F481923
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 813 | 709 | 319 | 366 |
Family's Representative Sequence
| Representative Sequence | 3300005353|Ga0070669_100038109|Ga0070669_1000381094 |
| Length | 374 |
| Sequence | MADIQIIDVDKHFGANHVIRKLNLQIRHGEFVVLLGPSGCGKTTTLRALAGLENIDSGEIRIGGRRVDQLPPQERDTAFVFQLYSLYPHLTAFDNIAFPLRAAGMPDAKVREAVTAVAKVLRIDHLLRKRPSALAGGDMQRVTIGRALVRRPAAMLMDEPIGALDAKLREEMRAELRRLHIENDSTTVYVTHDQVEAMSMADKIGVMNDGLLQQYDSPTKVYDEPANLFVAQFVGSPIMNVVDCEIAATANGAGLRLPGMSEAVRLGPRAAAKLHGGAAAADELMLGIRPEAIAVSRTPVAGAIAARVHLIEPMGPYDIVDIMTATGHDDGATLRARTASRFVRAQGEPVWLSLDDARTHFFNKRSSQLLRAAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2503198000 | Mesorhizobium opportunistum WSM2075 | Isolate | Nodule |
| 2 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 3 | 2508501123 | Mesorhizobium sp. WSM3626 | Isolate | Nodule |
| 4 | 2508501127 | Mesorhizobium sp. WSM2561 | Isolate | Nodule |
| 5 | 2509276018 | Mesorhizobium ciceri CMG6 | Isolate | Nodule |
| 6 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 7 | 2509276022 | Mesorhizobium australicum WSM2073 | Isolate | Nodule |
| 8 | 2509276033 | Rhizobium leguminosarum bv. trifolii WSM2012 | Isolate | Nodule |
| 9 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 10 | 2510065057 | Sinorhizobium meliloti WSM1022 | Isolate | Nodule |
| 11 | 2510065059 | Mesorhizobium ciceri WSM4083 | Isolate | Nodule |
| 12 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 13 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 14 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 15 | 2512875024 | Mesorhizobium loti R88b | Isolate | Nodule |
| 16 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 17 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 18 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 19 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 20 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 21 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 22 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 23 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 24 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 25 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 26 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 27 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 28 | 2513237164 | Mesorhizobium loti CJ3sym | Isolate | Nodule |
| 29 | 2513237305 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 30 | 2513237351 | Mesorhizobium alhagi CCNWXJ12-2 | Isolate | Nodule |
| 31 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 32 | 2515154107 | Sinorhizobium meliloti 4H41 | Isolate | Nodule |
| 33 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 34 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 35 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 36 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 37 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 38 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 39 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 40 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 41 | 2551306084 | Sinorhizobium meliloti 5A14 | Isolate | Nodule |
| 42 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 43 | 2551306086 | Sinorhizobium meliloti AK11 | Isolate | Nodule |
| 44 | 2551306087 | Sinorhizobium meliloti A0643DD | Isolate | Nodule |
| 45 | 2551306089 | Sinorhizobium meliloti 1A42 | Isolate | Nodule |
| 46 | 2551306090 | Sinorhizobium meliloti A0641M | Isolate | Nodule |
| 47 | 2551306091 | Sinorhizobium meliloti C0431A | Isolate | Nodule |
| 48 | 2551306092 | Sinorhizobium meliloti AK75 | Isolate | Nodule |
| 49 | 2551306093 | Sinorhizobium meliloti C0438LL | Isolate | Nodule |
| 50 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 51 | 2597489875 | Mesorhizobium ciceri ca181 | Isolate | Unclassified |
| 52 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 53 | 2599185301 | Mesorhizobium sp. NFR06 | Isolate | Rhizoplane |
| 54 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 55 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 56 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 57 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 58 | 2643221643 | Rhizobium sp. Root1220 | Isolate | Unclassified |
| 59 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 60 | 2693429783 | Mesorhizobium sp. LCM 4577 | Isolate | Rhizosphere |
| 61 | 2693429784 | Mesorhizobium sp. LCM 4576 | Isolate | Rhizosphere |
| 62 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 63 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 64 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 65 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 66 | 2775506902 | Phyllobacterium zundukense Tri-48 | Isolate | Unclassified |
| 67 | 2775506904 | Phyllobacterium zundukense Tri-38 | Isolate | Unclassified |
| 68 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 69 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 70 | 2791355094 | Sinorhizobium sp. BJ1 | Isolate | Nodule |
| 71 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 72 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 73 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 74 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 75 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 76 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 77 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 78 | 2837651117 | Pseudohoeflea suaedae YC6898 | Isolate | Unclassified |
| 79 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 80 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 81 | 2839993093 | Phyllobacterium endophyticum PEPV15 | Isolate | Unclassified |
| 82 | 2840764183 | Phyllobacterium sophorae CCBAU 03422 | Isolate | Unclassified |
| 83 | 2841734538 | Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 | Isolate | Nodule |
| 84 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 85 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 86 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 87 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 88 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 89 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 90 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 91 | 2844009547 | Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 | Isolate | Nodule |
| 92 | 2847670302 | Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 | Isolate | Nodule |
| 93 | 2847686936 | Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 | Isolate | Nodule |
| 94 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 95 | 2855825444 | Sinorhizobium meliloti CXM1-105 | Isolate | Nodule |
| 96 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 97 | 2856314179 | Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 | Isolate | Nodule |
| 98 | 2856320880 | Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 | Isolate | Nodule |
| 99 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 100 | 2856342000 | Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 | Isolate | Nodule |
| 101 | 2856349417 | Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 | Isolate | Nodule |
| 102 | 2856356410 | Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 | Isolate | Nodule |
| 103 | 2856364286 | Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 | Isolate | Nodule |
| 104 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 105 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 106 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 107 | 2869162929 | Mesorhizobium sanjuanii BSA136 | Isolate | Nodule |
| 108 | 2869169390 | Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 | Isolate | Nodule |
| 109 | 2869242130 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 | Isolate | Nodule |
| 110 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 111 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 112 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 113 | 2869271264 | Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | Isolate | Nodule |
| 114 | 2869278585 | Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 | Isolate | Nodule |
| 115 | 2869285874 | Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 | Isolate | Nodule |
| 116 | 2871429161 | Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 | Isolate | Nodule |
| 117 | 2871435913 | Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 | Isolate | Nodule |
| 118 | 2871444079 | Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 | Isolate | Nodule |
