F481923

General Info

Members Datasets Scaffolds Average Seq Length
813 709 319 366

Family's Representative Sequence

Representative Sequence 3300005353|Ga0070669_100038109|Ga0070669_1000381094
Length 374
Sequence MADIQIIDVDKHFGANHVIRKLNLQIRHGEFVVLLGPSGCGKTTTLRALAGLENIDSGEIRIGGRRVDQLPPQERDTAFVFQLYSLYPHLTAFDNIAFPLRAAGMPDAKVREAVTAVAKVLRIDHLLRKRPSALAGGDMQRVTIGRALVRRPAAMLMDEPIGALDAKLREEMRAELRRLHIENDSTTVYVTHDQVEAMSMADKIGVMNDGLLQQYDSPTKVYDEPANLFVAQFVGSPIMNVVDCEIAATANGAGLRLPGMSEAVRLGPRAAAKLHGGAAAADELMLGIRPEAIAVSRTPVAGAIAARVHLIEPMGPYDIVDIMTATGHDDGATLRARTASRFVRAQGEPVWLSLDDARTHFFNKRSSQLLRAAA

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
3 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
4 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
5 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
6 2509276019 Ensifer aridi TW10 Isolate Nodule
7 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
8 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
9 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
10 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
11 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
12 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
13 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
14 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
15 2512875024 Mesorhizobium loti R88b Isolate Nodule
16 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
17 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
18 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
19 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
20 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
21 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
22 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
23 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
24 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
25 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
26 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
27 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
28 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
29 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
30 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
31 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
32 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
33 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
34 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
35 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
36 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
37 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
38 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
39 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
40 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
41 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
42 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
43 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
44 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
45 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
46 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
47 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
48 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
49 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
50 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
51 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
52 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
53 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
54 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
55 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
56 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
57 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
58 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
59 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
60 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
61 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
62 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
63 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
64 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
65 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
66 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
67 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
68 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
69 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
70 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
71 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
72 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
73 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
74 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
75 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
76 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
77 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
78 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
79 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
80 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
81 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
82 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
83 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
84 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
85 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
86 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
87 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
88 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
89 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
90 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
91 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
92 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
93 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
94 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
95 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
96 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
97 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
98 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
99 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
100 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
101 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
102 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
103 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
104 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
105 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
106 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
107 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
108 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
109 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
110 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
111 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
112 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
113 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
114 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
115 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
116 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
117 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
118 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
119 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
120 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
121 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
122 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
123 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
124 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
125 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
126 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
127 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
128 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
129 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
130 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
131 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
132 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
133 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
134 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
135 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
136 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
137 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
138 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
139 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
140 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
141 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
142 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
143 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
144 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
145 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
146 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
147 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
148 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
149 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
150 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
151 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
152 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
153 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
154 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
155 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
156 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
157 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
158 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
159 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
160 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
161 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
162 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
163 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
164 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
165 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
166 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
167 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
168 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
169 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
170 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
171 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
172 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
173 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
174 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
175 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
176 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
177 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
178 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
179 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
180 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
181 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
182 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
183 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
184 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
185 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
186 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
187 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
188 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
189 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
190 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
191 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
192 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
193 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
194 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
195 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
196 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
197 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
198 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
199 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
200 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
201 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
202 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
203 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
204 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
205 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
206 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
207 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
208 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
209 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
210 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
211 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
212 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
213 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
214 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
215 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
216 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
217 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
218 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
219 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
220 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
221 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
222 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
223 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
224 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
225 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
226 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
227 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
228 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
229 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
230 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
231 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
232 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
233 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
234 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
235 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
236 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
237 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
238 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
239 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
240 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
241 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
242 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
243 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
244 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
245 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
246 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
247 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
248 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
249 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
250 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
251 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
252 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
253 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
254 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
255 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
256 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
257 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
258 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
259 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
260 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
261 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
262 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
263 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
264 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
265 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
266 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
267 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
268 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
269 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
270 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
271 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
272 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
273 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
274 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
275 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
276 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
277 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
278 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
279 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
280 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
281 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
282 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
283 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
284 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
285 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
286 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
287 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
288 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
289 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
290 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
291 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
292 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
293 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
294 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
295 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
296 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
297 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
298 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
299 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
300 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
301 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
302 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
303 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
304 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
305 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
306 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
307 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
308 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
309 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
310 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
311 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
312 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
313 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
314 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
315 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
316 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
317 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
318 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
319 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
320 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
321 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
322 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
323 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
324 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
325 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
326 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
327 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
328 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
329 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
330 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
331 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
332 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
333 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
334 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
335 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
336 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
337 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
338 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
339 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
340 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
341 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
342 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
343 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
344 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
345 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
346 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
347 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
348 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
349 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
350 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
351 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
352 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
353 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
354 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
355 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
356 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
357 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
358 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
359 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
360 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
361 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
362 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
363 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
364 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
365 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
366 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
367 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
368 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
369 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
370 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
371 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
372 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
373 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
374 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
375 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
376 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
377 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
378 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
379 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
380 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
381 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
382 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
383 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
384 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
385 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
386 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
387 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
388 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
389 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
390 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
391 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
392 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
393 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
394 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
395 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
396 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
397 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
398 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
399 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
400 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
401 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
402 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
403 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
404 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
405 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
406 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
407 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
408 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
409 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
410 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
411 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
412 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
413 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
414 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
415 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
416 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
417 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
418 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
419 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
420 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
421 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
422 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
423 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
424 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
425 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
426 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
427 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
428 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
429 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
430 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
431 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
432 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
433 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
434 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
435 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
436 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
437 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
438 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
439 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
440 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
441 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
442 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
443 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
444 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
445 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
446 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
447 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
448 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
449 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
450 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
451 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
452 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
453 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
454 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
455 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
456 3004167301 Mesorhizobium loti 582 Isolate Unclassified
457 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
458 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
459 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
460 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
461 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
462 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
463 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
464 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
465 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
466 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
467 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
468 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
469 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
470 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
471 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
472 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
473 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
474 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
475 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
476 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
477 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
478 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
479 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
480 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
481 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
482 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
483 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
484 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
485 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
486 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
487 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
488 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
489 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
490 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
491 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
492 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
493 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
494 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
495 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
496 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
497 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
498 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
499 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
500 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
501 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
502 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
503 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
504 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
505 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
506 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
507 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
508 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
509 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
510 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
511 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
512 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
513 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
514 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
515 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
516 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
517 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
518 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
519 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
520 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
521 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
522 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
523 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
524 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
525 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
526 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
527 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
528 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
529 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
530 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
531 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
532 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
533 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
534 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
535 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
536 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
537 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
538 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
539 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
540 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
541 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
542 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
543 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
544 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
545 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
546 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
547 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
548 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
549 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
550 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
551 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
552 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
553 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
554 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
555 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
556 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
557 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
558 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
559 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
560 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
561 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
562 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
563 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
564 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
565 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
566 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
567 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
568 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
569 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
570 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
571 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
572 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
573 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
574 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
575 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
576 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
577 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
578 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
579 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
580 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
581 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
582 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
583 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
584 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
585 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
586 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
587 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
588 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
589 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
590 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
591 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
592 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
593 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
594 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
595 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
596 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
597 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
598 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
599 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
600 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
601 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
602 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
603 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
604 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
605 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
606 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
607 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
608 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
609 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
610 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
611 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
612 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
613 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
614 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
615 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
616 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
617 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
618 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
619 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
620 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
621 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
622 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
623 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
624 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
625 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
626 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
627 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
628 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
629 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
630 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
631 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
632 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
633 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
634 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
635 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
636 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
637 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
638 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
639 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
640 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
641 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
642 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
643 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
644 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
645 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
646 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
647 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
648 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
649 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
650 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
651 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
652 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
653 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
654 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
655 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
656 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
657 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
658 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
659 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
660 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
661 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
662 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
663 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
664 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
665 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
666 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
667 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
668 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
669 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
670 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
671 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
672 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
673 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
674 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
675 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
676 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
677 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
678 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
679 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
680 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
681 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
682 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
683 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
684 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
685 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
686 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
687 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
688 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
689 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
690 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
691 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
692 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
693 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
694 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
695 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
696 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
697 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
698 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
699 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
700 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
701 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
702 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
703 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
704 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
705 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
706 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
707 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
708 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
709 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 39.24
Metatranscriptomes 0
Isolates 60.76

