F481949
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 813 | 312 | 1626 | 128 |
Family's Representative Sequence
| Representative Sequence | 3300045976|Ga0466967_0174093|Ga0466967_0174093_984_1403 |
| Length | 139 |
| Sequence | VPARTNVDGGELMKDVVRTEEAPAPFQGAPYSQAIKAGGFVFVSGQLALRPGDKELTGGDIGAQTEQVFANLRAILEEAGTSLDNLVKTTVFLQSLDDFPGMNEVYARHVGDRPPARSTFEVAKLPSGALVEIEAIAVV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 2 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 3 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 33 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 39 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 41 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 42 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 43 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 44 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 45 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 46 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 47 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 49 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 50 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 51 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 52 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 55 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 56 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 57 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 58 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 59 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 60 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009979 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG | Metagenome | Rhizosphere |
| 69 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 82 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 84 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 85 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 87 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 88 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 89 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 90 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 91 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 92 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 93 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 94 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 134 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 135 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 136 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 137 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 138 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 139 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 140 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 141 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 142 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 143 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 144 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 145 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 146 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 147 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 148 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 149 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 150 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 151 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 152 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 153 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 154 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 155 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 156 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 157 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 158 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 159 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 160 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 161 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 162 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 163 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 164 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 165 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 166 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 167 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 168 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 169 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 170 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 171 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 172 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 173 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 174 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 175 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 176 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 177 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 178 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 179 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 180 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 181 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 182 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 183 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 184 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 185 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 186 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 187 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 188 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 189 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 190 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 191 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 192 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 193 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 194 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 245 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 246 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 247 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 248 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 249 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 250 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 251 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 252 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 253 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 254 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 255 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 256 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 257 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 258 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 261 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 263 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 266 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 285 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 293 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 294 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 295 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 296 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 297 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 298 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 299 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 303 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 308 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 309 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 310 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 312 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.42 |
| Metatranscriptomes | 2.58 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.35 |
| Nodule | 0 |
| Rhizoplane | 5.17 |
| Rhizosphere | 92.37 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.67 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0466967_0174093 | 3300045976 | Bacteria | 2027 |
| 2 | ARcpr5yngRDRAFT_c009150 | 3300000043 | Bacteria | 850 |
| 3 | JGI25406J46586_10012777 | 3300003203 | Bacteria | 3629 |
| 4 | Ga0070658_10004687 | 3300005327 | Bacteria | 11121 |
| 5 | Ga0070658_10018852 | 3300005327 | Bacteria | 5528 |
| 6 | Ga0070658_10025917 | 3300005327 | Bacteria | 4703 |
| 7 | Ga0070658_10126258 | 3300005327 | Bacteria | 2130 |
| 8 | Ga0070658_10161685 | 3300005327 | Bacteria | 1879 |
| 9 | Ga0070683_100043116 | 3300005329 | Bacteria | 4157 |
| 10 | Ga0070683_100535026 | 3300005329 | Bacteria | 1120 |
| 11 | Ga0070683_100911877 | 3300005329 | Bacteria | 843 |
| 12 | Ga0068869_100782064 | 3300005334 | Bacteria | 819 |
| 13 | Ga0070680_100049617 | 3300005336 | Bacteria | 3422 |
| 14 | Ga0070680_100071703 | 3300005336 | Bacteria | 2847 |
| 15 | Ga0070680_100075275 | 3300005336 | Bacteria | 2779 |
| 16 | Ga0070680_100132801 | 3300005336 | Bacteria | 2083 |
| 17 | Ga0070680_100532137 | 3300005336 | Bacteria | 1007 |
| 18 | Ga0070680_101124444 | 3300005336 | Bacteria | 679 |
| 19 | Ga0070680_101390491 | 3300005336 | Bacteria | 608 |
| 20 | Ga0070682_100014049 | 3300005337 | Bacteria | 4621 |
| 21 | Ga0070682_100483153 | 3300005337 | Bacteria | 956 |
| 22 | Ga0068868_100905099 | 3300005338 | Bacteria | 802 |
| 23 | Ga0070660_100006831 | 3300005339 | Bacteria | 7915 |
| 24 | Ga0070660_100071852 | 3300005339 | Bacteria | 2702 |
| 25 | Ga0070660_100083629 | 3300005339 | Bacteria | 2508 |
| 26 | Ga0070660_100406854 | 3300005339 | Bacteria | 1126 |
| 27 | Ga0070660_100407973 | 3300005339 | Bacteria | 1124 |
| 28 | Ga0070660_100524484 | 3300005339 | Bacteria | 987 |
| 29 | Ga0070660_100842311 | 3300005339 | Bacteria | 772 |
| 30 | Ga0070660_100975063 | 3300005339 | Bacteria | 716 |
| 31 | Ga0070691_10010579 | 3300005341 | Bacteria | 4213 |
| 32 | Ga0070691_11044090 | 3300005341 | Bacteria | 512 |
| 33 | Ga0070661_100160608 | 3300005344 | Bacteria | 1702 |
| 34 | Ga0070661_100188448 | 3300005344 | Bacteria | 1572 |
| 35 | Ga0070661_100263508 | 3300005344 | Bacteria | 1333 |
| 36 | Ga0070692_10079398 | 3300005345 | Bacteria | 1764 |
| 37 | Ga0070692_11381647 | 3300005345 | Bacteria | 508 |
| 38 | Ga0070668_100034965 | 3300005347 | Bacteria | 3830 |
| 39 | Ga0070673_101112713 | 3300005364 | Bacteria | 738 |
| 40 | Ga0070688_100290120 | 3300005365 | Bacteria | 1179 |
| 41 | Ga0070659_100062810 | 3300005366 | Bacteria | 2937 |
| 42 | Ga0070659_100078192 | 3300005366 | Bacteria | 2639 |
| 43 | Ga0070659_100353014 | 3300005366 | Bacteria | 1234 |
| 44 | Ga0070709_10039607 | 3300005434 | Bacteria | 2892 |
| 45 | Ga0070714_100021504 | 3300005435 | Bacteria | 5279 |
| 46 | Ga0070714_100055021 | 3300005435 | Bacteria | 3401 |