| 119 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 120 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 121 | 2871466892 | Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 | Isolate | Nodule |
| 122 | 2871474448 | Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 | Isolate | Nodule |
| 123 | 2871481445 | Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 | Isolate | Nodule |
| 124 | 2871488783 | Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 | Isolate | Nodule |
| 125 | 2871495908 | Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 | Isolate | Nodule |
| 126 | 2874102143 | Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 | Isolate | Nodule |
| 127 | 2874109183 | Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 | Isolate | Nodule |
| 128 | 2874116593 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 | Isolate | Nodule |
| 129 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 130 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 131 | 2874146452 | Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 | Isolate | Nodule |
| 132 | 2874155637 | Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 | Isolate | Nodule |
| 133 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 134 | 2876369609 | Mesorhizobium sp. USDA-HM6 | Isolate | Unclassified |
| 135 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 136 | 2876392853 | Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 | Isolate | Nodule |
| 137 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 138 | 2876406927 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 | Isolate | Nodule |
| 139 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 140 | 2876420981 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 | Isolate | Nodule |
| 141 | 2878035449 | Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 | Isolate | Nodule |
| 142 | 2878738818 | Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 | Isolate | Nodule |
| 143 | 2878745973 | Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 | Isolate | Nodule |
| 144 | 2878753008 | Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 | Isolate | Nodule |
| 145 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 146 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 147 | 2878774303 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 | Isolate | Nodule |
| 148 | 2878788777 | Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 | Isolate | Nodule |
| 149 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 150 | 2881155292 | Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 | Isolate | Nodule |
| 151 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 152 | 2881845957 | Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 | Isolate | Nodule |
| 153 | 2881861095 | Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 | Isolate | Nodule |
| 154 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 155 | 2882912400 | Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 | Isolate | Nodule |
| 156 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 157 | 2885312484 | Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 | Isolate | Nodule |
| 158 | 2885318864 | Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 | Isolate | Nodule |
| 159 | 2885326080 | Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 | Isolate | Nodule |
| 160 | 2885334103 | Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 | Isolate | Nodule |
| 161 | 2885342637 | Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 | Isolate | Nodule |
| 162 | 2885350715 | Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 | Isolate | Nodule |
| 163 | 2888343758 | Mesorhizobium sp. AA22 | Isolate | Unclassified |
| 164 | 2888350351 | Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 | Isolate | Nodule |
| 165 | 2889010040 | Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 | Isolate | Nodule |
| 166 | 2889016732 | Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 | Isolate | Nodule |
| 167 | 2889790730 | Chelativorans xinjiangense lm93 | Isolate | Rhizosphere |
| 168 | 2889914905 | Chelativorans alearense UJN715 | Isolate | Rhizosphere |
| 169 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 170 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 171 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 172 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 173 | 2906308376 | Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 | Isolate | Nodule |
| 174 | 2906321335 | Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 | Isolate | Nodule |
| 175 | 2906328253 | Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 | Isolate | Nodule |
| 176 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 177 | 2906378014 | Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 | Isolate | Nodule |
| 178 | 2906386501 | Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 | Isolate | Nodule |
| 179 | 2906393657 | Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 | Isolate | Nodule |
| 180 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 181 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 182 | 2906414383 | Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 | Isolate | Nodule |
| 183 | 2913295892 | Sinorhizobium kostiensis DSM 13372 | Isolate | Nodule |
| 184 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 185 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 186 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 187 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 188 | 2916007675 | Sinorhizobium meliloti USDA1289 | Isolate | Nodule |
| 189 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 190 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 191 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 192 | 2916035215 | Sinorhizobium meliloti 3011 | Isolate | Nodule |
| 193 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 194 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 195 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 196 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 197 | 2916068649 | Sinorhizobium meliloti USDA1220 | Isolate | Nodule |
| 198 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 199 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 200 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 201 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 202 | 2921237296 | Sinorhizobium meliloti USDA1508 | Isolate | Nodule |
| 203 | 2921244191 | Sinorhizobium meliloti 2119 | Isolate | Nodule |
| 204 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 205 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 206 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 207 | 2921282425 | Sinorhizobium meliloti USDA1203 | Isolate | Nodule |
| 208 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 209 | 2921296804 | Sinorhizobium meliloti USDA1200 | Isolate | Nodule |
| 210 | 2922130491 | Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 | Isolate | Nodule |
| 211 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 212 | 2922158528 | Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 | Isolate | Nodule |
| 213 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 214 | 2922178524 | Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 | Isolate | Nodule |
| 215 | 2922185730 | Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 | Isolate | Nodule |
| 216 | 2924144063 | Sinorhizobium meliloti USDA1022 | Isolate | Nodule |
| 217 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 218 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 219 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 220 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 221 | 2924179722 | Sinorhizobium meliloti USDA1280 | Isolate | Nodule |
| 222 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 223 | 2924193448 | Sinorhizobium meliloti USDA1158 | Isolate | Nodule |
| 224 | 2924200457 | Sinorhizobium meliloti USDA1007 | Isolate | Nodule |
| 225 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 226 | 2924214083 | Sinorhizobium meliloti USDA1702 | Isolate | Nodule |
| 227 | 2924221636 | Sinorhizobium meliloti USDA1416 | Isolate | Nodule |
| 228 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 229 | 2924726620 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 | Isolate | Nodule |
| 230 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 231 | 2924741084 | Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 | Isolate | Nodule |
| 232 | 2924748358 | Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 | Isolate | Nodule |
| 233 | 2924754689 | Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 | Isolate | Nodule |
