500661_003130_300_1289 326
743 3300002067 JGI24735J21928_10011974 JGI24735J21928_100119743 327
744 3300003203 JGI25406J46586_10026758 JGI25406J46586_100267583 327
745 3300005343 Ga0070687_100209289 Ga0070687_1002092891 327
746 3300005435 Ga0070714_100049176 Ga0070714_1000491762 327
747 3300005455 Ga0070663_100024663 Ga0070663_1000246632 327
748 3300005467 Ga0070706_100301189 Ga0070706_1003011892 327
749 3300005468 Ga0070707_100258966 Ga0070707_1002589661 327
750 3300005518 Ga0070699_100229057 Ga0070699_1002290572 327
751 3300005535 Ga0070684_100182823 Ga0070684_1001828232 327
752 3300005546 Ga0070696_100004816 Ga0070696_1000048165 327
753 3300005564 Ga0070664_100059919 Ga0070664_1000599192 327
754 3300005616 Ga0068852_100130625 Ga0068852_1001306251 327
755 3300005617 Ga0068859_100031068 Ga0068859_1000310682 327
756 3300005618 Ga0068864_100382674 Ga0068864_1003826742 327
757 3300005843 Ga0068860_100283232 Ga0068860_1002832322 327
758 3300006844 Ga0075428_100161311 Ga0075428_1001613112 327
759 3300006881 Ga0068865_100236845 Ga0068865_1002368451 327
760 3300006914 Ga0075436_100031864 Ga0075436_1000318647 327
761 3300006914 Ga0075436_100049846 Ga0075436_1000498463 327
762 3300006914 Ga0075436_100121580 Ga0075436_1001215802 327
763 3300006931 Ga0097620_100031068 Ga0097620_1000310682 327
764 3300009545 Ga0105237_10121831 Ga0105237_101218312 327
765 3300013105 Ga0157369_10047903 Ga0157369_100479034 327
766 3300013296 Ga0157374_10033334 Ga0157374_100333342 327
767 3300013296 Ga0157374_10104431 Ga0157374_101044313 327
768 3300013297 Ga0157378_10158133 Ga0157378_101581332 327
769 3300013306 Ga0163162_10108982 Ga0163162_101089821 327
770 3300013307 Ga0157372_10053886 Ga0157372_100538863 327
771 3300013307 Ga0157372_10099595 Ga0157372_100995957 327
772 3300013307 Ga0157372_10104030 Ga0157372_101040302 327
773 3300014325 Ga0163163_10272001 Ga0163163_102720012 327
774 3300014968 Ga0157379_10151341 Ga0157379_101513411 327
775 3300017792 Ga0163161_10018993 Ga0163161_100189934 327
776 3300025910 Ga0207684_10257587 Ga0207684_102575872 327
777 3300025929 Ga0207664_10114864 Ga0207664_101148642 327
778 3300025941 Ga0207711_10014531 Ga0207711_100145312 327
779 3300026023 Ga0207677_10070454 Ga0207677_100704543 327
780 3300026035 Ga0207703_10038574 Ga0207703_100385743 327
781 3300026067 Ga0207678_10022979 Ga0207678_100229797 327
782 3300027907 Ga0207428_10005919 Ga0207428_1000591930 327
783 3300027907 Ga0207428_10026747 Ga0207428_100267473 327
784 3300028381 Ga0268264_10192436 Ga0268264_101924362 327
785 3300028800 Ga0265338_10018014 Ga0265338_100180144 327
786 3300031344 Ga0265316_10132332 Ga0265316_101323322 327
787 3300031911 Ga0307412_10049883 Ga0307412_100498832 327
788 3300031995 Ga0307409_100100442 Ga0307409_1001004421 327
789 3300044712 Ga0453684_0123407 Ga0453684_0123407_247_1269 327
790 3300045051 Ga0451576_0507514 Ga0451576_0507514_158_1150 327
791 3300046463 Ga0495653_0006291 Ga0495653_0006291_5456_6454 327
792 3300046477 Ga0495664_0012766 Ga0495664_0012766_847_1845 327
793 3300046511 Ga0495608_0001348 Ga0495608_0001348_9023_10021 327
794 3300046516 Ga0495628_0001615 Ga0495628_0001615_15579_16577 327
795 3300046517 Ga0495630_0055415 Ga0495630_0055415_1796_2794 327
796 3300046529 Ga0495652_0000812 Ga0495652_0000812_11385_12383 327
797 3300046536 Ga0495587_0001718 Ga0495587_0001718_12658_13656 327
798 3300046543 Ga0495645_0016029 Ga0495645_0016029_1725_2723 327
799 3300046559 Ga0495667_0000215 Ga0495667_0000215_13952_14950 327
800 3300046663 Ga0495635_0046015 Ga0495635_0046015_161_1159 327
801 3300046675 Ga0495657_0006599 Ga0495657_0006599_6134_7132 327
802 3300047319 Ga0495674_0000271 Ga0495674_0000271_7038_8036 327
803 3300047322 Ga0495680_0002950 Ga0495680_0002950_9478_10476 327
804 3300047444 Ga0495675_0000354 Ga0495675_0000354_14835_15833 327
805 3300047471 Ga0495684_0020764 Ga0495684_0020764_1813_2811 327
806 3300048088 Ga0495602_0059737 Ga0495602_0059737_449_1447 327
807 3300048908 Ga0496105_0179163 Ga0496105_0179163_558_1553 327
808 3300048912 Ga0496109_0010551 Ga0496109_0010551_5997_6992 327
809 3300050514 nmdc:mga08x19_17316_c1 nmdc:mga08x19_17316_c1_2680_3678 327
810 3300050514 nmdc:mga08x19_25250_c1 nmdc:mga08x19_25250_c1_2247_3236 327
811 3300050514 nmdc:mga08x19_34963_c1 nmdc:mga08x19_34963_c1_1844_2833 327
812 3300053103 Ga0500555_020364 Ga0500555_020364_188_1180 327
813 3300053134 Ga0500658_0046104 Ga0500658_0046104_358_1350 327
814 3300053731 Ga0500609_000501 Ga0500609_000501_3073_4092 327