| 47 | Ga0070714_100061376 | 3300005435 | Bacteria | 3229 |
| 48 | Ga0070714_100065591 | 3300005435 | Bacteria | 3128 |
| 49 | Ga0070714_100070904 | 3300005435 | Bacteria | 3012 |
| 50 | Ga0070714_100240189 | 3300005435 | Bacteria | 1672 |
| 51 | Ga0070714_101085325 | 3300005435 | Bacteria | 780 |
| 52 | Ga0070713_100027432 | 3300005436 | Bacteria | 4483 |
| 53 | Ga0070694_101361767 | 3300005444 | Bacteria | 598 |
| 54 | Ga0070708_100015521 | 3300005445 | Bacteria | 6294 |
| 55 | Ga0070663_100431492 | 3300005455 | Unclassified | 1083 |
| 56 | Ga0070681_10037270 | 3300005458 | Bacteria | 4880 |
| 57 | Ga0070681_10052366 | 3300005458 | Bacteria | 4071 |
| 58 | Ga0070681_10065908 | 3300005458 | Bacteria | 3590 |
| 59 | Ga0070681_10072699 | 3300005458 | Bacteria | 3401 |
| 60 | Ga0070681_10078526 | 3300005458 | Bacteria | 3258 |
| 61 | Ga0070681_10095066 | 3300005458 | Bacteria | 2929 |
| 62 | Ga0070681_11226197 | 3300005458 | Bacteria | 672 |
| 63 | Ga0070706_100085991 | 3300005467 | Bacteria | 2914 |
| 64 | Ga0070707_100208481 | 3300005468 | Bacteria | 1905 |
| 65 | Ga0070707_101117960 | 3300005468 | Bacteria | 754 |
| 66 | Ga0070707_101712958 | 3300005468 | Unclassified | 596 |
| 67 | Ga0070698_100076590 | 3300005471 | Bacteria | 3346 |
| 68 | Ga0070698_100383730 | 3300005471 | Unclassified | 1338 |
| 69 | Ga0070699_100083715 | 3300005518 | Bacteria | 2783 |
| 70 | Ga0070679_100048987 | 3300005530 | Bacteria | 4208 |
| 71 | Ga0070679_100104119 | 3300005530 | Bacteria | 2824 |
| 72 | Ga0070679_100108736 | 3300005530 | Bacteria | 2759 |
| 73 | Ga0070679_100173941 | 3300005530 | Bacteria | 2126 |
| 74 | Ga0070679_100314963 | 3300005530 | Bacteria | 1514 |
| 75 | Ga0070679_100820855 | 3300005530 | Bacteria | 873 |
| 76 | Ga0070684_100058856 | 3300005535 | Bacteria | 3359 |
| 77 | Ga0070684_100124613 | 3300005535 | Bacteria | 2320 |
| 78 | Ga0070684_100209430 | 3300005535 | Bacteria | 1777 |
| 79 | Ga0070684_100217954 | 3300005535 | Bacteria | 1741 |
| 80 | Ga0070684_100378887 | 3300005535 | Bacteria | 1303 |
| 81 | Ga0070697_101060670 | 3300005536 | Unclassified | 721 |
| 82 | Ga0068853_100873977 | 3300005539 | Bacteria | 863 |
| 83 | Ga0070686_101193177 | 3300005544 | Bacteria | 632 |
| 84 | Ga0070696_100244473 | 3300005546 | Unclassified | 1355 |
| 85 | Ga0070693_100010919 | 3300005547 | Bacteria | 4562 |
| 86 | Ga0070693_100538696 | 3300005547 | Bacteria | 834 |
| 87 | Ga0070693_100921848 | 3300005547 | Unclassified | 656 |
| 88 | Ga0070665_100441279 | 3300005548 | Bacteria | 1311 |
| 89 | Ga0070704_101499375 | 3300005549 | Bacteria | 620 |
| 90 | Ga0068855_100015442 | 3300005563 | Bacteria | 9192 |
| 91 | Ga0068855_100053923 | 3300005563 | Bacteria | 4730 |
| 92 | Ga0068855_100311094 | 3300005563 | Bacteria | 1743 |
| 93 | Ga0068855_100882109 | 3300005563 | Bacteria | 946 |
| 94 | Ga0070664_100464727 | 3300005564 | Bacteria | 1163 |
| 95 | Ga0070664_101048793 | 3300005564 | Bacteria | 767 |
| 96 | Ga0070664_101173734 | 3300005564 | Bacteria | 724 |
| 97 | Ga0070664_102336762 | 3300005564 | Bacteria | 507 |
| 98 | Ga0068856_101180489 | 3300005614 | Bacteria | 782 |
| 99 | Ga0068852_100044134 | 3300005616 | Bacteria | 3784 |
| 100 | Ga0068852_101185750 | 3300005616 | Bacteria | 785 |
| 101 | Ga0068852_101260555 | 3300005616 | Bacteria | 761 |
| 102 | Ga0068861_100222521 | 3300005719 | Bacteria | 1596 |
| 103 | Ga0068851_10628077 | 3300005834 | Bacteria | 656 |
| 104 | Ga0068858_101552979 | 3300005842 | Bacteria | 653 |
| 105 | Ga0081455_10026678 | 3300005937 | Bacteria | 5306 |
| 106 | Ga0081455_10273205 | 3300005937 | Bacteria | 1225 |
| 107 | Ga0081539_10001263 | 3300005985 | Bacteria | 44753 |
| 108 | Ga0081539_10232842 | 3300005985 | Bacteria | 830 |
| 109 | Ga0070717_10110292 | 3300006028 | Bacteria | 2346 |
| 110 | Ga0075365_10201497 | 3300006038 | Bacteria | 1394 |
| 111 | Ga0075365_11104564 | 3300006038 | Bacteria | 558 |
| 112 | Ga0075368_10196784 | 3300006042 | Bacteria | 852 |
| 113 | Ga0075368_10262288 | 3300006042 | Bacteria | 740 |
| 114 | Ga0075364_10212667 | 3300006051 | Bacteria | 1311 |
| 115 | Ga0075432_10000710 | 3300006058 | Bacteria | 10274 |
| 116 | Ga0070716_100065566 | 3300006173 | Bacteria | 2115 |
| 117 | Ga0070716_100129755 | 3300006173 | Bacteria | 1592 |
| 118 | Ga0070716_100638845 | 3300006173 | Bacteria | 806 |
| 119 | Ga0070716_101614393 | 3300006173 | Bacteria | 533 |
| 120 | Ga0070712_100462857 | 3300006175 | Bacteria | 1058 |
| 121 | Ga0070712_101065059 | 3300006175 | Bacteria | 701 |
| 122 | Ga0075367_10570627 | 3300006178 | Bacteria | 719 |
| 123 | Ga0075428_100045698 | 3300006844 | Bacteria | 4811 |
| 124 | Ga0075428_101725180 | 3300006844 | Bacteria | 653 |
| 125 | Ga0075433_10122023 | 3300006852 | Bacteria | 2314 |
| 126 | Ga0075433_10311517 | 3300006852 | Bacteria | 1393 |
| 127 | Ga0075433_10582498 | 3300006852 | Bacteria | 983 |
| 128 | Ga0075434_100161024 | 3300006871 | Bacteria | 2264 |
| 129 | Ga0075434_100234829 | 3300006871 | Bacteria | 1853 |
| 130 | Ga0075434_101246424 | 3300006871 | Bacteria | 755 |
| 131 | Ga0075429_100169046 | 3300006880 | Bacteria | 1915 |
| 132 | Ga0075435_100284233 | 3300007076 | Bacteria | 1412 |
| 133 | Ga0105240_10293897 | 3300009093 | Bacteria | 1861 |
| 134 | Ga0105240_10581031 | 3300009093 | Bacteria | 1236 |
| 135 | Ga0111539_10003299 | 3300009094 | Bacteria | 21326 |
| 136 | Ga0111539_10478330 | 3300009094 | Bacteria | 1450 |
| 137 | Ga0111539_11187224 | 3300009094 | Unclassified | 886 |
| 138 | Ga0111539_11415158 | 3300009094 | Bacteria | 807 |
| 139 | Ga0105245_10039768 | 3300009098 | Bacteria | 4186 |
| 140 | Ga0105245_10328996 | 3300009098 | Unclassified | 1507 |
| 141 | Ga0105245_10604445 | 3300009098 | Bacteria | 1123 |
| 142 | Ga0105245_11576654 | 3300009098 | Unclassified | 708 |
| 143 | Ga0105245_11728651 | 3300009098 | Bacteria | 678 |
| 144 | Ga0114129_10004297 | 3300009147 | Bacteria | 20136 |
| 145 | Ga0114129_10135692 | 3300009147 | Bacteria | 3376 |
| 146 | Ga0114129_10162742 | 3300009147 | Bacteria | 3047 |
| 147 | Ga0114129_11027455 | 3300009147 | Bacteria | 1036 |
| 148 | Ga0105241_10251780 | 3300009174 | Bacteria | 1498 |
| 149 | Ga0105242_10307687 | 3300009176 | Bacteria | 1449 |
| 150 | Ga0105238_10227782 | 3300009551 | Bacteria | 1841 |
| 151 | Ga0105238_10419299 | 3300009551 | Bacteria | 1333 |
| 152 | Ga0105238_11787926 | 3300009551 | Bacteria | 646 |
| 153 | Ga0105249_10226067 | 3300009553 | Bacteria | 1844 |
| 154 | Ga0105032_110179 | 3300009979 | Bacteria | 762 |
| 155 | Ga0105239_10904072 | 3300010375 | Bacteria | 1013 |
| 156 | Ga0105239_11067279 | 3300010375 | Bacteria | 929 |
| 157 | Ga0105239_11658493 | 3300010375 | Bacteria | 740 |
| 158 | Ga0157373_10088541 | 3300013100 | Bacteria | 2181 |
| 159 | Ga0157371_10187229 | 3300013102 | Bacteria | 1481 |
| 160 | Ga0157371_10385155 | 3300013102 | Bacteria | 1024 |
| 161 | Ga0157370_10005407 | 3300013104 | Bacteria | 14328 |
| 162 | Ga0157370_10026276 | 3300013104 | Bacteria | 5751 |
| 163 | Ga0157370_10112036 | 3300013104 | Bacteria | 2550 |
| 164 | Ga0157370_10747347 | 3300013104 | Bacteria | 891 |
| 165 | Ga0157370_11526826 | 3300013104 | Bacteria | 600 |
| 166 | Ga0157369_10004504 | 3300013105 | Bacteria | 16412 |
| 167 | Ga0157369_10009525 | 3300013105 | Bacteria | 11106 |
| 168 | Ga0157369_10556034 | 3300013105 | Bacteria | 1186 |
| 169 | Ga0157369_11808295 | 3300013105 | Unclassified | 620 |
| 170 | Ga0157374_10384204 | 3300013296 | Bacteria | 1399 |
| 171 | Ga0157374_10965040 | 3300013296 | Bacteria | 871 |
| 172 | Ga0157378_10314890 | 3300013297 | Bacteria | 1519 |
| 173 | Ga0163162_10500389 | 3300013306 | Bacteria | 1346 |
| 174 | Ga0157372_10400258 | 3300013307 | Bacteria | 1600 |
| 175 | Ga0157372_10700359 | 3300013307 | Bacteria | 1179 |
| 176 | Ga0157372_10786527 | 3300013307 | Bacteria | 1106 |
| 177 | Ga0157372_11819967 | 3300013307 | Bacteria | 700 |
| 178 | Ga0157372_13198665 | 3300013307 | Bacteria | 522 |
| 179 | Ga0157372_13341283 | 3300013307 | Archaea | 511 |
| 180 | Ga0157375_10198332 | 3300013308 | Bacteria | 2162 |
| 181 | Ga0157375_10646307 | 3300013308 | Bacteria | 1214 |
| 182 | Ga0157375_13521087 | 3300013308 | Bacteria | 521 |
| 183 | Ga0163163_10308875 | 3300014325 | Bacteria | 1634 |
| 184 | Ga0157380_10388310 | 3300014326 | Bacteria | 1320 |
| 185 | Ga0182008_10006444 | 3300014497 | Bacteria | 6562 |
| 186 | Ga0182008_10084038 | 3300014497 | Bacteria | 1567 |
| 187 | Ga0182008_10095018 | 3300014497 | Bacteria | 1471 |
| 188 | Ga0182008_10533565 | 3300014497 | Bacteria | 650 |
| 189 | Ga0157377_11688452 | 3300014745 | Archaea | 510 |
| 190 | Ga0182006_1016966 | 3300015261 | Bacteria | 3101 |
| 191 | Ga0182006_1120768 | 3300015261 | Bacteria | 910 |
| 192 | Ga0182006_1275331 | 3300015261 | Bacteria | 552 |
| 193 | Ga0182007_10050930 | 3300015262 | Bacteria | 1367 |
| 194 | Ga0182007_10160578 | 3300015262 | Bacteria | 768 |
| 195 | Ga0163161_11945725 | 3300017792 | Bacteria | 523 |
| 196 | Ga0197907_10220929 | 3300020069 | Bacteria | 1217 |
| 197 | Ga0197907_11303737 | 3300020069 | Bacteria | 7047 |
| 198 | Ga0206356_10464478 | 3300020070 | Bacteria | 6018 |
| 199 | Ga0206356_10732343 | 3300020070 | Bacteria | 1237 |
| 200 | Ga0206356_10744457 | 3300020070 | Bacteria | 1219 |
| 201 | Ga0206356_10886950 | 3300020070 | Bacteria | 1015 |
| 202 | Ga0206356_11626683 | 3300020070 | Bacteria | 1885 |
| 203 | Ga0206356_11721452 | 3300020070 | Bacteria | 989 |
| 204 | Ga0206349_1470884 | 3300020075 | Bacteria | 777 |
| 205 | Ga0206352_10016425 | 3300020078 | Bacteria | 568 |
| 206 | Ga0206352_11240383 | 3300020078 | Bacteria | 844 |
| 207 | Ga0206354_10591732 | 3300020081 | Bacteria | 3016 |
| 208 | Ga0206354_10666366 | 3300020081 | Bacteria | 1250 |
| 209 | Ga0206354_10741748 | 3300020081 | Bacteria | 1061 |
| 210 | Ga0206354_11589568 | 3300020081 | Bacteria | 751 |
| 211 | Ga0206353_10345868 | 3300020082 | Bacteria | 638 |
| 212 | Ga0206353_10481260 | 3300020082 | Bacteria | 5357 |
| 213 | Ga0206353_11434971 | 3300020082 | Bacteria | 1947 |
| 214 | Ga0206353_11448681 | 3300020082 | Bacteria | 3287 |
| 215 | Ga0206353_11898434 | 3300020082 | Bacteria | 2512 |
| 216 | Ga0213876_10061542 | 3300021384 | Bacteria | 1981 |
| 217 | Ga0213871_10193442 | 3300021441 | Bacteria | 632 |
| 218 | Ga0207688_10033313 | 3300025901 | Bacteria | 2849 |
| 219 | Ga0207699_10040027 | 3300025906 | Bacteria | 2698 |
| 220 | Ga0207699_10097455 | 3300025906 | Bacteria | 1858 |
| 221 | Ga0207699_10307322 | 3300025906 | Bacteria | 1109 |
| 222 | Ga0207699_10373498 | 3300025906 | Bacteria | 1011 |
| 223 | Ga0207699_10502580 | 3300025906 | Bacteria | 875 |
| 224 | Ga0207705_10001180 | 3300025909 | Bacteria | 21214 |