| 234 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 235 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 236 | 2924784321 | Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | Isolate | Nodule |
| 237 | 2933016740 | Rhizobium sp. SEMIA 4085 | Isolate | Nodule |
| 238 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 239 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 240 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 241 | 2936996657 | Sinorhizobium meliloti USDA1025 | Isolate | Nodule |
| 242 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 243 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 244 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 245 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 246 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 247 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 248 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 249 | 2937049772 | Sinorhizobium meliloti USDA1691 | Isolate | Nodule |
| 250 | 2937056579 | Sinorhizobium meliloti USDA1357 | Isolate | Nodule |
| 251 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 252 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 253 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 254 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 255 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 256 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 257 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 258 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 259 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 260 | 2937126314 | Sinorhizobium meliloti USDA1612 | Isolate | Nodule |
| 261 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 262 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 263 | 2937836603 | Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 | Isolate | Nodule |
| 264 | 2937843397 | Mesorhizobium xinjiangense lm94 | Isolate | Rhizosphere |
| 265 | 2937861824 | Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 | Isolate | Nodule |
| 266 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 267 | 2937972304 | Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 | Isolate | Nodule |
| 268 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 269 | 2957375807 | Sinorhizobium medicae USDA1632 | Isolate | Nodule |
| 270 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 271 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 272 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 273 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 274 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 275 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 276 | 2957422303 | Sinorhizobium meliloti USDA1497 | Isolate | Nodule |
| 277 | 2957430029 | Sinorhizobium meliloti USDA1590 | Isolate | Nodule |
| 278 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 279 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 280 | 2957450854 | Sinorhizobium meliloti USDA1655 | Isolate | Nodule |
| 281 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 282 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 283 | 2957471148 | Sinorhizobium meliloti USDA1204 | Isolate | Nodule |
| 284 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 285 | 2957484790 | Sinorhizobium meliloti USDA1464 | Isolate | Nodule |
| 286 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 287 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 288 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 289 | 2958034702 | Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 | Isolate | Nodule |
| 290 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 291 | 2958064165 | Mesorhizobium sp. SARCC-RB16n | Isolate | Unclassified |
| 292 | 2958071322 | Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 | Isolate | Nodule |
| 293 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 294 | 2958092219 | Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 | Isolate | Nodule |
| 295 | 2958100919 | Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 | Isolate | Nodule |
| 296 | 2958108152 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 | Isolate | Nodule |
| 297 | 2958115193 | Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 | Isolate | Nodule |
| 298 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 299 | 2958130278 | Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 | Isolate | Nodule |
| 300 | 2958137437 | Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 | Isolate | Nodule |
| 301 | 2958144490 | Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 | Isolate | Nodule |
| 302 | 2958158011 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 | Isolate | Nodule |
| 303 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 304 | 2958172287 | Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 | Isolate | Nodule |
| 305 | 2958179912 | Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 | Isolate | Nodule |
| 306 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 307 | 2960597568 | Sinorhizobium meliloti 3085 | Isolate | Nodule |
| 308 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 309 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 310 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 311 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 312 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 313 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 314 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 315 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 316 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 317 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 318 | 2960674078 | Sinorhizobium meliloti USDA1666 | Isolate | Nodule |
| 319 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 320 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 321 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 322 | 2961077736 | Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 | Isolate | Nodule |
| 323 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 324 | 2961127735 | Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 | Isolate | Nodule |
| 325 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 326 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 327 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 328 | 2964607997 | Sinorhizobium meliloti USDA1212 | Isolate | Nodule |
| 329 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 330 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 331 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 332 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 333 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 334 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 335 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 336 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 337 | 2964670856 | Sinorhizobium meliloti USDA1211 | Isolate | Nodule |
| 338 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 339 | 2964685014 | Sinorhizobium meliloti USDA1232 | Isolate | Nodule |
| 340 | 2964691889 | Sinorhizobium meliloti USDA1379 | Isolate | Nodule |
| 341 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 342 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 343 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 344 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 345 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 346 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 347 | 2965040258 | Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 | Isolate | Nodule |
| 348 | 2965047637 | Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 | Isolate | Nodule |
| 349 | 2965062239 | Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 | Isolate | Nodule |
| 350 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 351 | 2965119406 | Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 | Isolate | Nodule |
| 352 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 353 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 354 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 355 | 2967686174 | Sinorhizobium medicae USDA1641 | Isolate | Nodule |
| 356 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 357 | 2967699805 | Sinorhizobium meliloti USDA1695 | Isolate | Nodule |
| 358 | 2967706974 | Sinorhizobium meliloti USDA1206 | Isolate | Nodule |
| 359 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 360 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 361 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 362 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 363 | 2967742019 | Sinorhizobium meliloti USDA1676 | Isolate | Nodule |