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.95
Nodule 57.44
Rhizoplane 1.11
Rhizosphere 31.98
Stem 0
Stem Tuber 0
Unclassified 6.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25157J39369_1000883 3300002741 Bacteria 14428
2 JGI25159J45721_1002347 3300002987 Bacteria 7242
3 JGI25151J46595_10016496 3300003187 Bacteria 3229
4 JGI25160J50197_1000248 3300003354 Bacteria 41777
5 JGI25161J50226_1000183 3300003374 Bacteria 41777
6 Ga0055542_1000997 3300003762 Bacteria 18150
7 Ga0055543_1000245 3300004625 Bacteria 41815
8 Ga0065165_1001012 3300005262 Bacteria 34230
9 Ga0068869_100002565 3300005334 Bacteria 10973
10 Ga0068869_100021988 3300005334 Bacteria 4390
11 Ga0068868_100243842 3300005338 Bacteria 1510
12 Ga0070669_100038109 3300005353 Bacteria 3489
13 Ga0070669_100100208 3300005353 Bacteria 2184
14 Ga0070674_100014071 3300005356 Bacteria 4965
15 Ga0070674_100018046 3300005356 Bacteria 4452
16 Ga0070688_100226369 3300005365 Bacteria 1320
17 Ga0070659_100121132 3300005366 Bacteria 2119
18 Ga0070659_100154234 3300005366 Bacteria 1875
19 Ga0070713_100037915 3300005436 Bacteria 3900
20 Ga0070711_100191533 3300005439 Bacteria 1572
21 Ga0070700_100006486 3300005441 Bacteria 6262
22 Ga0070694_100177451 3300005444 Bacteria 1573
23 Ga0070708_100081274 3300005445 Bacteria 2934
24 Ga0070708_100105467 3300005445 Bacteria 2586
25 Ga0070681_10021135 3300005458 Bacteria 6521
26 Ga0068867_100003008 3300005459 Bacteria 11880
27 Ga0070706_100005829 3300005467 Bacteria 11689
28 Ga0070706_100012677 3300005467 Bacteria 7798
29 Ga0070707_100087322 3300005468 Bacteria 3017
30 Ga0070707_100241361 3300005468 Bacteria 1758
31 Ga0070698_100007395 3300005471 Bacteria 11884
32 Ga0070698_100017344 3300005471 Bacteria 7586
33 Ga0070698_100180094 3300005471 Bacteria 2052
34 Ga0070699_100002153 3300005518 Bacteria 17815
35 Ga0070699_100056287 3300005518 Bacteria 3405
36 Ga0070684_100020552 3300005535 Bacteria 5476
37 Ga0070697_100010896 3300005536 Bacteria 7101
38 Ga0070697_100044574 3300005536 Bacteria 3593
39 Ga0068853_100003049 3300005539 Bacteria 12792
40 Ga0068853_100028418 3300005539 Bacteria 4703
41 Ga0070672_100024311 3300005543 Bacteria 4475
42 Ga0070686_100009849 3300005544 Bacteria 5371
43 Ga0070686_100009913 3300005544 Bacteria 5357
44 Ga0070686_100096609 3300005544 Bacteria 1987
45 Ga0070696_100014190 3300005546 Bacteria 5346
46 Ga0070665_100010912 3300005548 Bacteria 9189
47 Ga0070665_100028936 3300005548 Bacteria 5577
48 Ga0068855_100017230 3300005563 Bacteria 8693
49 Ga0068856_100037087 3300005614 Bacteria 4782
50 Ga0068856_100204435 3300005614 Bacteria 1989
51 Ga0070702_100094417 3300005615 Bacteria 1821
52 Ga0068852_100017456 3300005616 Bacteria 5631
53 Ga0068864_100191146 3300005618 Bacteria 1877
54 Ga0068861_100000528 3300005719 Bacteria 22394
55 Ga0068870_10066426 3300005840 Bacteria 1953
56 Ga0068858_100010662 3300005842 Bacteria 8692
57 Ga0068858_100010782 3300005842 Bacteria 8641
58 Ga0068858_100215671 3300005842 Bacteria 1817
59 Ga0068860_100000693 3300005843 Bacteria 38695
60 Ga0068860_100087629 3300005843 Bacteria 2964
61 Ga0068862_100141795 3300005844 Bacteria 2133
62 Ga0081455_10001945 3300005937 Bacteria 24827
63 Ga0081455_10046861 3300005937 Bacteria 3747
64 Ga0081539_10002732 3300005985 Bacteria 23848
65 Ga0070717_10031885 3300006028 Bacteria 4243
66 Ga0075365_10128800 3300006038 Bacteria 1750
67 Ga0075364_10031274 3300006051 Bacteria 3420
68 Ga0070716_100097855 3300006173 Bacteria 1792
69 Ga0097621_100058390 3300006237 Bacteria 3157
70 Ga0075430_100020550 3300006846 Bacteria 5616
71 Ga0075429_100116125 3300006880 Bacteria 2340
72 Ga0068865_100000782 3300006881 Bacteria 17887
73 Ga0068865_100104689 3300006881 Bacteria 2077
74 Ga0099794_10096660 3300007265 Bacteria 1471
75 Ga0099795_10037473 3300007788 Bacteria 1706
76 Ga0105240_10306216 3300009093 Bacteria 1816
77 Ga0105240_10539504 3300009093 Bacteria 1292
78 Ga0105240_10561186 3300009093 Bacteria 1262
79 Ga0114129_10150282 3300009147 Bacteria 3187
80 Ga0105243_10083244 3300009148 Bacteria 2617
81 Ga0105241_10003046 3300009174 Bacteria 12508
82 Ga0105242_10041274 3300009176 Bacteria 3721
83 Ga0105248_10374435 3300009177 Bacteria 1603
84 Ga0105237_10011641 3300009545 Bacteria 9308
85 Ga0105238_10010422 3300009551 Bacteria 9331
86 Ga0105238_10016370 3300009551 Bacteria 7505
87 Ga0105238_10086900 3300009551 Bacteria 3114
88 Ga0105249_10011516 3300009553 Bacteria 7772
89 Ga0123341_1000002 3300009765 Bacteria 191257
90 Ga0123342_1024895 3300009766 Bacteria 3682
91 Ga0105239_10152678 3300010375 Bacteria 2577
92 Ga0105239_10215219 3300010375 Bacteria 2154
93 Ga0105239_10283948 3300010375 Bacteria 1864
94 Ga0105246_10181193 3300011119 Bacteria 1622
95 Ga0157371_10117980 3300013102 Bacteria 1886
96 Ga0157369_10186808 3300013105 Bacteria 2179
97 Ga0157378_10000567 3300013297 Bacteria 35017
98 Ga0157378_10020203 3300013297 Bacteria 5859
99 Ga0163162_10023386 3300013306 Bacteria 6099
100 Ga0163162_10071653 3300013306 Bacteria 3519
101 Ga0163162_10109227 3300013306 Bacteria 2863
102 Ga0157372_10146897 3300013307 Bacteria 2719
103 Ga0157375_10030013 3300013308 Bacteria 5120
104 Ga0157375_10084396 3300013308 Bacteria 3224
105 Ga0157375_10167228 3300013308 Bacteria 2344
106 Ga0157375_10195640 3300013308 Bacteria 2177
107 Ga0157380_10009891 3300014326 Bacteria 6847
108 Ga0182008_10028948 3300014497 Bacteria 2800
109 Ga0157379_10073322 3300014968 Bacteria 3064
110 Ga0157379_10243440 3300014968 Bacteria 1631
111 Ga0157376_10087459 3300014969 Bacteria 2689
112 Ga0163161_10284218 3300017792 Bacteria 1299
113 Ga0214542_1000023 3300021321 Bacteria 191557
114 Ga0214543_1000019 3300021327 Bacteria 267908
115 Ga0214543_1000156 3300021327 Bacteria 96889
116 Ga0228711_1000056 3300022739 Bacteria 78987
117 Ga0228710_1000229 3300022740 Bacteria 58988
118 Ga0209026_1000100 3300025250 Bacteria 156131
119 Ga0209148_1000069 3300025254 Bacteria 334444
120 Ga0209148_1007886 3300025254 Bacteria 2176
121 Ga0209759_1000549 3300025256 Bacteria 38630
122 Ga0209233_1000028 3300025261 Bacteria 642062
123 Ga0209233_1027876 3300025261 Bacteria 1362
124 Ga0209455_1000135 3300025272 Bacteria 148007
125 Ga0209130_1000098 3300025284 Bacteria 142506
126 Ga0209025_1000180 3300025294 Bacteria 157372
127 Ga0207426_1000069 3300025302 Bacteria 334513
128 Ga0207642_10006621 3300025899 Bacteria 3864
129 Ga0207642_10014701 3300025899 Bacteria 2897
130 Ga0207680_10211805 3300025903 Bacteria 1325
131 Ga0207647_10062497 3300025904 Bacteria 2269
132 Ga0207684_10007039 3300025910 Bacteria 10173
133 Ga0207684_10014342 3300025910 Bacteria 6836
134 Ga0207654_10029847 3300025911 Bacteria 2989
135 Ga0207707_10199664 3300025912 Bacteria 1744
136 Ga0207695_10099921 3300025913 Bacteria 2898
137 Ga0207695_10121521 3300025913 Bacteria 2579
138 Ga0207671_10017693 3300025914 Bacteria 5490
139 Ga0207671_10050550 3300025914 Bacteria 3078
140 Ga0207646_10022450 3300025922 Bacteria 5813
141 Ga0207646_10082655 3300025922 Bacteria 2872
142 Ga0207681_10043446 3300025923 Bacteria 3008
143 Ga0207650_10274789 3300025925 Bacteria 1370
144 Ga0207700_10029000 3300025928 Bacteria 3900
145 Ga0207690_10122285 3300025932 Bacteria 1893
146 Ga0207690_10129363 3300025932 Bacteria 1846
147 Ga0207669_10014236 3300025937 Bacteria 3982
148 Ga0207669_10026562 3300025937 Bacteria 3152
149 Ga0207704_10002454 3300025938 Bacteria 8345
150 Ga0207704_10074731 3300025938 Bacteria 2164
151 Ga0207665_10040832 3300025939 Bacteria 3096
152 Ga0207691_10015166 3300025940 Bacteria 7333
153 Ga0207689_10001210 3300025942 Bacteria 24834
154 Ga0207661_10044275 3300025944 Bacteria 3517
155 Ga0207667_10041153 3300025949 Bacteria 4916
156 Ga0207677_10254565 3300026023 Bacteria 1428
157 Ga0207703_10052317 3300026035 Bacteria 3315
158 Ga0207639_10002319 3300026041 Bacteria 12776
159 Ga0207639_10031055 3300026041 Bacteria 3924
160 Ga0207639_10175816 3300026041 Bacteria 1817
161 Ga0207708_10002503 3300026075 Bacteria 13520
162 Ga0207708_10012494 3300026075 Bacteria 6330
163 Ga0207702_10013168 3300026078 Bacteria 6878
164 Ga0207648_10001901 3300026089 Bacteria 22830
165 Ga0207648_10002672 3300026089 Bacteria 18989
166 Ga0207648_10213537 3300026089 Bacteria 1713
167 Ga0207674_10019394 3300026116 Bacteria 7367
168 Ga0207675_100001098 3300026118 Bacteria 26798
169 Ga0207675_100045332 3300026118 Bacteria 4108
170 Ga0207683_10038954 3300026121 Bacteria 4145
171 Ga0207683_10141708 3300026121 Bacteria 2166
172 Ga0207683_10148313 3300026121 Bacteria 2116
173 Ga0207698_10108162 3300026142 Bacteria 2323
174 Ga0209281_1000272 3300027111 Bacteria 99700
175 Ga0209281_1000709 3300027111 Bacteria 33568
176 Ga0209282_1000055 3300027666 Bacteria 101018
177 Ga0268266_10093169 3300028379 Bacteria 2643
178 Ga0268265_10007008 3300028380 Bacteria 7623
179 Ga0268265_10102207 3300028380 Bacteria 2318
180 Ga0268264_10005078 3300028381 Bacteria 11147
181 Ga0307515_10001956 3300028794 Bacteria 45627
182 Ga0265316_10109978 3300031344 Bacteria 2088
183 Ga0307513_10140077 3300031456 Bacteria 2347
184 Ga0307408_100193171 3300031548 Bacteria 1642
185 Ga0315914_1000095 3300031967 Bacteria 74092
186 Ga0315913_1000019 3300033430 Bacteria 100387
187 Ga0315915_1000023 3300033464 Bacteria 119157
188 Ga0373937_0128686 3300036401 Bacteria 2364
189 Ga0395899_0036383 3300037312 Bacteria 3693
190 Ga0395900_0001711 3300037418 Bacteria 25377
191 Ga0395900_0169684 3300037418 Bacteria 2222
192 Ga0395905_0000790 3300037471 Bacteria 41600
193 Ga0395905_0052469 3300037471 Bacteria 3817
194 Ga0395901_0003637 3300038443 Bacteria 15549
195 Ga0395901_0275241 3300038443 Bacteria 1750
196 Ga0439438_027260 3300041405 Bacteria 1543
197 Ga0439465_0008078 3300041413 Bacteria 3327
198 Ga0451835_0345568 3300041492 Bacteria 2178
199 Ga0451839_0268866 3300041496 Bacteria 3367
200 Ga0451841_0548923 3300041498 Bacteria 3014
201 Ga0451847_0448429 3300041503 Bacteria 3966
202 Ga0451847_0898239 3300041503 Bacteria 1974
203 Ga0451851_0633554 3300041507 Bacteria 1266
204 Ga0439442_010958 3300042002 Bacteria 1842
205 Ga0439449_0001660 3300042007 Bacteria 8743
206 Ga0439462_0017864 3300042015 Bacteria 1839
207 Ga0453683_0083466 3300044673 Bacteria 2002
208 Ga0451576_0520358 3300045051 Bacteria 1250
209 Ga0495592_0018991 3300046454 Bacteria 5232
210 Ga0495638_0010733 3300046460 Bacteria 6337
211 Ga0495638_0046165 3300046460 Bacteria 2737
212 Ga0495638_0103759 3300046460 Bacteria 1697
213 Ga0495605_0007855 3300046474 Bacteria 6042
214 Ga0495585_0124069 3300046492 Bacteria 1364
215 Ga0495607_0044522 3300046501 Bacteria 2617
216 Ga0495610_0012520 3300046512 Bacteria 5100
217 Ga0495618_0028680 3300046514 Bacteria 3470
218 Ga0495628_0041546 3300046516 Bacteria 3671
219 Ga0495631_0027227 3300046518 Bacteria 2618
220 Ga0495648_0013496 3300046524 Bacteria 6033
221 Ga0495597_0035849 3300046542 Bacteria 2236
222 Ga0495633_0022809 3300046558 Bacteria 3108
223 Ga0495668_0100639 3300046616 Bacteria 1581
224 Ga0495668_0101115 3300046616 Bacteria 1577
225 Ga0495625_0005544 3300046660 Bacteria 11461
226 Ga0495625_0015194 3300046660 Bacteria 6109
227 Ga0495599_0019409 3300046678 Bacteria 4237
228 Ga0495671_0012740 3300046692 Bacteria 4582
229 Ga0495660_0047616 3300046810 Bacteria 2347
230 Ga0495687_000790 3300047443 Bacteria 34028
231 Ga0495686_0066523 3300047472 Bacteria 2227
232 Ga0495626_0049137 3300048091 Bacteria 1954
233 Ga0495626_0070738 3300048091 Bacteria 1569
234 Ga0496102_0266912 3300048905 Bacteria 1614
235 Ga0496103_0156325 3300048906 Bacteria 1462
236 Ga0496108_0169740 3300048911 Bacteria 1887
237 Ga0496109_0087678 3300048912 Bacteria 2875
238 Ga0496110_0115130 3300048913 Bacteria 2420
239 Ga0496112_0001731 3300048915 Bacteria 17084
240 Ga0496113_0202494 3300048916 Bacteria 1578
241 Ga0496115_0077566 3300048918 Bacteria 2702
242 Ga0496119_0015738 3300048922 Bacteria 5800
243 Ga0496119_0075000 3300048922 Bacteria 1967
244 Ga0496120_0002155 3300048923 Bacteria 20986
245 Ga0496120_0034257 3300048923 Bacteria 3044
246 Ga0496121_0065485 3300048924 Bacteria 2956
247 Ga0496121_0085995 3300048924 Bacteria 2472
248 Ga0496125_0052190 3300048928 Bacteria 3364
249 Ga0496126_0109794 3300048929 Bacteria 2404
250 Ga0501031_0000008 3300049568 Bacteria 156304
251 Ga0501032_0000018 3300049569 Bacteria 156275
252 Ga0501033_0000032 3300049570 Bacteria 156304
253 Ga0501033_0131031 3300049570 Bacteria 1816
254 Ga0501034_0000103 3300049571 Bacteria 156304
255 Ga0501034_0000444 3300049571 Bacteria 68426
256 Ga0501034_0027759 3300049571 Bacteria 5755
257 Ga0501034_0058940 3300049571 Bacteria 3857
258 Ga0501034_0098582 3300049571 Bacteria 2918
259 Ga0501034_0138581 3300049571 Bacteria 2413
260 Ga0501034_0142525 3300049571 Bacteria 2375
261 Ga0501034_0214410 3300049571 Bacteria 1880
262 Ga0501036_0000012 3300049572 Bacteria 156304
263 Ga0501036_0048906 3300049572 Bacteria 3580
264 Ga0501036_0121790 3300049572 Bacteria 2203
265 Ga0501037_0000018 3300049573 Bacteria 156304
266 Ga0501037_0045997 3300049573 Bacteria 3202
267 Ga0501037_0078181 3300049573 Bacteria 2400
268 Ga0501038_0000017 3300049574 Bacteria 156304
269 Ga0501038_0028367 3300049574 Bacteria 4974
270 Ga0501039_0000024 3300049575 Bacteria 156304
271 Ga0501039_0012606 3300049575 Bacteria 6461
272 Ga0501039_0026717 3300049575 Bacteria 4436
273 Ga0501040_0002939 3300049576 Bacteria 11019
274 Ga0501042_0021447 3300049578 Bacteria 4503
275 Ga0501043_0087776 3300049579 Bacteria 2444
276 Ga0501043_0184059 3300049579 Bacteria 1627
277 Ga0501043_0203632 3300049579 Bacteria 1535
278 Ga0501046_0019750 3300049580 Bacteria 5583
279 Ga0501047_0004558 3300049581 Bacteria 13028
280 Ga0501047_0021324 3300049581 Bacteria 6219
281 Ga0501047_0039924 3300049581 Bacteria 4539
282 Ga0501047_0208265 3300049581 Bacteria 1814
283 Ga0501048_0032565 3300049582 Bacteria 3766
284 Ga0501068_0000614 3300049584 Bacteria 18139
285 Ga0501068_0038689 3300049584 Bacteria 2858
286 Ga0501069_0030241 3300049585 Bacteria 2974
287 Ga0501070_0007753 3300049586 Bacteria 9100
288 Ga0501070_0015990 3300049586 Bacteria 6306
289 Ga0501070_0084376 3300049586 Bacteria 2630
290 Ga0501070_0098602 3300049586 Bacteria 2417
291 Ga0501072_0006051 3300049588 Bacteria 9232
292 Ga0501073_0000143 3300049589 Bacteria 47217
293 Ga0501073_0006109 3300049589 Bacteria 8986
294 Ga0501073_0050868 3300049589 Bacteria 2902
295 Ga0501074_0027973 3300049590 Bacteria 4087
296 Ga0501074_0059501 3300049590 Bacteria 2752
297 Ga0501076_0365988 3300049592 Bacteria 1185
298 Ga0501080_0000955 3300049742 Bacteria 23659
299 Ga0501080_0059312 3300049742 Bacteria 3561
300 Ga0501035_0000040 3300049822 Bacteria 156262
301 Ga0501035_0090497 3300049822 Bacteria 2693
302 Ga0501035_0317488 3300049822 Bacteria 1309
303 Ga0501044_0000040 3300049823 Bacteria 156304
304 Ga0501044_0016222 3300049823 Bacteria 8008
305 Ga0501044_0038740 3300049823 Bacteria 4976
306 Ga0501044_0073102 3300049823 Bacteria 3485
307 Ga0501044_0236414 3300049823 Bacteria 1772
308 Ga0501045_0028489 3300049824 Bacteria 4029
309 nmdc:mga00v17_83103_c1 3300050491 Bacteria 2002
310 nmdc:mga07m45_82434_c1 3300050496 Bacteria 1837
311 nmdc:mga05p37_87408_c1 3300050507 Bacteria 3841
312 nmdc:mga09592_80253_c1 3300050508 Bacteria 2778
313 nmdc:mga06r32_3536_c1 3300050510 Bacteria 13957
314 Ga0495601_0024791 3300053077 Bacteria 3694
315 Ga0500644_0013497 3300053088 Bacteria 2283
316 Ga0500608_030026 3300053122 Bacteria 2574
317 Ga0500616_0109998 3300053153 Bacteria 1332
318 Ga0500620_000789 3300053155 Bacteria 5479
319 Ga0500622_0000734 3300053156 Bacteria 28647