| 225 | Ga0207705_10098191 | 3300025909 | Bacteria | 2151 |
| 226 | Ga0207705_10257385 | 3300025909 | Bacteria | 1332 |
| 227 | Ga0207705_10416913 | 3300025909 | Bacteria | 1039 |
| 228 | Ga0207684_10050994 | 3300025910 | Bacteria | 3511 |
| 229 | Ga0207684_10233343 | 3300025910 | Bacteria | 1587 |
| 230 | Ga0207684_10727593 | 3300025910 | Bacteria | 842 |
| 231 | Ga0207684_11027945 | 3300025910 | Unclassified | 688 |
| 232 | Ga0207707_10050054 | 3300025912 | Bacteria | 3641 |
| 233 | Ga0207707_10105593 | 3300025912 | Bacteria | 2462 |
| 234 | Ga0207707_10116914 | 3300025912 | Bacteria | 2331 |
| 235 | Ga0207707_10365357 | 3300025912 | Bacteria | 1242 |
| 236 | Ga0207707_10654774 | 3300025912 | Bacteria | 885 |
| 237 | Ga0207707_10790212 | 3300025912 | Unclassified | 791 |
| 238 | Ga0207695_10072423 | 3300025913 | Bacteria | 3516 |
| 239 | Ga0207695_11433087 | 3300025913 | Archaea | 571 |
| 240 | Ga0207693_10981419 | 3300025915 | Bacteria | 646 |
| 241 | Ga0207660_10007442 | 3300025917 | Bacteria | 7086 |
| 242 | Ga0207660_10088277 | 3300025917 | Bacteria | 2293 |
| 243 | Ga0207660_10200305 | 3300025917 | Bacteria | 1559 |
| 244 | Ga0207660_10328473 | 3300025917 | Bacteria | 1222 |
| 245 | Ga0207660_10404057 | 3300025917 | Bacteria | 1100 |
| 246 | Ga0207660_10511511 | 3300025917 | Bacteria | 975 |
| 247 | Ga0207657_10020763 | 3300025919 | Bacteria | 6199 |
| 248 | Ga0207657_10056284 | 3300025919 | Bacteria | 3393 |
| 249 | Ga0207657_10068835 | 3300025919 | Bacteria | 3006 |
| 250 | Ga0207657_10153907 | 3300025919 | Bacteria | 1871 |
| 251 | Ga0207657_10342951 | 3300025919 | Bacteria | 1179 |
| 252 | Ga0207657_10878072 | 3300025919 | Bacteria | 691 |
| 253 | Ga0207649_10041403 | 3300025920 | Bacteria | 2804 |
| 254 | Ga0207649_10185058 | 3300025920 | Bacteria | 1461 |
| 255 | Ga0207649_10275607 | 3300025920 | Bacteria | 1221 |
| 256 | Ga0207652_10031119 | 3300025921 | Bacteria | 4478 |
| 257 | Ga0207652_10049166 | 3300025921 | Bacteria | 3609 |
| 258 | Ga0207652_10139411 | 3300025921 | Bacteria | 2168 |
| 259 | Ga0207652_10213651 | 3300025921 | Bacteria | 1737 |
| 260 | Ga0207652_10286065 | 3300025921 | Bacteria | 1487 |
| 261 | Ga0207652_11589025 | 3300025921 | Bacteria | 558 |
| 262 | Ga0207646_10230746 | 3300025922 | Bacteria | 1672 |
| 263 | Ga0207646_10353124 | 3300025922 | Bacteria | 1329 |
| 264 | Ga0207646_10591503 | 3300025922 | Bacteria | 996 |
| 265 | Ga0207694_10235159 | 3300025924 | Bacteria | 1497 |
| 266 | Ga0207687_10041456 | 3300025927 | Bacteria | 3161 |
| 267 | Ga0207687_10150182 | 3300025927 | Bacteria | 1777 |
| 268 | Ga0207700_10000006 | 3300025928 | Bacteria | 348187 |
| 269 | Ga0207664_10025149 | 3300025929 | Bacteria | 4481 |
| 270 | Ga0207664_10051144 | 3300025929 | Bacteria | 3261 |
| 271 | Ga0207664_10067110 | 3300025929 | Bacteria | 2877 |
| 272 | Ga0207664_10725809 | 3300025929 | Unclassified | 893 |
| 273 | Ga0207664_11280459 | 3300025929 | Bacteria | 652 |
| 274 | Ga0207664_11300842 | 3300025929 | Bacteria | 646 |
| 275 | Ga0207664_11760424 | 3300025929 | Unclassified | 542 |
| 276 | Ga0207690_10037272 | 3300025932 | Bacteria | 3156 |
| 277 | Ga0207690_10110580 | 3300025932 | Bacteria | 1978 |
| 278 | Ga0207690_10206989 | 3300025932 | Bacteria | 1493 |
| 279 | Ga0207690_11305055 | 3300025932 | Bacteria | 607 |
| 280 | Ga0207686_10103796 | 3300025934 | Bacteria | 1903 |
| 281 | Ga0207709_10138263 | 3300025935 | Bacteria | 1671 |
| 282 | Ga0207669_11521182 | 3300025937 | Unclassified | 571 |
| 283 | Ga0207704_10246455 | 3300025938 | Bacteria | 1338 |
| 284 | Ga0207665_10011299 | 3300025939 | Bacteria | 5861 |
| 285 | Ga0207665_10016548 | 3300025939 | Bacteria | 4845 |
| 286 | Ga0207665_10542096 | 3300025939 | Bacteria | 903 |
| 287 | Ga0207665_10872933 | 3300025939 | Bacteria | 713 |
| 288 | Ga0207665_11116920 | 3300025939 | Bacteria | 628 |
| 289 | Ga0207711_10812862 | 3300025941 | Bacteria | 870 |
| 290 | Ga0207661_10056796 | 3300025944 | Bacteria | 3144 |
| 291 | Ga0207661_10395042 | 3300025944 | Bacteria | 1253 |
| 292 | Ga0207661_10570496 | 3300025944 | Bacteria | 1037 |
| 293 | Ga0207661_11880639 | 3300025944 | Bacteria | 544 |
| 294 | Ga0207679_10436284 | 3300025945 | Bacteria | 1159 |
| 295 | Ga0207679_10535143 | 3300025945 | Bacteria | 1049 |
| 296 | Ga0207679_10743766 | 3300025945 | Bacteria | 892 |
| 297 | Ga0207667_10142082 | 3300025949 | Bacteria | 2472 |
| 298 | Ga0207667_10177105 | 3300025949 | Bacteria | 2191 |
| 299 | Ga0207667_10373439 | 3300025949 | Bacteria | 1453 |
| 300 | Ga0207667_10375247 | 3300025949 | Unclassified | 1449 |
| 301 | Ga0207667_10685593 | 3300025949 | Bacteria | 1028 |
| 302 | Ga0207667_10820032 | 3300025949 | Bacteria | 926 |
| 303 | Ga0207712_11383394 | 3300025961 | Bacteria | 630 |
| 304 | Ga0207668_10465114 | 3300025972 | Bacteria | 1082 |
| 305 | Ga0207640_10181631 | 3300025981 | Bacteria | 1578 |
| 306 | Ga0207640_10738932 | 3300025981 | Bacteria | 847 |
| 307 | Ga0207677_10265191 | 3300026023 | Bacteria | 1402 |
| 308 | Ga0207677_10354975 | 3300026023 | Bacteria | 1230 |
| 309 | Ga0207677_11715514 | 3300026023 | Bacteria | 582 |
| 310 | Ga0207678_10437706 | 3300026067 | Bacteria | 1135 |
| 311 | Ga0207708_10045354 | 3300026075 | Bacteria | 3350 |
| 312 | Ga0207708_10633271 | 3300026075 | Bacteria | 909 |
| 313 | Ga0207702_10107306 | 3300026078 | Bacteria | 2476 |
| 314 | Ga0207702_11001439 | 3300026078 | Bacteria | 829 |
| 315 | Ga0207702_11197043 | 3300026078 | Bacteria | 754 |
| 316 | Ga0207648_10151471 | 3300026089 | Bacteria | 2046 |
| 317 | Ga0207676_10363021 | 3300026095 | Bacteria | 1343 |
| 318 | Ga0207674_10460237 | 3300026116 | Bacteria | 1229 |
| 319 | Ga0207675_100244684 | 3300026118 | Bacteria | 1734 |
| 320 | Ga0207698_10100651 | 3300026142 | Bacteria | 2394 |
| 321 | Ga0207698_10184701 | 3300026142 | Bacteria | 1851 |
| 322 | Ga0207698_11275278 | 3300026142 | Bacteria | 749 |
| 323 | Ga0207698_12035934 | 3300026142 | Bacteria | 588 |
| 324 | Ga0209813_10225089 | 3300027866 | Bacteria | 704 |
| 325 | Ga0207428_10000401 | 3300027907 | Bacteria | 53789 |
| 326 | Ga0207428_10398988 | 3300027907 | Bacteria | 1007 |
| 327 | Ga0265318_10018498 | 3300028577 | Bacteria | 2842 |
| 328 | Ga0265318_10098219 | 3300028577 | Bacteria | 1078 |
| 329 | Ga0265318_10116016 | 3300028577 | Bacteria | 984 |
| 330 | Ga0265323_10192301 | 3300028653 | Bacteria | 644 |
| 331 | Ga0265338_10003455 | 3300028800 | Bacteria | 22237 |
| 332 | Ga0265338_10049628 | 3300028800 | Bacteria | 3802 |
| 333 | Ga0265338_10051124 | 3300028800 | Bacteria | 3725 |
| 334 | Ga0265338_10085957 | 3300028800 | Bacteria | 2620 |
| 335 | Ga0265338_10233461 | 3300028800 | Bacteria | 1367 |
| 336 | Ga0265324_10333788 | 3300029957 | Bacteria | 517 |
| 337 | Ga0265328_10195428 | 3300031239 | Bacteria | 767 |
| 338 | Ga0265320_10086528 | 3300031240 | Bacteria | 1457 |
| 339 | Ga0265320_10089791 | 3300031240 | Bacteria | 1424 |
| 340 | Ga0265340_10020255 | 3300031247 | Bacteria | 3422 |
| 341 | Ga0265327_10021452 | 3300031251 | Bacteria | 3897 |
| 342 | Ga0265316_10500350 | 3300031344 | Bacteria | 868 |
| 343 | Ga0265313_10166004 | 3300031595 | Bacteria | 935 |
| 344 | Ga0265314_10578058 | 3300031711 | Bacteria | 581 |
| 345 | Ga0307409_102404801 | 3300031995 | Bacteria | 556 |
| 346 | Ga0316583_10046486 | 3300032133 | Bacteria | 1532 |
| 347 | Ga0373926_0031150 | 3300035083 | Bacteria | 1880 |
| 348 | Ga0373926_0112757 | 3300035083 | Unclassified | 1022 |
| 349 | Ga0373944_0004206 | 3300035089 | Bacteria | 3741 |
| 350 | Ga0373936_0628326 | 3300035113 | Bacteria | 505 |
| 351 | Ga0373957_0060207 | 3300035120 | Bacteria | 1470 |
| 352 | Ga0373960_0050424 | 3300035121 | Bacteria | 1234 |
| 353 | Ga0373943_0027736 | 3300035170 | Bacteria | 2663 |
| 354 | Ga0373943_0043730 | 3300035170 | Bacteria | 2177 |
| 355 | Ga0373946_0396822 | 3300035171 | Bacteria | 696 |
| 356 | Ga0373955_0182486 | 3300035172 | Bacteria | 1246 |
| 357 | Ga0373924_0052850 | 3300035410 | Bacteria | 1687 |
| 358 | Ga0373931_0179907 | 3300035691 | Bacteria | 1251 |
| 359 | Ga0373931_0723483 | 3300035691 | Unclassified | 659 |
| 360 | Ga0373931_0806519 | 3300035691 | Bacteria | 626 |
| 361 | Ga0373935_0355925 | 3300035692 | Bacteria | 1044 |
| 362 | Ga0373927_0080501 | 3300035695 | Bacteria | 2111 |
| 363 | Ga0373933_0132320 | 3300035724 | Bacteria | 1569 |
| 364 | Ga0373947_0000788 | 3300035725 | Bacteria | 19051 |
| 365 | Ga0373937_0046196 | 3300036401 | Bacteria | 3981 |
| 366 | Ga0373925_0005147 | 3300037068 | Bacteria | 9799 |
| 367 | Ga0373925_1239127 | 3300037068 | Bacteria | 613 |
| 368 | Ga0395899_0041176 | 3300037312 | Bacteria | 3452 |
| 369 | Ga0395899_0042016 | 3300037312 | Bacteria | 3414 |
| 370 | Ga0395899_0048425 | 3300037312 | Bacteria | 3163 |
| 371 | Ga0395899_0193396 | 3300037312 | Bacteria | 1422 |
| 372 | Ga0395899_0321991 | 3300037312 | Bacteria | 1041 |
| 373 | Ga0395900_0005654 | 3300037418 | Bacteria | 13077 |
| 374 | Ga0395900_0092431 | 3300037418 | Bacteria | 3108 |
| 375 | Ga0395900_0135451 | 3300037418 | Bacteria | 2523 |
| 376 | Ga0395900_0211541 | 3300037418 | Bacteria | 1958 |
| 377 | Ga0395900_0310907 | 3300037418 | Bacteria | 1559 |
| 378 | Ga0395900_0833300 | 3300037418 | Bacteria | 849 |
| 379 | Ga0395900_0907059 | 3300037418 | Bacteria | 804 |
| 380 | Ga0395900_1281410 | 3300037418 | Bacteria | 647 |
| 381 | Ga0395898_0014811 | 3300037466 | Bacteria | 8004 |
| 382 | Ga0395898_0014884 | 3300037466 | Bacteria | 7985 |
| 383 | Ga0395898_0029176 | 3300037466 | Bacteria | 5527 |
| 384 | Ga0395898_0068700 | 3300037466 | Bacteria | 3428 |
| 385 | Ga0395898_0084262 | 3300037466 | Bacteria | 3064 |
| 386 | Ga0395898_0373200 | 3300037466 | Bacteria | 1360 |
| 387 | Ga0395898_0449678 | 3300037466 | Unclassified | 1227 |
| 388 | Ga0395898_0584289 | 3300037466 | Bacteria | 1059 |
| 389 | Ga0395898_0596478 | 3300037466 | Bacteria | 1047 |
| 390 | Ga0395905_0013996 | 3300037471 | Bacteria | 7674 |
| 391 | Ga0395905_0075998 | 3300037471 | Bacteria | 3147 |
| 392 | Ga0395905_0076956 | 3300037471 | Bacteria | 3126 |
| 393 | Ga0395905_0097204 | 3300037471 | Bacteria | 2765 |
| 394 | Ga0395905_0111338 | 3300037471 | Bacteria | 2571 |
| 395 | Ga0395905_0141672 | 3300037471 | Bacteria | 2261 |
| 396 | Ga0395905_1660557 | 3300037471 | Bacteria | 544 |
| 397 | Ga0395905_1767494 | 3300037471 | Bacteria | 524 |
| 398 | Ga0436364_0144090 | 3300037853 | Bacteria | 1382 |
| 399 | Ga0436364_1394280 | 3300037853 | Bacteria | 524 |
| 400 | Ga0395901_0003421 | 3300038443 | Bacteria | 15994 |
| 401 | Ga0395901_0021860 | 3300038443 | Bacteria | 6555 |
| 402 | Ga0395901_0023493 | 3300038443 | Bacteria | 6322 |