| 364 | 2967748971 | Sinorhizobium meliloti USDA1024A | Isolate | Nodule |
| 365 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 366 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 367 | 2967769361 | Sinorhizobium meliloti USDA1005 | Isolate | Nodule |
| 368 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 369 | 2967996073 | Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 | Isolate | Nodule |
| 370 | 2968003550 | Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 | Isolate | Nodule |
| 371 | 2968016561 | Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 | Isolate | Nodule |
| 372 | 2968091066 | Mesorhizobium sp. AA23 | Isolate | Unclassified |
| 373 | 2968097103 | Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 | Isolate | Nodule |
| 374 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 375 | 2968117919 | Mesorhizobium atlanticum CNPSo 3140 | Isolate | Unclassified |
| 376 | 2968128360 | Mesorhizobium sp. WSM3873 | Isolate | Unclassified |
| 377 | 2968138860 | Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 | Isolate | Nodule |
| 378 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 379 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 380 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 381 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 382 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 383 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 384 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 385 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 386 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 387 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 388 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 389 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 390 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 391 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 392 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 393 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 394 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 395 | 2970136068 | Sinorhizobium meliloti USDA1699 | Isolate | Nodule |
| 396 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 397 | 2970149975 | Sinorhizobium meliloti USDA1215 | Isolate | Nodule |
| 398 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 399 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 400 | 2970170962 | Sinorhizobium meliloti USDA1571 | Isolate | Nodule |
| 401 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 402 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 403 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 404 | 2970469710 | Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 | Isolate | Nodule |
| 405 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 406 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 407 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 408 | 2970524798 | Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 | Isolate | Nodule |
| 409 | 2970540015 | Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 | Isolate | Nodule |
| 410 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 411 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 412 | 2970593180 | Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 | Isolate | Nodule |
| 413 | 2970619444 | Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 | Isolate | Nodule |
| 414 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 415 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 416 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 417 | 2977537788 | Sinorhizobium meliloti USDA1184 | Isolate | Nodule |
| 418 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 419 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 420 | 2977558990 | Sinorhizobium meliloti USDA1222 | Isolate | Nodule |
| 421 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 422 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 423 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 424 | 2977821940 | Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 | Isolate | Nodule |
| 425 | 2977828996 | Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 | Isolate | Nodule |
| 426 | 2977843712 | Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 | Isolate | Nodule |
| 427 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 428 | 2977858184 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 | Isolate | Nodule |
| 429 | 2977864932 | Mesorhizobium tamadayense DSM 28320 | Isolate | Nodule |
| 430 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 431 | 2977898635 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 | Isolate | Nodule |
| 432 | 2977907340 | Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 | Isolate | Nodule |
| 433 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 434 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 435 | 2977942078 | Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 | Isolate | Nodule |
| 436 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 437 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 438 | 2977971508 | Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 | Isolate | Nodule |
| 439 | 2977986579 | Mesorhizobium intechi BD68 | Isolate | Unclassified |
| 440 | 2979710463 | Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 | Isolate | Nodule |
| 441 | 2979764755 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 | Isolate | Nodule |
| 442 | 2979779861 | Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 | Isolate | Nodule |
| 443 | 2979793036 | Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 | Isolate | Nodule |
| 444 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 445 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 446 | 2987652177 | Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 | Isolate | Nodule |
| 447 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 448 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 449 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 450 | 2996310559 | Mesorhizobium zhangyense CGMCC 1.15528 | Isolate | Unclassified |
| 451 | 2996336353 | Mesorhizobium sp. YM1C-6-2 | Isolate | Unclassified |
| 452 | 2996341866 | Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 | Isolate | Nodule |
| 453 | 2996348954 | Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 | Isolate | Nodule |
| 454 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 455 | 3003930520 | Sinorhizobium sp. BG8 | Isolate | Unclassified |
| 456 | 3004167301 | Mesorhizobium loti 582 | Isolate | Unclassified |
| 457 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 458 | 3004195979 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 | Isolate | Nodule |
| 459 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 460 | 3004232784 | Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 | Isolate | Nodule |
| 461 | 3004248173 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 | Isolate | Nodule |
| 462 | 3004275668 | Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 | Isolate | Nodule |
| 463 | 3004289098 | Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 | Isolate | Nodule |
| 464 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 465 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 466 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 467 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 468 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 469 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 470 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 471 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 472 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 473 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 474 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 475 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 476 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 477 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 478 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 479 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 480 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 481 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 482 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 483 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 484 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 485 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 486 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 487 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 488 