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046460 Ga0495638_0103759 Ga0495638_0103759_702_1676 322
2 iso_pu_bacteria 2958041894 2958044351 325
3 3300005518 Ga0070699_100002153 Ga0070699_10000215318 335
4 3300048929 Ga0496126_0109794 Ga0496126_0109794_119_1204 341
5 3300013105 Ga0157369_10186808 Ga0157369_101868081 359
6 3300025261 Ga0209233_1000028 Ga0209233_100002891 359
7 3300046542 Ga0495597_0035849 Ga0495597_0035849_792_1913 359
8 3300047443 Ga0495687_000790 Ga0495687_000790_19583_20704 359
9 3300048091 Ga0495626_0049137 Ga0495626_0049137_218_1339 359
10 3300046460 Ga0495638_0046165 Ga0495638_0046165_1345_2454 360
11 iso_pu_bacteria 2837651117 2837652030 360
12 iso_pu_bacteria 2996310559 2996316559 362
13 iso_pu_bacteria 2996336353 2996341640 362
14 3300049589 Ga0501073_0006109 Ga0501073_0006109_7336_8448 363
15 iso_pu_bacteria 2503198000 2503199721 363
16 iso_pu_bacteria 2508501122 2509111463 363
17 iso_pu_bacteria 2508501123 2509116662 363
18 iso_pu_bacteria 2508501127 2509142460 363
19 iso_pu_bacteria 2509276018 2509372048 363
20 iso_pu_bacteria 2509276019 2509379602 363
21 iso_pu_bacteria 2509276022 2509394650 363
22 iso_pu_bacteria 2509276033 2509442297 363
23 iso_pu_bacteria 2510065019 2510136107 363
24 iso_pu_bacteria 2510065057 2510306504 363
25 iso_pu_bacteria 2510065059 2510318771 363
26 iso_pu_bacteria 2510461076 2510892889 363
27 iso_pu_bacteria 2511231052 2511499772 363
28 iso_pu_bacteria 2512047086 2512530195 363
29 iso_pu_bacteria 2512875024 2512960884 363
30 iso_pu_bacteria 2512875026 2512975485 363
31 iso_pu_bacteria 2513237084 2513568409 363
32 iso_pu_bacteria 2513237086 2513584888 363
33 iso_pu_bacteria 2513237089 2513605865 363
34 iso_pu_bacteria 2513237091 2513618270 363
35 iso_pu_bacteria 2513237093 2513630734 363
36 iso_pu_bacteria 2513237103 2513711914 363
37 iso_pu_bacteria 2513237140 2513883037 363
38 iso_pu_bacteria 2513237143 2513903092 363
39 iso_pu_bacteria 2513237146 2513924881 363
40 iso_pu_bacteria 2513237160 2514006836 363
41 iso_pu_bacteria 2513237162 2514018243 363
42 iso_pu_bacteria 2513237164 2514036656 363
43 iso_pu_bacteria 2513237305 2514417279 363
44 iso_pu_bacteria 2513237351 2514585988 363
45 iso_pu_bacteria 2515075009 2515108965 363
46 iso_pu_bacteria 2515154107 2515611871 363
47 iso_pu_bacteria 2515154113 2515633030 363
48 iso_pu_bacteria 2515154114 2515640235 363
49 iso_pu_bacteria 2515154116 2515656316 363
50 iso_pu_bacteria 2516653046 2516897362 363
51 iso_pu_bacteria 2516653077 2517040906 363
52 iso_pu_bacteria 2517093000 2517098506 363
53 iso_pu_bacteria 2517487022 2517567077 363
54 iso_pu_bacteria 2524023207 2524453260 363
55 iso_pu_bacteria 2551306084 2551678527 363
56 iso_pu_bacteria 2551306084 2551681542 363
57 iso_pu_bacteria 2551306085 2551688902 363
58 iso_pu_bacteria 2551306086 2551695899 363
59 iso_pu_bacteria 2551306087 2551702701 363
60 iso_pu_bacteria 2551306089 2551714928 363
61 iso_pu_bacteria 2551306090 2551723423 363
62 iso_pu_bacteria 2551306091 2551730196 363
63 iso_pu_bacteria 2551306092 2551739130 363
64 iso_pu_bacteria 2551306093 2551742831 363
65 iso_pu_bacteria 2558860100 2558862905 363
66 iso_pu_bacteria 2597489875 2597811073 363
67 iso_pu_bacteria 2599185170 2599416442 363
68 iso_pu_bacteria 2599185301 2599939853 363
69 iso_pu_bacteria 2615840624 2616297879 363
70 iso_pu_bacteria 2643221595 2643987602 363
71 iso_pu_bacteria 2643221627 2644157877 363
72 iso_pu_bacteria 2643221634 2644195215 363
73 iso_pu_bacteria 2643221643 2644241125 363
74 iso_pu_bacteria 2687453392 2688596973 363
75 iso_pu_bacteria 2693429783 2694630232 363
76 iso_pu_bacteria 2693429784 2694634312 363
77 iso_pu_bacteria 2721755686 2723574123 363
78 iso_pu_bacteria 2724679232 2725949376 363
79 iso_pu_bacteria 2756170246 2756670937 363
80 iso_pu_bacteria 2765235942 2766064614 363
81 iso_pu_bacteria 2775506902 2776267098 363
82 iso_pu_bacteria 2775506904 2776283427 363
83 iso_pu_bacteria 2791355091 2792621355 363
84 iso_pu_bacteria 2791355092 2792627960 363
85 iso_pu_bacteria 2791355094 2792643664 363
86 iso_pu_bacteria 2791355259 2793315007 363
87 iso_pu_bacteria 2802428858 2802720975 363
88 iso_pu_bacteria 2802428859 2802727466 363
89 iso_pu_bacteria 2802428860 2802733433 363
90 iso_pu_bacteria 2802428861 2802740173 363
91 iso_pu_bacteria 2802428862 2802746487 363
92 iso_pu_bacteria 2802428863 2802753239 363
93 iso_pu_bacteria 2838035591 2838036557 363
94 iso_pu_bacteria 2838661181 2838662464 363
95 iso_pu_bacteria 2839993093 2839997345 363
96 iso_pu_bacteria 2840764183 2840765794 363
97 iso_pu_bacteria 2841734538 2841737469 363
98 iso_pu_bacteria 2842110456 2842113791 363
99 iso_pu_bacteria 2842205361 2842209937 363
100 iso_pu_bacteria 2842217011 2842219637 363
101 iso_pu_bacteria 2842278818 2842283391 363
102 iso_pu_bacteria 2842489311 2842494813 363
103 iso_pu_bacteria 2842495871 2842500849 363
104 iso_pu_bacteria 2844002411 2844008971 363
105 iso_pu_bacteria 2844009547 2844012314 363
106 iso_pu_bacteria 2847670302 2847674713 363
107 iso_pu_bacteria 2847686936 2847690822 363
108 iso_pu_bacteria 2850079185 2850079386 363
109 iso_pu_bacteria 2855825444 2855830766 363
110 iso_pu_bacteria 2855839649 2855845462 363
111 iso_pu_bacteria 2856314179 2856317401 363
112 iso_pu_bacteria 2856320880 2856322810 363
113 iso_pu_bacteria 2856334872 2856338345 363
114 iso_pu_bacteria 2856342000 2856349207 363
115 iso_pu_bacteria 2856349417 2856355341 363
116 iso_pu_bacteria 2856356410 2856357787 363
117 iso_pu_bacteria 2856364286 2856366864 363
118 iso_pu_bacteria 2857349434 2857352248 363
119 iso_pu_bacteria 2857516855 2857523139 363
120 iso_pu_bacteria 2858800743 2858805329 363
121 iso_pu_bacteria 2869162929 2869168568 363
122 iso_pu_bacteria 2869169390 2869175176 363
123 iso_pu_bacteria 2869242130 2869249196 363
124 iso_pu_bacteria 2869249662 2869249915 363
125 iso_pu_bacteria 2869256925 2869262918 363
126 iso_pu_bacteria 2869264136 2869270043 363
127 iso_pu_bacteria 2869271264 2869272737 363
128 iso_pu_bacteria 2869278585 2869285646 363
129 iso_pu_bacteria 2869285874 2869287724 363
130 iso_pu_bacteria 2871429161 2871435672 363
131 iso_pu_bacteria 2871435913 2871436071 363
132 iso_pu_bacteria 2871444079 2871445472 363
133 iso_pu_bacteria 2871451962 2871452844 363
134 iso_pu_bacteria 2871459585 2871460258 363
135 iso_pu_bacteria 2871466892 2871473279 363
136 iso_pu_bacteria 2871474448 2871476952 363
137 iso_pu_bacteria 2871481445 2871485847 363
138 iso_pu_bacteria 2871488783 2871493513 363
139 iso_pu_bacteria 2871495908 2871496537 363
140 iso_pu_bacteria 2874102143 2874105277 363
141 iso_pu_bacteria 2874109183 2874112432 363
142 iso_pu_bacteria 2874116593 2874119255 363
143 iso_pu_bacteria 2874123672 2874128953 363
144 iso_pu_bacteria 2874139085 2874142016 363
145 iso_pu_bacteria 2874146452 2874151355 363
146 iso_pu_bacteria 2874155637 2874158989 363
147 iso_pu_bacteria 2874162495 2874163041 363
148 iso_pu_bacteria 2876369609 2876377293 363
149 iso_pu_bacteria 2876386047 2876387070 363
150 iso_pu_bacteria 2876392853 2876397715 363
151 iso_pu_bacteria 2876399893 2876405599 363
152 iso_pu_bacteria 2876406927 2876413845 363
153 iso_pu_bacteria 2876413966 2876417408 363
154 iso_pu_bacteria 2876420981 2876422192 363
155 iso_pu_bacteria 2878035449 2878038439 363
156 iso_pu_bacteria 2878738818 2878744800 363
157 iso_pu_bacteria 2878745973 2878749235 363
158 iso_pu_bacteria 2878753008 2878757555 363
159 iso_pu_bacteria 2878760144 2878760765 363
160 iso_pu_bacteria 2878767105 2878767610 363
161 iso_pu_bacteria 2878774303 2878775696 363
162 iso_pu_bacteria 2878788777 2878796931 363
163 iso_pu_bacteria 2881147464 2881149597 363
164 iso_pu_bacteria 2881155292 2881160778 363
165 iso_pu_bacteria 2881161766 2881166476 363
166 iso_pu_bacteria 2881845957 2881850826 363
167 iso_pu_bacteria 2881861095 2881864236 363
168 iso_pu_bacteria 2882632389 2882639390 363
169 iso_pu_bacteria 2882912400 2882918387 363
170 iso_pu_bacteria 2885305155 2885307957 363
171 iso_pu_bacteria 2885312484 2885313121 363
172 iso_pu_bacteria 2885318864 2885319408 363
173 iso_pu_bacteria 2885326080 2885326741 363
174 iso_pu_bacteria 2885334103 2885337967 363
175 iso_pu_bacteria 2885342637 2885346515 363
176 iso_pu_bacteria 2885350715 2885356115 363
177 iso_pu_bacteria 2888343758 2888345385 363
178 iso_pu_bacteria 2888350351 2888354705 363
179 iso_pu_bacteria 2889010040 2889016320 363
180 iso_pu_bacteria 2889016732 2889018657 363
181 iso_pu_bacteria 2889790730 2889794449 363