| 403 | Ga0395901_0091537 | 3300038443 | Bacteria | 3184 |
| 404 | Ga0395901_0119399 | 3300038443 | Bacteria | 2771 |
| 405 | Ga0395901_0291184 | 3300038443 | Bacteria | 1694 |
| 406 | Ga0395901_0309866 | 3300038443 | Bacteria | 1635 |
| 407 | Ga0395901_0401552 | 3300038443 | Bacteria | 1408 |
| 408 | Ga0395901_0402326 | 3300038443 | Bacteria | 1406 |
| 409 | Ga0395901_0904561 | 3300038443 | Bacteria | 864 |
| 410 | Ga0395901_1053749 | 3300038443 | Bacteria | 786 |
| 411 | Ga0436365_1136723 | 3300039437 | Bacteria | 1051 |
| 412 | Ga0436365_1666332 | 3300039437 | Bacteria | 4837 |
| 413 | Ga0436365_1869413 | 3300039437 | Bacteria | 740 |
| 414 | Ga0436360_1329995 | 3300039438 | Bacteria | 5061 |
| 415 | Ga0436363_0717714 | 3300039450 | Bacteria | 4850 |
| 416 | Ga0436363_0885272 | 3300039450 | Bacteria | 1109 |
| 417 | Ga0436362_1022240 | 3300039453 | Bacteria | 790 |
| 418 | Ga0439461_0001850 | 3300041410 | Bacteria | 3329 |
| 419 | Ga0439465_0101872 | 3300041413 | Bacteria | 992 |
| 420 | Ga0451793_1435797 | 3300041452 | Unclassified | 702 |
| 421 | Ga0451853_2537051 | 3300041512 | Bacteria | 524 |
| 422 | Ga0439433_0103282 | 3300041999 | Bacteria | 709 |
| 423 | Ga0439433_0143183 | 3300041999 | Bacteria | 612 |
| 424 | Ga0450907_031836 | 3300042146 | Bacteria | 897 |
| 425 | Ga0439446_0019958 | 3300042156 | Bacteria | 1885 |
| 426 | Ga0439460_0285564 | 3300042461 | Bacteria | 575 |
| 427 | Ga0466969_0549886 | 3300044656 | Bacteria | 528 |
| 428 | Ga0466969_0607601 | 3300044656 | Bacteria | 502 |
| 429 | Ga0466965_0054924 | 3300044683 | Bacteria | 1981 |
| 430 | Ga0466966_0159841 | 3300044684 | Bacteria | 1372 |
| 431 | Ga0466961_0010006 | 3300044693 | Bacteria | 6042 |
| 432 | Ga0466963_0003862 | 3300044694 | Bacteria | 8649 |
| 433 | Ga0466963_0011736 | 3300044694 | Bacteria | 5342 |
| 434 | Ga0466963_0018482 | 3300044694 | Bacteria | 4359 |
| 435 | Ga0466963_0039027 | 3300044694 | Bacteria | 3108 |
| 436 | Ga0466963_0139904 | 3300044694 | Bacteria | 1676 |
| 437 | Ga0466963_0146855 | 3300044694 | Bacteria | 1636 |
| 438 | Ga0466963_0188360 | 3300044694 | Bacteria | 1441 |
| 439 | Ga0466963_0220219 | 3300044694 | Bacteria | 1329 |
| 440 | Ga0466963_0392183 | 3300044694 | Bacteria | 979 |
| 441 | Ga0466963_0447393 | 3300044694 | Bacteria | 911 |
| 442 | Ga0466963_0456821 | 3300044694 | Bacteria | 901 |
| 443 | Ga0466963_0643418 | 3300044694 | Bacteria | 748 |
| 444 | Ga0466963_0782153 | 3300044694 | Bacteria | 673 |
| 445 | Ga0466964_0039397 | 3300044706 | Bacteria | 1904 |
| 446 | Ga0466964_0081981 | 3300044706 | Bacteria | 1386 |
| 447 | Ga0466964_0125310 | 3300044706 | Bacteria | 1163 |
| 448 | Ga0466964_0136915 | 3300044706 | Bacteria | 1121 |
| 449 | Ga0466964_0300557 | 3300044706 | Bacteria | 809 |
| 450 | Ga0466971_0000282 | 3300044719 | Bacteria | 19481 |
| 451 | Ga0466971_0044380 | 3300044719 | Bacteria | 1996 |
| 452 | Ga0466968_0665389 | 3300044735 | Bacteria | 530 |
| 453 | Ga0466957_0002174 | 3300044842 | Bacteria | 10505 |
| 454 | Ga0466957_0028021 | 3300044842 | Bacteria | 3351 |
| 455 | Ga0466957_0046539 | 3300044842 | Bacteria | 2634 |
| 456 | Ga0466957_0065994 | 3300044842 | Bacteria | 2230 |
| 457 | Ga0466957_0243922 | 3300044842 | Bacteria | 1193 |
| 458 | Ga0466957_0309487 | 3300044842 | Bacteria | 1063 |
| 459 | Ga0466957_0606494 | 3300044842 | Bacteria | 767 |
| 460 | Ga0466957_1339944 | 3300044842 | Bacteria | 520 |
| 461 | Ga0466960_0044779 | 3300044901 | Bacteria | 2111 |
| 462 | Ga0466960_0500503 | 3300044901 | Bacteria | 712 |
| 463 | Ga0466960_0799274 | 3300044901 | Bacteria | 571 |
| 464 | Ga0466959_0007644 | 3300045049 | Bacteria | 7601 |
| 465 | Ga0451576_0042887 | 3300045051 | Bacteria | 4776 |
| 466 | Ga0466958_0004124 | 3300045836 | Bacteria | 7626 |
| 467 | Ga0466958_0015851 | 3300045836 | Bacteria | 4330 |
| 468 | Ga0466958_0019424 | 3300045836 | Bacteria | 3955 |
| 469 | Ga0466958_0023275 | 3300045836 | Bacteria | 3634 |
| 470 | Ga0466958_0276899 | 3300045836 | Bacteria | 1075 |
| 471 | Ga0466958_0442206 | 3300045836 | Bacteria | 841 |
| 472 | Ga0466958_0727261 | 3300045836 | Bacteria | 647 |
| 473 | Ga0466967_0006616 | 3300045976 | Bacteria | 8236 |
| 474 | Ga0466967_0015053 | 3300045976 | Bacteria | 6052 |
| 475 | Ga0466967_0022962 | 3300045976 | Bacteria | 5103 |
| 476 | Ga0466967_0034499 | 3300045976 | Bacteria | 4295 |
| 477 | Ga0466967_0050081 | 3300045976 | Bacteria | 3656 |
| 478 | Ga0466967_0085814 | 3300045976 | Bacteria | 2851 |
| 479 | Ga0466967_0088039 | 3300045976 | Bacteria | 2817 |
| 480 | Ga0466967_0096813 | 3300045976 | Bacteria | 2692 |
| 481 | Ga0466967_0120331 | 3300045976 | Bacteria | 2425 |
| 482 | Ga0466967_0159082 | 3300045976 | Bacteria | 2119 |
| 483 | Ga0466967_0200135 | 3300045976 | Bacteria | 1891 |
| 484 | Ga0466967_0222440 | 3300045976 | Bacteria | 1794 |
| 485 | Ga0466967_0282740 | 3300045976 | Bacteria | 1592 |
| 486 | Ga0466967_0420303 | 3300045976 | Bacteria | 1303 |
| 487 | Ga0466967_0570802 | 3300045976 | Bacteria | 1114 |
| 488 | Ga0466967_0715749 | 3300045976 | Bacteria | 992 |
| 489 | Ga0466967_0897370 | 3300045976 | Bacteria | 881 |
| 490 | Ga0466967_0911846 | 3300045976 | Bacteria | 874 |
| 491 | Ga0466967_0912896 | 3300045976 | Bacteria | 873 |
| 492 | Ga0466967_1419681 | 3300045976 | Bacteria | 691 |
| 493 | Ga0466967_1802156 | 3300045976 | Bacteria | 609 |
| 494 | Ga0495592_0020890 | 3300046454 | Bacteria | 4981 |
| 495 | Ga0495592_0354905 | 3300046454 | Bacteria | 939 |
| 496 | Ga0495603_0000648 | 3300046455 | Bacteria | 19609 |
| 497 | Ga0495603_0242861 | 3300046455 | Bacteria | 1037 |
| 498 | Ga0495629_0281023 | 3300046459 | Bacteria | 1142 |
| 499 | Ga0495641_0001526 | 3300046461 | Bacteria | 19677 |
| 500 | Ga0495641_0148198 | 3300046461 | Unclassified | 1048 |
| 501 | Ga0495651_0040631 | 3300046462 | Bacteria | 3617 |
| 502 | Ga0495651_0204966 | 3300046462 | Bacteria | 1377 |
| 503 | Ga0495653_0015646 | 3300046463 | Bacteria | 6183 |
| 504 | Ga0495653_0064363 | 3300046463 | Bacteria | 2763 |
| 505 | Ga0495580_0139001 | 3300046472 | Bacteria | 1684 |
| 506 | Ga0495580_0531911 | 3300046472 | Unclassified | 782 |
| 507 | Ga0495582_0116479 | 3300046473 | Bacteria | 1503 |
| 508 | Ga0495582_0151569 | 3300046473 | Bacteria | 1316 |
| 509 | Ga0495582_0408803 | 3300046473 | Unclassified | 783 |
| 510 | Ga0495664_0192946 | 3300046477 | Bacteria | 1235 |
| 511 | Ga0495664_0343752 | 3300046477 | Bacteria | 899 |
| 512 | Ga0495584_0025653 | 3300046491 | Bacteria | 2988 |
| 513 | Ga0495594_0000340 | 3300046499 | Bacteria | 23268 |
| 514 | Ga0495596_0083158 | 3300046500 | Bacteria | 1243 |
| 515 | Ga0495607_0152396 | 3300046501 | Bacteria | 1182 |
| 516 | Ga0495608_0010122 | 3300046511 | Bacteria | 6580 |
| 517 | Ga0495618_0026293 | 3300046514 | Bacteria | 3618 |
| 518 | Ga0495618_0122813 | 3300046514 | Bacteria | 1663 |
| 519 | Ga0495628_0156745 | 3300046516 | Bacteria | 1732 |
| 520 | Ga0495630_0017606 | 3300046517 | Bacteria | 5237 |
| 521 | Ga0495630_0179013 | 3300046517 | Unclassified | 1616 |
| 522 | Ga0495630_0257615 | 3300046517 | Bacteria | 1333 |
| 523 | Ga0495630_0556317 | 3300046517 | Unclassified | 880 |
| 524 | Ga0495666_0038604 | 3300046526 | Bacteria | 2322 |
| 525 | Ga0495642_0025115 | 3300046528 | Bacteria | 2360 |
| 526 | Ga0495652_0052706 | 3300046529 | Bacteria | 3469 |
| 527 | Ga0495652_0309611 | 3300046529 | Bacteria | 1145 |
| 528 | Ga0495652_0633260 | 3300046529 | Bacteria | 726 |
| 529 | Ga0495665_0665145 | 3300046531 | Bacteria | 518 |
| 530 | Ga0495640_0002423 | 3300046533 | Bacteria | 14977 |
| 531 | Ga0495586_0309534 | 3300046535 | Unclassified | 905 |
| 532 | Ga0495587_0143304 | 3300046536 | Unclassified | 1363 |
| 533 | Ga0495609_0276254 | 3300046538 | Bacteria | 688 |
| 534 | Ga0495645_0532129 | 3300046543 | Bacteria | 731 |
| 535 | Ga0495645_0760554 | 3300046543 | Bacteria | 584 |
| 536 | Ga0495622_0092927 | 3300046557 | Bacteria | 1385 |
| 537 | Ga0495667_0054275 | 3300046559 | Bacteria | 2637 |
| 538 | Ga0495667_0369240 | 3300046559 | Bacteria | 905 |
| 539 | Ga0495656_0735113 | 3300046615 | Unclassified | 532 |
| 540 | Ga0495634_0012520 | 3300046642 | Bacteria | 6138 |
| 541 | Ga0495634_0221719 | 3300046642 | Bacteria | 1167 |
| 542 | Ga0495635_0127030 | 3300046663 | Bacteria | 1739 |
| 543 | Ga0495659_0528378 | 3300046664 | Bacteria | 519 |
| 544 | Ga0495588_0001114 | 3300046674 | Bacteria | 11561 |
| 545 | Ga0495588_0634767 | 3300046674 | Bacteria | 559 |
| 546 | Ga0495657_0011624 | 3300046675 | Bacteria | 6574 |
| 547 | Ga0495657_0712179 | 3300046675 | Bacteria | 577 |
| 548 | Ga0495599_0249378 | 3300046678 | Unclassified | 1081 |
| 549 | Ga0495623_0382400 | 3300046679 | Bacteria | 761 |
| 550 | Ga0495646_0226934 | 3300046680 | Bacteria | 1008 |
| 551 | Ga0495647_0038672 | 3300046681 | Bacteria | 1804 |
| 552 | Ga0495658_0175666 | 3300046683 | Bacteria | 1327 |
| 553 | Ga0495613_0035351 | 3300046689 | Bacteria | 3708 |
| 554 | Ga0495613_0225619 | 3300046689 | Bacteria | 1314 |
| 555 | Ga0495600_0043102 | 3300046809 | Bacteria | 2942 |
| 556 | Ga0495581_0082239 | 3300047315 | Unclassified | 1865 |
| 557 | Ga0495604_0282423 | 3300047317 | Bacteria | 1121 |
| 558 | Ga0495604_0284569 | 3300047317 | Bacteria | 1116 |
| 559 | Ga0495636_0483475 | 3300047318 | Bacteria | 597 |
| 560 | Ga0495674_0019510 | 3300047319 | Bacteria | 6289 |
| 561 | Ga0495676_0001422 | 3300047321 | Bacteria | 20618 |
| 562 | Ga0495676_0151863 | 3300047321 | Bacteria | 1647 |
| 563 | Ga0495676_0334916 | 3300047321 | Bacteria | 1014 |
| 564 | Ga0495680_0006023 | 3300047322 | Bacteria | 11341 |
| 565 | Ga0495680_0011579 | 3300047322 | Bacteria | 7797 |
| 566 | Ga0495677_0018087 | 3300047445 | Bacteria | 2555 |
| 567 | Ga0495684_0077839 | 3300047471 | Bacteria | 2517 |
| 568 | Ga0495684_0344222 | 3300047471 | Bacteria | 1060 |
| 569 | Ga0495684_0696059 | 3300047471 | Bacteria | 674 |
| 570 | Ga0495602_0133586 | 3300048088 | Bacteria | 1975 |
| 571 | Ga0495602_0189801 | 3300048088 | Bacteria | 1577 |
| 572 | Ga0495602_0332200 | 3300048088 | Unclassified | 1102 |
| 573 | Ga0496100_0207104 | 3300048903 | Bacteria | 1433 |
| 574 | Ga0496100_0271768 | 3300048903 | Bacteria | 1261 |
| 575 | Ga0496101_0049711 | 3300048904 | Bacteria | 3018 |
| 576 | Ga0496102_0258514 | 3300048905 | Unclassified | 1642 |
| 577 | Ga0496102_1739797 | 3300048905 | Bacteria | 541 |
| 578 | Ga0496104_0025652 | 3300048907 | Bacteria | 5436 |
| 579 | Ga0496104_0082970 | 3300048907 | Bacteria | 3057 |
| 580 | Ga0496104_0096326 | 3300048907 | Bacteria | 2831 |
| 581 | Ga0496105_0083154 | 3300048908 | Bacteria | 2644 |
| 582 | Ga0496105_0457795 | 3300048908 | Bacteria | 1006 |
| 583 | Ga0496105_1122435 | 3300048908 | Bacteria | 583 |