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 489 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 490 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 491 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 492 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 493 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 494 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 495 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 496 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 497 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 498 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 499 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 500 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 501 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 502 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 503 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 504 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 505 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 506 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 507 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 508 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 509 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 510 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 511 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 512 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 513 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 514 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 515 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 516 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 517 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 518 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 519 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 520 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 521 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 522 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 523 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 524 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 525 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 526 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 527 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 528 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 529 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 530 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 531 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 532 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 533 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 534 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 535 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 536 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 537 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 538 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 539 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 540 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 541 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 542 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 543 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 544 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 545 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 546 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 547 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 548 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 549 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 550 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 551 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 552 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 553 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 554 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 555 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 556 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 557 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 558 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 559 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 560 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 561 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 562 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 563 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 564 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 565 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 566 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 567 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 568 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 569 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 570 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 571 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 572 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 573 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 574 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 575 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 576 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 577 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 578 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 579 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 580 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 581 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 582 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 583 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 584 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 585 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 586 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 587 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 588 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 589 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 590 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 591 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 592 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 593 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 594 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 595 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 596 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 597 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 598 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 599 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 600 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 601 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 602 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 603 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 604 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 605 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 606 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 607 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 608 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 609 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 610 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 611 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 612 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 613 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 614 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 615 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 616 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 617 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 618 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 619 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 620 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 621 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 622 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 623 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 624 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 625 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 626 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 627 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 628 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 629 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 630 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 631 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 632 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 633 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 634 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 635 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 636 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 637 