182 iso_pu_bacteria 2889914905 2889914960 363
183 iso_pu_bacteria 2896384573 2896389741 363
184 iso_pu_bacteria 2903492973 2903498699 363
185 iso_pu_bacteria 2903492973 2903501285 363
186 iso_pu_bacteria 2903540706 2903541331 363
187 iso_pu_bacteria 2904659560 2904664366 363
188 iso_pu_bacteria 2906308376 2906310273 363
189 iso_pu_bacteria 2906321335 2906324338 363
190 iso_pu_bacteria 2906328253 2906333152 363
191 iso_pu_bacteria 2906363423 2906365971 363
192 iso_pu_bacteria 2906378014 2906378166 363
193 iso_pu_bacteria 2906386501 2906390956 363
194 iso_pu_bacteria 2906393657 2906395257 363
195 iso_pu_bacteria 2906401398 2906407979 363
196 iso_pu_bacteria 2906408224 2906414058 363
197 iso_pu_bacteria 2906414383 2906417466 363
198 iso_pu_bacteria 2913295892 2913301653 363
199 iso_pu_bacteria 2915980308 2915983594 363
200 iso_pu_bacteria 2915986958 2915989761 363
201 iso_pu_bacteria 2915993759 2915997573 363
202 iso_pu_bacteria 2916000859 2916003636 363
203 iso_pu_bacteria 2916007675 2916011474 363
204 iso_pu_bacteria 2916014648 2916019246 363
205 iso_pu_bacteria 2916021584 2916025705 363
206 iso_pu_bacteria 2916028427 2916032496 363
207 iso_pu_bacteria 2916035215 2916039590 363
208 iso_pu_bacteria 2916041962 2916043863 363
209 iso_pu_bacteria 2916048683 2916053021 363
210 iso_pu_bacteria 2916055098 2916059323 363
211 iso_pu_bacteria 2916061851 2916063235 363
212 iso_pu_bacteria 2916068649 2916071951 363
213 iso_pu_bacteria 2916076590 2916082220 363
214 iso_pu_bacteria 2920760137 2920767153 363
215 iso_pu_bacteria 2921201388 2921201550 363
216 iso_pu_bacteria 2921208531 2921211493 363
217 iso_pu_bacteria 2921237296 2921243157 363
218 iso_pu_bacteria 2921244191 2921247406 363
219 iso_pu_bacteria 2921250672 2921252358 363
220 iso_pu_bacteria 2921257292 2921259135 363
221 iso_pu_bacteria 2921263974 2921268257 363
222 iso_pu_bacteria 2921282425 2921286572 363
223 iso_pu_bacteria 2921289301 2921293049 363
224 iso_pu_bacteria 2921296804 2921299837 363
225 iso_pu_bacteria 2922130491 2922138332 363
226 iso_pu_bacteria 2922151315 2922153679 363
227 iso_pu_bacteria 2922158528 2922159033 363
228 iso_pu_bacteria 2922172374 2922172659 363
229 iso_pu_bacteria 2922178524 2922179873 363
230 iso_pu_bacteria 2922185730 2922188382 363
231 iso_pu_bacteria 2924144063 2924149359 363
232 iso_pu_bacteria 2924150972 2924155151 363
233 iso_pu_bacteria 2924158325 2924162580 363
234 iso_pu_bacteria 2924165586 2924166866 363
235 iso_pu_bacteria 2924172951 2924176689 363
236 iso_pu_bacteria 2924179722 2924182614 363
237 iso_pu_bacteria 2924186466 2924188652 363
238 iso_pu_bacteria 2924193448 2924197069 363
239 iso_pu_bacteria 2924200457 2924206318 363
240 iso_pu_bacteria 2924207177 2924208798 363
241 iso_pu_bacteria 2924214083 2924218462 363
242 iso_pu_bacteria 2924221636 2924222218 363
243 iso_pu_bacteria 2924228884 2924231523 363
244 iso_pu_bacteria 2924726620 2924729363 363
245 iso_pu_bacteria 2924733363 2924733911 363
246 iso_pu_bacteria 2924741084 2924743658 363
247 iso_pu_bacteria 2924748358 2924749209 363
248 iso_pu_bacteria 2924754689 2924755055 363
249 iso_pu_bacteria 2924762789 2924767241 363
250 iso_pu_bacteria 2924776078 2924782831 363
251 iso_pu_bacteria 2924784321 2924786850 363
252 iso_pu_bacteria 2933016740 2933019400 363
253 iso_pu_bacteria 2933586486 2933589573 363
254 iso_pu_bacteria 2936367885 2936374706 363
255 iso_pu_bacteria 2936375103 2936375859 363
256 iso_pu_bacteria 2936996657 2936998157 363
257 iso_pu_bacteria 2937002841 2937009134 363
258 iso_pu_bacteria 2937009748 2937011459 363
259 iso_pu_bacteria 2937016420 2937017249 363
260 iso_pu_bacteria 2937023124 2937026062 363
261 iso_pu_bacteria 2937029754 2937032027 363
262 iso_pu_bacteria 2937036028 2937038838 363
263 iso_pu_bacteria 2937042894 2937046577 363
264 iso_pu_bacteria 2937049772 2937054915 363
265 iso_pu_bacteria 2937056579 2937060667 363
266 iso_pu_bacteria 2937063883 2937067324 363
267 iso_pu_bacteria 2937071275 2937074505 363
268 iso_pu_bacteria 2937078374 2937081400 363
269 iso_pu_bacteria 2937084907 2937088863 363
270 iso_pu_bacteria 2937091812 2937095116 363
271 iso_pu_bacteria 2937098957 2937103761 363
272 iso_pu_bacteria 2937106411 2937109292 363
273 iso_pu_bacteria 2937113482 2937117372 363
274 iso_pu_bacteria 2937119839 2937120826 363
275 iso_pu_bacteria 2937126314 2937130665 363
276 iso_pu_bacteria 2937813078 2937817097 363
277 iso_pu_bacteria 2937822353 2937822541 363
278 iso_pu_bacteria 2937836603 2937840295 363
279 iso_pu_bacteria 2937843397 2937847017 363
280 iso_pu_bacteria 2937861824 2937863412 363
281 iso_pu_bacteria 2937877337 2937883628 363
282 iso_pu_bacteria 2937972304 2937977563 363
283 iso_pu_bacteria 2937994558 2937995187 363
284 iso_pu_bacteria 2957375807 2957375863 363
285 iso_pu_bacteria 2957382221 2957386759 363
286 iso_pu_bacteria 2957388812 2957391613 363
287 iso_pu_bacteria 2957395598 2957397550 363
288 iso_pu_bacteria 2957402308 2957407077 363
289 iso_pu_bacteria 2957408893 2957409322 363
290 iso_pu_bacteria 2957415311 2957418820 363
291 iso_pu_bacteria 2957422303 2957425093 363
292 iso_pu_bacteria 2957430029 2957435610 363
293 iso_pu_bacteria 2957437181 2957437936 363
294 iso_pu_bacteria 2957443900 2957444666 363
295 iso_pu_bacteria 2957450854 2957453031 363
296 iso_pu_bacteria 2957457609 2957463126 363
297 iso_pu_bacteria 2957464669 2957470452 363
298 iso_pu_bacteria 2957471148 2957476052 363
299 iso_pu_bacteria 2957478035 2957482169 363
300 iso_pu_bacteria 2957484790 2957489395 363
301 iso_pu_bacteria 2957491536 2957495385 363
302 iso_pu_bacteria 2957498199 2957502830 363
303 iso_pu_bacteria 2957505466 2957508995 363
304 iso_pu_bacteria 2958034702 2958041661 363
305 iso_pu_bacteria 2958041894 2958047957 363
306 iso_pu_bacteria 2958064165 2958070654 363
307 iso_pu_bacteria 2958071322 2958071504 363
308 iso_pu_bacteria 2958084443 2958090796 363
309 iso_pu_bacteria 2958092219 2958093736 363
310 iso_pu_bacteria 2958100919 2958102435 363
311 iso_pu_bacteria 2958108152 2958111277 363
312 iso_pu_bacteria 2958115193 2958120918 363
313 iso_pu_bacteria 2958122699 2958128974 363
314 iso_pu_bacteria 2958130278 2958132126 363
315 iso_pu_bacteria 2958137437 2958138024 363
316 iso_pu_bacteria 2958144490 2958147380 363
317 iso_pu_bacteria 2958158011 2958164483 363
318 iso_pu_bacteria 2958165035 2958165548 363
319 iso_pu_bacteria 2958172287 2958174664 363
320 iso_pu_bacteria 2958179912 2958181940 363
321 iso_pu_bacteria 2960591022 2960593982 363
322 iso_pu_bacteria 2960597568 2960600513 363
323 iso_pu_bacteria 2960603979 2960606889 363
324 iso_pu_bacteria 2960610863 2960612771 363
325 iso_pu_bacteria 2960617483 2960618418 363
326 iso_pu_bacteria 2960624210 2960628990 363
327 iso_pu_bacteria 2960631154 2960634301 363
328 iso_pu_bacteria 2960637947 2960643406 363
329 iso_pu_bacteria 2960645483 2960651817 363
330 iso_pu_bacteria 2960652885 2960656102 363
331 iso_pu_bacteria 2960660292 2960661305 363
332 iso_pu_bacteria 2960667422 2960670614 363
333 iso_pu_bacteria 2960674078 2960676179 363
334 iso_pu_bacteria 2960680706 2960683023 363
335 iso_pu_bacteria 2960687367 2960689709 363
336 iso_pu_bacteria 2960693952 2960697735 363
337 iso_pu_bacteria 2961077736 2961079784 363
338 iso_pu_bacteria 2961114664 2961119365 363
339 iso_pu_bacteria 2961127735 2961129566 363
340 iso_pu_bacteria 2961163497 2961164007 363
341 iso_pu_bacteria 2961170736 2961175118 363
342 iso_pu_bacteria 2961183825 2961185866 363
343 iso_pu_bacteria 2964607997 2964612341 363
344 iso_pu_bacteria 2964615318 2964617227 363
345 iso_pu_bacteria 2964621998 2964628363 363
346 iso_pu_bacteria 2964628898 2964630109 363
347 iso_pu_bacteria 2964636051 2964637942 363
348 iso_pu_bacteria 2964643177 2964647120 363
349 iso_pu_bacteria 2964649959 2964654427 363
350 iso_pu_bacteria 2964656573 2964660942 363
351 iso_pu_bacteria 2964663802 2964664850 363
352 iso_pu_bacteria 2964670856 2964675206 363
353 iso_pu_bacteria 2964678106 2964683163 363
354 iso_pu_bacteria 2964685014 2964691187 363
355 iso_pu_bacteria 2964691889 2964694028 363
356 iso_pu_bacteria 2964698721 2964699715 363
357 iso_pu_bacteria 2964705432 2964709064 363
358 iso_pu_bacteria 2964712639 2964716413 363
359 iso_pu_bacteria 2964719344 2964724811 363
360 iso_pu_bacteria 2965018300 2965018927 363
361 iso_pu_bacteria 2965025482 2965027042 363
362 iso_pu_bacteria 2965040258 2965047518 363
363 iso_pu_bacteria 2965047637 2965049765 363
364 iso_pu_bacteria 2965062239 2965062840 363
365 iso_pu_bacteria 2965089291 2965090437 363