| 584 | Ga0496106_0857245 | 3300048909 | Bacteria | 719 |
| 585 | Ga0496106_0863660 | 3300048909 | Bacteria | 716 |
| 586 | Ga0496106_1503054 | 3300048909 | Bacteria | 518 |
| 587 | Ga0496107_1314170 | 3300048910 | Bacteria | 517 |
| 588 | Ga0496108_0067759 | 3300048911 | Bacteria | 3011 |
| 589 | Ga0496108_0081794 | 3300048911 | Bacteria | 2737 |
| 590 | Ga0496108_0119859 | 3300048911 | Bacteria | 2256 |
| 591 | Ga0496109_0034347 | 3300048912 | Bacteria | 4566 |
| 592 | Ga0496109_0069364 | 3300048912 | Unclassified | 3233 |
| 593 | Ga0496110_0019029 | 3300048913 | Bacteria | 5771 |
| 594 | Ga0496110_0886850 | 3300048913 | Bacteria | 798 |
| 595 | Ga0496110_0919148 | 3300048913 | Bacteria | 781 |
| 596 | Ga0496111_0649942 | 3300048914 | Bacteria | 769 |
| 597 | Ga0496112_0014992 | 3300048915 | Bacteria | 7214 |
| 598 | Ga0496112_0015066 | 3300048915 | Bacteria | 7199 |
| 599 | Ga0496112_0020985 | 3300048915 | Bacteria | 6203 |
| 600 | Ga0496112_0021553 | 3300048915 | Bacteria | 6130 |
| 601 | Ga0496112_0031572 | 3300048915 | Bacteria | 5140 |
| 602 | Ga0496112_0206960 | 3300048915 | Bacteria | 1920 |
| 603 | Ga0496112_0330457 | 3300048915 | Bacteria | 1468 |
| 604 | Ga0496112_0470467 | 3300048915 | Bacteria | 1194 |
| 605 | Ga0496112_0583874 | 3300048915 | Bacteria | 1050 |
| 606 | Ga0496113_0160321 | 3300048916 | Bacteria | 1778 |
| 607 | Ga0496113_0329256 | 3300048916 | Bacteria | 1225 |
| 608 | Ga0496113_0609893 | 3300048916 | Unclassified | 874 |
| 609 | Ga0496113_0832551 | 3300048916 | Bacteria | 732 |
| 610 | Ga0496114_0031583 | 3300048917 | Bacteria | 4357 |
| 611 | Ga0496114_0120636 | 3300048917 | Bacteria | 2255 |
| 612 | Ga0496114_0542523 | 3300048917 | Bacteria | 1028 |
| 613 | Ga0496114_1267826 | 3300048917 | Bacteria | 624 |
| 614 | Ga0501031_0022062 | 3300049568 | Bacteria | 4149 |
| 615 | Ga0501031_0023490 | 3300049568 | Bacteria | 4019 |
| 616 | Ga0501031_1108516 | 3300049568 | Bacteria | 505 |
| 617 | Ga0501032_0010844 | 3300049569 | Bacteria | 6556 |
| 618 | Ga0501032_0014682 | 3300049569 | Bacteria | 5545 |
| 619 | Ga0501033_0042080 | 3300049570 | Bacteria | 3406 |
| 620 | Ga0501033_0832129 | 3300049570 | Bacteria | 623 |
| 621 | Ga0501034_0021244 | 3300049571 | Bacteria | 6620 |
| 622 | Ga0501034_0085831 | 3300049571 | Bacteria | 3149 |
| 623 | Ga0501036_0041784 | 3300049572 | Bacteria | 3879 |
| 624 | Ga0501036_0099261 | 3300049572 | Bacteria | 2462 |
| 625 | Ga0501036_0323980 | 3300049572 | Bacteria | 1287 |
| 626 | Ga0501037_0010845 | 3300049573 | Bacteria | 6696 |
| 627 | Ga0501037_0081398 | 3300049573 | Bacteria | 2348 |
| 628 | Ga0501037_0846383 | 3300049573 | Bacteria | 602 |
| 629 | Ga0501038_0001233 | 3300049574 | Bacteria | 23205 |
| 630 | Ga0501038_0046986 | 3300049574 | Bacteria | 3741 |
| 631 | Ga0501038_0117016 | 3300049574 | Bacteria | 2202 |
| 632 | Ga0501038_0238591 | 3300049574 | Bacteria | 1444 |
| 633 | Ga0501038_0906408 | 3300049574 | Bacteria | 651 |
| 634 | Ga0501039_0016565 | 3300049575 | Bacteria | 5646 |
| 635 | Ga0501039_0026754 | 3300049575 | Bacteria | 4433 |
| 636 | Ga0501039_0038031 | 3300049575 | Bacteria | 3717 |
| 637 | Ga0501039_0787842 | 3300049575 | Unclassified | 742 |
| 638 | Ga0501040_0005985 | 3300049576 | Bacteria | 7875 |
| 639 | Ga0501040_0082039 | 3300049576 | Bacteria | 2235 |
| 640 | Ga0501040_0510762 | 3300049576 | Bacteria | 866 |
| 641 | Ga0501041_0006585 | 3300049577 | Bacteria | 6802 |
| 642 | Ga0501041_0050709 | 3300049577 | Bacteria | 2529 |
| 643 | Ga0501041_0323726 | 3300049577 | Bacteria | 972 |
| 644 | Ga0501041_0517105 | 3300049577 | Bacteria | 760 |
| 645 | Ga0501042_0025813 | 3300049578 | Bacteria | 4129 |
| 646 | Ga0501042_0107064 | 3300049578 | Bacteria | 2013 |
| 647 | Ga0501043_0040546 | 3300049579 | Bacteria | 3660 |
| 648 | Ga0501043_0043359 | 3300049579 | Bacteria | 3536 |
| 649 | Ga0501043_0346076 | 3300049579 | Bacteria | 1130 |
| 650 | Ga0501043_0564350 | 3300049579 | Bacteria | 844 |
| 651 | Ga0501043_0812159 | 3300049579 | Bacteria | 676 |
| 652 | Ga0501046_0007245 | 3300049580 | Bacteria | 9750 |
| 653 | Ga0501046_0030397 | 3300049580 | Bacteria | 4383 |
| 654 | Ga0501046_0283696 | 3300049580 | Bacteria | 1213 |
| 655 | Ga0501046_0358083 | 3300049580 | Bacteria | 1058 |
| 656 | Ga0501047_0030253 | 3300049581 | Bacteria | 5221 |
| 657 | Ga0501047_0376975 | 3300049581 | Bacteria | 1253 |
| 658 | Ga0501047_0768545 | 3300049581 | Bacteria | 779 |
| 659 | Ga0501048_0018789 | 3300049582 | Bacteria | 5081 |
| 660 | Ga0501048_0028277 | 3300049582 | Bacteria | 4069 |
| 661 | Ga0501048_0030317 | 3300049582 | Bacteria | 3913 |
| 662 | Ga0501048_0639605 | 3300049582 | Bacteria | 764 |
| 663 | Ga0501067_0177164 | 3300049583 | Bacteria | 1187 |
| 664 | Ga0501067_0250723 | 3300049583 | Bacteria | 985 |
| 665 | Ga0501067_0362090 | 3300049583 | Bacteria | 808 |
| 666 | Ga0501068_0017001 | 3300049584 | Bacteria | 4202 |
| 667 | Ga0501068_0018061 | 3300049584 | Bacteria | 4084 |
| 668 | Ga0501068_0093407 | 3300049584 | Bacteria | 1858 |
| 669 | Ga0501068_0371708 | 3300049584 | Bacteria | 920 |
| 670 | Ga0501068_0420990 | 3300049584 | Bacteria | 862 |
| 671 | Ga0501069_0026061 | 3300049585 | Bacteria | 3201 |
| 672 | Ga0501069_0032683 | 3300049585 | Bacteria | 2864 |
| 673 | Ga0501069_0116738 | 3300049585 | Bacteria | 1522 |
| 674 | Ga0501069_0367076 | 3300049585 | Bacteria | 849 |
| 675 | Ga0501070_0006372 | 3300049586 | Bacteria | 10044 |
| 676 | Ga0501070_0010214 | 3300049586 | Bacteria | 7942 |
| 677 | Ga0501070_0090444 | 3300049586 | Bacteria | 2533 |
| 678 | Ga0501070_0329173 | 3300049586 | Bacteria | 1242 |
| 679 | Ga0501070_0777895 | 3300049586 | Bacteria | 753 |
| 680 | Ga0501070_1111794 | 3300049586 | Bacteria | 609 |
| 681 | Ga0501071_0003710 | 3300049587 | Bacteria | 9587 |
| 682 | Ga0501071_0009248 | 3300049587 | Bacteria | 6554 |
| 683 | Ga0501071_0028423 | 3300049587 | Bacteria | 3941 |
| 684 | Ga0501071_0090206 | 3300049587 | Bacteria | 2250 |
| 685 | Ga0501071_0111050 | 3300049587 | Bacteria | 2026 |
| 686 | Ga0501071_0192011 | 3300049587 | Bacteria | 1532 |
| 687 | Ga0501071_0656934 | 3300049587 | Unclassified | 807 |
| 688 | Ga0501072_0002032 | 3300049588 | Bacteria | 15068 |
| 689 | Ga0501072_0024515 | 3300049588 | Bacteria | 4693 |
| 690 | Ga0501072_0047089 | 3300049588 | Bacteria | 3395 |
| 691 | Ga0501072_0110646 | 3300049588 | Bacteria | 2186 |
| 692 | Ga0501072_0156270 | 3300049588 | Bacteria | 1818 |
| 693 | Ga0501072_0213129 | 3300049588 | Bacteria | 1539 |
| 694 | Ga0501072_0316797 | 3300049588 | Bacteria | 1239 |
| 695 | Ga0501072_0368111 | 3300049588 | Bacteria | 1141 |
| 696 | Ga0501072_0590682 | 3300049588 | Bacteria | 876 |
| 697 | Ga0501073_0016363 | 3300049589 | Bacteria | 5376 |
| 698 | Ga0501073_0035320 | 3300049589 | Bacteria | 3554 |
| 699 | Ga0501073_0042398 | 3300049589 | Bacteria | 3212 |
| 700 | Ga0501073_0049530 | 3300049589 | Bacteria | 2946 |
| 701 | Ga0501073_0270463 | 3300049589 | Bacteria | 1173 |
| 702 | Ga0501073_0285900 | 3300049589 | Bacteria | 1138 |
| 703 | Ga0501074_0004703 | 3300049590 | Bacteria | 9775 |
| 704 | Ga0501074_0005266 | 3300049590 | Bacteria | 9310 |
| 705 | Ga0501074_0051723 | 3300049590 | Bacteria | 2964 |
| 706 | Ga0501074_0054002 | 3300049590 | Bacteria | 2898 |
| 707 | Ga0501074_0358574 | 3300049590 | Bacteria | 1035 |
| 708 | Ga0501074_0766211 | 3300049590 | Bacteria | 680 |
| 709 | Ga0501075_0010101 | 3300049591 | Bacteria | 6623 |
| 710 | Ga0501075_0041522 | 3300049591 | Bacteria | 3447 |
| 711 | Ga0501075_0241988 | 3300049591 | Bacteria | 1375 |
| 712 | Ga0501075_0275831 | 3300049591 | Bacteria | 1281 |
| 713 | Ga0501076_0011587 | 3300049592 | Bacteria | 6576 |
| 714 | Ga0501076_0016298 | 3300049592 | Bacteria | 5633 |
| 715 | Ga0501076_0023760 | 3300049592 | Bacteria | 4729 |
| 716 | Ga0501076_0148090 | 3300049592 | Bacteria | 1909 |
| 717 | Ga0501076_0154630 | 3300049592 | Bacteria | 1866 |
| 718 | Ga0501077_0005020 | 3300049593 | Bacteria | 8026 |
| 719 | Ga0501077_0007381 | 3300049593 | Bacteria | 6776 |
| 720 | Ga0501077_0101810 | 3300049593 | Bacteria | 1820 |
| 721 | Ga0501077_0122343 | 3300049593 | Bacteria | 1649 |
| 722 | Ga0501077_0206587 | 3300049593 | Bacteria | 1248 |
| 723 | Ga0501077_0255987 | 3300049593 | Bacteria | 1113 |
| 724 | Ga0501209_299588 | 3300049656 | Bacteria | 506 |
| 725 | Ga0501079_0044109 | 3300049741 | Bacteria | 3441 |
| 726 | Ga0501079_0059077 | 3300049741 | Bacteria | 2958 |
| 727 | Ga0501079_0071470 | 3300049741 | Bacteria | 2681 |
| 728 | Ga0501079_0123034 | 3300049741 | Bacteria | 2018 |
| 729 | Ga0501079_0132373 | 3300049741 | Bacteria | 1940 |
| 730 | Ga0501079_0159443 | 3300049741 | Bacteria | 1759 |
| 731 | Ga0501079_0273125 | 3300049741 | Bacteria | 1321 |
| 732 | Ga0501079_0555097 | 3300049741 | Bacteria | 903 |
| 733 | Ga0501079_0965637 | 3300049741 | Bacteria | 671 |
| 734 | Ga0501080_0000646 | 3300049742 | Bacteria | 27624 |
| 735 | Ga0501080_0028712 | 3300049742 | Bacteria | 5178 |
| 736 | Ga0501080_0049865 | 3300049742 | Bacteria | 3896 |
| 737 | Ga0501080_0068452 | 3300049742 | Bacteria | 3302 |
| 738 | Ga0501080_0082746 | 3300049742 | Bacteria | 2981 |
| 739 | Ga0501080_0131906 | 3300049742 | Bacteria | 2313 |
| 740 | Ga0501080_0218584 | 3300049742 | Bacteria | 1744 |
| 741 | Ga0501080_0643811 | 3300049742 | Bacteria | 938 |
| 742 | Ga0501080_1181606 | 3300049742 | Bacteria | 658 |
| 743 | Ga0501081_0006913 | 3300049743 | Bacteria | 7371 |
| 744 | Ga0501081_0007415 | 3300049743 | Bacteria | 7117 |
| 745 | Ga0501081_0056887 | 3300049743 | Bacteria | 2703 |
| 746 | Ga0501081_0212586 | 3300049743 | Bacteria | 1405 |
| 747 | Ga0501081_0857922 | 3300049743 | Bacteria | 684 |
| 748 | Ga0501083_0004964 | 3300049744 | Bacteria | 9428 |
| 749 | Ga0501083_0009099 | 3300049744 | Bacteria | 7015 |
| 750 | Ga0501083_0022824 | 3300049744 | Bacteria | 4341 |
| 751 | Ga0501083_0113976 | 3300049744 | Bacteria | 1776 |
| 752 | Ga0501083_1021299 | 3300049744 | Bacteria | 538 |
| 753 | Ga0501035_0006912 | 3300049822 | Bacteria | 10599 |
| 754 | Ga0501035_0236642 | 3300049822 | Bacteria | 1555 |
| 755 | Ga0501035_0299762 | 3300049822 | Bacteria | 1354 |
| 756 | Ga0501044_0242348 | 3300049823 | Bacteria | 1746 |
| 757 | Ga0501044_0720583 | 3300049823 | Bacteria | 882 |
| 758 | Ga0501045_0003536 | 3300049824 | Bacteria | 10717 |
| 759 | Ga0501045_0010764 | 3300049824 | Bacteria | 6409 |
| 760 | Ga0501045_0074085 | 3300049824 | Bacteria | 2507 |
| 761 | Ga0501045_0178778 | 3300049824 | Bacteria | 1581 |
| 762 | Ga0501045_0927148 | 3300049824 | Bacteria | 639 |
| 763 | nmdc:mga03n38_865726_c1 | 3300050490 | Bacteria | 529 |
| 764 | nmdc:mga0yw44_933592_c1 | 3300050492 | Bacteria | 588 |
| 765 | nmdc:mga06z11_191103_c1 | 3300050494 | Bacteria | 1185 |
| 766 | nmdc:mga04h51_309785_c1 | 3300050495 | Bacteria | 645 |
| 767 | nmdc:mga05p37_339596_c1 | 3300050507 | Bacteria | 1771 |
| 768 | nmdc:mga05p37_3733_c2 | 3300050507 | Bacteria | 13686 |
| 769 | nmdc:mga05p37_521333_c1 | 3300050507 | Bacteria | 1359 |
| 770 | nmdc:mga09592_163083_c1 | 3300050508 | Bacteria | 1926 |
| 771 | nmdc:mga08y16_284366_c1 | 3300050511 | Bacteria | 1706 |
| 772 | nmdc:mga08y16_328147_c1 | 3300050511 | Bacteria | 1574 |
| 773 | nmdc:mga08y16_380993_c1 | 3300050511 | Bacteria | 1446 |
| 774 | nmdc:mga08y16_588050_c1 | 3300050511 | Bacteria | 1123 |
| 775 | nmdc:mga0n895_101674_c1 | 3300050512 | Bacteria | 2884 |
| 776 | nmdc:mga0n895_139389_c1 | 3300050512 | Bacteria | 2453 |
| 777 | nmdc:mga0n895_991469_c1 | 3300050512 | Bacteria | 822 |
| 778 | nmdc:mga0rr50_637464_c1 | 3300050513 | Unclassified | 909 |
| 779 | nmdc:mga08x19_511146_c1 | 3300050514 | Unclassified | 848 |
| 780 | nmdc:mga08x19_92573_c1 | 3300050514 | Bacteria | 1997 |
| 781 | nmdc:mga0a205_119865_c1 | 3300050515 | Bacteria | 2530 |
| 782 | nmdc:mga0a205_420942_c1 | 3300050515 | Bacteria | 1198 |
| 783 | Ga0495601_0239831 | 3300053077 | Bacteria | 1184 |
| 784 | Ga0495601_0835391 | 3300053077 | Bacteria | 584 |
| 785 | Ga0495595_0021388 | 3300053084 | Bacteria | 2826 |
| 786 | Ga0495619_0041949 | 3300053085 | Bacteria | 2995 |
| 787 | Ga0495619_0643848 | 3300053085 | Bacteria | 723 |
| 788 | Ga0501084_0008276 | 3300054114 | Bacteria | 8580 |
| 789 | Ga0501084_0011771 | 3300054114 | Bacteria | 7244 |
| 790 | Ga0501084_0014592 | 3300054114 | Bacteria | 6513 |
| 791 | Ga0501084_0015324 | 3300054114 | Bacteria | 6356 |
| 792 | Ga0501084_0167254 | 3300054114 | Bacteria | 1856 |
| 793 | Ga0501084_0298467 | 3300054114 | Bacteria | 1361 |
| 794 | Ga0501084_0299965 | 3300054114 | Bacteria | 1357 |
| 795 | Ga0501084_0354384 | 3300054114 | Bacteria | 1239 |
| 796 | Ga0501084_0735632 | 3300054114 | Bacteria | 831 |
| 797 | Ga0501084_1801816 | 3300054114 | Bacteria | 511 |
| 798 | Ga0590071_047671 | 3300059421 | Bacteria | 1036 |
| 799 | Ga0590075_021507 | 3300059424 | Bacteria | 1610 |
| 800 | Ga0587083_0123793 | 3300059505 | Bacteria | 671 |
| 801 | Ga0501082_0001301 | 3300060353 | Bacteria | 21897 |
| 802 | Ga0501082_0007105 | 3300060353 | Bacteria | 9659 |
| 803 | Ga0501082_0054979 | 3300060353 | Bacteria | 3430 |
| 804 | Ga0501082_0105879 | 3300060353 | Bacteria | 2433 |
| 805 | Ga0501082_0502172 | 3300060353 | Bacteria | 1060 |
| 806 | Ga0466962_0034957 | 3300061719 | Bacteria | 2406 |
| 807 | Ga0530510_0012335 | 3300061734 | Bacteria | 6002 |
| 808 | Ga0530510_0096625 | 3300061734 | Bacteria | 2159 |
| 809 | Ga0530510_0112597 | 3300061734 | Bacteria | 1994 |
| 810 | Ga0530510_0115477 | 3300061734 | Bacteria | 1968 |
| 811 | Ga0530510_0188639 | 3300061734 | Bacteria | 1530 |
| 812 | Ga0530510_0704754 | 3300061734 | Bacteria | 769 |
| 813 | Ga0530510_1491169 | 3300061734 | Bacteria | 519 |
| 814 | Ga0466967_0174093 | |||
| 815 | ARcpr5yngRDRAFT_c009150 | |||
| 816 | JGI25406J46586_10012777 | |||
| 817 | Ga0070658_10004687 | |||
| 818 | Ga0070658_10018852 | |||
| 819 | Ga0070658_10025917 | |||
| 820 | Ga0070658_10126258 | |||
| 821 | Ga0070658_10161685 | |||
| 822 | Ga0070683_100043116 | |||
| 823 | Ga0070683_100535026 | |||
| 824 | Ga0070683_100911877 | |||
| 825 | Ga0068869_100782064 | |||
| 826 | Ga0070680_100049617 | |||
| 827 | Ga0070680_100071703 | |||
| 828 | Ga0070680_100075275 | |||
| 829 | Ga0070680_100132801 | |||
| 830 | Ga0070680_100532137 | |||
| 831 | Ga0070680_101124444 | |||
| 832 | Ga0070680_101390491 | |||
| 833 | Ga0070682_100014049 | |||
| 834 | Ga0070682_100483153 | |||
| 835 | Ga0068868_100905099 | |||
| 836 | Ga0070660_100006831 | |||
| 837 | Ga0070660_100071852 | |||
| 838 | Ga0070660_100083629 | |||
| 839 | Ga0070660_100406854 | |||
| 840 | Ga0070660_100407973 | |||
| 841 | Ga0070660_100524484 | |||
| 842 | Ga0070660_100842311 | |||
| 843 | Ga0070660_100975063 | |||
| 844 | Ga0070691_10010579 | |||
| 845 | Ga0070691_11044090 | |||
| 846 | Ga0070661_100160608 | |||
| 847 | Ga0070661_100188448 | |||
| 848 | Ga0070661_100263508 | |||
| 849 | Ga0070692_10079398 | |||
| 850 | Ga0070692_11381647 | |||
| 851 | Ga0070668_100034965 | |||
| 852 | Ga0070673_101112713 | |||
| 853 | Ga0070688_100290120 | |||
| 854 | Ga0070659_100062810 | |||
| 855 | Ga0070659_100078192 | |||
| 856 | Ga0070659_100353014 | |||
| 857 | Ga0070709_10039607 | |||
| 858 | Ga0070714_100021504 | |||
| 859 | Ga0070714_100055021 | |||
| 860 | Ga0070714_100061376 | |||
| 861 | Ga0070714_100065591 | |||
| 862 | Ga0070714_100070904 | |||
| 863 | Ga0070714_100240189 | |||
| 864 | Ga0070714_101085325 | |||
| 865 | Ga0070713_100027432 | |||
| 866 | Ga0070694_101361767 | |||
| 867 | Ga0070708_100015521 | |||
| 868 | Ga0070663_100431492 | |||
| 869 | Ga0070681_10037270 | |||
| 870 | Ga0070681_10052366 | |||
| 871 | Ga0070681_10065908 | |||
| 872 | Ga0070681_10072699 | |||
| 873 | Ga0070681_10078526 | |||
| 874 | Ga0070681_10095066 | |||
| 875 | Ga0070681_11226197 | |||
| 876 | Ga0070706_100085991 | |||
| 877 | Ga0070707_100208481 | |||
| 878 | Ga0070707_101117960 | |||
| 879 | Ga0070707_101712958 | |||
| 880 | Ga0070698_100076590 | |||
| 881 | Ga0070698_100383730 | |||
| 882 | Ga0070699_100083715 | |||
| 883 | Ga0070679_100048987 | |||
| 884 | Ga0070679_100104119 | |||
| 885 | Ga0070679_100108736 | |||
| 886 | Ga0070679_100173941 | |||
| 887 | Ga0070679_100314963 | |||
| 888 | Ga0070679_100820855 | |||
| 889 | Ga0070684_100058856 | |||
| 890 | Ga0070684_100124613 | |||
| 891 | Ga0070684_100209430 | |||
| 892 | Ga0070684_100217954 | |||
| 893 | Ga0070684_100378887 | |||
| 894 | Ga0070697_101060670 | |||
| 895 | Ga0068853_100873977 | |||
| 896 | Ga0070686_101193177 | |||
| 897 | Ga0070696_100244473 | |||
| 898 | Ga0070693_100010919 | |||
| 899 | Ga0070693_100538696 | |||
| 900 | Ga0070693_100921848 | |||
| 901 | Ga0070665_100441279 | |||
| 902 | Ga0070704_101499375 | |||
| 903 | Ga0068855_100015442 | |||
| 904 | Ga0068855_100053923 | |||
| 905 | Ga0068855_100311094 | |||
| 906 | Ga0068855_100882109 | |||
| 907 | Ga0070664_100464727 | |||
| 908 | Ga0070664_101048793 | |||
| 909 | Ga0070664_101173734 | |||
| 910 | Ga0070664_102336762 | |||
| 911 | Ga0068856_101180489 | |||
| 912 | Ga0068852_100044134 | |||
| 913 | Ga0068852_101185750 | |||
| 914 | Ga0068852_101260555 | |||
| 915 | Ga0068861_100222521 | |||
| 916 | Ga0068851_10628077 | |||
| 917 | Ga0068858_101552979 | |||
| 918 | Ga0081455_10026678 | |||
| 919 | Ga0081455_10273205 | |||
| 920 | Ga0081539_10001263 | |||
| 921 | Ga0081539_10232842 | |||
| 922 | Ga0070717_10110292 | |||
| 923 | Ga0075365_10201497 | |||
| 924 | Ga0075365_11104564 | |||
| 925 | Ga0075368_10196784 | |||
| 926 | Ga0075368_10262288 | |||
| 927 | Ga0075364_10212667 | |||
| 928 | Ga0075432_10000710 | |||
| 929 | Ga0070716_100065566 | |||
| 930 | Ga0070716_100129755 | |||
| 931 | Ga0070716_100638845 | |||
| 932 | Ga0070716_101614393 | |||
| 933 | Ga0070712_100462857 | |||
| 934 | Ga0070712_101065059 | |||
| 935 | Ga0075367_10570627 | |||
| 936 | Ga0075428_100045698 | |||
| 937 | Ga0075428_101725180 | |||
| 938 | Ga0075433_10122023 | |||
| 939 | Ga0075433_10311517 | |||
| 940 | Ga0075433_10582498 | |||
| 941 | Ga0075434_100161024 | |||
| 942 | Ga0075434_100234829 | |||
| 943 | Ga0075434_101246424 | |||
| 944 | Ga0075429_100169046 | |||
| 945 | Ga0075435_100284233 | |||
| 946 | Ga0105240_10293897 | |||
| 947 | Ga0105240_10581031 | |||
| 948 | Ga0111539_10003299 | |||
| 949 | Ga0111539_10478330 | |||
| 950 | Ga0111539_11187224 | |||
| 951 | Ga0111539_11415158 | |||
| 952 | Ga0105245_10039768 | |||
| 953 | Ga0105245_10328996 | |||
| 954 | Ga0105245_10604445 | |||
| 955 | Ga0105245_11576654 | |||
| 956 | Ga0105245_11728651 | |||
| 957 | Ga0114129_10004297 | |||
| 958 | Ga0114129_10135692 | |||
| 959 | Ga0114129_10162742 | |||
| 960 | Ga0114129_11027455 | |||
| 961 | Ga0105241_10251780 | |||
| 962 | Ga0105242_10307687 | |||
| 963 | Ga0105238_10227782 | |||
| 964 | Ga0105238_10419299 | |||
| 965 | Ga0105238_11787926 | |||
| 966 | Ga0105249_10226067 | |||
| 967 | Ga0105032_110179 | |||
| 968 | Ga0105239_10904072 | |||
| 969 | Ga0105239_11067279 | |||
| 970 | Ga0105239_11658493 | |||
| 971 | Ga0157373_10088541 | |||
| 972 | Ga0157371_10187229 | |||
| 973 | Ga0157371_10385155 | |||
| 974 | Ga0157370_10005407 | |||
| 975 | Ga0157370_10026276 | |||
| 976 | Ga0157370_10112036 | |||
| 977 | Ga0157370_10747347 | |||
| 978 | Ga0157370_11526826 | |||
| 979 | Ga0157369_10004504 | |||
| 980 | Ga0157369_10009525 | |||
| 981 | Ga0157369_10556034 | |||
| 982 | Ga0157369_11808295 | |||
| 983 | Ga0157374_10384204 | |||
| 984 | Ga0157374_10965040 | |||
| 985 | Ga0157378_10314890 | |||
| 986 | Ga0163162_10500389 | |||
| 987 | Ga0157372_10400258 | |||
| 988 | Ga0157372_10700359 | |||
| 989 | Ga0157372_10786527 | |||
| 990 | Ga0157372_11819967 | |||
| 991 | Ga0157372_13198665 | |||
| 992 | Ga0157372_13341283 | |||
| 993 | Ga0157375_10198332 | |||
| 994 | Ga0157375_10646307 | |||
| 995 | Ga0157375_13521087 | |||
| 996 | Ga0163163_10308875 | |||
| 997 | Ga0157380_10388310 | |||
| 998 | Ga0182008_10006444 | |||
| 999 | Ga0182008_10084038 | |||
| 1000 | Ga0182008_10095018 | |||
| 1001 | Ga0182008_10533565 | |||
| 1002 | Ga0157377_11688452 | |||
| 1003 | Ga0182006_1016966 | |||
| 1004 | Ga0182006_1120768 | |||
| 1005 | Ga0182006_1275331 | |||
| 1006 | Ga0182007_10050930 | |||
| 1007 | Ga0182007_10160578 | |||
| 1008 | Ga0163161_11945725 | |||
| 1009 | Ga0197907_10220929 | |||
| 1010 | Ga0197907_11303737 | |||
| 1011 | Ga0206356_10464478 | |||
| 1012 | Ga0206356_10732343 | |||
| 1013 | Ga0206356_10744457 | |||
| 1014 | Ga0206356_10886950 | |||
| 1015 | Ga0206356_11626683 | |||
| 1016 | Ga0206356_11721452 | |||
| 1017 | Ga0206349_1470884 | |||
| 1018 | Ga0206352_10016425 | |||
| 1019 | Ga0206352_11240383 | |||
| 1020 | Ga0206354_10591732 | |||
| 1021 | Ga0206354_10666366 | |||
| 1022 | Ga0206354_10741748 | |||
| 1023 | Ga0206354_11589568 | |||
| 1024 | Ga0206353_10345868 | |||
| 1025 | Ga0206353_10481260 | |||
| 1026 | Ga0206353_11434971 | |||
| 1027 | Ga0206353_11448681 | |||
| 1028 | Ga0206353_11898434 | |||
| 1029 | Ga0213876_10061542 | |||
| 1030 | Ga0213871_10193442 | |||
| 1031 | Ga0207688_10033313 | |||
| 1032 | Ga0207699_10040027 | |||
| 1033 | Ga0207699_10097455 | |||
| 1034 | Ga0207699_10307322 | |||
| 1035 | Ga0207699_10373498 | |||
| 1036 | Ga0207699_10502580 | |||
| 1037 | Ga0207705_10001180 | |||
| 1038 | Ga0207705_10098191 | |||
| 1039 | Ga0207705_10257385 | |||
| 1040 | Ga0207705_10416913 | |||