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 638 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 639 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 640 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 641 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 642 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 643 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 644 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 645 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 646 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 647 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 648 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 649 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 650 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 651 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 652 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 653 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 654 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 655 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 656 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 657 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 658 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 659 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 660 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 661 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 662 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 663 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 664 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 665 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 666 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 667 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 668 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 669 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 670 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 671 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 672 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 673 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 674 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 675 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 676 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 677 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 678 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 679 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 680 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 681 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 682 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 683 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 684 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 685 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 686 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 687 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 688 | 8004312739 | Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 | Isolate | Nodule |
| 689 | 8004374579 | Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 | Isolate | Nodule |
| 690 | 8004387939 | Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 | Isolate | Nodule |
| 691 | 8004395343 | Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 | Isolate | Nodule |
| 692 | 8004445564 | Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 | Isolate | Nodule |
| 693 | 8004633249 | Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 | Isolate | Nodule |
| 694 | 8004640170 | Mesorhizobium sp. GbtcB19 | Isolate | Unclassified |
| 695 | 8004703790 | Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 | Isolate | Nodule |
| 696 | 8004714634 | Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 | Isolate | Nodule |
| 697 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 698 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 699 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 700 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 701 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 702 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 703 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 704 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 705 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 706 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 707 | 8054558443 | Rhizobium alarense TRM95111 | Isolate | Nodule |
| 708 | 8055617313 | Mesorhizobium onobrychidis OM4 | Isolate | Nodule |
| 709 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 39.24 |
| Metatranscriptomes | 0 |
| Isolates | 60.76 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.95 |
| Nodule | 57.44 |
| Rhizoplane | 1.11 |
| Rhizosphere | 31.98 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.52 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25157J39369_1000883 | 3300002741 | Bacteria | 14428 |
| 2 | JGI25159J45721_1002347 | 3300002987 | Bacteria | 7242 |
| 3 | JGI25151J46595_10016496 | 3300003187 | Bacteria | 3229 |
| 4 | JGI25160J50197_1000248 | 3300003354 | Bacteria | 41777 |
| 5 | JGI25161J50226_1000183 | 3300003374 | Bacteria | 41777 |
| 6 | Ga0055542_1000997 | 3300003762 | Bacteria | 18150 |
| 7 | Ga0055543_1000245 | 3300004625 | Bacteria | 41815 |
| 8 | Ga0065165_1001012 | 3300005262 | Bacteria | 34230 |
| 9 | Ga0068869_100002565 | 3300005334 | Bacteria | 10973 |
| 10 | Ga0068869_100021988 | 3300005334 | Bacteria | 4390 |
| 11 | Ga0068868_100243842 | 3300005338 | Bacteria | 1510 |
| 12 | Ga0070669_100038109 | 3300005353 | Bacteria | 3489 |
| 13 | Ga0070669_100100208 | 3300005353 | Bacteria | 2184 |
| 14 | Ga0070674_100014071 | 3300005356 | Bacteria | 4965 |
| 15 | Ga0070674_100018046 | 3300005356 | Bacteria | 4452 |
| 16 | Ga0070688_100226369 | 3300005365 | Bacteria | 1320 |
| 17 | Ga0070659_100121132 | 3300005366 | Bacteria | 2119 |
| 18 | Ga0070659_100154234 | 3300005366 | Bacteria | 1875 |
| 19 | Ga0070713_100037915 | 3300005436 | Bacteria | 3900 |
| 20 | Ga0070711_100191533 | 3300005439 | Bacteria | 1572 |
| 21 | Ga0070700_100006486 | 3300005441 | Bacteria | 6262 |
| 22 | Ga0070694_100177451 | 3300005444 | Bacteria | 1573 |
| 23 | Ga0070708_100081274 | 3300005445 | Bacteria | 2934 |
| 24 | Ga0070708_100105467 | 3300005445 | Bacteria | 2586 |
| 25 | Ga0070681_10021135 | 3300005458 | Bacteria | 6521 |
| 26 | Ga0068867_100003008 | 3300005459 | Bacteria | 11880 |
| 27 | Ga0070706_100005829 | 3300005467 | Bacteria | 11689 |
| 28 | Ga0070706_100012677 | 3300005467 | Bacteria | 7798 |
| 29 | Ga0070707_100087322 | 3300005468 | Bacteria | 3017 |
| 30 | Ga0070707_100241361 | 3300005468 | Bacteria | 1758 |
| 31 | Ga0070698_100007395 | 3300005471 | Bacteria | 11884 |
| 32 | Ga0070698_100017344 | 3300005471 | Bacteria | 7586 |
| 33 | Ga0070698_100180094 | 3300005471 | Bacteria | 2052 |
| 34 | Ga0070699_100002153 | 3300005518 | Bacteria | 17815 |
| 35 | Ga0070699_100056287 | 3300005518 | Bacteria | 3405 |
| 36 | Ga0070684_100020552 | 3300005535 | Bacteria | 5476 |
| 37 | Ga0070697_100010896 | 3300005536 | Bacteria | 7101 |
| 38 | Ga0070697_100044574 | 3300005536 | Bacteria | 3593 |
| 39 | Ga0068853_100003049 | 3300005539 | Bacteria | 12792 |
| 40 | Ga0068853_100028418 | 3300005539 | Bacteria | 4703 |
| 41 | Ga0070672_100024311 | 3300005543 | Bacteria | 4475 |
| 42 | Ga0070686_100009849 | 3300005544 | Bacteria | 5371 |
| 43 | Ga0070686_100009913 | 3300005544 | Bacteria | 5357 |
| 44 | Ga0070686_100096609 | 3300005544 | Bacteria | 1987 |
| 45 | Ga0070696_100014190 | 3300005546 | Bacteria | 5346 |
| 46 | Ga0070665_100010912 | 3300005548 | Bacteria | 9189 |
| 47 | Ga0070665_100028936 | 3300005548 | Bacteria | 5577 |
| 48 | Ga0068855_100017230 | 3300005563 | Bacteria | 8693 |
| 49 | Ga0068856_100037087 | 3300005614 | Bacteria | 4782 |
| 50 | Ga0068856_100204435 | 3300005614 | Bacteria | 1989 |
| 51 | Ga0070702_100094417 | 3300005615 | Bacteria | 1821 |
| 52 | Ga0068852_100017456 | 3300005616 | Bacteria | 5631 |
| 53 | Ga0068864_100191146 | 3300005618 | Bacteria | 1877 |
| 54 | Ga0068861_100000528 | 3300005719 | Bacteria | 22394 |
| 55 | Ga0068870_10066426 | 3300005840 | Bacteria | 1953 |
| 56 | Ga0068858_100010662 | 3300005842 | Bacteria | 8692 |
| 57 | Ga0068858_100010782 | 3300005842 | Bacteria | 8641 |
| 58 | Ga0068858_100215671 | 3300005842 | Bacteria | 1817 |
| 59 | Ga0068860_100000693 | 3300005843 | Bacteria | 38695 |
| 60 | Ga0068860_100087629 | 3300005843 | Bacteria | 2964 |
| 61 | Ga0068862_100141795 | 3300005844 | Bacteria | 2133 |
| 62 | Ga0081455_10001945 | 3300005937 | Bacteria | 24827 |
| 63 | Ga0081455_10046861 | 3300005937 | Bacteria | 3747 |