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

68

363

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3v0u-assembly1.cif.gz_A crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding 0.9395 1 306
3v0t-assembly1.cif.gz_A crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding 0.9312 1 309
1pz1-assembly2.cif.gz_B structure of nadph-dependent family 11 aldo-keto reductase akr11b(holo) 0.9075 1 318
3v0u-assembly1.cif.gz_A crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding 0.907 1 306
8hnq-assembly1.cif.gz_A the structure of a alcohol dehydrogenase akr13b2 with nadp 0.9069 3 303
ID Description Score Start End Superfamily
af_Q09923_6_337_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9486 4 326 3.20.20.100
af_F4HPY8_8_325_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9475 1 319 3.20.20.100
af_A0A1D6KUU8_358_629_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9435 73 327 3.20.20.100
af_A0A0R0ETH2_7_234_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9409 1 223 3.20.20.100
3v0uA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9395 1 306 3.20.20.100
ID Description Score Start End GO Terms
AF-A0A328TDJ7-F1-model_v4 Aldo/keto reductase family protein 1.002 121 204 GO:0004033
GO:0005737
AF-A0A2V9HFB4-F1-model_v4 Aldo/keto reductase 0.9891 1 324 GO:0004033
GO:0005737
AF-A0A3B9ANH9-F1-model_v4 Aldo/keto reductase 0.9888 77 317 GO:0004033
GO:0005737
AF-A0A2V5YE55-F1-model_v4 Aldo/keto reductase 0.9871 1 327 GO:0004033
GO:0005737
AF-A0A7X1W0Z7-F1-model_v4 deleted 0.9855 1 327

Feature Viewer

pLDDT pTM Quality
94.88 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map