366 iso_pu_bacteria 2965119406 2965122450 363
367 iso_pu_bacteria 2967664464 2967668849 363
368 iso_pu_bacteria 2967671571 2967675740 363
369 iso_pu_bacteria 2967678726 2967683516 363
370 iso_pu_bacteria 2967686174 2967688238 363
371 iso_pu_bacteria 2967693043 2967697322 363
372 iso_pu_bacteria 2967699805 2967701337 363
373 iso_pu_bacteria 2967706974 2967707536 363
374 iso_pu_bacteria 2967714385 2967719297 363
375 iso_pu_bacteria 2967721400 2967724068 363
376 iso_pu_bacteria 2967728569 2967730174 363
377 iso_pu_bacteria 2967735183 2967739628 363
378 iso_pu_bacteria 2967742019 2967742411 363
379 iso_pu_bacteria 2967748971 2967751763 363
380 iso_pu_bacteria 2967755722 2967759461 363
381 iso_pu_bacteria 2967762386 2967764301 363
382 iso_pu_bacteria 2967769361 2967773910 363
383 iso_pu_bacteria 2967775926 2967776277 363
384 iso_pu_bacteria 2967996073 2967999881 363
385 iso_pu_bacteria 2968003550 2968008240 363
386 iso_pu_bacteria 2968016561 2968020468 363
387 iso_pu_bacteria 2968091066 2968091305 363
388 iso_pu_bacteria 2968097103 2968103133 363
389 iso_pu_bacteria 2968110612 2968115620 363
390 iso_pu_bacteria 2968117919 2968118993 363
391 iso_pu_bacteria 2968128360 2968128923 363
392 iso_pu_bacteria 2968138860 2968144603 363
393 iso_pu_bacteria 2968171901 2968172410 363
394 iso_pu_bacteria 2970019648 2970024238 363
395 iso_pu_bacteria 2970026789 2970027759 363
396 iso_pu_bacteria 2970033650 2970039360 363
397 iso_pu_bacteria 2970040964 2970043639 363
398 iso_pu_bacteria 2970047711 2970052262 363
399 iso_pu_bacteria 2970054988 2970057473 363
400 iso_pu_bacteria 2970061556 2970065807 363
401 iso_pu_bacteria 2970068827 2970071474 363
402 iso_pu_bacteria 2970076120 2970080355 363
403 iso_pu_bacteria 2970088815 2970093360 363
404 iso_pu_bacteria 2970095765 2970098988 363
405 iso_pu_bacteria 2970102677 2970105438 363
406 iso_pu_bacteria 2970109326 2970112681 363
407 iso_pu_bacteria 2970116247 2970119192 363
408 iso_pu_bacteria 2970122695 2970127767 363
409 iso_pu_bacteria 2970129317 2970133246 363
410 iso_pu_bacteria 2970136068 2970140406 363
411 iso_pu_bacteria 2970143518 2970149210 363
412 iso_pu_bacteria 2970149975 2970153509 363
413 iso_pu_bacteria 2970156795 2970163827 363
414 iso_pu_bacteria 2970164137 2970164986 363
415 iso_pu_bacteria 2970170962 2970177249 363
416 iso_pu_bacteria 2970177841 2970184236 363
417 iso_pu_bacteria 2970184632 2970191398 363
418 iso_pu_bacteria 2970191845 2970194587 363
419 iso_pu_bacteria 2970469710 2970473765 363
420 iso_pu_bacteria 2970489779 2970490422 363
421 iso_pu_bacteria 2970503327 2970507706 363
422 iso_pu_bacteria 2970510686 2970516856 363
423 iso_pu_bacteria 2970524798 2970527101 363
424 iso_pu_bacteria 2970540015 2970544542 363
425 iso_pu_bacteria 2970547951 2970548266 363
426 iso_pu_bacteria 2970554993 2970555618 363
427 iso_pu_bacteria 2970593180 2970600262 363
428 iso_pu_bacteria 2970619444 2970620160 363
429 iso_pu_bacteria 2977516862 2977520177 363
430 iso_pu_bacteria 2977523885 2977527590 363
431 iso_pu_bacteria 2977530762 2977533602 363
432 iso_pu_bacteria 2977537788 2977542868 363
433 iso_pu_bacteria 2977544691 2977548617 363
434 iso_pu_bacteria 2977551784 2977556426 363
435 iso_pu_bacteria 2977558990 2977562271 363
436 iso_pu_bacteria 2977565890 2977568395 363
437 iso_pu_bacteria 2977572785 2977576129 363
438 iso_pu_bacteria 2977579622 2977582115 363
439 iso_pu_bacteria 2977821940 2977826712 363
440 iso_pu_bacteria 2977828996 2977832932 363
441 iso_pu_bacteria 2977843712 2977847388 363
442 iso_pu_bacteria 2977851361 2977854166 363
443 iso_pu_bacteria 2977858184 2977862011 363
444 iso_pu_bacteria 2977864932 2977871918 363
445 iso_pu_bacteria 2977872689 2977873990 363
446 iso_pu_bacteria 2977898635 2977902877 363
447 iso_pu_bacteria 2977907340 2977907686 363
448 iso_pu_bacteria 2977915119 2977915878 363
449 iso_pu_bacteria 2977935797 2977940652 363
450 iso_pu_bacteria 2977942078 2977945667 363
451 iso_pu_bacteria 2977950692 2977956391 363
452 iso_pu_bacteria 2977957713 2977958332 363
453 iso_pu_bacteria 2977971508 2977973937 363
454 iso_pu_bacteria 2977986579 2977991294 363
455 iso_pu_bacteria 2979710463 2979713346 363
456 iso_pu_bacteria 2979764755 2979767661 363
457 iso_pu_bacteria 2979779861 2979781086 363
458 iso_pu_bacteria 2979793036 2979793972 363
459 iso_pu_bacteria 2979808191 2979812890 363
460 iso_pu_bacteria 2987636660 2987639432 363
461 iso_pu_bacteria 2987652177 2987653921 363
462 iso_pu_bacteria 2987659509 2987660015 363
463 iso_pu_bacteria 2987666974 2987673439 363
464 iso_pu_bacteria 2987673487 2987673586 363
465 iso_pu_bacteria 2996341866 2996342781 363
466 iso_pu_bacteria 2996348954 2996352912 363
467 iso_pu_bacteria 2996386984 2996393302 363
468 iso_pu_bacteria 3003930520 3003931256 363
469 iso_pu_bacteria 3004167301 3004167360 363
470 iso_pu_bacteria 3004188549 3004189063 363
471 iso_pu_bacteria 3004195979 3004198388 363
472 iso_pu_bacteria 3004203850 3004204324 363
473 iso_pu_bacteria 3004232784 3004232803 363
474 iso_pu_bacteria 3004248173 3004250630 363
475 iso_pu_bacteria 3004275668 3004279594 363
476 iso_pu_bacteria 3004289098 3004294141 363
477 iso_pu_bacteria 639633055 639645350 363
478 iso_pu_bacteria 648276728 648737940 363
479 iso_pu_bacteria 649633066 649871531 363
480 iso_pu_bacteria 8003992118 8003998156 363
481 iso_pu_bacteria 8003999396 8004005666 363
482 iso_pu_bacteria 8004300914 8004301837 363
483 iso_pu_bacteria 8004312739 8004314690 363
484 iso_pu_bacteria 8004374579 8004379128 363
485 iso_pu_bacteria 8004387939 8004389509 363
486 iso_pu_bacteria 8004395343 8004401628 363
487 iso_pu_bacteria 8004445564 8004451780 363
488 iso_pu_bacteria 8004633249 8004637413 363
489 iso_pu_bacteria 8004640170 8004644021 363
490 iso_pu_bacteria 8004703790 8004712330 363
491 iso_pu_bacteria 8004714634 8004717907 363
492 iso_pu_bacteria 8005289223 8005290819 363
493 iso_pu_bacteria 8005301065 8005301303 363
494 iso_pu_bacteria 8005376324 8005380533 363
495 iso_pu_bacteria 8005460587 8005467544 363
496 iso_pu_bacteria 8005556819 8005559459 363
497 iso_pu_bacteria 8005563573 8005566494 363
498 iso_pu_bacteria 8005688590 8005688882 363
499 iso_pu_bacteria 8018127388 8018132322 363
500 iso_pu_bacteria 8018163183 8018163768 363
501 iso_pu_bacteria 8024479707 8024481416 363
502 iso_pu_bacteria 8054558443 8054560625 363
503 iso_pu_bacteria 8055617313 8055619190 363
504 iso_pu_bacteria 8057874678 8057881277 363
505 3300048924 Ga0496121_0065485 Ga0496121_0065485_659_1774 364
506 3300005436 Ga0070713_100037915 Ga0070713_1000379152 365
507 3300005439 Ga0070711_100191533 Ga0070711_1001915331 365
508 3300005445 Ga0070708_100081274 Ga0070708_1000812741 365
509 3300005445 Ga0070708_100105467 Ga0070708_1001054671 365
510 3300005467 Ga0070706_100005829 Ga0070706_1000058296 365
511 3300005468 Ga0070707_100087322 Ga0070707_1000873222 365
512 3300005468 Ga0070707_100241361 Ga0070707_1002413612 365
513 3300005471 Ga0070698_100007395 Ga0070698_10000739510 365
514 3300005471 Ga0070698_100180094 Ga0070698_1001800943 365
515 3300005518 Ga0070699_100056287 Ga0070699_1000562873 365
516 3300005536 Ga0070697_100044574 Ga0070697_1000445743 365
517 3300006028 Ga0070717_10031885 Ga0070717_100318854 365
518 3300006173 Ga0070716_100097855 Ga0070716_1000978552 365
519 3300007788 Ga0099795_10037473 Ga0099795_100374732 365
520 3300025910 Ga0207684_10007039 Ga0207684_100070399 365
521 3300025922 Ga0207646_10022450 Ga0207646_100224502 365
522 3300025922 Ga0207646_10082655 Ga0207646_100826553 365
523 3300025928 Ga0207700_10029000 Ga0207700_100290004 365
524 3300025939 Ga0207665_10040832 Ga0207665_100408323 365
525 3300046454 Ga0495592_0018991 Ga0495592_0018991_1288_2391 365
526 3300046514 Ga0495618_0028680 Ga0495618_0028680_1815_2918 365
527 3300046516 Ga0495628_0041546 Ga0495628_0041546_581_1684 365
528 3300046678 Ga0495599_0019409 Ga0495599_0019409_2985_4088 365
529 3300053077 Ga0495601_0024791 Ga0495601_0024791_2113_3216 365
530 3300009093 Ga0105240_10539504 Ga0105240_105395042 366
531 3300009093 Ga0105240_10561186 Ga0105240_105611862 366
532 3300010375 Ga0105239_10152678 Ga0105239_101526782 366
533 3300025913 Ga0207695_10099921 Ga0207695_100999213 366
534 3300025913 Ga0207695_10121521 Ga0207695_101215213 366
535 3300025914 Ga0207671_10050550 Ga0207671_100505503 366
536 3300049592 Ga0501076_0365988 Ga0501076_0365988_29_1144 366
537 3300050507 nmdc:mga05p37_87408_c1 nmdc:mga05p37_87408_c1_2355_3476 366
538 3300002741 JGI25157J39369_1000883 JGI25157J39369_10008837 367
539 3300002987 JGI25159J45721_1002347 JGI25159J45721_10023472 367
540 3300003187 JGI25151J46595_10016496 JGI25151J46595_100164961 367
541 3300003354 JGI25160J50197_1000248 JGI25160J50197_100024826 367
542 3300003374 JGI25161J50226_1000183 JGI25161J50226_100018318 367
543 3300003762 Ga0055542_1000997 Ga0055542_10009977 367
544 3300004625 Ga0055543_1000245 Ga0055543_100024518 367
545 3300005262 Ga0065165_1001012 Ga0065165_100101226 367
546 3300005334 Ga0068869_100002565 Ga0068869_1000025653 367
547 3300005334 Ga0068869_100021988 Ga0068869_1000219881 367
548 3300005338 Ga0068868_100243842 Ga0068868_1002438422 367
549 3300005353 Ga0070669_100038109 Ga0070669_1000381094 367
550 3300005353 Ga0070669_100100208 Ga0070669_1001002082 367
551 3300005356 Ga0070674_100014071 Ga0070674_1000140714 367
552 3300005356 Ga0070674_100018046 Ga0070674_1000180465 367
553 3300005365 Ga0070688_100226369 Ga0070688_1002263692 367
554 3300005366 Ga0070659_100121132 Ga0070659_1001211322 367
555 3300005366 Ga0070659_100154234 Ga0070659_1001542342 367
556 3300005441 Ga0070700_100006486 Ga0070700_1000064863 367
557 3300005444 Ga0070694_100177451 Ga0070694_1001774511 367
558 3300005458 Ga0070681_10021135 Ga0070681_100211356 367
559 3300005459 Ga0068867_100003008 Ga0068867_10000300810 367
560 3300005467 Ga0070706_100012677 Ga0070706_1000126775 367
561 3300005471 Ga0070698_100017344 Ga0070698_1000173445 367
562 3300005535 Ga0070684_100020552 Ga0070684_1000205526 367
563 3300005536 Ga0070697_100010896 Ga0070697_1000108965 367
564 3300005539 Ga0068853_100003049 Ga0068853_1000030496 367
565 3300005539 Ga0068853_100028418 Ga0068853_1000284184 367
566 3300005543 Ga0070672_100024311 Ga0070672_1000243114 367
567 3300005544 Ga0070686_100009849 Ga0070686_1000098496 367
568 3300005544 Ga0070686_100009913 Ga0070686_1000099136 367
569 3300005544 Ga0070686_100096609 Ga0070686_1000966092 367
570 3300005546 Ga0070696_100014190 Ga0070696_1000141906 367
571 3300005548 Ga0070665_100010912 Ga0070665_1000109127 367
572 3300005548 Ga0070665_100028936 Ga0070665_1000289363 367
573 3300005563 Ga0068855_100017230 Ga0068855_1000172305 367
574 3300005614 Ga0068856_100037087 Ga0068856_1000370875 367
575 3300005614 Ga0068856_100204435 Ga0068856_1002044353 367
576 3300005615 Ga0070702_100094417 Ga0070702_1000944172 367
577 3300005616 Ga0068852_100017456 Ga0068852_1000174566 367
578 3300005618 Ga0068864_100191146 Ga0068864_1001911461 367
579 3300005719 Ga0068861_100000528 Ga0068861_1000005287 367
580 3300005840 Ga0068870_10066426 Ga0068870_100664262 367
581 3300005842 Ga0068858_100010662 Ga0068858_1000106629 367
582 3300005842 Ga0068858_100010782 Ga0068858_1000107821 367
583 3300005842 Ga0068858_100215671 Ga0068858_1002156712 367
584 3300005843 Ga0068860_100000693 Ga0068860_1000006937 367
585 3300005843 Ga0068860_100087629 Ga0068860_1000876293 367
586 3300005844 Ga0068862_100141795 Ga0068862_1001417952 367
587 3300005937 Ga0081455_10001945 Ga0081455_1000194529 367
588 3300005937 Ga0081455_10046861 Ga0081455_100468613 367
589 3300005985 Ga0081539_10002732 Ga0081539_1000273226 367
590 3300006038 Ga0075365_10128800 Ga0075365_101288003 367
591 3300006051 Ga0075364_10031274 Ga0075364_100312743 367
592 3300006237 Ga0097621_100058390 Ga0097621_1000583903 367
593 3300006846 Ga0075430_100020550 Ga0075430_1000205503 367
594 3300006880 Ga0075429_100116125 Ga0075429_1001161252 367
595 3300006881 Ga0068865_100000782 Ga0068865_10000078213 367
596 3300006881 Ga0068865_100104689 Ga0068865_1001046892 367
597 3300007265 Ga0099794_10096660 Ga0099794_100966601 367
598 3300009093 Ga0105240_10306216 Ga0105240_103062162 367
599 3300009147 Ga0114129_10150282 Ga0114129_101502823 367
600 3300009148 Ga0105243_10083244 Ga0105243_100832442 367
601 3300009174 Ga0105241_10003046 Ga0105241_100030467 367
602 3300009176 Ga0105242_10041274 Ga0105242_100412744 367
603 3300009177 Ga0105248_10374435 Ga0105248_103744352 367
604 3300009545 Ga0105237_10011641 Ga0105237_100116413 367
605 3300009551 Ga0105238_10010422 Ga0105238_100104226 367
606 3300009551 Ga0105238_10016370 Ga0105238_100163702 367
607 3300009551 Ga0105238_10086900 Ga0105238_100869002 367
608 3300009553 Ga0105249_10011516 Ga0105249_100115165 367
609 3300009765 Ga0123341_1000002 Ga0123341_100000226 367
610 3300009766 Ga0123342_1024895 Ga0123342_10248954 367
611 3300010375 Ga0105239_10215219 Ga0105239_102152193 367
612 3300010375 Ga0105239_10283948 Ga0105239_102839482 367
613 3300011119 Ga0105246_10181193 Ga0105246_101811931 367
614 3300013102 Ga0157371_10117980 Ga0157371_101179803 367
615 3300013297 Ga0157378_10000567 Ga0157378_100005679 367
616 3300013297 Ga0157378_10020203 Ga0157378_100202036 367
617 3300013306 Ga0163162_10023386 Ga0163162_100233863 367
618 3300013306 Ga0163162_10071653 Ga0163162_100716532 367
619 3300013306 Ga0163162_10109227 Ga0163162_101092272 367
620 3300013307 Ga0157372_10146897 Ga0157372_101468972 367
621 3300013308 Ga0157375_10030013 Ga0157375_100300135 367
622 3300013308 Ga0157375_10084396 Ga0157375_100843963 367
623 3300013308 Ga0157375_10167228 Ga0157375_101672282 367
624 3300013308 Ga0157375_10195640 Ga0157375_101956402 367
625 3300014326 Ga0157380_10009891 Ga0157380_100098912 367
626 3300014497 Ga0182008_10028948 Ga0182008_100289484 367
627 3300014968 Ga0157379_10073322 Ga0157379_100733222 367
628 3300014968 Ga0157379_10243440 Ga0157379_102434402 367
629 3300014969 Ga0157376_10087459 Ga0157376_100874593 367
630 3300017792 Ga0163161_10284218 Ga0163161_102842182 367
631 3300021321 Ga0214542_1000023 Ga0214542_100002312 367
632 3300021327 Ga0214543_1000019 Ga0214543_100001987 367
633 3300021327 Ga0214543_1000156 Ga0214543_100015637 367
634 3300022739 Ga0228711_1000056 Ga0228711_100005640 367
635 3300022740 Ga0228710_1000229 Ga0228710_100022921 367
636 3300025250 Ga0209026_1000100 Ga0209026_100010026 367
637 3300025254 Ga0209148_1000069 Ga0209148_1000069160 367
638 3300025254 Ga0209148_1007886 Ga0209148_10078862 367
639 3300025256 Ga0209759_1000549 Ga0209759_100054914 367
640 3300025261 Ga0209233_1027876 Ga0209233_10278762 367
641 3300025272 Ga0209455_1000135 Ga0209455_100013527 367
642 3300025284 Ga0209130_1000098 Ga0209130_1000098115 367
643 3300025294 Ga0209025_1000180 Ga0209025_100018093 367
644 3300025302 Ga0207426_1000069 Ga0207426_1000069145 367
645 3300025899 Ga0207642_10006621 Ga0207642_100066213 367
646 3300025899 Ga0207642_10014701 Ga0207642_100147011 367
647 3300025903 Ga0207680_10211805 Ga0207680_102118052 367
648 3300025904 Ga0207647_10062497 Ga0207647_100624972 367
649 3300025910 Ga0207684_10014342 Ga0207684_100143425 367
650 3300025911 Ga0207654_10029847 Ga0207654_100298472 367
651 3300025912 Ga0207707_10199664 Ga0207707_101996642 367
652 3300025914 Ga0207671_10017693 Ga0207671_100176933 367
653 3300025923 Ga0207681_10043446 Ga0207681_100434463 367
654 3300025925 Ga0207650_10274789 Ga0207650_102747891 367
655 3300025932 Ga0207690_10122285 Ga0207690_101222852 367
656 3300025932 Ga0207690_10129363 Ga0207690_101293632 367
657 3300025937 Ga0207669_10014236 Ga0207669_100142362 367
658 3300025937 Ga0207669_10026562 Ga0207669_100265624 367
659 3300025938 Ga0207704_10002454 Ga0207704_100024545 367
660 3300025938 Ga0207704_10074731 Ga0207704_100747312 367
661 3300025940 Ga0207691_10015166 Ga0207691_100151662 367
662 3300025942 Ga0207689_10001210 Ga0207689_1000121016 367
663 3300025944 Ga0207661_10044275 Ga0207661_100442754 367
664 3300025949 Ga0207667_10041153 Ga0207667_100411535 367
665 3300026023 Ga0207677_10254565 Ga0207677_102545652 367
666 3300026035 Ga0207703_10052317 Ga0207703_100523173 367
667 3300026041 Ga0207639_10002319 Ga0207639_100023196 367
668 3300026041 Ga0207639_10031055 Ga0207639_100310554 367
669 3300026041 Ga0207639_10175816 Ga0207639_101758162 367
670 3300026075 Ga0207708_10002503 Ga0207708_100025038 367
671 3300026075 Ga0207708_10012494 Ga0207708_100124943 367
672 3300026078 Ga0207702_10013168 Ga0207702_100131683 367
673 3300026089 Ga0207648_10001901 Ga0207648_100019017 367
674 3300026089 Ga0207648_10002672 Ga0207648_1000267215 367
675 3300026089 Ga0207648_10213537 Ga0207648_102135372 367
676 3300026116 Ga0207674_10019394 Ga0207674_100193947 367
677 3300026118 Ga0207675_100001098 Ga0207675_10000109810 367
678 3300026118 Ga0207675_100045332 Ga0207675_1000453323 367
679 3300026121 Ga0207683_10038954 Ga0207683_100389541 367
680 3300026121 Ga0207683_10141708 Ga0207683_101417084 367
681 3300026121 Ga0207683_10148313 Ga0207683_101483132 367
682 3300026142 Ga0207698_10108162 Ga0207698_101081622 367
683 3300027111 Ga0209281_1000272 Ga0209281_100027235 367
684 3300027111 Ga0209281_1000709 Ga0209281_10007098 367
685 3300027666 Ga0209282_1000055 Ga0209282_100005536 367
686 3300028379 Ga0268266_10093169 Ga0268266_100931694 367
687 3300028380 Ga0268265_10007008 Ga0268265_100070082 367
688 3300028380 Ga0268265_10102207 Ga0268265_101022073 367
689 3300028381 Ga0268264_10005078 Ga0268264_1000507812 367
690 3300028794 Ga0307515_10001956 Ga0307515_1000195632 367
691 3300031344 Ga0265316_10109978 Ga0265316_101099782 367
692 3300031456 Ga0307513_10140077 Ga0307513_101400773 367
693 3300031548 Ga0307408_100193171 Ga0307408_1001931713 367
694 3300031967 Ga0315914_1000095 Ga0315914_100009558 367
695 3300033430 Ga0315913_1000019 Ga0315913_100001935 367
696 3300033464 Ga0315915_1000023 Ga0315915_100002358 367
697 3300036401 Ga0373937_0128686 Ga0373937_0128686_748_1857 367
698 3300037312 Ga0395899_0036383 Ga0395899_0036383_646_1758 367
699 3300037418 Ga0395900_0001711 Ga0395900_0001711_21960_23072 367
700 3300037418 Ga0395900_0169684 Ga0395900_0169684_761_1864 367
701 3300037471 Ga0395905_0000790 Ga0395905_0000790_445_1554 367
702 3300037471 Ga0395905_0052469 Ga0395905_0052469_1772_2875 367
703 3300038443 Ga0395901_0003637 Ga0395901_0003637_6999_8111 367
704 3300038443 Ga0395901_0275241 Ga0395901_0275241_156_1259 367
705 3300041405 Ga0439438_027260 Ga0439438_027260_271_1374 367
706 3300041413 Ga0439465_0008078 Ga0439465_0008078_918_2027 367
707 3300041492 Ga0451835_0345568 Ga0451835_0345568_1025_2134 367
708 3300041496 Ga0451839_0268866 Ga0451839_0268866_1801_2910 367
709 3300041498 Ga0451841_0548923 Ga0451841_0548923_1662_2771 367
710 3300041503 Ga0451847_0448429 Ga0451847_0448429_496_1605 367
711 3300041503 Ga0451847_0898239 Ga0451847_0898239_209_1318 367
712 3300041507 Ga0451851_0633554 Ga0451851_0633554_108_1217 367
713 3300042002 Ga0439442_010958 Ga0439442_010958_484_1593 367
714 3300042007 Ga0439449_0001660 Ga0439449_0001660_4321_5430 367
715 3300042015 Ga0439462_0017864 Ga0439462_0017864_615_1724 367
716 3300044673 Ga0453683_0083466 Ga0453683_0083466_620_1744 367
717 3300045051 Ga0451576_0520358 Ga0451576_0520358_92_1216 367
718 3300046460 Ga0495638_0010733 Ga0495638_0010733_3633_4742 367
719 3300046474 Ga0495605_0007855 Ga0495605_0007855_1131_2240 367
720 3300046492 Ga0495585_0124069 Ga0495585_0124069_98_1207 367
721 3300046501 Ga0495607_0044522 Ga0495607_0044522_654_1763 367
722 3300046512 Ga0495610_0012520 Ga0495610_0012520_3006_4115 367
723 3300046518 Ga0495631_0027227 Ga0495631_0027227_424_1533 367
724 3300046524 Ga0495648_0013496 Ga0495648_0013496_2386_3495 367
725 3300046558 Ga0495633_0022809 Ga0495633_0022809_365_1474 367
726 3300046616 Ga0495668_0100639 Ga0495668_0100639_431_1540 367
727 3300046616 Ga0495668_0101115 Ga0495668_0101115_61_1164 367
728 3300046660 Ga0495625_0005544 Ga0495625_0005544_898_2007 367
729 3300046660 Ga0495625_0015194 Ga0495625_0015194_2071_3174 367
730 3300046692 Ga0495671_0012740 Ga0495671_0012740_650_1759 367
731 3300046810 Ga0495660_0047616 Ga0495660_0047616_918_2021 367
732 3300047472 Ga0495686_0066523 Ga0495686_0066523_724_1827 367
733 3300048091 Ga0495626_0070738 Ga0495626_0070738_91_1194 367
734 3300048905 Ga0496102_0266912 Ga0496102_0266912_149_1252 367
735 3300048906 Ga0496103_0156325 Ga0496103_0156325_314_1417 367
736 3300048911 Ga0496108_0169740 Ga0496108_0169740_202_1326 367
737 3300048912 Ga0496109_0087678 Ga0496109_0087678_1146_2255 367
738 3300048913 Ga0496110_0115130 Ga0496110_0115130_356_1465 367
739 3300048915 Ga0496112_0001731 Ga0496112_0001731_7357_8460 367
740 3300048916 Ga0496113_0202494 Ga0496113_0202494_463_1566 367
741 3300048918 Ga0496115_0077566 Ga0496115_0077566_1108_2211 367
742 3300048922 Ga0496119_0015738 Ga0496119_0015738_3981_5084 367
743 3300048922 Ga0496119_0075000 Ga0496119_0075000_443_1552 367
744 3300048923 Ga0496120_0002155 Ga0496120_0002155_10564_11667 367
745 3300048923 Ga0496120_0034257 Ga0496120_0034257_178_1287 367
746 3300048924 Ga0496121_0085995 Ga0496121_0085995_900_2009 367
747 3300048928 Ga0496125_0052190 Ga0496125_0052190_615_1724 367
748 3300049568 Ga0501031_0000008 Ga0501031_0000008_11233_12336 367
749 3300049569 Ga0501032_0000018 Ga0501032_0000018_143958_145061 367
750 3300049570 Ga0501033_0000032 Ga0501033_0000032_143969_145072 367
751 3300049570 Ga0501033_0131031 Ga0501033_0131031_41_1159 367
752 3300049571 Ga0501034_0000103 Ga0501034_0000103_11233_12336 367
753 3300049571 Ga0501034_0000444 Ga0501034_0000444_2203_3312 367
754 3300049571 Ga0501034_0027759 Ga0501034_0027759_1187_2305 367
755 3300049571 Ga0501034_0058940 Ga0501034_0058940_1566_2678 367
756 3300049571 Ga0501034_0098582 Ga0501034_0098582_18_1127 367
757 3300049571 Ga0501034_0138581 Ga0501034_0138581_229_1347 367
758 3300049571 Ga0501034_0142525 Ga0501034_0142525_602_1726 367
759 3300049571 Ga0501034_0214410 Ga0501034_0214410_388_1503 367
760 3300049572 Ga0501036_0000012 Ga0501036_0000012_143969_145072 367
761 3300049572 Ga0501036_0048906 Ga0501036_0048906_1196_2314 367
762 3300049572 Ga0501036_0121790 Ga0501036_0121790_636_1754 367
763 3300049573 Ga0501037_0000018 Ga0501037_0000018_11233_12336 367
764 3300049573 Ga0501037_0045997 Ga0501037_0045997_926_2044 367
765 3300049573 Ga0501037_0078181 Ga0501037_0078181_182_1300 367
766 3300049574 Ga0501038_0000017 Ga0501038_0000017_11233_12336 367
767 3300049574 Ga0501038_0028367 Ga0501038_0028367_1267_2385 367
768 3300049575 Ga0501039_0000024 Ga0501039_0000024_11233_12336 367
769 3300049575 Ga0501039_0012606 Ga0501039_0012606_243_1361 367
770 3300049575 Ga0501039_0026717 Ga0501039_0026717_1530_2633 367
771 3300049576 Ga0501040_0002939 Ga0501040_0002939_1290_2393 367
772 3300049578 Ga0501042_0021447 Ga0501042_0021447_1910_3013 367
773 3300049579 Ga0501043_0087776 Ga0501043_0087776_17_1135 367
774 3300049579 Ga0501043_0184059 Ga0501043_0184059_55_1164 367
775 3300049579 Ga0501043_0203632 Ga0501043_0203632_297_1415 367
776 3300049580 Ga0501046_0019750 Ga0501046_0019750_3118_4221 367
777 3300049581 Ga0501047_0004558 Ga0501047_0004558_11168_12271 367
778 3300049581 Ga0501047_0021324 Ga0501047_0021324_3164_4276 367
779 3300049581 Ga0501047_0039924 Ga0501047_0039924_2013_3131 367
780 3300049581 Ga0501047_0208265 Ga0501047_0208265_12_1115 367
781 3300049582 Ga0501048_0032565 Ga0501048_0032565_1474_2577 367
782 3300049584 Ga0501068_0000614 Ga0501068_0000614_14009_15118 367
783 3300049584 Ga0501068_0038689 Ga0501068_0038689_504_1616 367
784 3300049585 Ga0501069_0030241 Ga0501069_0030241_368_1480 367
785 3300049586 Ga0501070_0007753 Ga0501070_0007753_1780_2898 367
786 3300049586 Ga0501070_0015990 Ga0501070_0015990_295_1407 367
787 3300049586 Ga0501070_0084376 Ga0501070_0084376_1436_2560 367
788 3300049586 Ga0501070_0098602 Ga0501070_0098602_1209_2312 367
789 3300049588 Ga0501072_0006051 Ga0501072_0006051_6895_8004 367
790 3300049589 Ga0501073_0000143 Ga0501073_0000143_11029_12138 367
791 3300049589 Ga0501073_0050868 Ga0501073_0050868_1757_2872 367
792 3300049590 Ga0501074_0027973 Ga0501074_0027973_1678_2796 367
793 3300049590 Ga0501074_0059501 Ga0501074_0059501_1295_2407 367
794 3300049742 Ga0501080_0000955 Ga0501080_0000955_15221_16330 367
795 3300049742 Ga0501080_0059312 Ga0501080_0059312_165_1274 367
796 3300049822 Ga0501035_0000040 Ga0501035_0000040_11191_12294 367
797 3300049822 Ga0501035_0090497 Ga0501035_0090497_413_1516 367
798 3300049822 Ga0501035_0317488 Ga0501035_0317488_195_1298 367
799 3300049823 Ga0501044_0000040 Ga0501044_0000040_11233_12336 367
800 3300049823 Ga0501044_0016222 Ga0501044_0016222_4955_6073 367
801 3300049823 Ga0501044_0038740 Ga0501044_0038740_3652_4770 367
802 3300049823 Ga0501044_0073102 Ga0501044_0073102_2273_3385 367
803 3300049823 Ga0501044_0236414 Ga0501044_0236414_658_1761 367
804 3300049824 Ga0501045_0028489 Ga0501045_0028489_1334_2437 367
805 3300050491 nmdc:mga00v17_83103_c1 nmdc:mga00v17_83103_c1_355_1458 367
806 3300050496 nmdc:mga07m45_82434_c1 nmdc:mga07m45_82434_c1_272_1375 367
807 3300050508 nmdc:mga09592_80253_c1 nmdc:mga09592_80253_c1_870_1976 367
808 3300050510 nmdc:mga06r32_3536_c1 nmdc:mga06r32_3536_c1_2459_3565 367
809 3300053088 Ga0500644_0013497 Ga0500644_0013497_833_1942 367
810 3300053122 Ga0500608_030026 Ga0500608_030026_112_1221 367
811 3300053153 Ga0500616_0109998 Ga0500616_0109998_95_1204 367
812 3300053155 Ga0500620_000789 Ga0500620_000789_1369_2472 367
813 3300053156 Ga0500622_0000734 Ga0500622_0000734_15994_17103 367

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

19

162

0.9

PF17912

OB_MalK

MalK OB fold domain

235

293

0.83

PF08402

TOBE_2

TOBE domain

286

362

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
6xgz-assembly4.cif.gz_G crystal structure of e. coli mlafb abc transport subunits in the monomeric state 0.9437 4 233
6xgz-assembly2.cif.gz_C crystal structure of e. coli mlafb abc transport subunits in the monomeric state 0.9417 4 233
6xgz-assembly3.cif.gz_E crystal structure of e. coli mlafb abc transport subunits in the monomeric state 0.9389 4 234
7z16-assembly1.cif.gz_J e. coli c-p lyase bound to phnk/phnl dual abc dimer with amppnp and phnk e171q mutation 0.9361 4 233
7ch0-assembly1.cif.gz_E the overall structure of the mlafedb complex in atp-bound eqclose conformation (mutation of e170q on mlaf) 0.9333 2 235
ID Description Score Start End Superfamily
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.981 3 216 3.40.50.300
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9675 3 216 3.40.50.300
3fvqB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.952 3 235 3.40.50.300
af_Q9XW49_1237_1482_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9427 2 224 3.40.50.300
af_A1ZBS3_470_698_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9401 2 217 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A527GZS8-F1-model_v4 ABC transporter ATP-binding protein 0.9909 1 210 GO:0005524
GO:0008643
GO:0016887
GO:0055052
GO:0140359
AF-A0A527GZS8-F1-model_v4 ABC transporter ATP-binding protein 0.977 1 210 GO:0005524
GO:0008643
GO:0016887
GO:0055052
GO:0140359
AF-A0A7C4M9L8-F1-model_v4 Molybdate/tungstate import ATP-binding protein WtpC (EC 7.3.2.6) 0.967 1 166 GO:0005524
GO:0016887
AF-A0A0R2HB88-F1-model_v4 ABC superfamily ATP binding cassette transporter ABC protein 0.9607 4 235 GO:0005524
GO:0016887
AF-A0A348UPP1-F1-model_v4 Polyamine ABC transporter ATP-binding protein 0.9603 5 130 GO:0005524
GO:0016887

Feature Viewer

pLDDT pTM Quality
91.59 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map