| 64 | Ga0081539_10002732 | 3300005985 | Bacteria | 23848 |
| 65 | Ga0070717_10031885 | 3300006028 | Bacteria | 4243 |
| 66 | Ga0075365_10128800 | 3300006038 | Bacteria | 1750 |
| 67 | Ga0075364_10031274 | 3300006051 | Bacteria | 3420 |
| 68 | Ga0070716_100097855 | 3300006173 | Bacteria | 1792 |
| 69 | Ga0097621_100058390 | 3300006237 | Bacteria | 3157 |
| 70 | Ga0075430_100020550 | 3300006846 | Bacteria | 5616 |
| 71 | Ga0075429_100116125 | 3300006880 | Bacteria | 2340 |
| 72 | Ga0068865_100000782 | 3300006881 | Bacteria | 17887 |
| 73 | Ga0068865_100104689 | 3300006881 | Bacteria | 2077 |
| 74 | Ga0099794_10096660 | 3300007265 | Bacteria | 1471 |
| 75 | Ga0099795_10037473 | 3300007788 | Bacteria | 1706 |
| 76 | Ga0105240_10306216 | 3300009093 | Bacteria | 1816 |
| 77 | Ga0105240_10539504 | 3300009093 | Bacteria | 1292 |
| 78 | Ga0105240_10561186 | 3300009093 | Bacteria | 1262 |
| 79 | Ga0114129_10150282 | 3300009147 | Bacteria | 3187 |
| 80 | Ga0105243_10083244 | 3300009148 | Bacteria | 2617 |
| 81 | Ga0105241_10003046 | 3300009174 | Bacteria | 12508 |
| 82 | Ga0105242_10041274 | 3300009176 | Bacteria | 3721 |
| 83 | Ga0105248_10374435 | 3300009177 | Bacteria | 1603 |
| 84 | Ga0105237_10011641 | 3300009545 | Bacteria | 9308 |
| 85 | Ga0105238_10010422 | 3300009551 | Bacteria | 9331 |
| 86 | Ga0105238_10016370 | 3300009551 | Bacteria | 7505 |
| 87 | Ga0105238_10086900 | 3300009551 | Bacteria | 3114 |
| 88 | Ga0105249_10011516 | 3300009553 | Bacteria | 7772 |
| 89 | Ga0123341_1000002 | 3300009765 | Bacteria | 191257 |
| 90 | Ga0123342_1024895 | 3300009766 | Bacteria | 3682 |
| 91 | Ga0105239_10152678 | 3300010375 | Bacteria | 2577 |
| 92 | Ga0105239_10215219 | 3300010375 | Bacteria | 2154 |
| 93 | Ga0105239_10283948 | 3300010375 | Bacteria | 1864 |
| 94 | Ga0105246_10181193 | 3300011119 | Bacteria | 1622 |
| 95 | Ga0157371_10117980 | 3300013102 | Bacteria | 1886 |
| 96 | Ga0157369_10186808 | 3300013105 | Bacteria | 2179 |
| 97 | Ga0157378_10000567 | 3300013297 | Bacteria | 35017 |
| 98 | Ga0157378_10020203 | 3300013297 | Bacteria | 5859 |
| 99 | Ga0163162_10023386 | 3300013306 | Bacteria | 6099 |
| 100 | Ga0163162_10071653 | 3300013306 | Bacteria | 3519 |
| 101 | Ga0163162_10109227 | 3300013306 | Bacteria | 2863 |
| 102 | Ga0157372_10146897 | 3300013307 | Bacteria | 2719 |
| 103 | Ga0157375_10030013 | 3300013308 | Bacteria | 5120 |
| 104 | Ga0157375_10084396 | 3300013308 | Bacteria | 3224 |
| 105 | Ga0157375_10167228 | 3300013308 | Bacteria | 2344 |
| 106 | Ga0157375_10195640 | 3300013308 | Bacteria | 2177 |
| 107 | Ga0157380_10009891 | 3300014326 | Bacteria | 6847 |
| 108 | Ga0182008_10028948 | 3300014497 | Bacteria | 2800 |
| 109 | Ga0157379_10073322 | 3300014968 | Bacteria | 3064 |
| 110 | Ga0157379_10243440 | 3300014968 | Bacteria | 1631 |
| 111 | Ga0157376_10087459 | 3300014969 | Bacteria | 2689 |
| 112 | Ga0163161_10284218 | 3300017792 | Bacteria | 1299 |
| 113 | Ga0214542_1000023 | 3300021321 | Bacteria | 191557 |
| 114 | Ga0214543_1000019 | 3300021327 | Bacteria | 267908 |
| 115 | Ga0214543_1000156 | 3300021327 | Bacteria | 96889 |
| 116 | Ga0228711_1000056 | 3300022739 | Bacteria | 78987 |
| 117 | Ga0228710_1000229 | 3300022740 | Bacteria | 58988 |
| 118 | Ga0209026_1000100 | 3300025250 | Bacteria | 156131 |
| 119 | Ga0209148_1000069 | 3300025254 | Bacteria | 334444 |
| 120 | Ga0209148_1007886 | 3300025254 | Bacteria | 2176 |
| 121 | Ga0209759_1000549 | 3300025256 | Bacteria | 38630 |
| 122 | Ga0209233_1000028 | 3300025261 | Bacteria | 642062 |
| 123 | Ga0209233_1027876 | 3300025261 | Bacteria | 1362 |
| 124 | Ga0209455_1000135 | 3300025272 | Bacteria | 148007 |
| 125 | Ga0209130_1000098 | 3300025284 | Bacteria | 142506 |
| 126 | Ga0209025_1000180 | 3300025294 | Bacteria | 157372 |
| 127 | Ga0207426_1000069 | 3300025302 | Bacteria | 334513 |
| 128 | Ga0207642_10006621 | 3300025899 | Bacteria | 3864 |
| 129 | Ga0207642_10014701 | 3300025899 | Bacteria | 2897 |
| 130 | Ga0207680_10211805 | 3300025903 | Bacteria | 1325 |
| 131 | Ga0207647_10062497 | 3300025904 | Bacteria | 2269 |
| 132 | Ga0207684_10007039 | 3300025910 | Bacteria | 10173 |
| 133 | Ga0207684_10014342 | 3300025910 | Bacteria | 6836 |
| 134 | Ga0207654_10029847 | 3300025911 | Bacteria | 2989 |
| 135 | Ga0207707_10199664 | 3300025912 | Bacteria | 1744 |
| 136 | Ga0207695_10099921 | 3300025913 | Bacteria | 2898 |
| 137 | Ga0207695_10121521 | 3300025913 | Bacteria | 2579 |
| 138 | Ga0207671_10017693 | 3300025914 | Bacteria | 5490 |
| 139 | Ga0207671_10050550 | 3300025914 | Bacteria | 3078 |
| 140 | Ga0207646_10022450 | 3300025922 | Bacteria | 5813 |
| 141 | Ga0207646_10082655 | 3300025922 | Bacteria | 2872 |
| 142 | Ga0207681_10043446 | 3300025923 | Bacteria | 3008 |
| 143 | Ga0207650_10274789 | 3300025925 | Bacteria | 1370 |
| 144 | Ga0207700_10029000 | 3300025928 | Bacteria | 3900 |
| 145 | Ga0207690_10122285 | 3300025932 | Bacteria | 1893 |
| 146 | Ga0207690_10129363 | 3300025932 | Bacteria | 1846 |
| 147 | Ga0207669_10014236 | 3300025937 | Bacteria | 3982 |
| 148 | Ga0207669_10026562 | 3300025937 | Bacteria | 3152 |
| 149 | Ga0207704_10002454 | 3300025938 | Bacteria | 8345 |
| 150 | Ga0207704_10074731 | 3300025938 | Bacteria | 2164 |
| 151 | Ga0207665_10040832 | 3300025939 | Bacteria | 3096 |
| 152 | Ga0207691_10015166 | 3300025940 | Bacteria | 7333 |
| 153 | Ga0207689_10001210 | 3300025942 | Bacteria | 24834 |
| 154 | Ga0207661_10044275 | 3300025944 | Bacteria | 3517 |
| 155 | Ga0207667_10041153 | 3300025949 | Bacteria | 4916 |
| 156 | Ga0207677_10254565 | 3300026023 | Bacteria | 1428 |
| 157 | Ga0207703_10052317 | 3300026035 | Bacteria | 3315 |
| 158 | Ga0207639_10002319 | 3300026041 | Bacteria | 12776 |
| 159 | Ga0207639_10031055 | 3300026041 | Bacteria | 3924 |
| 160 | Ga0207639_10175816 | 3300026041 | Bacteria | 1817 |
| 161 | Ga0207708_10002503 | 3300026075 | Bacteria | 13520 |
| 162 | Ga0207708_10012494 | 3300026075 | Bacteria | 6330 |
| 163 | Ga0207702_10013168 | 3300026078 | Bacteria | 6878 |
| 164 | Ga0207648_10001901 | 3300026089 | Bacteria | 22830 |
| 165 | Ga0207648_10002672 | 3300026089 | Bacteria | 18989 |
| 166 | Ga0207648_10213537 | 3300026089 | Bacteria | 1713 |
| 167 | Ga0207674_10019394 | 3300026116 | Bacteria | 7367 |
| 168 | Ga0207675_100001098 | 3300026118 | Bacteria | 26798 |
| 169 | Ga0207675_100045332 | 3300026118 | Bacteria | 4108 |
| 170 | Ga0207683_10038954 | 3300026121 | Bacteria | 4145 |
| 171 | Ga0207683_10141708 | 3300026121 | Bacteria | 2166 |
| 172 | Ga0207683_10148313 | 3300026121 | Bacteria | 2116 |
| 173 | Ga0207698_10108162 | 3300026142 | Bacteria | 2323 |
| 174 | Ga0209281_1000272 | 3300027111 | Bacteria | 99700 |
| 175 | Ga0209281_1000709 | 3300027111 | Bacteria | 33568 |
| 176 | Ga0209282_1000055 | 3300027666 | Bacteria | 101018 |
| 177 | Ga0268266_10093169 | 3300028379 | Bacteria | 2643 |
| 178 | Ga0268265_10007008 | 3300028380 | Bacteria | 7623 |
| 179 | Ga0268265_10102207 | 3300028380 | Bacteria | 2318 |
| 180 | Ga0268264_10005078 | 3300028381 | Bacteria | 11147 |
| 181 | Ga0307515_10001956 | 3300028794 | Bacteria | 45627 |
| 182 | Ga0265316_10109978 | 3300031344 | Bacteria | 2088 |
| 183 | Ga0307513_10140077 | 3300031456 | Bacteria | 2347 |
| 184 | Ga0307408_100193171 | 3300031548 | Bacteria | 1642 |
| 185 | Ga0315914_1000095 | 3300031967 | Bacteria | 74092 |
| 186 | Ga0315913_1000019 | 3300033430 | Bacteria | 100387 |
| 187 | Ga0315915_1000023 | 3300033464 | Bacteria | 119157 |
| 188 | Ga0373937_0128686 | 3300036401 | Bacteria | 2364 |
| 189 | Ga0395899_0036383 | 3300037312 | Bacteria | 3693 |
| 190 | Ga0395900_0001711 | 3300037418 | Bacteria | 25377 |
| 191 | Ga0395900_0169684 | 3300037418 | Bacteria | 2222 |
| 192 | Ga0395905_0000790 | 3300037471 | Bacteria | 41600 |
| 193 | Ga0395905_0052469 | 3300037471 | Bacteria | 3817 |
| 194 | Ga0395901_0003637 | 3300038443 | Bacteria | 15549 |
| 195 | Ga0395901_0275241 | 3300038443 | Bacteria | 1750 |
| 196 | Ga0439438_027260 | 3300041405 | Bacteria | 1543 |
| 197 | Ga0439465_0008078 | 3300041413 | Bacteria | 3327 |
| 198 | Ga0451835_0345568 | 3300041492 | Bacteria | 2178 |
| 199 | Ga0451839_0268866 | 3300041496 | Bacteria | 3367 |
| 200 | Ga0451841_0548923 | 3300041498 | Bacteria | 3014 |
| 201 | Ga0451847_0448429 | 3300041503 | Bacteria | 3966 |
| 202 | Ga0451847_0898239 | 3300041503 | Bacteria | 1974 |
| 203 | Ga0451851_0633554 | 3300041507 | Bacteria | 1266 |
| 204 | Ga0439442_010958 | 3300042002 | Bacteria | 1842 |
| 205 | Ga0439449_0001660 | 3300042007 | Bacteria | 8743 |
| 206 | Ga0439462_0017864 | 3300042015 | Bacteria | 1839 |
| 207 | Ga0453683_0083466 | 3300044673 | Bacteria | 2002 |
| 208 | Ga0451576_0520358 | 3300045051 | Bacteria | 1250 |