| 1041 | Ga0207684_10050994 | |||
| 1042 | Ga0207684_10233343 | |||
| 1043 | Ga0207684_10727593 | |||
| 1044 | Ga0207684_11027945 | |||
| 1045 | Ga0207707_10050054 | |||
| 1046 | Ga0207707_10105593 | |||
| 1047 | Ga0207707_10116914 | |||
| 1048 | Ga0207707_10365357 | |||
| 1049 | Ga0207707_10654774 | |||
| 1050 | Ga0207707_10790212 | |||
| 1051 | Ga0207695_10072423 | |||
| 1052 | Ga0207695_11433087 | |||
| 1053 | Ga0207693_10981419 | |||
| 1054 | Ga0207660_10007442 | |||
| 1055 | Ga0207660_10088277 | |||
| 1056 | Ga0207660_10200305 | |||
| 1057 | Ga0207660_10328473 | |||
| 1058 | Ga0207660_10404057 | |||
| 1059 | Ga0207660_10511511 | |||
| 1060 | Ga0207657_10020763 | |||
| 1061 | Ga0207657_10056284 | |||
| 1062 | Ga0207657_10068835 | |||
| 1063 | Ga0207657_10153907 | |||
| 1064 | Ga0207657_10342951 | |||
| 1065 | Ga0207657_10878072 | |||
| 1066 | Ga0207649_10041403 | |||
| 1067 | Ga0207649_10185058 | |||
| 1068 | Ga0207649_10275607 | |||
| 1069 | Ga0207652_10031119 | |||
| 1070 | Ga0207652_10049166 | |||
| 1071 | Ga0207652_10139411 | |||
| 1072 | Ga0207652_10213651 | |||
| 1073 | Ga0207652_10286065 | |||
| 1074 | Ga0207652_11589025 | |||
| 1075 | Ga0207646_10230746 | |||
| 1076 | Ga0207646_10353124 | |||
| 1077 | Ga0207646_10591503 | |||
| 1078 | Ga0207694_10235159 | |||
| 1079 | Ga0207687_10041456 | |||
| 1080 | Ga0207687_10150182 | |||
| 1081 | Ga0207700_10000006 | |||
| 1082 | Ga0207664_10025149 | |||
| 1083 | Ga0207664_10051144 | |||
| 1084 | Ga0207664_10067110 | |||
| 1085 | Ga0207664_10725809 | |||
| 1086 | Ga0207664_11280459 | |||
| 1087 | Ga0207664_11300842 | |||
| 1088 | Ga0207664_11760424 | |||
| 1089 | Ga0207690_10037272 | |||
| 1090 | Ga0207690_10110580 | |||
| 1091 | Ga0207690_10206989 | |||
| 1092 | Ga0207690_11305055 | |||
| 1093 | Ga0207686_10103796 | |||
| 1094 | Ga0207709_10138263 | |||
| 1095 | Ga0207669_11521182 | |||
| 1096 | Ga0207704_10246455 | |||
| 1097 | Ga0207665_10011299 | |||
| 1098 | Ga0207665_10016548 | |||
| 1099 | Ga0207665_10542096 | |||
| 1100 | Ga0207665_10872933 | |||
| 1101 | Ga0207665_11116920 | |||
| 1102 | Ga0207711_10812862 | |||
| 1103 | Ga0207661_10056796 | |||
| 1104 | Ga0207661_10395042 | |||
| 1105 | Ga0207661_10570496 | |||
| 1106 | Ga0207661_11880639 | |||
| 1107 | Ga0207679_10436284 | |||
| 1108 | Ga0207679_10535143 | |||
| 1109 | Ga0207679_10743766 | |||
| 1110 | Ga0207667_10142082 | |||
| 1111 | Ga0207667_10177105 | |||
| 1112 | Ga0207667_10373439 | |||
| 1113 | Ga0207667_10375247 | |||
| 1114 | Ga0207667_10685593 | |||
| 1115 | Ga0207667_10820032 | |||
| 1116 | Ga0207712_11383394 | |||
| 1117 | Ga0207668_10465114 | |||
| 1118 | Ga0207640_10181631 | |||
| 1119 | Ga0207640_10738932 | |||
| 1120 | Ga0207677_10265191 | |||
| 1121 | Ga0207677_10354975 | |||
| 1122 | Ga0207677_11715514 | |||
| 1123 | Ga0207678_10437706 | |||
| 1124 | Ga0207708_10045354 | |||
| 1125 | Ga0207708_10633271 | |||
| 1126 | Ga0207702_10107306 | |||
| 1127 | Ga0207702_11001439 | |||
| 1128 | Ga0207702_11197043 | |||
| 1129 | Ga0207648_10151471 | |||
| 1130 | Ga0207676_10363021 | |||
| 1131 | Ga0207674_10460237 | |||
| 1132 | Ga0207675_100244684 | |||
| 1133 | Ga0207698_10100651 | |||
| 1134 | Ga0207698_10184701 | |||
| 1135 | Ga0207698_11275278 | |||
| 1136 | Ga0207698_12035934 | |||
| 1137 | Ga0209813_10225089 | |||
| 1138 | Ga0207428_10000401 | |||
| 1139 | Ga0207428_10398988 | |||
| 1140 | Ga0265318_10018498 | |||
| 1141 | Ga0265318_10098219 | |||
| 1142 | Ga0265318_10116016 | |||
| 1143 | Ga0265323_10192301 | |||
| 1144 | Ga0265338_10003455 | |||
| 1145 | Ga0265338_10049628 | |||
| 1146 | Ga0265338_10051124 | |||
| 1147 | Ga0265338_10085957 | |||
| 1148 | Ga0265338_10233461 | |||
| 1149 | Ga0265324_10333788 | |||
| 1150 | Ga0265328_10195428 | |||
| 1151 | Ga0265320_10086528 | |||
| 1152 | Ga0265320_10089791 | |||
| 1153 | Ga0265340_10020255 | |||
| 1154 | Ga0265327_10021452 | |||
| 1155 | Ga0265316_10500350 | |||
| 1156 | Ga0265313_10166004 | |||
| 1157 | Ga0265314_10578058 | |||
| 1158 | Ga0307409_102404801 | |||
| 1159 | Ga0316583_10046486 | |||
| 1160 | Ga0373926_0031150 | |||
| 1161 | Ga0373926_0112757 | |||
| 1162 | Ga0373944_0004206 | |||
| 1163 | Ga0373936_0628326 | |||
| 1164 | Ga0373957_0060207 | |||
| 1165 | Ga0373960_0050424 | |||
| 1166 | Ga0373943_0027736 | |||
| 1167 | Ga0373943_0043730 | |||
| 1168 | Ga0373946_0396822 | |||
| 1169 | Ga0373955_0182486 | |||
| 1170 | Ga0373924_0052850 | |||
| 1171 | Ga0373931_0179907 | |||
| 1172 | Ga0373931_0723483 | |||
| 1173 | Ga0373931_0806519 | |||
| 1174 | Ga0373935_0355925 | |||
| 1175 | Ga0373927_0080501 | |||
| 1176 | Ga0373933_0132320 | |||
| 1177 | Ga0373947_0000788 | |||
| 1178 | Ga0373937_0046196 | |||
| 1179 | Ga0373925_0005147 | |||
| 1180 | Ga0373925_1239127 | |||
| 1181 | Ga0395899_0041176 | |||
| 1182 | Ga0395899_0042016 | |||
| 1183 | Ga0395899_0048425 | |||
| 1184 | Ga0395899_0193396 | |||
| 1185 | Ga0395899_0321991 | |||
| 1186 | Ga0395900_0005654 | |||
| 1187 | Ga0395900_0092431 | |||
| 1188 | Ga0395900_0135451 | |||
| 1189 | Ga0395900_0211541 | |||
| 1190 | Ga0395900_0310907 | |||
| 1191 | Ga0395900_0833300 | |||
| 1192 | Ga0395900_0907059 | |||
| 1193 | Ga0395900_1281410 | |||
| 1194 | Ga0395898_0014811 | |||
| 1195 | Ga0395898_0014884 | |||
| 1196 | Ga0395898_0029176 | |||
| 1197 | Ga0395898_0068700 | |||
| 1198 | Ga0395898_0084262 | |||
| 1199 | Ga0395898_0373200 | |||
| 1200 | Ga0395898_0449678 | |||
| 1201 | Ga0395898_0584289 | |||
| 1202 | Ga0395898_0596478 | |||
| 1203 | Ga0395905_0013996 | |||
| 1204 | Ga0395905_0075998 | |||
| 1205 | Ga0395905_0076956 | |||
| 1206 | Ga0395905_0097204 | |||
| 1207 | Ga0395905_0111338 | |||
| 1208 | Ga0395905_0141672 | |||
| 1209 | Ga0395905_1660557 | |||
| 1210 | Ga0395905_1767494 | |||
| 1211 | Ga0436364_0144090 | |||
| 1212 | Ga0436364_1394280 | |||
| 1213 | Ga0395901_0003421 | |||
| 1214 | Ga0395901_0021860 | |||
| 1215 | Ga0395901_0023493 | |||
| 1216 | Ga0395901_0091537 | |||
| 1217 | Ga0395901_0119399 | |||
| 1218 | Ga0395901_0291184 | |||
| 1219 | Ga0395901_0309866 | |||
| 1220 | Ga0395901_0401552 | |||
| 1221 | Ga0395901_0402326 | |||
| 1222 | Ga0395901_0904561 | |||
| 1223 | Ga0395901_1053749 | |||
| 1224 | Ga0436365_1136723 | |||
| 1225 | Ga0436365_1666332 | |||
| 1226 | Ga0436365_1869413 | |||
| 1227 | Ga0436360_1329995 | |||
| 1228 | Ga0436363_0717714 | |||
| 1229 | Ga0436363_0885272 | |||
| 1230 | Ga0436362_1022240 | |||
| 1231 | Ga0439461_0001850 | |||
| 1232 | Ga0439465_0101872 | |||
| 1233 | Ga0451793_1435797 | |||
| 1234 | Ga0451853_2537051 | |||
| 1235 | Ga0439433_0103282 | |||
| 1236 | Ga0439433_0143183 | |||
| 1237 | Ga0450907_031836 | |||
| 1238 | Ga0439446_0019958 | |||
| 1239 | Ga0439460_0285564 | |||
| 1240 | Ga0466969_0549886 | |||
| 1241 | Ga0466969_0607601 | |||
| 1242 | Ga0466965_0054924 | |||
| 1243 | Ga0466966_0159841 | |||
| 1244 | Ga0466961_0010006 | |||
| 1245 | Ga0466963_0003862 | |||
| 1246 | Ga0466963_0011736 | |||
| 1247 | Ga0466963_0018482 | |||
| 1248 | Ga0466963_0039027 | |||
| 1249 | Ga0466963_0139904 | |||
| 1250 | Ga0466963_0146855 | |||
| 1251 | Ga0466963_0188360 | |||
| 1252 | Ga0466963_0220219 | |||
| 1253 | Ga0466963_0392183 | |||
| 1254 | Ga0466963_0447393 | |||
| 1255 | Ga0466963_0456821 | |||
| 1256 | Ga0466963_0643418 | |||
| 1257 | Ga0466963_0782153 | |||
| 1258 | Ga0466964_0039397 | |||
| 1259 | Ga0466964_0081981 | |||
| 1260 | Ga0466964_0125310 | |||
| 1261 | Ga0466964_0136915 | |||
| 1262 | Ga0466964_0300557 | |||
| 1263 | Ga0466971_0000282 | |||
| 1264 | Ga0466971_0044380 | |||
| 1265 | Ga0466968_0665389 | |||
| 1266 | Ga0466957_0002174 | |||
| 1267 | Ga0466957_0028021 | |||
| 1268 | Ga0466957_0046539 | |||
| 1269 | Ga0466957_0065994 | |||
| 1270 | Ga0466957_0243922 | |||
| 1271 | Ga0466957_0309487 | |||
| 1272 | Ga0466957_0606494 | |||
| 1273 | Ga0466957_1339944 | |||
| 1274 | Ga0466960_0044779 | |||
| 1275 | Ga0466960_0500503 | |||
| 1276 | Ga0466960_0799274 | |||
| 1277 | Ga0466959_0007644 | |||
| 1278 | Ga0451576_0042887 | |||
| 1279 | Ga0466958_0004124 | |||
| 1280 | Ga0466958_0015851 | |||
| 1281 | Ga0466958_0019424 | |||
| 1282 | Ga0466958_0023275 | |||
| 1283 | Ga0466958_0276899 | |||
| 1284 | Ga0466958_0442206 | |||
| 1285 | Ga0466958_0727261 | |||
| 1286 | Ga0466967_0006616 | |||
| 1287 | Ga0466967_0015053 | |||
| 1288 | Ga0466967_0022962 | |||
| 1289 | Ga0466967_0034499 | |||
| 1290 | Ga0466967_0050081 | |||
| 1291 | Ga0466967_0085814 | |||
| 1292 | Ga0466967_0088039 | |||
| 1293 | Ga0466967_0096813 | |||
| 1294 | Ga0466967_0120331 | |||
| 1295 | Ga0466967_0159082 | |||
| 1296 | Ga0466967_0200135 | |||
| 1297 | Ga0466967_0222440 | |||
| 1298 | Ga0466967_0282740 | |||
| 1299 | Ga0466967_0420303 | |||
| 1300 | Ga0466967_0570802 | |||
| 1301 | Ga0466967_0715749 | |||
| 1302 | Ga0466967_0897370 | |||
| 1303 | Ga0466967_0911846 | |||
| 1304 | Ga0466967_0912896 | |||
| 1305 | Ga0466967_1419681 | |||
| 1306 | Ga0466967_1802156 | |||
| 1307 | Ga0495592_0020890 | |||
| 1308 | Ga0495592_0354905 | |||
| 1309 | Ga0495603_0000648 | |||
| 1310 | Ga0495603_0242861 | |||
| 1311 | Ga0495629_0281023 | |||
| 1312 | Ga0495641_0001526 | |||
| 1313 | Ga0495641_0148198 | |||
| 1314 | Ga0495651_0040631 | |||
| 1315 | Ga0495651_0204966 | |||
| 1316 | Ga0495653_0015646 | |||
| 1317 | Ga0495653_0064363 | |||
| 1318 | Ga0495580_0139001 | |||
| 1319 | Ga0495580_0531911 | |||
| 1320 | Ga0495582_0116479 | |||
| 1321 | Ga0495582_0151569 | |||
| 1322 | Ga0495582_0408803 | |||
| 1323 | Ga0495664_0192946 | |||
| 1324 | Ga0495664_0343752 | |||
| 1325 | Ga0495584_0025653 | |||
| 1326 | Ga0495594_0000340 | |||
| 1327 | Ga0495596_0083158 | |||
| 1328 | Ga0495607_0152396 | |||
| 1329 | Ga0495608_0010122 | |||
| 1330 | Ga0495618_0026293 | |||
| 1331 | Ga0495618_0122813 | |||
| 1332 | Ga0495628_0156745 | |||
| 1333 | Ga0495630_0017606 | |||
| 1334 | Ga0495630_0179013 | |||
| 1335 | Ga0495630_0257615 | |||
| 1336 | Ga0495630_0556317 | |||
| 1337 | Ga0495666_0038604 | |||
| 1338 | Ga0495642_0025115 | |||
| 1339 | Ga0495652_0052706 | |||
| 1340 | Ga0495652_0309611 | |||
| 1341 | Ga0495652_0633260 | |||
| 1342 | Ga0495665_0665145 | |||
| 1343 | Ga0495640_0002423 | |||
| 1344 | Ga0495586_0309534 | |||
| 1345 | Ga0495587_0143304 | |||
| 1346 | Ga0495609_0276254 | |||
| 1347 | Ga0495645_0532129 | |||
| 1348 | Ga0495645_0760554 | |||
| 1349 | Ga0495622_0092927 | |||
| 1350 | Ga0495667_0054275 | |||
| 1351 | Ga0495667_0369240 | |||
| 1352 | Ga0495656_0735113 | |||
| 1353 | Ga0495634_0012520 | |||
| 1354 | Ga0495634_0221719 | |||
| 1355 | Ga0495635_0127030 | |||
| 1356 | Ga0495659_0528378 | |||
| 1357 | Ga0495588_0001114 | |||
| 1358 | Ga0495588_0634767 | |||
| 1359 | Ga0495657_0011624 | |||
| 1360 | Ga0495657_0712179 | |||
| 1361 | Ga0495599_0249378 | |||
| 1362 | Ga0495623_0382400 | |||
| 1363 | Ga0495646_0226934 | |||
| 1364 | Ga0495647_0038672 | |||
| 1365 | Ga0495658_0175666 | |||
| 1366 | Ga0495613_0035351 | |||
| 1367 | Ga0495613_0225619 | |||
| 1368 | Ga0495600_0043102 | |||
| 1369 | Ga0495581_0082239 | |||
| 1370 | Ga0495604_0282423 | |||
| 1371 | Ga0495604_0284569 | |||
| 1372 | Ga0495636_0483475 | |||
| 1373 | Ga0495674_0019510 | |||
| 1374 | Ga0495676_0001422 | |||
| 1375 | Ga0495676_0151863 | |||
| 1376 | Ga0495676_0334916 | |||
| 1377 | Ga0495680_0006023 | |||
| 1378 | Ga0495680_0011579 | |||
| 1379 | Ga0495677_0018087 | |||
| 1380 | Ga0495684_0077839 | |||
| 1381 | Ga0495684_0344222 | |||
| 1382 | Ga0495684_0696059 | |||
| 1383 | Ga0495602_0133586 | |||
| 1384 | Ga0495602_0189801 | |||
| 1385 | Ga0495602_0332200 | |||
| 1386 | Ga0496100_0207104 | |||
| 1387 | Ga0496100_0271768 | |||
| 1388 | Ga0496101_0049711 | |||
| 1389 | Ga0496102_0258514 | |||
| 1390 | Ga0496102_1739797 | |||
| 1391 | Ga0496104_0025652 | |||
| 1392 | Ga0496104_0082970 | |||
| 1393 | Ga0496104_0096326 | |||
| 1394 | Ga0496105_0083154 | |||
| 1395 | Ga0496105_0457795 | |||
| 1396 | Ga0496105_1122435 | |||
| 1397 | Ga0496106_0857245 | |||
| 1398 | Ga0496106_0863660 | |||
| 1399 | Ga0496106_1503054 | |||
| 1400 | Ga0496107_1314170 | |||
| 1401 | Ga0496108_0067759 | |||
| 1402 | Ga0496108_0081794 | |||
| 1403 | Ga0496108_0119859 | |||
| 1404 | Ga0496109_0034347 | |||
| 1405 | Ga0496109_0069364 | |||
| 1406 | Ga0496110_0019029 | |||
| 1407 | Ga0496110_0886850 | |||
| 1408 | Ga0496110_0919148 | |||
| 1409 | Ga0496111_0649942 | |||
| 1410 | Ga0496112_0014992 | |||
| 1411 | Ga0496112_0015066 | |||
| 1412 | Ga0496112_0020985 | |||
| 1413 | Ga0496112_0021553 | |||
| 1414 | Ga0496112_0031572 | |||
| 1415 | Ga0496112_0206960 | |||
| 1416 | Ga0496112_0330457 | |||
| 1417 | Ga0496112_0470467 | |||
| 1418 | Ga0496112_0583874 | |||
| 1419 | Ga0496113_0160321 | |||
| 1420 | Ga0496113_0329256 | |||
| 1421 | Ga0496113_0609893 | |||
| 1422 | Ga0496113_0832551 | |||
| 1423 | Ga0496114_0031583 | |||
| 1424 | Ga0496114_0120636 | |||
| 1425 | Ga0496114_0542523 | |||
| 1426 | Ga0496114_1267826 | |||
| 1427 | Ga0501031_0022062 | |||
| 1428 | Ga0501031_0023490 | |||
| 1429 | Ga0501031_1108516 | |||
| 1430 | Ga0501032_0010844 | |||
| 1431 | Ga0501032_0014682 | |||
| 1432 | Ga0501033_0042080 | |||
| 1433 | Ga0501033_0832129 | |||
| 1434 | Ga0501034_0021244 | |||
| 1435 | Ga0501034_0085831 | |||
| 1436 | Ga0501036_0041784 | |||
| 1437 | Ga0501036_0099261 | |||
| 1438 | Ga0501036_0323980 | |||
| 1439 | Ga0501037_0010845 | |||
| 1440 | Ga0501037_0081398 | |||
| 1441 | Ga0501037_0846383 | |||
| 1442 | Ga0501038_0001233 | |||
| 1443 | Ga0501038_0046986 | |||
| 1444 | Ga0501038_0117016 | |||
| 1445 | Ga0501038_0238591 | |||
| 1446 | Ga0501038_0906408 | |||
| 1447 | Ga0501039_0016565 | |||
| 1448 | Ga0501039_0026754 | |||
| 1449 | Ga0501039_0038031 | |||
| 1450 | Ga0501039_0787842 | |||
| 1451 | Ga0501040_0005985 | |||
| 1452 | Ga0501040_0082039 | |||
| 1453 | Ga0501040_0510762 | |||
| 1454 | Ga0501041_0006585 | |||
| 1455 | Ga0501041_0050709 | |||
| 1456 | Ga0501041_0323726 | |||
| 1457 | Ga0501041_0517105 | |||
| 1458 | Ga0501042_0025813 | |||
| 1459 | Ga0501042_0107064 | |||
| 1460 | Ga0501043_0040546 | |||
| 1461 | Ga0501043_0043359 | |||
| 1462 | Ga0501043_0346076 | |||
| 1463 | Ga0501043_0564350 | |||
| 1464 | Ga0501043_0812159 | |||
| 1465 | Ga0501046_0007245 | |||
| 1466 | Ga0501046_0030397 | |||
| 1467 | Ga0501046_0283696 | |||
| 1468 | Ga0501046_0358083 | |||
| 1469 | Ga0501047_0030253 | |||
| 1470 | Ga0501047_0376975 | |||
| 1471 | Ga0501047_0768545 | |||
| 1472 | Ga0501048_0018789 | |||
| 1473 | Ga0501048_0028277 | |||
| 1474 | Ga0501048_0030317 | |||
| 1475 | Ga0501048_0639605 | |||
| 1476 | Ga0501067_0177164 | |||
| 1477 | Ga0501067_0250723 | |||
| 1478 | Ga0501067_0362090 | |||
| 1479 | Ga0501068_0017001 | |||
| 1480 | Ga0501068_0018061 | |||
| 1481 | Ga0501068_0093407 | |||
| 1482 | Ga0501068_0371708 | |||
| 1483 | Ga0501068_0420990 | |||
| 1484 | Ga0501069_0026061 | |||
| 1485 | Ga0501069_0032683 | |||
| 1486 | Ga0501069_0116738 | |||
| 1487 | Ga0501069_0367076 | |||
| 1488 | Ga0501070_0006372 | |||
| 1489 | Ga0501070_0010214 | |||
| 1490 | Ga0501070_0090444 | |||
| 1491 | Ga0501070_0329173 | |||
| 1492 | Ga0501070_0777895 | |||
| 1493 | Ga0501070_1111794 | |||
| 1494 | Ga0501071_0003710 | |||
| 1495 | Ga0501071_0009248 | |||
| 1496 | Ga0501071_0028423 | |||
| 1497 | Ga0501071_0090206 | |||
| 1498 | Ga0501071_0111050 | |||
| 1499 | Ga0501071_0192011 | |||
| 1500 | Ga0501071_0656934 | |||
| 1501 | Ga0501072_0002032 | |||
| 1502 | Ga0501072_0024515 | |||
| 1503 | Ga0501072_0047089 | |||
| 1504 | Ga0501072_0110646 | |||
| 1505 | Ga0501072_0156270 | |||
| 1506 | Ga0501072_0213129 | |||
| 1507 | Ga0501072_0316797 | |||
| 1508 | Ga0501072_0368111 | |||
| 1509 | Ga0501072_0590682 | |||
| 1510 | Ga0501073_0016363 | |||
| 1511 | Ga0501073_0035320 | |||
| 1512 | Ga0501073_0042398 | |||
| 1513 | Ga0501073_0049530 | |||
| 1514 | Ga0501073_0270463 | |||
| 1515 | Ga0501073_0285900 | |||
| 1516 | Ga0501074_0004703 | |||
| 1517 | Ga0501074_0005266 | |||
| 1518 | Ga0501074_0051723 | |||
| 1519 | Ga0501074_0054002 | |||
| 1520 | Ga0501074_0358574 | |||
| 1521 | Ga0501074_0766211 | |||
| 1522 | Ga0501075_0010101 | |||
| 1523 | Ga0501075_0041522 | |||
| 1524 | Ga0501075_0241988 | |||
| 1525 | Ga0501075_0275831 | |||
| 1526 | Ga0501076_0011587 | |||
| 1527 | Ga0501076_0016298 | |||
| 1528 | Ga0501076_0023760 | |||
| 1529 | Ga0501076_0148090 | |||
| 1530 | Ga0501076_0154630 | |||
| 1531 | Ga0501077_0005020 | |||
| 1532 | Ga0501077_0007381 | |||
| 1533 | Ga0501077_0101810 | |||
| 1534 | Ga0501077_0122343 | |||
| 1535 | Ga0501077_0206587 | |||
| 1536 | Ga0501077_0255987 | |||
| 1537 | Ga0501209_299588 | |||
| 1538 | Ga0501079_0044109 | |||
| 1539 | Ga0501079_0059077 | |||
| 1540 | Ga0501079_0071470 | |||
| 1541 | Ga0501079_0123034 | |||
| 1542 | Ga0501079_0132373 | |||
| 1543 | Ga0501079_0159443 | |||
| 1544 | Ga0501079_0273125 | |||
| 1545 | Ga0501079_0555097 | |||
| 1546 | Ga0501079_0965637 | |||
| 1547 | Ga0501080_0000646 | |||
| 1548 | Ga0501080_0028712 | |||
| 1549 | Ga0501080_0049865 | |||
| 1550 | Ga0501080_0068452 | |||
| 1551 | Ga0501080_0082746 | |||
| 1552 | Ga0501080_0131906 | |||
| 1553 | Ga0501080_0218584 | |||
| 1554 | Ga0501080_0643811 | |||
| 1555 | Ga0501080_1181606 | |||
| 1556 | Ga0501081_0006913 | |||
| 1557 | Ga0501081_0007415 | |||
| 1558 | Ga0501081_0056887 | |||
| 1559 | Ga0501081_0212586 | |||
| 1560 | Ga0501081_0857922 | |||
| 1561 | Ga0501083_0004964 | |||
| 1562 | Ga0501083_0009099 | |||
| 1563 | Ga0501083_0022824 | |||
| 1564 | Ga0501083_0113976 | |||
| 1565 | Ga0501083_1021299 | |||
| 1566 | Ga0501035_0006912 | |||
| 1567 | Ga0501035_0236642 | |||
| 1568 | Ga0501035_0299762 | |||
| 1569 | Ga0501044_0242348 | |||
| 1570 | Ga0501044_0720583 | |||
| 1571 | Ga0501045_0003536 | |||
| 1572 | Ga0501045_0010764 | |||
| 1573 | Ga0501045_0074085 | |||
| 1574 | Ga0501045_0178778 | |||
| 1575 | Ga0501045_0927148 | |||
| 1576 | nmdc:mga03n38_865726_c1 | |||
| 1577 | nmdc:mga0yw44_933592_c1 | |||
| 1578 | nmdc:mga06z11_191103_c1 | |||
| 1579 | nmdc:mga04h51_309785_c1 | |||
| 1580 | nmdc:mga05p37_339596_c1 | |||
| 1581 | nmdc:mga05p37_3733_c2 | |||
| 1582 | nmdc:mga05p37_521333_c1 | |||
| 1583 | nmdc:mga09592_163083_c1 | |||
| 1584 | nmdc:mga08y16_284366_c1 | |||
| 1585 | nmdc:mga08y16_328147_c1 | |||
| 1586 | nmdc:mga08y16_380993_c1 | |||
| 1587 | nmdc:mga08y16_588050_c1 | |||
| 1588 | nmdc:mga0n895_101674_c1 | |||
| 1589 | nmdc:mga0n895_139389_c1 | |||
| 1590 | nmdc:mga0n895_991469_c1 | |||
| 1591 | nmdc:mga0rr50_637464_c1 | |||
| 1592 | nmdc:mga08x19_511146_c1 | |||
| 1593 | nmdc:mga08x19_92573_c1 | |||
| 1594 | nmdc:mga0a205_119865_c1 | |||
| 1595 | nmdc:mga0a205_420942_c1 | |||
| 1596 | Ga0495601_0239831 | |||
| 1597 | Ga0495601_0835391 | |||
| 1598 | Ga0495595_0021388 | |||
| 1599 | Ga0495619_0041949 | |||
| 1600 | Ga0495619_0643848 | |||
| 1601 | Ga0501084_0008276 | |||
| 1602 | Ga0501084_0011771 | |||
| 1603 | Ga0501084_0014592 | |||
| 1604 | Ga0501084_0015324 | |||
| 1605 | Ga0501084_0167254 | |||
| 1606 | Ga0501084_0298467 | |||
| 1607 | Ga0501084_0299965 | |||
| 1608 | Ga0501084_0354384 | |||
| 1609 | Ga0501084_0735632 | |||
| 1610 | Ga0501084_1801816 | |||
| 1611 | Ga0590071_047671 | |||
| 1612 | Ga0590075_021507 | |||
| 1613 | Ga0587083_0123793 | |||
| 1614 | Ga0501082_0001301 | |||
| 1615 | Ga0501082_0007105 | |||
| 1616 | Ga0501082_0054979 | |||
| 1617 | Ga0501082_0105879 | |||
| 1618 | Ga0501082_0502172 | |||
| 1619 | Ga0466962_0034957 | |||
| 1620 | Ga0530510_0012335 | |||
| 1621 | Ga0530510_0096625 | |||
| 1622 | Ga0530510_0112597 | |||
| 1623 | Ga0530510_0115477 | |||
| 1624 | Ga0530510_0188639 | |||
| 1625 | Ga0530510_0704754 | |||
| 1626 | Ga0530510_1491169 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5hp7-assembly1.cif.gz_A | crystal structures of rida in the apo form | 0.9425 | 23 | 127 |
| 6l8p-assembly1.cif.gz_B | crystal structure of rida from antarctic bacterium psychrobacter sp. pamc 21119 | 0.9373 | 4 | 127 |
| 5yu2-assembly1.cif.gz_B | structure of ribonuclease yabj | 0.9329 | 5 | 126 |
| 5y6u-assembly1.cif.gz_C | crystal structure of wild-type yabj protein from bacillus subtilis (natto). | 0.9328 | 4 | 126 |
| 2csl-assembly1.cif.gz_B | crystal structure of ttha0137 from thermus thermophilus hb8 | 0.931 | 4 | 126 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5hp8A00 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like | 0.9444 | 23 | 127 | 3.30.1330.40 |
| 1jd1F00 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like | 0.9261 | 2 | 126 | 3.30.1330.40 |
| af_Q86I26_20_139_3.30.1330.40 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like | 0.9247 | 23 | 127 | 3.30.1330.40 |
| af_Q9UR06_1_126_3.30.1330.40 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like | 0.9209 | 1 | 127 | 3.30.1330.40 |
| 1nq3C00 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like | 0.9208 | 2 | 126 | 3.30.1330.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-U7G1S1-F1-model_v4 | deleted | 0.972 | 28 | 126 |
|
| AF-A0A845JC96-F1-model_v4 | 3,4-dihydroxy-2-butanone-4-phosphate synthase (EC 4.1.99.12) | 0.9715 | 23 | 126 |
GO:0005829
GO:0008686 GO:0009231 GO:0046872 |
| AF-A0A527ZSN5-F1-model_v4 | RidA family protein | 0.97 | 25 | 126 |
GO:0005829
GO:0019239 |
| AF-A0A7K2B6L1-F1-model_v4 | deleted | 0.9693 | 23 | 127 |
|
| AF-A0A3P7JPX2-F1-model_v4 | Uncharacterized protein | 0.9685 | 23 | 127 |
GO:0005739
GO:0005829 GO:0019239 |