| 209 | Ga0495592_0018991 | 3300046454 | Bacteria | 5232 |
| 210 | Ga0495638_0010733 | 3300046460 | Bacteria | 6337 |
| 211 | Ga0495638_0046165 | 3300046460 | Bacteria | 2737 |
| 212 | Ga0495638_0103759 | 3300046460 | Bacteria | 1697 |
| 213 | Ga0495605_0007855 | 3300046474 | Bacteria | 6042 |
| 214 | Ga0495585_0124069 | 3300046492 | Bacteria | 1364 |
| 215 | Ga0495607_0044522 | 3300046501 | Bacteria | 2617 |
| 216 | Ga0495610_0012520 | 3300046512 | Bacteria | 5100 |
| 217 | Ga0495618_0028680 | 3300046514 | Bacteria | 3470 |
| 218 | Ga0495628_0041546 | 3300046516 | Bacteria | 3671 |
| 219 | Ga0495631_0027227 | 3300046518 | Bacteria | 2618 |
| 220 | Ga0495648_0013496 | 3300046524 | Bacteria | 6033 |
| 221 | Ga0495597_0035849 | 3300046542 | Bacteria | 2236 |
| 222 | Ga0495633_0022809 | 3300046558 | Bacteria | 3108 |
| 223 | Ga0495668_0100639 | 3300046616 | Bacteria | 1581 |
| 224 | Ga0495668_0101115 | 3300046616 | Bacteria | 1577 |
| 225 | Ga0495625_0005544 | 3300046660 | Bacteria | 11461 |
| 226 | Ga0495625_0015194 | 3300046660 | Bacteria | 6109 |
| 227 | Ga0495599_0019409 | 3300046678 | Bacteria | 4237 |
| 228 | Ga0495671_0012740 | 3300046692 | Bacteria | 4582 |
| 229 | Ga0495660_0047616 | 3300046810 | Bacteria | 2347 |
| 230 | Ga0495687_000790 | 3300047443 | Bacteria | 34028 |
| 231 | Ga0495686_0066523 | 3300047472 | Bacteria | 2227 |
| 232 | Ga0495626_0049137 | 3300048091 | Bacteria | 1954 |
| 233 | Ga0495626_0070738 | 3300048091 | Bacteria | 1569 |
| 234 | Ga0496102_0266912 | 3300048905 | Bacteria | 1614 |
| 235 | Ga0496103_0156325 | 3300048906 | Bacteria | 1462 |
| 236 | Ga0496108_0169740 | 3300048911 | Bacteria | 1887 |
| 237 | Ga0496109_0087678 | 3300048912 | Bacteria | 2875 |
| 238 | Ga0496110_0115130 | 3300048913 | Bacteria | 2420 |
| 239 | Ga0496112_0001731 | 3300048915 | Bacteria | 17084 |
| 240 | Ga0496113_0202494 | 3300048916 | Bacteria | 1578 |
| 241 | Ga0496115_0077566 | 3300048918 | Bacteria | 2702 |
| 242 | Ga0496119_0015738 | 3300048922 | Bacteria | 5800 |
| 243 | Ga0496119_0075000 | 3300048922 | Bacteria | 1967 |
| 244 | Ga0496120_0002155 | 3300048923 | Bacteria | 20986 |
| 245 | Ga0496120_0034257 | 3300048923 | Bacteria | 3044 |
| 246 | Ga0496121_0065485 | 3300048924 | Bacteria | 2956 |
| 247 | Ga0496121_0085995 | 3300048924 | Bacteria | 2472 |
| 248 | Ga0496125_0052190 | 3300048928 | Bacteria | 3364 |
| 249 | Ga0496126_0109794 | 3300048929 | Bacteria | 2404 |
| 250 | Ga0501031_0000008 | 3300049568 | Bacteria | 156304 |
| 251 | Ga0501032_0000018 | 3300049569 | Bacteria | 156275 |
| 252 | Ga0501033_0000032 | 3300049570 | Bacteria | 156304 |
| 253 | Ga0501033_0131031 | 3300049570 | Bacteria | 1816 |
| 254 | Ga0501034_0000103 | 3300049571 | Bacteria | 156304 |
| 255 | Ga0501034_0000444 | 3300049571 | Bacteria | 68426 |
| 256 | Ga0501034_0027759 | 3300049571 | Bacteria | 5755 |
| 257 | Ga0501034_0058940 | 3300049571 | Bacteria | 3857 |
| 258 | Ga0501034_0098582 | 3300049571 | Bacteria | 2918 |
| 259 | Ga0501034_0138581 | 3300049571 | Bacteria | 2413 |
| 260 | Ga0501034_0142525 | 3300049571 | Bacteria | 2375 |
| 261 | Ga0501034_0214410 | 3300049571 | Bacteria | 1880 |
| 262 | Ga0501036_0000012 | 3300049572 | Bacteria | 156304 |
| 263 | Ga0501036_0048906 | 3300049572 | Bacteria | 3580 |
| 264 | Ga0501036_0121790 | 3300049572 | Bacteria | 2203 |
| 265 | Ga0501037_0000018 | 3300049573 | Bacteria | 156304 |
| 266 | Ga0501037_0045997 | 3300049573 | Bacteria | 3202 |
| 267 | Ga0501037_0078181 | 3300049573 | Bacteria | 2400 |
| 268 | Ga0501038_0000017 | 3300049574 | Bacteria | 156304 |
| 269 | Ga0501038_0028367 | 3300049574 | Bacteria | 4974 |
| 270 | Ga0501039_0000024 | 3300049575 | Bacteria | 156304 |
| 271 | Ga0501039_0012606 | 3300049575 | Bacteria | 6461 |
| 272 | Ga0501039_0026717 | 3300049575 | Bacteria | 4436 |
| 273 | Ga0501040_0002939 | 3300049576 | Bacteria | 11019 |
| 274 | Ga0501042_0021447 | 3300049578 | Bacteria | 4503 |
| 275 | Ga0501043_0087776 | 3300049579 | Bacteria | 2444 |
| 276 | Ga0501043_0184059 | 3300049579 | Bacteria | 1627 |
| 277 | Ga0501043_0203632 | 3300049579 | Bacteria | 1535 |
| 278 | Ga0501046_0019750 | 3300049580 | Bacteria | 5583 |
| 279 | Ga0501047_0004558 | 3300049581 | Bacteria | 13028 |
| 280 | Ga0501047_0021324 | 3300049581 | Bacteria | 6219 |
| 281 | Ga0501047_0039924 | 3300049581 | Bacteria | 4539 |
| 282 | Ga0501047_0208265 | 3300049581 | Bacteria | 1814 |
| 283 | Ga0501048_0032565 | 3300049582 | Bacteria | 3766 |
| 284 | Ga0501068_0000614 | 3300049584 | Bacteria | 18139 |
| 285 | Ga0501068_0038689 | 3300049584 | Bacteria | 2858 |
| 286 | Ga0501069_0030241 | 3300049585 | Bacteria | 2974 |
| 287 | Ga0501070_0007753 | 3300049586 | Bacteria | 9100 |
| 288 | Ga0501070_0015990 | 3300049586 | Bacteria | 6306 |
| 289 | Ga0501070_0084376 | 3300049586 | Bacteria | 2630 |
| 290 | Ga0501070_0098602 | 3300049586 | Bacteria | 2417 |
| 291 | Ga0501072_0006051 | 3300049588 | Bacteria | 9232 |
| 292 | Ga0501073_0000143 | 3300049589 | Bacteria | 47217 |
| 293 | Ga0501073_0006109 | 3300049589 | Bacteria | 8986 |
| 294 | Ga0501073_0050868 | 3300049589 | Bacteria | 2902 |
| 295 | Ga0501074_0027973 | 3300049590 | Bacteria | 4087 |
| 296 | Ga0501074_0059501 | 3300049590 | Bacteria | 2752 |
| 297 | Ga0501076_0365988 | 3300049592 | Bacteria | 1185 |
| 298 | Ga0501080_0000955 | 3300049742 | Bacteria | 23659 |
| 299 | Ga0501080_0059312 | 3300049742 | Bacteria | 3561 |
| 300 | Ga0501035_0000040 | 3300049822 | Bacteria | 156262 |
| 301 | Ga0501035_0090497 | 3300049822 | Bacteria | 2693 |
| 302 | Ga0501035_0317488 | 3300049822 | Bacteria | 1309 |
| 303 | Ga0501044_0000040 | 3300049823 | Bacteria | 156304 |
| 304 | Ga0501044_0016222 | 3300049823 | Bacteria | 8008 |
| 305 | Ga0501044_0038740 | 3300049823 | Bacteria | 4976 |
| 306 | Ga0501044_0073102 | 3300049823 | Bacteria | 3485 |
| 307 | Ga0501044_0236414 | 3300049823 | Bacteria | 1772 |
| 308 | Ga0501045_0028489 | 3300049824 | Bacteria | 4029 |
| 309 | nmdc:mga00v17_83103_c1 | 3300050491 | Bacteria | 2002 |
| 310 | nmdc:mga07m45_82434_c1 | 3300050496 | Bacteria | 1837 |
| 311 | nmdc:mga05p37_87408_c1 | 3300050507 | Bacteria | 3841 |
| 312 | nmdc:mga09592_80253_c1 | 3300050508 | Bacteria | 2778 |
| 313 | nmdc:mga06r32_3536_c1 | 3300050510 | Bacteria | 13957 |
| 314 | Ga0495601_0024791 | 3300053077 | Bacteria | 3694 |
| 315 | Ga0500644_0013497 | 3300053088 | Bacteria | 2283 |
| 316 | Ga0500608_030026 | 3300053122 | Bacteria | 2574 |
| 317 | Ga0500616_0109998 | 3300053153 | Bacteria | 1332 |
| 318 | Ga0500620_000789 | 3300053155 | Bacteria | 5479 |
| 319 | Ga0500622_0000734 | 3300053156 | Bacteria | 28647 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6xgz-assembly4.cif.gz_G | crystal structure of e. coli mlafb abc transport subunits in the monomeric state | 0.9437 | 4 | 233 |
| 6xgz-assembly2.cif.gz_C | crystal structure of e. coli mlafb abc transport subunits in the monomeric state | 0.9417 | 4 | 233 |
| 6xgz-assembly3.cif.gz_E | crystal structure of e. coli mlafb abc transport subunits in the monomeric state | 0.9389 | 4 | 234 |
| 7z16-assembly1.cif.gz_J | e. coli c-p lyase bound to phnk/phnl dual abc dimer with amppnp and phnk e171q mutation | 0.9361 | 4 | 233 |
| 7ch0-assembly1.cif.gz_E | the overall structure of the mlafedb complex in atp-bound eqclose conformation (mutation of e170q on mlaf) | 0.9333 | 2 | 235 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2awoD01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.981 | 3 | 216 | 3.40.50.300 |
| 2awoD01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9675 | 3 | 216 | 3.40.50.300 |
| 3fvqB01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.952 | 3 | 235 | 3.40.50.300 |
| af_Q9XW49_1237_1482_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9427 | 2 | 224 | 3.40.50.300 |
| af_A1ZBS3_470_698_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9401 | 2 | 217 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A527GZS8-F1-model_v4 | ABC transporter ATP-binding protein | 0.9909 | 1 | 210 |
GO:0005524
GO:0008643 GO:0016887 GO:0055052 GO:0140359 |
| AF-A0A527GZS8-F1-model_v4 | ABC transporter ATP-binding protein | 0.977 | 1 | 210 |
GO:0005524
GO:0008643 GO:0016887 GO:0055052 GO:0140359 |
| AF-A0A7C4M9L8-F1-model_v4 | Molybdate/tungstate import ATP-binding protein WtpC (EC 7.3.2.6) | 0.967 | 1 | 166 |
GO:0005524
GO:0016887 |
| AF-A0A0R2HB88-F1-model_v4 | ABC superfamily ATP binding cassette transporter ABC protein | 0.9607 | 4 | 235 |
GO:0005524
GO:0016887 |
| AF-A0A348UPP1-F1-model_v4 | Polyamine ABC transporter ATP-binding protein | 0.9603 | 5 | 130 |
GO:0005524
GO:0016887 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar