F481914

General Info

Members Datasets Scaffolds Average Seq Length
812 543 587 432

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2721755755|2723845983
Length 474
Sequence IDVAQAAEAGPGQGSVLDHLLMRDEEGQLRREFVEEIARAIHAADRPLLCEVVAELHEADLGDLIAALEPEDRVTLVEITGTDFDFSALNEVDDAVREEILEELEPETVAEGVRELESDDAVQLLQGLDEEDQEEILEKLPPPERVAIERVLLYPENSAGRRMQTEFIAVPPDWTVGQAIDYMRDTPDLPDRFYEIYAVDSEQHWQGAVSLDTLLRARRPVPLVDLIEEDRRRVSVLDDQEEVARMFGKYNLVAAPVVDTTNRLVGVITIDDVVDVIEEEADEDLKALGGVTSDEELSDNVWTIARGRFNWLLVNLATAFLASSVLGLFEGQLEKMVALAVLAPIVASQGGNAATQTMTVAVRALATRELGSNNAFRVVMREAMVGLVNGLAFAVITGVAAVAWFKIPGLGVVIGLAIICNLVAGALGGILIPMVLERVRADPAVASGTFVTTITDVVGFFSFLGIATLWFGLK

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
5 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
6 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
7 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
8 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
9 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
10 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
11 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
12 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
13 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
14 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
15 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
16 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
17 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
18 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
19 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
20 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
21 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
22 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
23 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
24 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
25 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
26 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
27 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
28 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
29 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
30 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
31 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
32 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
33 2791355199
34 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
35 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
36 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
37 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
38 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
39 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
40 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
41 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
42 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
43 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
44 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
45 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
46 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
47 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
48 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
49 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
50 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
51 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
52 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
53 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
54 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
55 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
56 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
57 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
58 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
59 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
60 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
61 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
62 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
63 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
64 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
65 2842694124 Methylopila sp. R-72369 Isolate Unclassified
66 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
67 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
68 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
69 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
70 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
71 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
72 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
73 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
74 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
75 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
76 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
77 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
78 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
79 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
80 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
81 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
82 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
83 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
84 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
85 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
86 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
87 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
88 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
89 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
90 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
91 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
92 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
93 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
94 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
95 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
96 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
97 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
98 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
99 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
100 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
101 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
102 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
103 2904699407
104 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
105 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
106 2906610324
107 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
108 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
109 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
110 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
111 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
112 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
113 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
114 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
115 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
116 2922368715
117 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
118 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
119 2922425934
120 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
121 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
122 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
123 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
124 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
125 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
126 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
127 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
128 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
129 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
130 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
131 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
132 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
133 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
134 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
135 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
136 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
137 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
138 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
139 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
140 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
141 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
142 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
143 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
144 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
145 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
146 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
147 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
148 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
149 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
150 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
151 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
152 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
153 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
154 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
155 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
156 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
157 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
158 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
159 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
160 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
161 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
162 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
163 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
164 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
165 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
166 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
167 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
168 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
169 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
170 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
171 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
172 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
173 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
174 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
175 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
176 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
177 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
178 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
179 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
180 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
181 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
182 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
183 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
184 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
185 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
186 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
187 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
188 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
189 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
190 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
191 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
192 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
193 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
194 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
195 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
196 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
197 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
198 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
199 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
200 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
201 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
202 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
203 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
204 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
205 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
206 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
207 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
208 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
209 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
210 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
211 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
212 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
213 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
214 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
215 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
216 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
217 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
218 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
219 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
220 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
221 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
222 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
223 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
224 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
225 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
226 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
227 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
228 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
229 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
230 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
231 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
232 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
233 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
234 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
235 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
236 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
237 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
238 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
239 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
240 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
241 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
242 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
243 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
244 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
245 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
246 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
247 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
248 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
249 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
250 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
251 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
252 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
253 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
254 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
255 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
256 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
257 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
258 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
259 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
260 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
261 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
262 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
263 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
264 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
265 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
266 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
267 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
268 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
269 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
270 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
271 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
272 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
273 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
274 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
275 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
276 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
277 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
278 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
279 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
280 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
281 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
282 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
283 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
284 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
285 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
286 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
287 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
288 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
318 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
319 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
320 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
321 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
322 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
323 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
324 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
325 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
326 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
327 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
328 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
329 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
330 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
331 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
332 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
333 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
334 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
335 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
336 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
337 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
338 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
339 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
340 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
341 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
342 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
343 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
344 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
345 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
346 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
347 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
348 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
349 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
350 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
351 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
352 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
353 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
354 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
355 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
356 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
357 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
358 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
359 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
360 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
361 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
362 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
363 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
364 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
365 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
366 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
367 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
368 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
369 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
370 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
371 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
372 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
373 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
374 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
375 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
376 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
377 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
378 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
379 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
380 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
381 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
382 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
383 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
384 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
385 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
386 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
387 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
388 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
389 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
390 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
391 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
392 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
393 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
394 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
395 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
396 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
397 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
398 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
399 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
400 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
401 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
402 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
403 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
404 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
405 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
406 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
407 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
408 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
409 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
410 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
411 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
412 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
413 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
414 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
415 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
416 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
417 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
418 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
419 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
420 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
421 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
422 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
423 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
424 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
425 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
426 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
427 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
428 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
429 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
430 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
431 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
432 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
433 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
434 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
435 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
436 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
437 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
438 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
439 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
440 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
441 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
442 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
443 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
444 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
445 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
446 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
447 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
448 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
449 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
450 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
451 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
452 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
453 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
454 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
455 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
456 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
457 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
458 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
459 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
460 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
461 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
462 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
463 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
464 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
465 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
466 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
467 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
468 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
469 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
470 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
471 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
472 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
473 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
474 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
475 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
476 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
477 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
478 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
479 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
480 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
481 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
482 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
483 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
484 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
485 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
486 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
487 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
488 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
489 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
490 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
491 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
492 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
493 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
494 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
495 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
496 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
497 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
498 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
499 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
500 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
501 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
502 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
503 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
504 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
505 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
506 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
507 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
508 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
509 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
510 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
511 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
512 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
513 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
514 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
515 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
516 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
517 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
518 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
519 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
520 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
521 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
522 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
523 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
524 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
525 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
526 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
527 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
528 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
529 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
530 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
531 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
532 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
533 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
534 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
535 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
536 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
537 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
538 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
539 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
540 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
541 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
542 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
543 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 72.74
Metatranscriptomes 0
Isolates 27.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.05
Nodule 21.67
Rhizoplane 4.56
Rhizosphere 45.94
Stem 0
Stem Tuber 0
Unclassified 14.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10002137 3300001979 Bacteria 9028
2 JGI24737J22298_10002974 3300001990 Bacteria 6006
3 JGI24735J21928_10016183 3300002067 Bacteria 2319
4 JGI25406J46586_10000026 3300003203 Bacteria 70727
5 JGI25406J46586_10006773 3300003203 Bacteria 5263
6 JGI25165J46597_1005476 3300003214 Bacteria 2435
7 JGI25153J46596_10000985 3300003215 Bacteria 17294
8 JGI25153J46596_10004178 3300003215 Bacteria 7834
9 JGI25153J46596_10005451 3300003215 Bacteria 6677
10 JGI25160J50197_1000471 3300003354 Bacteria 24649
11 JGI25160J50197_1000905 3300003354 Bacteria 15612
12 JGI25160J50197_1009760 3300003354 Bacteria 3528
13 JGI25404J52841_10003281 3300003659 Bacteria 3180
14 Ga0055531_10006158 3300003794 Bacteria 6862
15 Ga0065165_1000676 3300005262 Bacteria 49091
16 Ga0065165_1001028 3300005262 Bacteria 33815
17 Ga0065165_1004302 3300005262 Bacteria 8962
18 Ga0070658_10080165 3300005327 Bacteria 2681
19 Ga0070683_100036193 3300005329 Bacteria 4516
20 Ga0070683_100049586 3300005329 Bacteria 3884
21 Ga0070680_100108465 3300005336 Bacteria 2310
22 Ga0070680_100183432 3300005336 Bacteria 1763
23 Ga0070660_100011169 3300005339 Bacteria 6372
24 Ga0070660_100073729 3300005339 Bacteria 2669
25 Ga0070668_100016411 3300005347 Bacteria 5536
26 Ga0070668_100018846 3300005347 Bacteria 5184
27 Ga0070671_100028726 3300005355 Bacteria 4582
28 Ga0070688_100095027 3300005365 Bacteria 1955
29 Ga0070659_100018101 3300005366 Bacteria 5312
30 Ga0070709_10000449 3300005434 Bacteria 24812
31 Ga0070714_100005397 3300005435 Bacteria 9758
32 Ga0070714_100031171 3300005435 Bacteria 4446
33 Ga0070713_100012520 3300005436 Bacteria 6226
34 Ga0070713_100024226 3300005436 Bacteria 4724
35 Ga0070713_100081030 3300005436 Bacteria 2769
36 Ga0070713_100105498 3300005436 Bacteria 2448
37 Ga0070710_10000080 3300005437 Bacteria 43770
38 Ga0070710_10007237 3300005437 Bacteria 5364
39 Ga0070710_10033559 3300005437 Bacteria 2788
40 Ga0070711_100002916 3300005439 Bacteria 9857
41 Ga0070663_100016650 3300005455 Bacteria 4781
42 Ga0070663_100034481 3300005455 Bacteria 3505
43 Ga0070663_100162708 3300005455 Bacteria 1719
44 Ga0070678_100014660 3300005456 Bacteria 4954
45 Ga0070678_100032005 3300005456 Bacteria 3635
46 Ga0070662_100042111 3300005457 Bacteria 3261
47 Ga0070681_10038494 3300005458 Bacteria 4795
48 Ga0070681_10073038 3300005458 Bacteria 3392
49 Ga0070679_100061981 3300005530 Bacteria 3727
50 Ga0070684_100009926 3300005535 Bacteria 7525
51 Ga0070684_100020540 3300005535 Bacteria 5478
52 Ga0068853_100023072 3300005539 Bacteria 5206
53 Ga0068853_100028496 3300005539 Bacteria 4698
54 Ga0070686_100022536 3300005544 Bacteria 3752
55 Ga0070665_100001701 3300005548 Bacteria 25284
56 Ga0070665_100005911 3300005548 Bacteria 12536
57 Ga0070665_100011311 3300005548 Bacteria 9027
58 Ga0068855_100024197 3300005563 Bacteria 7269
59 Ga0068855_100061078 3300005563 Bacteria 4404
60 Ga0068855_100146670 3300005563 Bacteria 2686
61 Ga0068855_100202044 3300005563 Bacteria 2237
62 Ga0070664_100114009 3300005564 Bacteria 2361
63 Ga0070664_100115014 3300005564 Bacteria 2351
64 Ga0068857_100025654 3300005577 Bacteria 5189
65 Ga0068857_100084756 3300005577 Bacteria 2832
66 Ga0068854_100020160 3300005578 Bacteria 4505
67 Ga0068854_100148899 3300005578 Bacteria 1803
68 Ga0068856_100003013 3300005614 Bacteria 17245
69 Ga0068856_100007962 3300005614 Bacteria 10350
70 Ga0068856_100037003 3300005614 Bacteria 4787
71 Ga0070702_100009142 3300005615 Bacteria 4836
72 Ga0068852_100024478 3300005616 Bacteria 4880
73 Ga0068852_100038374 3300005616 Bacteria 4025
74 Ga0068861_100148545 3300005719 Bacteria 1920
75 Ga0068851_10001148 3300005834 Bacteria 11480
76 Ga0068860_100000149 3300005843 Bacteria 113068
77 Ga0081455_10004867 3300005937 Bacteria 14894
78 Ga0081455_10034642 3300005937 Bacteria 4522
79 Ga0081455_10062521 3300005937 Bacteria 3129
80 Ga0081455_10131209 3300005937 Bacteria 1959
81 Ga0081538_10022152 3300005981 Bacteria 4613
82 Ga0081538_10041851 3300005981 Bacteria 2901
83 Ga0081540_1000565 3300005983 Bacteria 35910
84 Ga0081540_1001009 3300005983 Bacteria 25255
85 Ga0081540_1001804 3300005983 Bacteria 17954
86 Ga0081540_1007583 3300005983 Bacteria 7708
87 Ga0081540_1008855 3300005983 Bacteria 6988
88 Ga0081540_1041827 3300005983 Bacteria 2371
89 Ga0081539_10000140 3300005985 Bacteria 166746
90 Ga0081539_10001416 3300005985 Bacteria 41282
91 Ga0081539_10077832 3300005985 Bacteria 1753
92 Ga0070717_10002484 3300006028 Bacteria 13019
93 Ga0070717_10028456 3300006028 Bacteria 4475
94 Ga0070717_10113211 3300006028 Bacteria 2316
95 Ga0075365_10000501 3300006038 Bacteria 14880
96 Ga0075365_10022102 3300006038 Bacteria 3980
97 Ga0075363_100001550 3300006048 Bacteria 8815
98 Ga0075363_100005187 3300006048 Bacteria 5769
99 Ga0075364_10012257 3300006051 Bacteria 5242
100 Ga0075364_10021345 3300006051 Bacteria 4080
101 Ga0075364_10040499 3300006051 Bacteria 3022
102 Ga0075364_10133886 3300006051 Bacteria 1665
103 Ga0070715_10004402 3300006163 Bacteria 4618
104 Ga0070716_100003205 3300006173 Bacteria 7672
105 Ga0070716_100024388 3300006173 Bacteria 3219
106 Ga0075367_10001628 3300006178 Bacteria 9761
107 Ga0075367_10018260 3300006178 Bacteria 3866
108 Ga0075366_10015409 3300006195 Bacteria 4381
109 Ga0097621_100252534 3300006237 Bacteria 1544
110 Ga0075370_10106471 3300006353 Bacteria 1626
111 Ga0075428_100001309 3300006844 Bacteria 26388
112 Ga0075431_100000481 3300006847 Bacteria 33062
113 Ga0075434_100067965 3300006871 Bacteria 3550
114 Ga0075429_100004176 3300006880 Bacteria 12367
115 Ga0099824_1014350 3300006942 Bacteria 7895
116 Ga0099824_1027789 3300006942 Bacteria 2672
117 Ga0099822_1015994 3300006943 Bacteria 8332
118 Ga0105240_10028194 3300009093 Bacteria 7338
119 Ga0105240_10036147 3300009093 Bacteria 6356
120 Ga0105240_10074624 3300009093 Bacteria 4185
121 Ga0105240_10153425 3300009093 Bacteria 2741
122 Ga0111539_10002444 3300009094 Bacteria 24696
123 Ga0105245_10022065 3300009098 Bacteria 5588
124 Ga0105247_10014265 3300009101 Bacteria 4769
125 Ga0105247_10126371 3300009101 Bacteria 1662
126 Ga0114129_10001244 3300009147 Bacteria 33939
127 Ga0105243_10110300 3300009148 Bacteria 2300
128 Ga0105241_10004323 3300009174 Bacteria 10508
129 Ga0105242_10032961 3300009176 Bacteria 4145
130 Ga0105242_10073447 3300009176 Bacteria 2844
131 Ga0105237_10009290 3300009545 Bacteria 10534
132 Ga0105237_10011062 3300009545 Bacteria 9567
133 Ga0105237_10047580 3300009545 Bacteria 4312
134 Ga0105237_10062127 3300009545 Bacteria 3734
135 Ga0105237_10079494 3300009545 Bacteria 3269
136 Ga0105238_10011154 3300009551 Bacteria 9038
137 Ga0105238_10011212 3300009551 Bacteria 9017
138 Ga0105238_10021238 3300009551 Bacteria 6615
139 Ga0105238_10025526 3300009551 Bacteria 6024
140 Ga0099796_10000263 3300010159 Bacteria 8331
141 Ga0105239_10003480 3300010375 Bacteria 19264
142 Ga0105239_10011760 3300010375 Bacteria 9770
143 Ga0105239_10065770 3300010375 Bacteria 3983
144 Ga0105239_10084754 3300010375 Bacteria 3491
145 Ga0105239_10094674 3300010375 Bacteria 3299
146 Ga0105239_10118417 3300010375 Bacteria 2939
147 Ga0157371_10146057 3300013102 Bacteria 1685
148 Ga0157370_10040094 3300013104 Bacteria 4521
149 Ga0157370_10045350 3300013104 Bacteria 4218
150 Ga0157370_10114184 3300013104 Bacteria 2523
151 Ga0157370_10208642 3300013104 Bacteria 1811
152 Ga0157369_10002568 3300013105 Bacteria 21726
153 Ga0157369_10006143 3300013105 Bacteria 13941
154 Ga0157369_10007826 3300013105 Bacteria 12301
155 Ga0157369_10042037 3300013105 Bacteria 4987
156 Ga0157374_10027530 3300013296 Bacteria 5131
157 Ga0157378_10003347 3300013297 Bacteria 14261
158 Ga0157378_10096739 3300013297 Bacteria 2690
159 Ga0157375_10112031 3300013308 Bacteria 2828
160 Ga0157379_10147012 3300014968 Bacteria 2126
161 Ga0157376_10002196 3300014969 Bacteria 13158
162 Ga0214544_1005900 3300021320 Bacteria 23196
163 Ga0214542_1000002 3300021321 Bacteria 720798
164 Ga0214545_1000002 3300021324 Bacteria 727485
165 Ga0214543_1000013 3300021327 Bacteria 329117
166 Ga0213876_10002558 3300021384 Bacteria 10644
167 Ga0213875_10000089 3300021388 Bacteria 105772
168 Ga0209563_103109 3300025230 Bacteria 3515
169 Ga0209677_100317 3300025253 Bacteria 31458
170 Ga0209677_104466 3300025253 Bacteria 4021
171 Ga0209148_1002077 3300025254 Bacteria 7657
172 Ga0209233_1001148 3300025261 Bacteria 10790
173 Ga0209455_1002461 3300025272 Bacteria 7133
174 Ga0209455_1003127 3300025272 Bacteria 6029
175 Ga0209564_1001156 3300025295 Bacteria 30779
176 Ga0209564_1011460 3300025295 Bacteria 3970
177 Ga0209564_1011750 3300025295 Bacteria 3889
178 Ga0209758_1000100 3300025297 Bacteria 227948
179 Ga0209758_1000138 3300025297 Bacteria 175187
180 Ga0209758_1001091 3300025297 Bacteria 35146
181 Ga0209758_1001346 3300025297 Bacteria 29651
182 Ga0209758_1004633 3300025297 Bacteria 11268
183 Ga0209758_1004795 3300025297 Bacteria 10934
184 Ga0207426_1000575 3300025302 Bacteria 49342
185 Ga0207426_1000611 3300025302 Bacteria 46127
186 Ga0207426_1003097 3300025302 Bacteria 9505
187 Ga0207426_1011857 3300025302 Bacteria 3298
188 Ga0209257_1002068 3300025304 Bacteria 21183
189 Ga0207697_10046903 3300025315 Bacteria 1780
190 Ga0207656_10028559 3300025321 Bacteria 2290
191 Ga0207692_10001336 3300025898 Bacteria 9193
192 Ga0207692_10031465 3300025898 Bacteria 2542
193 Ga0207680_10095354 3300025903 Bacteria 1901
194 Ga0207647_10001716 3300025904 Bacteria 16822
195 Ga0207647_10002180 3300025904 Bacteria 14930
196 Ga0207699_10000664 3300025906 Bacteria 16532
197 Ga0207699_10023020 3300025906 Bacteria 3385
198 Ga0207645_10139343 3300025907 Bacteria 1580
199 Ga0207654_10008431 3300025911 Bacteria 5210
200 Ga0207707_10001819 3300025912 Bacteria 19559
201 Ga0207707_10027529 3300025912 Bacteria 4971
202 Ga0207707_10035918 3300025912 Bacteria 4333
203 Ga0207707_10056163 3300025912 Bacteria 3425
204 Ga0207707_10125546 3300025912 Bacteria 2244
205 Ga0207695_10000883 3300025913 Bacteria 54495
206 Ga0207695_10024523 3300025913 Bacteria 6781
207 Ga0207695_10094686 3300025913 Bacteria 2993
208 Ga0207671_10030544 3300025914 Bacteria 4018
209 Ga0207671_10032489 3300025914 Bacteria 3885
210 Ga0207671_10085135 3300025914 Bacteria 2375
211 Ga0207671_10143460 3300025914 Bacteria 1841
212 Ga0207693_10012619 3300025915 Bacteria 6827
213 Ga0207693_10062417 3300025915 Bacteria 2919
214 Ga0207663_10074620 3300025916 Bacteria 2198
215 Ga0207660_10060137 3300025917 Bacteria 2730
216 Ga0207660_10107581 3300025917 Bacteria 2093
217 Ga0207660_10108926 3300025917 Bacteria 2081
218 Ga0207657_10032851 3300025919 Bacteria 4683
219 Ga0207657_10154476 3300025919 Bacteria 1867
220 Ga0207649_10015585 3300025920 Bacteria 4269
221 Ga0207652_10056483 3300025921 Bacteria 3379
222 Ga0207646_10124224 3300025922 Bacteria 2320
223 Ga0207694_10000436 3300025924 Bacteria 38791
224 Ga0207694_10012321 3300025924 Bacteria 6447
225 Ga0207694_10057660 3300025924 Bacteria 3019
226 Ga0207700_10018027 3300025928 Bacteria 4731
227 Ga0207700_10076545 3300025928 Bacteria 2596
228 Ga0207700_10100452 3300025928 Bacteria 2306
229 Ga0207664_10013089 3300025929 Bacteria 5947
230 Ga0207706_10011445 3300025933 Bacteria 8081
231 Ga0207686_10089188 3300025934 Bacteria 2032
232 Ga0207669_10050729 3300025937 Bacteria 2482
233 Ga0207704_10160824 3300025938 Bacteria 1598
234 Ga0207665_10005731 3300025939 Bacteria 8269
235 Ga0207665_10036936 3300025939 Bacteria 3250
236 Ga0207665_10101381 3300025939 Bacteria 2010
237 Ga0207661_10005117 3300025944 Bacteria 9206
238 Ga0207667_10022504 3300025949 Bacteria 6960
239 Ga0207667_10029290 3300025949 Bacteria 5972
240 Ga0207667_10032844 3300025949 Bacteria 5586
241 Ga0207667_10053024 3300025949 Bacteria 4268
242 Ga0207667_10161717 3300025949 Bacteria 2303
243 Ga0207712_10163361 3300025961 Bacteria 1733
244 Ga0207640_10012053 3300025981 Bacteria 4914
245 Ga0207640_10085324 3300025981 Bacteria 2171
246 Ga0207639_10049883 3300026041 Bacteria 3176
247 Ga0207639_10086285 3300026041 Bacteria 2499
248 Ga0207678_10047972 3300026067 Bacteria 3692
249 Ga0207678_10187027 3300026067 Bacteria 1769
250 Ga0207702_10000005 3300026078 Bacteria 420296
251 Ga0207702_10000365 3300026078 Bacteria 51814
252 Ga0207702_10070046 3300026078 Bacteria 3016
253 Ga0207702_10126676 3300026078 Bacteria 2294
254 Ga0207674_10020453 3300026116 Bacteria 7150
255 Ga0207674_10022794 3300026116 Bacteria 6719
256 Ga0207674_10049929 3300026116 Bacteria 4276
257 Ga0207674_10064122 3300026116 Bacteria 3706
258 Ga0207675_100078766 3300026118 Bacteria 3088
259 Ga0207683_10046767 3300026121 Bacteria 3788
260 Ga0207683_10071290 3300026121 Bacteria 3071
261 Ga0207683_10147718 3300026121 Bacteria 2121
262 Ga0207698_10015737 3300026142 Bacteria 5077
263 Ga0207698_10044750 3300026142 Bacteria 3329
264 Ga0207698_10216343 3300026142 Bacteria 1728
265 Ga0207698_10267413 3300026142 Bacteria 1574
266 Ga0209389_1000094 3300027296 Bacteria 80555
267 Ga0209389_1000189 3300027296 Bacteria 46457
268 Ga0209589_1000030 3300027357 Bacteria 147457
269 Ga0209589_1000845 3300027357 Bacteria 46457
270 Ga0209489_100056 3300027361 Bacteria 147457
271 Ga0209489_101612 3300027361 Bacteria 46456
272 Ga0209489_110925 3300027361 Bacteria 9734
273 Ga0209700_100059 3300027363 Bacteria 147457
274 Ga0209700_100374 3300027363 Bacteria 81273
275 Ga0209179_1002897 3300027512 Bacteria 2394
276 Ga0209813_10019792 3300027866 Bacteria 1876
277 Ga0207428_10001178 3300027907 Bacteria 28140
278 Ga0268266_10002227 3300028379 Bacteria 21177
279 Ga0268266_10034792 3300028379 Bacteria 4285
280 Ga0268266_10052050 3300028379 Bacteria 3515
281 Ga0268266_10155010 3300028379 Bacteria 2068
282 Ga0268264_10000084 3300028381 Bacteria 242128
283 Ga0265334_10017182 3300028573 Bacteria 2992
284 Ga0265323_10009250 3300028653 Bacteria 4032
285 Ga0265336_10003221 3300028666 Bacteria 6474
286 Ga0307517_10001070 3300028786 Bacteria 46406
287 Ga0265338_10000306 3300028800 Bacteria 88631
288 Ga0307511_10046287 3300030521 Bacteria 3580
289 Ga0265330_10022333 3300031235 Bacteria 2879
290 Ga0265330_10036168 3300031235 Bacteria 2201
291 Ga0265340_10005613 3300031247 Bacteria 6952
292 Ga0265331_10059075 3300031250 Bacteria 1814
293 Ga0307509_10227595 3300031507 Bacteria 1671
294 Ga0265314_10126271 3300031711 Bacteria 1602
295 Ga0307516_10019104 3300031730 Bacteria 7105
296 Ga0307516_10035156 3300031730 Bacteria 5029
297 Ga0307516_10039406 3300031730 Bacteria 4710
298 Ga0307413_10044697 3300031824 Bacteria 2620
299 Ga0307507_10046137 3300033179 Bacteria 4276
300 Ga0307510_10043883 3300033180 Bacteria 4853
301 Ga0307510_10055257 3300033180 Bacteria 4149
302 Ga0307510_10091352 3300033180 Bacteria 2887
303 Ga0315911_1000020 3300033442 Bacteria 139809
304 Ga0316215_1002160 3300033544 Bacteria 1859
305 Ga0373959_0007535 3300034820 Bacteria 1832
306 Ga0373926_0006349 3300035083 Bacteria 3925
307 Ga0373929_0012980 3300035085 Bacteria 1591
308 Ga0373934_0001625 3300035086 Bacteria 8244
309 Ga0373952_0010315 3300035092 Unclassified 1803
310 Ga0373923_0000728 3300035111 Bacteria 8477
311 Ga0373923_0014602 3300035111 Bacteria 2953
312 Ga0373953_0001784 3300035117 Bacteria 6357
313 Ga0373953_0005032 3300035117 Bacteria 4260
314 Ga0373954_0012962 3300035118 Bacteria 3712
315 Ga0373956_0005702 3300035119 Bacteria 4978
316 Ga0373956_0026766 3300035119 Bacteria 2500
317 Ga0373957_0000700 3300035120 Bacteria 8682
318 Ga0373960_0027339 3300035121 Bacteria 1566
319 Ga0373955_0000682 3300035172 Bacteria 14514
320 Ga0373955_0032561 3300035172 Bacteria 2737
321 Ga0373924_0002550 3300035410 Bacteria 6148
322 Ga0373931_0003895 3300035691 Bacteria 6750
323 Ga0373935_0013240 3300035692 Bacteria 4975
324 Ga0373935_0037039 3300035692 Bacteria 3052
325 Ga0373935_0080551 3300035692 Bacteria 2115
326 Ga0373927_0022562 3300035695 Bacteria 4123
327 Ga0373927_0025245 3300035695 Bacteria 3884
328 Ga0373927_0031239 3300035695 Bacteria 3472
329 Ga0373927_0108354 3300035695 Bacteria 1809
330 Ga0373933_0000276 3300035724 Bacteria 33468
331 Ga0373933_0002551 3300035724 Bacteria 10216
332 Ga0373933_0033581 3300035724 Bacteria 2985
333 Ga0373947_0014079 3300035725 Bacteria 4585
334 Ga0373947_0053457 3300035725 Bacteria 2435
335 Ga0373937_0205402 3300036401 Bacteria 1852
336 Ga0373925_0020120 3300037068 Bacteria 4857
337 Ga0373925_0122281 3300037068 Bacteria 2021
338 Ga0373925_0192576 3300037068 Bacteria 1618
339 Ga0373925_0195652 3300037068 Bacteria 1606
340 Ga0395900_0000601 3300037418 Bacteria 49219
341 Ga0395900_0062773 3300037418 Bacteria 3819
342 Ga0395898_0204433 3300037466 Bacteria 1885
343 Ga0395905_0003686 3300037471 Bacteria 16219
344 Ga0436364_0571570 3300037853 Bacteria 2326
345 Ga0436364_0768079 3300037853 Bacteria 31728
346 Ga0395901_0053569 3300038443 Bacteria 4192
347 Ga0395901_0100710 3300038443 Bacteria 3031
348 Ga0395901_0103703 3300038443 Bacteria 2984
349 Ga0436365_0871323 3300039437 Bacteria 58014
350 Ga0436365_1157755 3300039437 Bacteria 2049
351 Ga0436365_1461999 3300039437 Bacteria 6432
352 Ga0436365_1867827 3300039437 Bacteria 2196
353 Ga0466972_0000206 3300044658 Bacteria 42982
354 Ga0466961_0000082 3300044693 Bacteria 59328
355 Ga0466963_0044837 3300044694 Bacteria 2911
356 Ga0466959_0008199 3300045049 Bacteria 7372
357 Ga0495603_0010909 3300046455 Bacteria 5512
358 Ga0495603_0013008 3300046455 Bacteria 5031
359 Ga0495603_0013682 3300046455 Bacteria 4909
360 Ga0495629_0000450 3300046459 Bacteria 34200
361 Ga0495629_0001771 3300046459 Bacteria 16939
362 Ga0495629_0103888 3300046459 Bacteria 1982
363 Ga0495638_0003230 3300046460 Bacteria 12885
364 Ga0495651_0003667 3300046462 Bacteria 11763
365 Ga0495651_0024660 3300046462 Bacteria 4679
366 Ga0495651_0038481 3300046462 Bacteria 3724
367 Ga0495653_0001326 3300046463 Bacteria 19200
368 Ga0495580_0004175 3300046472 Bacteria 12153
369 Ga0495580_0091584 3300046472 Bacteria 2116
370 Ga0495580_0096750 3300046472 Bacteria 2053
371 Ga0495582_0014658 3300046473 Bacteria 4307
372 Ga0495639_0006594 3300046475 Bacteria 4993
373 Ga0495662_0053759 3300046476 Bacteria 1945
374 Ga0495594_0060186 3300046499 Bacteria 2100
375 Ga0495606_0005859 3300046507 Bacteria 11583
376 Ga0495606_0006244 3300046507 Bacteria 11061
377 Ga0495608_0000519 3300046511 Bacteria 26476
378 Ga0495608_0086977 3300046511 Bacteria 2025
379 Ga0495610_0020870 3300046512 Bacteria 3621
380 Ga0495610_0039694 3300046512 Bacteria 2378
381 Ga0495616_0055620 3300046513 Bacteria 1958
382 Ga0495628_0084298 3300046516 Bacteria 2466
383 Ga0495630_0078635 3300046517 Bacteria 2487
384 Ga0495643_0004362 3300046522 Bacteria 9919
385 Ga0495644_0028199 3300046523 Bacteria 2125
386 Ga0495648_0004756 3300046524 Bacteria 11492
387 Ga0495648_0055892 3300046524 Bacteria 2377
388 Ga0495652_0105929 3300046529 Bacteria 2271
389 Ga0495652_0139817 3300046529 Bacteria 1905
390 Ga0495665_0006975 3300046531 Bacteria 6093
391 Ga0495586_0064243 3300046535 Bacteria 2000
392 Ga0495587_0010165 3300046536 Bacteria 6003
393 Ga0495645_0027571 3300046543 Bacteria 4127
394 Ga0495645_0106070 3300046543 Bacteria 1993
395 Ga0495633_0028152 3300046558 Bacteria 2741
396 Ga0495667_0022688 3300046559 Bacteria 4228
397 Ga0495667_0047031 3300046559 Bacteria 2851
398 Ga0495668_0037587 3300046616 Bacteria 2709
399 Ga0495668_0077050 3300046616 Bacteria 1831
400 Ga0495634_0023795 3300046642 Bacteria 4303
401 Ga0495634_0029860 3300046642 Bacteria 3770
402 Ga0495611_0011021 3300046648 Bacteria 3829
403 Ga0495635_0000949 3300046663 Bacteria 19120
404 Ga0495635_0002315 3300046663 Bacteria 12949
405 Ga0495635_0028172 3300046663 Bacteria 3904
406 Ga0495588_0081907 3300046674 Bacteria 1685
407 Ga0495657_0026545 3300046675 Bacteria 4100
408 Ga0495657_0040214 3300046675 Bacteria 3209
409 Ga0495599_0001298 3300046678 Bacteria 14185
410 Ga0495623_0004108 3300046679 Bacteria 9593
411 Ga0495623_0067875 3300046679 Bacteria 2225
412 Ga0495646_0053097 3300046680 Bacteria 2445
413 Ga0495647_0001492 3300046681 Bacteria 7260
414 Ga0495658_0009441 3300046683 Bacteria 4863
415 Ga0495669_0004566 3300046684 Bacteria 5731
416 Ga0495613_0088406 3300046689 Bacteria 2245
417 Ga0495624_0073887 3300046690 Bacteria 2119
418 Ga0495600_0025985 3300046809 Bacteria 3776
419 Ga0495600_0028790 3300046809 Bacteria 3595
420 Ga0495600_0140416 3300046809 Bacteria 1567
421 Ga0495581_0028348 3300047315 Bacteria 3246
422 Ga0495581_0125207 3300047315 Bacteria 1496
423 Ga0495604_0002058 3300047317 Bacteria 16236
424 Ga0495604_0052524 3300047317 Bacteria 3155
425 Ga0495604_0096684 3300047317 Bacteria 2178
426 Ga0495674_0004477 3300047319 Bacteria 13445
427 Ga0495672_0005547 3300047320 Bacteria 9981
428 Ga0495672_0017919 3300047320 Bacteria 4722
429 Ga0495672_0018944 3300047320 Bacteria 4554
430 Ga0495676_0050331 3300047321 Bacteria 3342
431 Ga0495676_0127008 3300047321 Bacteria 1847
432 Ga0495680_0000314 3300047322 Bacteria 54452
433 Ga0495680_0035823 3300047322 Bacteria 3991
434 Ga0495687_004018 3300047443 Bacteria 10214
435 Ga0495675_0069520 3300047444 Bacteria 2223
436 Ga0495675_0076651 3300047444 Bacteria 2107
437 Ga0495684_0015304 3300047471 Bacteria 5908
438 Ga0495593_0007958 3300047673 Bacteria 6175
439 Ga0495593_0013821 3300047673 Bacteria 4598
440 Ga0496100_0041695 3300048903 Bacteria 2928
441 Ga0496101_0003025 3300048904 Bacteria 10368
442 Ga0496101_0036310 3300048904 Bacteria 3490
443 Ga0496102_0212867 3300048905 Bacteria 1822
444 Ga0496103_0020192 3300048906 Bacteria 4001
445 Ga0496103_0030869 3300048906 Bacteria 3262
446 Ga0496104_0000871 3300048907 Bacteria 25996
447 Ga0496104_0054348 3300048907 Bacteria 3785
448 Ga0496105_0000692 3300048908 Bacteria 22697
449 Ga0496105_0016067 3300048908 Bacteria 5972
450 Ga0496105_0090051 3300048908 Bacteria 2534
451 Ga0496105_0122039 3300048908 Bacteria 2148
452 Ga0496105_0259542 3300048908 Bacteria 1405
453 Ga0496106_0000664 3300048909 Bacteria 24642
454 Ga0496106_0061398 3300048909 Bacteria 2851
455 Ga0496106_0139181 3300048909 Bacteria 1908
456 Ga0496107_0028502 3300048910 Bacteria 3968
457 Ga0496108_0000464 3300048911 Bacteria 32517
458 Ga0496108_0011933 3300048911 Bacteria 7068
459 Ga0496108_0072438 3300048911 Bacteria 2908
460 Ga0496108_0096499 3300048911 Bacteria 2518
461 Ga0496109_0002389 3300048912 Bacteria 15696
462 Ga0496109_0002448 3300048912 Bacteria 15545
463 Ga0496109_0133502 3300048912 Bacteria 2318
464 Ga0496110_0013700 3300048913 Bacteria 6717
465 Ga0496111_0019393 3300048914 Bacteria 4722
466 Ga0496111_0029699 3300048914 Bacteria 3884
467 Ga0496112_0000004 3300048915 Bacteria 553294
468 Ga0496112_0003189 3300048915 Bacteria 13489
469 Ga0496112_0046911 3300048915 Bacteria 4238
470 Ga0496114_0021145 3300048917 Bacteria 5291
471 Ga0496114_0036871 3300048917 Bacteria 4041
472 Ga0496114_0138011 3300048917 Bacteria 2109
473 Ga0496115_0007995 3300048918 Bacteria 7806
474 Ga0496115_0034257 3300048918 Bacteria 4013
475 Ga0496116_0004328 3300048919 Bacteria 13582
476 Ga0496116_0016391 3300048919 Bacteria 5799
477 Ga0496117_0034299 3300048920 Bacteria 3825
478 Ga0496118_0027054 3300048921 Bacteria 4864
479 Ga0496118_0056890 3300048921 Bacteria 2936
480 Ga0496119_0007355 3300048922 Bacteria 9952
481 Ga0496119_0039898 3300048922 Bacteria 3012
482 Ga0496120_0011482 3300048923 Bacteria 6088
483 Ga0496120_0034063 3300048923 Bacteria 3055
484 Ga0496121_0000077 3300048924 Bacteria 235293
485 Ga0496121_0000616 3300048924 Bacteria 66339
486 Ga0496121_0000902 3300048924 Bacteria 53572
487 Ga0496121_0005105 3300048924 Bacteria 17110
488 Ga0496121_0005157 3300048924 Bacteria 16971
489 Ga0496121_0028377 3300048924 Bacteria 5210
490 Ga0496121_0030084 3300048924 Bacteria 4998
491 Ga0496121_0144038 3300048924 Bacteria 1763
492 Ga0496122_0026245 3300048925 Bacteria 5029
493 Ga0496123_0008882 3300048926 Bacteria 9145
494 Ga0496124_0006148 3300048927 Bacteria 13170
495 Ga0496124_0058370 3300048927 Bacteria 3246
496 Ga0496124_0164896 3300048927 Bacteria 1723
497 Ga0496125_0000125 3300048928 Bacteria 169979
498 Ga0496125_0000681 3300048928 Bacteria 56691
499 Ga0496125_0001203 3300048928 Bacteria 38917
500 Ga0496125_0031400 3300048928 Bacteria 4735
501 Ga0496125_0036601 3300048928 Bacteria 4281
502 Ga0496125_0066115 3300048928 Bacteria 2859
503 Ga0496126_0003238 3300048929 Bacteria 20812
504 Ga0496126_0010498 3300048929 Bacteria 9700
505 Ga0496126_0012314 3300048929 Bacteria 8776
506 Ga0496126_0014159 3300048929 Bacteria 8072
507 Ga0496126_0015017 3300048929 Bacteria 7806
508 Ga0496126_0018799 3300048929 Bacteria 6832
509 Ga0496126_0031960 3300048929 Bacteria 4965
510 Ga0496126_0050756 3300048929 Bacteria 3779
511 Ga0496126_0111299 3300048929 Bacteria 2385
512 Ga0496126_0208345 3300048929 Bacteria 1647
513 Ga0501067_0039519 3300049583 Bacteria 2620
514 Ga0501070_0036123 3300049586 Bacteria 4126
515 Ga0501073_0029897 3300049589 Bacteria 3891
516 Ga0501080_0022925 3300049742 Bacteria 5788
517 Ga0501044_0024513 3300049823 Bacteria 6402
518 nmdc:mga03n38_6679_c1 3300050490 Bacteria 4028
519 nmdc:mga03n38_6784_c1 3300050490 Bacteria 4008
520 nmdc:mga00v17_23171_c1 3300050491 Bacteria 3589
521 nmdc:mga00v17_6414_c2 3300050491 Bacteria 3294
522 nmdc:mga0yw44_13867_c1 3300050492 Bacteria 4259
523 nmdc:mga0yw44_16799_c1 3300050492 Bacteria 3964
524 nmdc:mga0yw44_27522_c1 3300050492 Bacteria 3258
525 nmdc:mga0k408_14814_c1 3300050493 Bacteria 4302
526 nmdc:mga04h51_10426_c1 3300050495 Bacteria 2552
527 nmdc:mga04h51_21243_c1 3300050495 Bacteria 1951
528 nmdc:mga05p37_332212_c1 3300050507 Bacteria 1795
529 nmdc:mga05p37_528_c1 3300050507 Bacteria 42336
530 nmdc:mga09592_704_c1 3300050508 Bacteria 25621
531 nmdc:mga06r32_1819_c1 3300050510 Bacteria 19037
532 nmdc:mga08y16_427_c1 3300050511 Bacteria 38825
533 nmdc:mga08y16_97546_c1 3300050511 Bacteria 3061
534 Ga0495601_0084926 3300053077 Bacteria 2033
535 Ga0500635_0001559 3300053080 Bacteria 5514
536 Ga0495595_0000602 3300053084 Bacteria 13704
537 Ga0495619_0002618 3300053085 Bacteria 11755
538 Ga0500578_0126885 3300053086 Bacteria 1602
539 Ga0500643_000114 3300053087 Bacteria 84221
540 Ga0500643_011390 3300053087 Bacteria 3248
541 Ga0500646_0001099 3300053090 Bacteria 7353
542 Ga0500647_0021187 3300053091 Bacteria 3031
543 Ga0500651_0025879 3300053093 Bacteria 3684
544 Ga0500566_0000021 3300053094 Bacteria 82710
545 Ga0500566_0000569 3300053094 Bacteria 20772
546 Ga0500566_0012626 3300053094 Bacteria 4970
547 Ga0500641_0002087 3300053096 Bacteria 7087
548 Ga0500650_0000314 3300053098 Bacteria 11712
549 Ga0500556_0000002 3300053104 Bacteria 773626
550 Ga0500556_0000009 3300053104 Bacteria 288111
551 Ga0500557_000001 3300053105 Bacteria 241298
552 Ga0500562_016678 3300053108 Bacteria 1889
553 Ga0500569_009149 3300053109 Bacteria 2293
554 Ga0500572_000012 3300053111 Bacteria 56206
555 Ga0500595_003362 3300053119 Bacteria 7506
556 Ga0500595_007948 3300053119 Bacteria 4359
557 Ga0500595_017615 3300053119 Bacteria 2632
558 Ga0500607_024182 3300053121 Bacteria 3394
559 Ga0500608_008858 3300053122 Bacteria 4249
560 Ga0500642_0000016 3300053130 Bacteria 176560
561 Ga0500642_0000077 3300053130 Bacteria 53422
562 Ga0500642_0023665 3300053130 Bacteria 2469
563 Ga0500652_054228 3300053131 Bacteria 1642
564 Ga0500559_0000205 3300053136 Bacteria 47084
565 Ga0500559_0000675 3300053136 Bacteria 22834
566 Ga0500559_0005464 3300053136 Bacteria 5844
567 Ga0500559_0030489 3300053136 Bacteria 2312
568 Ga0500568_0000994 3300053139 Bacteria 19383
569 Ga0500568_0004711 3300053139 Bacteria 7235
570 Ga0500568_0007793 3300053139 Bacteria 5217
571 Ga0500577_0000249 3300053142 Bacteria 13959
572 Ga0500590_046065 3300053148 Bacteria 2230
573 Ga0500603_000044 3300053150 Bacteria 30278
574 Ga0500603_001043 3300053150 Bacteria 6506
575 Ga0500604_0019610 3300053151 Bacteria 1895
576 Ga0500616_0001314 3300053153 Bacteria 24544
577 Ga0500616_0004067 3300053153 Bacteria 10637
578 Ga0500622_0070111 3300053156 Bacteria 1773
579 Ga0500638_003387 3300053162 Bacteria 5890
580 Ga0500639_000004 3300053163 Bacteria 216921
581 Ga0500639_019770 3300053163 Bacteria 3552
582 Ga0500636_0001512 3300053177 Bacteria 12652
583 Ga0500637_0016041 3300053178 Bacteria 3986
584 Ga0500637_0029788 3300053178 Bacteria 3031
585 Ga0500576_015385 3300053725 Bacteria 3459
586 Ga0500601_000646 3300053737 Bacteria 4793
587 Ga0500661_000462 3300055283 Bacteria 7505

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025928 Ga0207700_10018027 Ga0207700_100180273 354
2 3300025929 Ga0207664_10013089 Ga0207664_100130893 354
3 3300026121 Ga0207683_10147718 Ga0207683_101477182 364
4 3300035695 Ga0373927_0022562 Ga0373927_0022562_1127_2548 365
5 3300037068 Ga0373925_0192576 Ga0373925_0192576_106_1527 365
6 3300046455 Ga0495603_0013008 Ga0495603_0013008_1558_2979 365
7 3300046674 Ga0495588_0081907 Ga0495588_0081907_139_1560 365
8 3300049586 Ga0501070_0036123 Ga0501070_0036123_188_1597 365
9 3300049589 Ga0501073_0029897 Ga0501073_0029897_699_2108 365
10 3300049742 Ga0501080_0022925 Ga0501080_0022925_2635_4044 365
11 3300049823 Ga0501044_0024513 Ga0501044_0024513_3586_4995 365
12 3300005336 Ga0070680_100183432 Ga0070680_1001834322 368
13 3300025912 Ga0207707_10125546 Ga0207707_101255462 368
14 3300025917 Ga0207660_10107581 Ga0207660_101075812 368
15 3300048928 Ga0496125_0000681 Ga0496125_0000681_37873_39288 368
16 3300028573 Ga0265334_10017182 Ga0265334_100171821 372
17 3300028653 Ga0265323_10009250 Ga0265323_100092502 372
18 3300028666 Ga0265336_10003221 Ga0265336_100032215 372
19 3300028800 Ga0265338_10000306 Ga0265338_1000030687 372
20 3300053142 Ga0500577_0000249 Ga0500577_0000249_4304_5734 372
21 3300003215 JGI25153J46596_10000985 JGI25153J46596_1000098513 374
22 3300006237 Ga0097621_100252534 Ga0097621_1002525341 374
23 3300025297 Ga0209758_1004795 Ga0209758_10047959 374
24 3300037466 Ga0395898_0204433 Ga0395898_0204433_12_1373 375
25 3300013105 Ga0157369_10002568 Ga0157369_1000256819 376
26 3300025295 Ga0209564_1001156 Ga0209564_100115617 376
27 3300005437 Ga0070710_10033559 Ga0070710_100335592 377
28 3300009176 Ga0105242_10032961 Ga0105242_100329613 378
29 3300048909 Ga0496106_0061398 Ga0496106_0061398_1081_2442 378
30 3300048910 Ga0496107_0028502 Ga0496107_0028502_450_1811 378
31 3300048913 Ga0496110_0013700 Ga0496110_0013700_425_1786 378
32 3300005436 Ga0070713_100105498 Ga0070713_1001054981 379
33 3300005437 Ga0070710_10007237 Ga0070710_100072373 379
34 3300005548 Ga0070665_100005911 Ga0070665_1000059117 379
35 3300010375 Ga0105239_10094674 Ga0105239_100946743 379
36 3300025898 Ga0207692_10031465 Ga0207692_100314652 379
37 3300025915 Ga0207693_10062417 Ga0207693_100624173 379
38 3300025928 Ga0207700_10100452 Ga0207700_101004523 379
39 3300030521 Ga0307511_10046287 Ga0307511_100462873 379
40 3300033179 Ga0307507_10046137 Ga0307507_100461373 379
41 3300035692 Ga0373935_0013240 Ga0373935_0013240_1005_2441 379
42 3300037068 Ga0373925_0020120 Ga0373925_0020120_3280_4716 379
43 3300048909 Ga0496106_0000664 Ga0496106_0000664_19298_20734 379
44 3300048924 Ga0496121_0000077 Ga0496121_0000077_181386_182822 379
45 3300048924 Ga0496121_0030084 Ga0496121_0030084_48_1409 379
46 3300048927 Ga0496124_0006148 Ga0496124_0006148_4787_6223 379
47 3300053130 Ga0500642_0000016 Ga0500642_0000016_163300_164730 379
48 3300053136 Ga0500559_0030489 Ga0500559_0030489_583_2019 379
49 3300005366 Ga0070659_100018101 Ga0070659_1000181013 380
50 3300005456 Ga0070678_100014660 Ga0070678_1000146603 380
51 3300005458 Ga0070681_10073038 Ga0070681_100730383 380
52 3300005578 Ga0068854_100148899 Ga0068854_1001488992 380
53 3300005616 Ga0068852_100024478 Ga0068852_1000244784 380
54 3300025912 Ga0207707_10056163 Ga0207707_100561633 380
55 3300026121 Ga0207683_10046767 Ga0207683_100467673 380
56 3300026142 Ga0207698_10267413 Ga0207698_102674131 380
57 3300053094 Ga0500566_0000021 Ga0500566_0000021_2939_4351 380
58 3300053111 Ga0500572_000012 Ga0500572_000012_33407_34819 380
59 3300053136 Ga0500559_0005464 Ga0500559_0005464_904_2316 380
60 3300053150 Ga0500603_000044 Ga0500603_000044_23758_25170 380
61 3300053163 Ga0500639_000004 Ga0500639_000004_75906_77318 380
62 3300053178 Ga0500637_0029788 Ga0500637_0029788_495_1907 380
63 3300006353 Ga0075370_10106471 Ga0075370_101064712 381
64 3300050495 nmdc:mga04h51_10426_c1 nmdc:mga04h51_10426_c1_360_1793 381
65 3300031730 Ga0307516_10019104 Ga0307516_100191043 382
66 3300048908 Ga0496105_0259542 Ga0496105_0259542_19_1380 382
67 3300013102 Ga0157371_10146057 Ga0157371_101460571 383
68 3300025253 Ga0209677_100317 Ga0209677_10031720 383
69 3300035172 Ga0373955_0032561 Ga0373955_0032561_1354_2715 383
70 3300035695 Ga0373927_0108354 Ga0373927_0108354_436_1797 383
71 3300036401 Ga0373937_0205402 Ga0373937_0205402_48_1409 383
72 3300039437 Ga0436365_1867827 Ga0436365_1867827_783_2144 383
73 3300048903 Ga0496100_0041695 Ga0496100_0041695_259_1620 383
74 3300048921 Ga0496118_0027054 Ga0496118_0027054_2262_3623 383
75 3300048924 Ga0496121_0144038 Ga0496121_0144038_29_1390 383
76 3300048928 Ga0496125_0066115 Ga0496125_0066115_180_1598 383
77 3300048929 Ga0496126_0050756 Ga0496126_0050756_2398_3759 383
78 3300053725 Ga0500576_015385 Ga0500576_015385_12_1373 383
79 3300039437 Ga0436365_1157755 Ga0436365_1157755_576_1997 385
80 3300046524 Ga0495648_0004756 Ga0495648_0004756_8761_10191 386
81 3300048929 Ga0496126_0012314 Ga0496126_0012314_1264_2685 386
82 3300009545 Ga0105237_10009290 Ga0105237_100092909 387
83 3300025914 Ga0207671_10030544 Ga0207671_100305443 387
84 3300046455 Ga0495603_0010909 Ga0495603_0010909_1072_2505 387
85 3300046472 Ga0495580_0096750 Ga0495580_0096750_327_1760 388
86 3300046499 Ga0495594_0060186 Ga0495594_0060186_375_1808 388
87 3300048919 Ga0496116_0016391 Ga0496116_0016391_3652_5061 388
88 3300053093 Ga0500651_0025879 Ga0500651_0025879_2276_3655 388
89 3300053737 Ga0500601_000646 Ga0500601_000646_1184_2593 388
90 3300005985 Ga0081539_10077832 Ga0081539_100778322 389
91 3300046460 Ga0495638_0003230 Ga0495638_0003230_5174_6583 389
92 3300048920 Ga0496117_0034299 Ga0496117_0034299_715_2145 389
93 3300048925 Ga0496122_0026245 Ga0496122_0026245_446_1876 389
94 3300048926 Ga0496123_0008882 Ga0496123_0008882_4366_5796 389
95 3300053090 Ga0500646_0001099 Ga0500646_0001099_3288_4718 389
96 3300053094 Ga0500566_0000569 Ga0500566_0000569_15391_16821 389
97 3300053109 Ga0500569_009149 Ga0500569_009149_423_1853 389
98 3300053122 Ga0500608_008858 Ga0500608_008858_970_2400 389
99 3300053136 Ga0500559_0000675 Ga0500559_0000675_11489_12919 389
100 3300053139 Ga0500568_0000994 Ga0500568_0000994_7509_8939 389
101 3300053151 Ga0500604_0019610 Ga0500604_0019610_399_1829 389
102 iso_pu_bacteria 8019597564 8019602191 389
103 3300003214 JGI25165J46597_1005476 JGI25165J46597_10054762 390
104 3300025261 Ga0209233_1001148 Ga0209233_10011482 390
105 3300037471 Ga0395905_0003686 Ga0395905_0003686_2843_4264 390
106 3300038443 Ga0395901_0103703 Ga0395901_0103703_380_1801 390
107 3300046512 Ga0495610_0020870 Ga0495610_0020870_2023_3453 390
108 3300047320 Ga0495672_0017919 Ga0495672_0017919_2352_3782 390
109 3300048923 Ga0496120_0034063 Ga0496120_0034063_217_1647 390
110 3300048924 Ga0496121_0005157 Ga0496121_0005157_9841_11271 390
111 3300048928 Ga0496125_0001203 Ga0496125_0001203_33754_35184 390
112 3300048929 Ga0496126_0014159 Ga0496126_0014159_1160_2578 390
113 3300053087 Ga0500643_011390 Ga0500643_011390_1560_2990 390
114 3300053098 Ga0500650_0000314 Ga0500650_0000314_54_1484 390
115 3300053104 Ga0500556_0000002 Ga0500556_0000002_453259_454689 390
116 3300053104 Ga0500556_0000009 Ga0500556_0000009_123088_124470 390
117 3300053108 Ga0500562_016678 Ga0500562_016678_408_1838 390
118 3300053153 Ga0500616_0001314 Ga0500616_0001314_8277_9707 390
119 3300003354 JGI25160J50197_1009760 JGI25160J50197_10097602 391
120 3300005262 Ga0065165_1001028 Ga0065165_100102822 391
121 3300005436 Ga0070713_100024226 Ga0070713_1000242262 391
122 3300006028 Ga0070717_10002484 Ga0070717_1000248410 391
123 3300025302 Ga0207426_1003097 Ga0207426_10030974 391
124 3300025928 Ga0207700_10076545 Ga0207700_100765452 391
125 3300025939 Ga0207665_10101381 Ga0207665_101013812 391
126 3300053121 Ga0500607_024182 Ga0500607_024182_1603_3012 391
127 3300003203 JGI25406J46586_10006773 JGI25406J46586_100067736 392
128 3300005327 Ga0070658_10080165 Ga0070658_100801653 392
129 3300005985 Ga0081539_10001416 Ga0081539_1000141617 392
130 3300044694 Ga0466963_0044837 Ga0466963_0044837_1261_2682 392
131 3300046616 Ga0495668_0037587 Ga0495668_0037587_793_2214 392
132 3300048928 Ga0496125_0000125 Ga0496125_0000125_70483_71898 392
133 3300048929 Ga0496126_0018799 Ga0496126_0018799_4275_5696 392
134 3300049583 Ga0501067_0039519 Ga0501067_0039519_165_1586 392
135 iso_pu_bacteria 2842694124 2842694323 392
136 3300003659 JGI25404J52841_10003281 JGI25404J52841_100032812 393
137 3300005937 Ga0081455_10034642 Ga0081455_100346422 393
138 3300005983 Ga0081540_1001804 Ga0081540_10018045 393
139 3300006871 Ga0075434_100067965 Ga0075434_1000679653 393
140 3300026121 Ga0207683_10071290 Ga0207683_100712902 393
141 3300044693 Ga0466961_0000082 Ga0466961_0000082_9464_10873 393
142 3300045049 Ga0466959_0008199 Ga0466959_0008199_4793_6202 393
143 3300046512 Ga0495610_0039694 Ga0495610_0039694_735_2156 393
144 3300048908 Ga0496105_0090051 Ga0496105_0090051_29_1450 393
145 3300048921 Ga0496118_0056890 Ga0496118_0056890_709_2130 393
146 3300048922 Ga0496119_0039898 Ga0496119_0039898_1270_2679 393
147 3300053156 Ga0500622_0070111 Ga0500622_0070111_259_1680 393
148 iso_pu_bacteria 2847930680 2847935029 393
149 iso_pu_bacteria 2874612657 2874613255 393
150 iso_pu_bacteria 2879083081 2879086422 393
151 iso_pu_bacteria 2906643746 2906652250 393
152 3300005614 Ga0068856_100003013 Ga0068856_10000301312 394
153 3300005937 Ga0081455_10062521 Ga0081455_100625213 394
154 3300005983 Ga0081540_1001009 Ga0081540_100100915 394
155 3300005983 Ga0081540_1041827 Ga0081540_10418272 394
156 3300026078 Ga0207702_10000365 Ga0207702_1000036523 394
157 3300046507 Ga0495606_0006244 Ga0495606_0006244_5783_7192 394
158 iso_pu_bacteria 2906610324 2906617446 394
159 3300005843 Ga0068860_100000149 Ga0068860_10000014969 395
160 3300010159 Ga0099796_10000263 Ga0099796_100002638 395
161 3300028381 Ga0268264_10000084 Ga0268264_10000084106 395
162 3300031507 Ga0307509_10227595 Ga0307509_102275951 395
163 3300035121 Ga0373960_0027339 Ga0373960_0027339_72_1505 395
164 3300035691 Ga0373931_0003895 Ga0373931_0003895_4165_5598 395
165 3300035724 Ga0373933_0000276 Ga0373933_0000276_14815_16236 395
166 3300037068 Ga0373925_0195652 Ga0373925_0195652_61_1494 395
167 3300048908 Ga0496105_0122039 Ga0496105_0122039_89_1522 395
168 3300048917 Ga0496114_0036871 Ga0496114_0036871_724_2157 395
169 3300053139 Ga0500568_0007793 Ga0500568_0007793_964_2397 395
170 3300053148 Ga0500590_046065 Ga0500590_046065_322_1743 395
171 3300053177 Ga0500636_0001512 Ga0500636_0001512_5787_7208 395
172 3300003215 JGI25153J46596_10005451 JGI25153J46596_100054514 396
173 3300003354 JGI25160J50197_1000471 JGI25160J50197_100047121 396
174 3300003354 JGI25160J50197_1000905 JGI25160J50197_100090517 396
175 3300009545 Ga0105237_10062127 Ga0105237_100621274 396
176 3300010375 Ga0105239_10011760 Ga0105239_100117604 396
177 3300025297 Ga0209758_1001091 Ga0209758_100109117 396
178 3300025302 Ga0207426_1000611 Ga0207426_100061132 396
179 3300046513 Ga0495616_0055620 Ga0495616_0055620_149_1558 396
180 3300046522 Ga0495643_0004362 Ga0495643_0004362_2762_4171 396
181 3300047443 Ga0495687_004018 Ga0495687_004018_2734_4143 396
182 3300048904 Ga0496101_0036310 Ga0496101_0036310_969_2378 396
183 3300048906 Ga0496103_0030869 Ga0496103_0030869_1499_2908 396
184 3300048907 Ga0496104_0054348 Ga0496104_0054348_453_1862 396
185 3300048911 Ga0496108_0096499 Ga0496108_0096499_990_2399 396
186 3300048928 Ga0496125_0031400 Ga0496125_0031400_729_2150 396
187 3300050490 nmdc:mga03n38_6784_c1 nmdc:mga03n38_6784_c1_481_1890 396
188 3300050491 nmdc:mga00v17_23171_c1 nmdc:mga00v17_23171_c1_993_2414 396
189 3300050492 nmdc:mga0yw44_27522_c1 nmdc:mga0yw44_27522_c1_245_1654 396
190 3300050493 nmdc:mga0k408_14814_c1 nmdc:mga0k408_14814_c1_2627_4036 396
191 3300050495 nmdc:mga04h51_21243_c1 nmdc:mga04h51_21243_c1_36_1445 396
192 iso_pu_bacteria 2513237101 2513691591 396
193 iso_pu_bacteria 2874604998 2874609356 396
194 iso_pu_bacteria 2876808645 2876811554 396
195 iso_pu_bacteria 2879110137 2879110425 396
196 iso_pu_bacteria 2904690495 2904696822 396
197 iso_pu_bacteria 2908756301 2908759517 396
198 iso_pu_bacteria 8006994254 8006996241 396
199 iso_pu_bacteria 8056673599 8056680616 396
200 iso_pu_bacteria 8056689827 8056694198 396
201 3300001990 JGI24737J22298_10002974 JGI24737J22298_100029742 397
202 3300002067 JGI24735J21928_10016183 JGI24735J21928_100161832 397
203 3300005435 Ga0070714_100031171 Ga0070714_1000311714 397
204 3300005457 Ga0070662_100042111 Ga0070662_1000421113 397
205 3300005564 Ga0070664_100114009 Ga0070664_1001140092 397
206 3300005981 Ga0081538_10022152 Ga0081538_100221523 397
207 3300006028 Ga0070717_10113211 Ga0070717_101132112 397
208 3300006163 Ga0070715_10004402 Ga0070715_100044022 397
209 3300006173 Ga0070716_100024388 Ga0070716_1000243882 397
210 3300009093 Ga0105240_10074624 Ga0105240_100746243 397
211 3300009545 Ga0105237_10079494 Ga0105237_100794943 397
212 3300009551 Ga0105238_10011212 Ga0105238_1001121210 397
213 3300010375 Ga0105239_10065770 Ga0105239_100657703 397
214 3300021388 Ga0213875_10000089 Ga0213875_1000008950 397
215 3300025904 Ga0207647_10002180 Ga0207647_1000218016 397
216 3300025913 Ga0207695_10094686 Ga0207695_100946862 397
217 3300025914 Ga0207671_10143460 Ga0207671_101434601 397
218 3300025939 Ga0207665_10036936 Ga0207665_100369362 397
219 3300025949 Ga0207667_10053024 Ga0207667_100530243 397
220 3300026041 Ga0207639_10086285 Ga0207639_100862852 397
221 3300026078 Ga0207702_10070046 Ga0207702_100700463 397
222 3300026116 Ga0207674_10022794 Ga0207674_100227945 397
223 3300026142 Ga0207698_10044750 Ga0207698_100447503 397
224 3300037853 Ga0436364_0571570 Ga0436364_0571570_101_1507 397
225 3300037853 Ga0436364_0768079 Ga0436364_0768079_5308_6714 397
226 3300039437 Ga0436365_1461999 Ga0436365_1461999_2179_3585 397
227 3300046459 Ga0495629_0001771 Ga0495629_0001771_1568_2989 397
228 3300046462 Ga0495651_0024660 Ga0495651_0024660_2880_4301 397
229 3300046511 Ga0495608_0086977 Ga0495608_0086977_147_1568 397
230 3300046663 Ga0495635_0002315 Ga0495635_0002315_143_1564 397
231 3300046809 Ga0495600_0028790 Ga0495600_0028790_1750_3171 397
232 3300047315 Ga0495581_0125207 Ga0495581_0125207_26_1447 397
233 3300047317 Ga0495604_0096684 Ga0495604_0096684_728_2149 397
234 3300047321 Ga0495676_0050331 Ga0495676_0050331_73_1581 397
235 3300048907 Ga0496104_0000871 Ga0496104_0000871_20087_21508 397
236 3300048908 Ga0496105_0000692 Ga0496105_0000692_14907_16328 397
237 3300048922 Ga0496119_0007355 Ga0496119_0007355_6542_7963 397
238 3300048923 Ga0496120_0011482 Ga0496120_0011482_4415_5836 397
239 3300048927 Ga0496124_0058370 Ga0496124_0058370_1762_3183 397
240 3300048929 Ga0496126_0031960 Ga0496126_0031960_1235_2656 397
241 iso_pu_bacteria 2507262055 2507509596 397
242 iso_pu_bacteria 2508501009 2508543635 397
243 iso_pu_bacteria 2508501042 2508698574 397
244 iso_pu_bacteria 2511231028 2511401402 397
245 iso_pu_bacteria 2513237092 2513626621 397
246 iso_pu_bacteria 2513237094 2513638149 397
247 iso_pu_bacteria 2513237095 2513646301 397
248 iso_pu_bacteria 2513237096 2513659660 397
249 iso_pu_bacteria 2513237098 2513673634 397
250 iso_pu_bacteria 2513237102 2513700957 397
251 iso_pu_bacteria 2513237104 2513719008 397
252 iso_pu_bacteria 2513237137 2513862689 397
253 iso_pu_bacteria 2513237139 2513875318 397
254 iso_pu_bacteria 2513237145 2513921620 397
255 iso_pu_bacteria 2513237161 2514016111 397
256 iso_pu_bacteria 2515154112 2515629069 397
257 iso_pu_bacteria 2517093001 2517103671 397
258 iso_pu_bacteria 2517572143 2517893349 397
259 iso_pu_bacteria 2524023205 2524439650 397
260 iso_pu_bacteria 2524023210 2524467631 397
261 iso_pu_bacteria 2524023228 2524539921 397
262 iso_pu_bacteria 2528768022 2528853368 397
263 iso_pu_bacteria 2602042107 2603856711 397
264 iso_pu_bacteria 2617270735 2617349104 397
265 iso_pu_bacteria 2617270741 2617376702 397
266 iso_pu_bacteria 2667528175 2671117986 397
267 iso_pu_bacteria 2721755755 2723845983 397
268 iso_pu_bacteria 2728368998 2728750596 397
269 iso_pu_bacteria 2744054633 2745082105 397
270 iso_pu_bacteria 2791355196 2793060419 397
271 iso_pu_bacteria 2791355197 2793071896 397
272 iso_pu_bacteria 2791355199 2793079686 397
273 iso_pu_bacteria 2802429603 2805921946 397
274 iso_pu_bacteria 2816332527 2818241360 397
275 iso_pu_bacteria 2824600985 2824608971 397
276 iso_pu_bacteria 2824609381 2824610260 397
277 iso_pu_bacteria 2824617872 2824624353 397
278 iso_pu_bacteria 2824626560 2824630877 397
279 iso_pu_bacteria 2824635225 2824643295 397
280 iso_pu_bacteria 2824644064 2824651709 397
281 iso_pu_bacteria 2824653114 2824661234 397
282 iso_pu_bacteria 2824661429 2824666931 397
283 iso_pu_bacteria 2824671348 2824679140 397
284 iso_pu_bacteria 2824679649 2824686431 397
285 iso_pu_bacteria 2824687955 2824695058 397
286 iso_pu_bacteria 2824696289 2824703689 397
287 iso_pu_bacteria 2824704595 2824712165 397
288 iso_pu_bacteria 2824714736 2824721821 397
289 iso_pu_bacteria 2824723954 2824731686 397
290 iso_pu_bacteria 2824732956 2824740081 397
291 iso_pu_bacteria 2824746037 2824748242 397
292 iso_pu_bacteria 2824753945 2824759607 397
293 iso_pu_bacteria 2824763712 2824766714 397
294 iso_pu_bacteria 2824773399 2824773846 397
295 iso_pu_bacteria 2838122688 2838128743 397
296 iso_pu_bacteria 2841941048 2841941051 397
297 iso_pu_bacteria 2841949485 2841956431 397
298 iso_pu_bacteria 2841957949 2841962380 397
299 iso_pu_bacteria 2841966195 2841967202 397
300 iso_pu_bacteria 2841974524 2841979398 397
301 iso_pu_bacteria 2841983080 2841989876 397
302 iso_pu_bacteria 2842038055 2842039996 397
303 iso_pu_bacteria 2842045827 2842047059 397
304 iso_pu_bacteria 2844315083 2844318157 397
305 iso_pu_bacteria 2847939898 2847945585 397
306 iso_pu_bacteria 2849076700 2849080255 397
307 iso_pu_bacteria 2857509624 2857510381 397
308 iso_pu_bacteria 2857524615 2857528188 397
309 iso_pu_bacteria 2874590934 2874595288 397
310 iso_pu_bacteria 2874620515 2874626923 397
311 iso_pu_bacteria 2874628541 2874636506 397
312 iso_pu_bacteria 2874645413 2874651129 397
313 iso_pu_bacteria 2876761206 2876761264 397
314 iso_pu_bacteria 2876771140 2876775224 397
315 iso_pu_bacteria 2876818435 2876824039 397
316 iso_pu_bacteria 2879074833 2879080667 397
317 iso_pu_bacteria 2879099564 2879109473 397
318 iso_pu_bacteria 2879127579 2879134748 397
319 iso_pu_bacteria 2879142872 2879144208 397
320 iso_pu_bacteria 2881364244 2881366478 397
321 iso_pu_bacteria 2881665667 2881673031 397
322 iso_pu_bacteria 2885366525 2885373477 397
323 iso_pu_bacteria 2885374607 2885380285 397
324 iso_pu_bacteria 2885383462 2885391789 397
325 iso_pu_bacteria 2885409591 2885416711 397
326 iso_pu_bacteria 2888378607 2888383001 397
327 iso_pu_bacteria 2888388044 2888394828 397
328 iso_pu_bacteria 2888419890 2888423463 397
329 iso_pu_bacteria 2889033259 2889040848 397
330 iso_pu_bacteria 2893066018 2893068633 397
331 iso_pu_bacteria 2903727486 2903734140 397
332 iso_pu_bacteria 2903748898 2903752908 397
333 iso_pu_bacteria 2904666416 2904669624 397
334 iso_pu_bacteria 2904699407 2904701937 397
335 iso_pu_bacteria 2904711408 2904716887 397
336 iso_pu_bacteria 2906602504 2906608415 397
337 iso_pu_bacteria 2906626472 2906628123 397
338 iso_pu_bacteria 2906635258 2906636079 397
339 iso_pu_bacteria 2906660503 2906665786 397
340 iso_pu_bacteria 2908739725 2908743747 397
341 iso_pu_bacteria 2908775508 2908779149 397
342 iso_pu_bacteria 2919073203 2919075616 397
343 iso_pu_bacteria 2922361189 2922367940 397
344 iso_pu_bacteria 2922368715 2922373177 397
345 iso_pu_bacteria 2922386360 2922392171 397
346 iso_pu_bacteria 2922393267 2922395393 397
347 iso_pu_bacteria 2922425934 2922429122 397
348 iso_pu_bacteria 2929615660 2929615769 397
349 iso_pu_bacteria 2929624759 2929630382 397
350 iso_pu_bacteria 2932784394 2932792027 397
351 iso_pu_bacteria 2932794094 2932796261 397
352 iso_pu_bacteria 2932801729 2932804433 397
353 iso_pu_bacteria 2932809354 2932814106 397
354 iso_pu_bacteria 2932818245 2932819406 397
355 iso_pu_bacteria 2932828146 2932833885 397
356 iso_pu_bacteria 2933577622 2933578945 397
357 iso_pu_bacteria 2935608549 2935611528 397
358 iso_pu_bacteria 2935616580 2935618585 397
359 iso_pu_bacteria 2935630451 2935634288 397
360 iso_pu_bacteria 2935638405 2935644572 397
361 iso_pu_bacteria 2935648319 2935648902 397
362 iso_pu_bacteria 2935656913 2935657016 397
363 iso_pu_bacteria 2935665750 2935673537 397
364 iso_pu_bacteria 2935675223 2935678424 397
365 iso_pu_bacteria 2935684952 2935688147 397
366 iso_pu_bacteria 2935694250 2935698813 397
367 iso_pu_bacteria 2935703347 2935708429 397
368 iso_pu_bacteria 2935713505 2935715166 397
369 iso_pu_bacteria 2935722832 2935726269 397
370 iso_pu_bacteria 2935732158 2935733985 397
371 iso_pu_bacteria 2935741537 2935743364 397
372 iso_pu_bacteria 2935750917 2935754598 397
373 iso_pu_bacteria 2935760218 2935765377 397
374 iso_pu_bacteria 2935769743 2935777037 397
375 iso_pu_bacteria 2935777560 2935784111 397
376 iso_pu_bacteria 2935785616 2935790356 397
377 iso_pu_bacteria 2935793552 2935798939 397
378 iso_pu_bacteria 2935801545 2935805328 397
379 iso_pu_bacteria 2935810662 2935816626 397
380 iso_pu_bacteria 2935819856 2935821005 397
381 iso_pu_bacteria 2935827899 2935833679 397
382 iso_pu_bacteria 2935837841 2935839635 397
383 iso_pu_bacteria 2935847175 2935850735 397
384 iso_pu_bacteria 2935855204 2935856950 397
385 iso_pu_bacteria 2935864058 2935871221 397
386 iso_pu_bacteria 2935873716 2935876276 397
387 iso_pu_bacteria 2935883170 2935888845 397
388 iso_pu_bacteria 2935908558 2935913896 397
389 iso_pu_bacteria 2935916978 2935920114 397
390 iso_pu_bacteria 2935926038 2935930453 397
391 iso_pu_bacteria 2935934488 2935939574 397
392 iso_pu_bacteria 2935942939 2935946523 397
393 iso_pu_bacteria 2935951376 2935955638 397
394 iso_pu_bacteria 2935959822 2935964564 397
395 iso_pu_bacteria 2935967501 2935972652 397
396 iso_pu_bacteria 2935975950 2935981525 397
397 iso_pu_bacteria 2935984226 2935989083 397
398 iso_pu_bacteria 2935992306 2935997762 397
399 iso_pu_bacteria 2936002035 2936007274 397
400 iso_pu_bacteria 2936011229 2936011812 397
401 iso_pu_bacteria 2936019824 2936020407 397
402 iso_pu_bacteria 2936028420 2936029101 397
403 iso_pu_bacteria 2936037263 2936043112 397
404 iso_pu_bacteria 2936046547 2936047130 397
405 iso_pu_bacteria 2936055302 2936061360 397
406 iso_pu_bacteria 2940556831 2940560025 397
407 iso_pu_bacteria 2941507105 2941511178 397
408 iso_pu_bacteria 2941515067 2941518562 397
409 iso_pu_bacteria 2941523033 2941527175 397
410 iso_pu_bacteria 2941531003 2941533906 397
411 iso_pu_bacteria 2941538514 2941540324 397
412 iso_pu_bacteria 3005474847 3005479292 397
413 iso_pu_bacteria 3005483717 3005489997 397
414 iso_pu_bacteria 3005506211 3005507887 397
415 iso_pu_bacteria 3005587118 3005590312 397
416 iso_pu_bacteria 3005594810 3005598208 397
417 iso_pu_bacteria 3005710791 3005713924 397
418 iso_pu_bacteria 3005718088 3005721387 397
419 iso_pu_bacteria 8006933436 8006941855 397
420 iso_pu_bacteria 8006964411 8006971363 397
421 iso_pu_bacteria 8006973647 8006981604 397
422 iso_pu_bacteria 8006984368 8006990489 397
423 iso_pu_bacteria 8016511872 8016514544 397
424 iso_pu_bacteria 8016522445 8016530627 397
425 iso_pu_bacteria 8016557553 8016561424 397
426 iso_pu_bacteria 8016566248 8016574257 397
427 iso_pu_bacteria 8016575299 8016578356 397
428 iso_pu_bacteria 8016583857 8016591487 397
429 iso_pu_bacteria 8016595262 8016599273 397
430 iso_pu_bacteria 8016603502 8016611769 397
431 iso_pu_bacteria 8016613128 8016622033 397
432 iso_pu_bacteria 8016630954 8016632136 397
433 iso_pu_bacteria 8017057580 8017061882 397
434 iso_pu_bacteria 8019530166 8019535636 397
435 iso_pu_bacteria 8019538911 8019543846 397
436 iso_pu_bacteria 8019547302 8019554931 397
437 iso_pu_bacteria 8019555841 8019557768 397
438 iso_pu_bacteria 8019576017 8019581414 397
439 iso_pu_bacteria 8019608314 8019616370 397
440 iso_pu_bacteria 8019619141 8019627039 397
441 iso_pu_bacteria 8019638758 8019644199 397
442 iso_pu_bacteria 8019648815 8019657254 397
443 iso_pu_bacteria 8019659431 8019663314 397
444 iso_pu_bacteria 8019668869 8019672932 397
445 iso_pu_bacteria 8019678201 8019683209 397
446 iso_pu_bacteria 8019687851 8019688916 397
447 iso_pu_bacteria 8055742211 8055747416 397
448 iso_pu_bacteria 8056681323 8056684033 397
449 iso_pu_bacteria 8056967851 8056972513 397
450 3300005436 Ga0070713_100012520 Ga0070713_1000125202 398
451 3300005937 Ga0081455_10131209 Ga0081455_101312092 398
452 3300005983 Ga0081540_1008855 Ga0081540_10088558 398
453 3300006844 Ga0075428_100001309 Ga0075428_10000130913 398
454 3300006847 Ga0075431_100000481 Ga0075431_1000004812 398
455 3300006880 Ga0075429_100004176 Ga0075429_1000041767 398
456 3300009094 Ga0111539_10002444 Ga0111539_1000244424 398
457 3300009147 Ga0114129_10001244 Ga0114129_1000124433 398
458 3300025915 Ga0207693_10012619 Ga0207693_100126196 398
459 3300027512 Ga0209179_1002897 Ga0209179_10028972 398
460 3300027907 Ga0207428_10001178 Ga0207428_1000117819 398
461 3300028786 Ga0307517_10001070 Ga0307517_100010705 398
462 3300031711 Ga0265314_10126271 Ga0265314_101262711 398
463 3300031730 Ga0307516_10035156 Ga0307516_100351563 398
464 3300031730 Ga0307516_10039406 Ga0307516_100394062 398
465 3300046524 Ga0495648_0055892 Ga0495648_0055892_132_1553 398
466 3300047315 Ga0495581_0028348 Ga0495581_0028348_1008_2441 398
467 3300048917 Ga0496114_0138011 Ga0496114_0138011_98_1519 398
468 3300048929 Ga0496126_0003238 Ga0496126_0003238_16308_17735 398
469 3300050507 nmdc:mga05p37_332212_c1 nmdc:mga05p37_332212_c1_137_1555 398
470 3300050507 nmdc:mga05p37_528_c1 nmdc:mga05p37_528_c1_22021_23427 398
471 3300050508 nmdc:mga09592_704_c1 nmdc:mga09592_704_c1_5517_6923 398
472 3300050510 nmdc:mga06r32_1819_c1 nmdc:mga06r32_1819_c1_2789_4195 398
473 3300050511 nmdc:mga08y16_427_c1 nmdc:mga08y16_427_c1_22400_23806 398
474 3300005548 Ga0070665_100011311 Ga0070665_1000113116 399
475 3300010375 Ga0105239_10118417 Ga0105239_101184172 399
476 3300013104 Ga0157370_10208642 Ga0157370_102086421 399
477 3300013296 Ga0157374_10027530 Ga0157374_100275303 399
478 3300025912 Ga0207707_10027529 Ga0207707_100275294 399
479 3300028379 Ga0268266_10034792 Ga0268266_100347922 399
480 3300031250 Ga0265331_10059075 Ga0265331_100590752 399
481 3300044658 Ga0466972_0000206 Ga0466972_0000206_21996_23417 399
482 3300046507 Ga0495606_0005859 Ga0495606_0005859_7209_8633 399
483 3300046616 Ga0495668_0077050 Ga0495668_0077050_291_1733 399
484 3300048924 Ga0496121_0005105 Ga0496121_0005105_1141_2568 399
485 3300048929 Ga0496126_0111299 Ga0496126_0111299_535_1947 399
486 3300053091 Ga0500647_0021187 Ga0500647_0021187_955_2376 399
487 3300053105 Ga0500557_000001 Ga0500557_000001_186714_188135 399
488 3300053130 Ga0500642_0000077 Ga0500642_0000077_32832_34253 399
489 3300003203 JGI25406J46586_10000026 JGI25406J46586_1000002638 400
490 3300003215 JGI25153J46596_10004178 JGI25153J46596_100041782 400
491 3300005329 Ga0070683_100036193 Ga0070683_1000361933 400
492 3300005339 Ga0070660_100073729 Ga0070660_1000737292 400
493 3300005347 Ga0070668_100016411 Ga0070668_1000164114 400
494 3300005355 Ga0070671_100028726 Ga0070671_1000287262 400
495 3300005365 Ga0070688_100095027 Ga0070688_1000950272 400
496 3300005455 Ga0070663_100034481 Ga0070663_1000344814 400
497 3300005456 Ga0070678_100032005 Ga0070678_1000320053 400
498 3300005548 Ga0070665_100001701 Ga0070665_1000017013 400
499 3300005563 Ga0068855_100146670 Ga0068855_1001466702 400
500 3300005614 Ga0068856_100037003 Ga0068856_1000370034 400
501 3300005615 Ga0070702_100009142 Ga0070702_1000091423 400
502 3300005937 Ga0081455_10004867 Ga0081455_1000486711 400
503 3300005981 Ga0081538_10041851 Ga0081538_100418513 400
504 3300005983 Ga0081540_1007583 Ga0081540_10075833 400
505 3300005985 Ga0081539_10000140 Ga0081539_10000140158 400
506 3300006028 Ga0070717_10028456 Ga0070717_100284563 400
507 3300006038 Ga0075365_10000501 Ga0075365_1000050110 400
508 3300006038 Ga0075365_10022102 Ga0075365_100221021 400
509 3300006048 Ga0075363_100001550 Ga0075363_10000155011 400
510 3300006048 Ga0075363_100005187 Ga0075363_1000051874 400
511 3300006051 Ga0075364_10012257 Ga0075364_100122575 400
512 3300006051 Ga0075364_10021345 Ga0075364_100213452 400
513 3300006051 Ga0075364_10040499 Ga0075364_100404994 400
514 3300006051 Ga0075364_10133886 Ga0075364_101338862 400
515 3300006178 Ga0075367_10001628 Ga0075367_100016286 400
516 3300006178 Ga0075367_10018260 Ga0075367_100182603 400
517 3300006195 Ga0075366_10015409 Ga0075366_100154092 400
518 3300009093 Ga0105240_10153425 Ga0105240_101534252 400
519 3300009098 Ga0105245_10022065 Ga0105245_100220653 400
520 3300014968 Ga0157379_10147012 Ga0157379_101470121 400
521 3300014969 Ga0157376_10002196 Ga0157376_100021963 400
522 3300025230 Ga0209563_103109 Ga0209563_1031092 400
523 3300025253 Ga0209677_104466 Ga0209677_1044664 400
524 3300025295 Ga0209564_1011750 Ga0209564_10117503 400
525 3300025297 Ga0209758_1004633 Ga0209758_10046337 400
526 3300025903 Ga0207680_10095354 Ga0207680_100953541 400
527 3300025904 Ga0207647_10001716 Ga0207647_1000171619 400
528 3300025911 Ga0207654_10008431 Ga0207654_100084315 400
529 3300025914 Ga0207671_10032489 Ga0207671_100324893 400
530 3300025919 Ga0207657_10154476 Ga0207657_101544762 400
531 3300026067 Ga0207678_10047972 Ga0207678_100479723 400
532 3300026142 Ga0207698_10216343 Ga0207698_102163432 400
533 3300027866 Ga0209813_10019792 Ga0209813_100197922 400
534 3300028379 Ga0268266_10002227 Ga0268266_1000222721 400
535 3300028379 Ga0268266_10052050 Ga0268266_100520502 400
536 3300028379 Ga0268266_10155010 Ga0268266_101550102 400
537 3300031824 Ga0307413_10044697 Ga0307413_100446972 400
538 3300033180 Ga0307510_10043883 Ga0307510_100438835 400
539 3300033544 Ga0316215_1002160 Ga0316215_10021602 400
540 3300034820 Ga0373959_0007535 Ga0373959_0007535_14_1447 400
541 3300035085 Ga0373929_0012980 Ga0373929_0012980_52_1485 400
542 3300035695 Ga0373927_0031239 Ga0373927_0031239_1706_3127 400
543 3300035725 Ga0373947_0014079 Ga0373947_0014079_1802_3223 400
544 3300037418 Ga0395900_0000601 Ga0395900_0000601_29620_31041 400
545 3300038443 Ga0395901_0053569 Ga0395901_0053569_877_2298 400
546 3300046558 Ga0495633_0028152 Ga0495633_0028152_391_1824 400
547 3300046679 Ga0495623_0067875 Ga0495623_0067875_315_1751 400
548 3300047320 Ga0495672_0005547 Ga0495672_0005547_3100_4533 400
549 3300047320 Ga0495672_0018944 Ga0495672_0018944_1909_3330 400
550 3300048904 Ga0496101_0003025 Ga0496101_0003025_7138_8559 400
551 3300048906 Ga0496103_0020192 Ga0496103_0020192_681_2102 400
552 3300048908 Ga0496105_0016067 Ga0496105_0016067_2655_4076 400
553 3300048909 Ga0496106_0139181 Ga0496106_0139181_436_1869 400
554 3300048911 Ga0496108_0011933 Ga0496108_0011933_1948_3369 400
555 3300048911 Ga0496108_0072438 Ga0496108_0072438_1174_2607 400
556 3300048912 Ga0496109_0002448 Ga0496109_0002448_4450_5871 400
557 3300048914 Ga0496111_0019393 Ga0496111_0019393_1250_2671 400
558 3300048915 Ga0496112_0003189 Ga0496112_0003189_10288_11709 400
559 3300048915 Ga0496112_0046911 Ga0496112_0046911_1182_2603 400
560 3300048917 Ga0496114_0021145 Ga0496114_0021145_1465_2886 400
561 3300048918 Ga0496115_0007995 Ga0496115_0007995_48_1469 400
562 3300048919 Ga0496116_0004328 Ga0496116_0004328_5388_6818 400
563 3300048924 Ga0496121_0000616 Ga0496121_0000616_39123_40544 400
564 3300048927 Ga0496124_0164896 Ga0496124_0164896_97_1527 400
565 3300048928 Ga0496125_0036601 Ga0496125_0036601_2608_4038 400
566 3300048929 Ga0496126_0208345 Ga0496126_0208345_19_1446 400
567 3300050490 nmdc:mga03n38_6679_c1 nmdc:mga03n38_6679_c1_1736_3169 400
568 3300050491 nmdc:mga00v17_6414_c2 nmdc:mga00v17_6414_c2_930_2360 400
569 3300050492 nmdc:mga0yw44_13867_c1 nmdc:mga0yw44_13867_c1_1797_3227 400
570 3300053086 Ga0500578_0126885 Ga0500578_0126885_67_1500 400
571 3300053096 Ga0500641_0002087 Ga0500641_0002087_2969_4402 400
572 3300053119 Ga0500595_007948 Ga0500595_007948_342_1763 400
573 3300053119 Ga0500595_017615 Ga0500595_017615_920_2347 400
574 3300053130 Ga0500642_0023665 Ga0500642_0023665_50_1483 400
575 3300053139 Ga0500568_0004711 Ga0500568_0004711_291_1712 400
576 3300001979 JGI24740J21852_10002137 JGI24740J21852_100021376 401
577 3300003794 Ga0055531_10006158 Ga0055531_100061586 401
578 3300005262 Ga0065165_1000676 Ga0065165_100067621 401
579 3300005262 Ga0065165_1004302 Ga0065165_10043023 401
580 3300005329 Ga0070683_100049586 Ga0070683_1000495864 401
581 3300005336 Ga0070680_100108465 Ga0070680_1001084651 401
582 3300005339 Ga0070660_100011169 Ga0070660_1000111694 401
583 3300005347 Ga0070668_100018846 Ga0070668_1000188462 401
584 3300005434 Ga0070709_10000449 Ga0070709_1000044923 401
585 3300005435 Ga0070714_100005397 Ga0070714_1000053974 401
586 3300005436 Ga0070713_100081030 Ga0070713_1000810301 401
587 3300005437 Ga0070710_10000080 Ga0070710_1000008022 401
588 3300005439 Ga0070711_100002916 Ga0070711_10000291613 401
589 3300005455 Ga0070663_100016650 Ga0070663_1000166502 401
590 3300005455 Ga0070663_100162708 Ga0070663_1001627081 401
591 3300005458 Ga0070681_10038494 Ga0070681_100384945 401
592 3300005530 Ga0070679_100061981 Ga0070679_1000619813 401
593 3300005535 Ga0070684_100009926 Ga0070684_1000099266 401
594 3300005535 Ga0070684_100020540 Ga0070684_1000205405 401
595 3300005539 Ga0068853_100023072 Ga0068853_1000230723 401
596 3300005539 Ga0068853_100028496 Ga0068853_1000284962 401
597 3300005544 Ga0070686_100022536 Ga0070686_1000225361 401
598 3300005563 Ga0068855_100024197 Ga0068855_1000241974 401
599 3300005563 Ga0068855_100061078 Ga0068855_1000610783 401
600 3300005563 Ga0068855_100202044 Ga0068855_1002020442 401
601 3300005564 Ga0070664_100115014 Ga0070664_1001150141 401
602 3300005577 Ga0068857_100025654 Ga0068857_1000256544 401
603 3300005577 Ga0068857_100084756 Ga0068857_1000847562 401
604 3300005578 Ga0068854_100020160 Ga0068854_1000201603 401
605 3300005614 Ga0068856_100007962 Ga0068856_1000079623 401
606 3300005616 Ga0068852_100038374 Ga0068852_1000383743 401
607 3300005719 Ga0068861_100148545 Ga0068861_1001485452 401
608 3300005834 Ga0068851_10001148 Ga0068851_100011488 401
609 3300005983 Ga0081540_1000565 Ga0081540_100056522 401
610 3300006173 Ga0070716_100003205 Ga0070716_1000032056 401
611 3300006942 Ga0099824_1014350 Ga0099824_10143505 401
612 3300006942 Ga0099824_1027789 Ga0099824_10277891 401
613 3300006943 Ga0099822_1015994 Ga0099822_10159942 401
614 3300009093 Ga0105240_10028194 Ga0105240_100281948 401
615 3300009093 Ga0105240_10036147 Ga0105240_100361475 401
616 3300009101 Ga0105247_10014265 Ga0105247_100142651 401
617 3300009101 Ga0105247_10126371 Ga0105247_101263711 401
618 3300009148 Ga0105243_10110300 Ga0105243_101103002 401
619 3300009174 Ga0105241_10004323 Ga0105241_100043233 401
620 3300009176 Ga0105242_10073447 Ga0105242_100734471 401
621 3300009545 Ga0105237_10011062 Ga0105237_100110625 401
622 3300009545 Ga0105237_10047580 Ga0105237_100475803 401
623 3300009551 Ga0105238_10011154 Ga0105238_100111549 401
624 3300009551 Ga0105238_10021238 Ga0105238_100212382 401
625 3300009551 Ga0105238_10025526 Ga0105238_100255262 401
626 3300010375 Ga0105239_10003480 Ga0105239_100034803 401
627 3300010375 Ga0105239_10084754 Ga0105239_100847544 401
628 3300013104 Ga0157370_10040094 Ga0157370_100400944 401
629 3300013104 Ga0157370_10045350 Ga0157370_100453502 401
630 3300013104 Ga0157370_10114184 Ga0157370_101141842 401
631 3300013105 Ga0157369_10006143 Ga0157369_100061434 401
632 3300013105 Ga0157369_10007826 Ga0157369_100078265 401
633 3300013105 Ga0157369_10042037 Ga0157369_100420377 401
634 3300013297 Ga0157378_10003347 Ga0157378_1000334713 401
635 3300013297 Ga0157378_10096739 Ga0157378_100967392 401
636 3300013308 Ga0157375_10112031 Ga0157375_101120311 401
637 3300021320 Ga0214544_1005900 Ga0214544_100590028 401
638 3300021321 Ga0214542_1000002 Ga0214542_1000002408 401
639 3300021324 Ga0214545_1000002 Ga0214545_1000002312 401
640 3300021327 Ga0214543_1000013 Ga0214543_100001310 401
641 3300021384 Ga0213876_10002558 Ga0213876_1000255813 401
642 3300025254 Ga0209148_1002077 Ga0209148_10020774 401
643 3300025272 Ga0209455_1002461 Ga0209455_10024612 401
644 3300025272 Ga0209455_1003127 Ga0209455_10031273 401
645 3300025295 Ga0209564_1011460 Ga0209564_10114603 401
646 3300025297 Ga0209758_1000100 Ga0209758_1000100220 401
647 3300025297 Ga0209758_1000138 Ga0209758_1000138128 401
648 3300025297 Ga0209758_1001346 Ga0209758_100134621 401
649 3300025302 Ga0207426_1000575 Ga0207426_100057520 401
650 3300025302 Ga0207426_1011857 Ga0207426_10118573 401
651 3300025304 Ga0209257_1002068 Ga0209257_100206825 401
652 3300025315 Ga0207697_10046903 Ga0207697_100469032 401
653 3300025321 Ga0207656_10028559 Ga0207656_100285592 401
654 3300025898 Ga0207692_10001336 Ga0207692_100013368 401
655 3300025906 Ga0207699_10000664 Ga0207699_100006643 401
656 3300025906 Ga0207699_10023020 Ga0207699_100230203 401
657 3300025907 Ga0207645_10139343 Ga0207645_101393431 401
658 3300025912 Ga0207707_10001819 Ga0207707_100018192 401
659 3300025912 Ga0207707_10035918 Ga0207707_100359184 401
660 3300025913 Ga0207695_10000883 Ga0207695_1000088316 401
661 3300025913 Ga0207695_10024523 Ga0207695_100245232 401
662 3300025914 Ga0207671_10085135 Ga0207671_100851352 401
663 3300025916 Ga0207663_10074620 Ga0207663_100746201 401
664 3300025917 Ga0207660_10060137 Ga0207660_100601372 401
665 3300025917 Ga0207660_10108926 Ga0207660_101089262 401
666 3300025919 Ga0207657_10032851 Ga0207657_100328512 401
667 3300025920 Ga0207649_10015585 Ga0207649_100155852 401
668 3300025921 Ga0207652_10056483 Ga0207652_100564833 401
669 3300025922 Ga0207646_10124224 Ga0207646_101242242 401
670 3300025924 Ga0207694_10000436 Ga0207694_1000043611 401
671 3300025924 Ga0207694_10012321 Ga0207694_100123218 401
672 3300025924 Ga0207694_10057660 Ga0207694_100576603 401
673 3300025933 Ga0207706_10011445 Ga0207706_100114453 401
674 3300025934 Ga0207686_10089188 Ga0207686_100891882 401
675 3300025937 Ga0207669_10050729 Ga0207669_100507291 401
676 3300025938 Ga0207704_10160824 Ga0207704_101608241 401
677 3300025939 Ga0207665_10005731 Ga0207665_100057316 401
678 3300025944 Ga0207661_10005117 Ga0207661_100051175 401
679 3300025949 Ga0207667_10022504 Ga0207667_100225047 401
680 3300025949 Ga0207667_10029290 Ga0207667_100292907 401
681 3300025949 Ga0207667_10032844 Ga0207667_100328444 401
682 3300025949 Ga0207667_10161717 Ga0207667_101617172 401
683 3300025961 Ga0207712_10163361 Ga0207712_101633611 401
684 3300025981 Ga0207640_10012053 Ga0207640_100120534 401
685 3300025981 Ga0207640_10085324 Ga0207640_100853242 401
686 3300026041 Ga0207639_10049883 Ga0207639_100498834 401
687 3300026067 Ga0207678_10187027 Ga0207678_101870271 401
688 3300026078 Ga0207702_10000005 Ga0207702_10000005123 401
689 3300026078 Ga0207702_10126676 Ga0207702_101266762 401
690 3300026116 Ga0207674_10020453 Ga0207674_100204535 401
691 3300026116 Ga0207674_10049929 Ga0207674_100499293 401
692 3300026116 Ga0207674_10064122 Ga0207674_100641222 401
693 3300026118 Ga0207675_100078766 Ga0207675_1000787663 401
694 3300026142 Ga0207698_10015737 Ga0207698_100157372 401
695 3300027296 Ga0209389_1000094 Ga0209389_10000944 401
696 3300027296 Ga0209389_1000189 Ga0209389_10001892 401
697 3300027357 Ga0209589_1000030 Ga0209589_100003057 401
698 3300027357 Ga0209589_1000845 Ga0209589_10008452 401
699 3300027361 Ga0209489_100056 Ga0209489_10005657 401
700 3300027361 Ga0209489_101612 Ga0209489_1016122 401
701 3300027361 Ga0209489_110925 Ga0209489_11092511 401
702 3300027363 Ga0209700_100059 Ga0209700_10005957 401
703 3300027363 Ga0209700_100374 Ga0209700_1003745 401
704 3300031235 Ga0265330_10022333 Ga0265330_100223332 401
705 3300031235 Ga0265330_10036168 Ga0265330_100361682 401
706 3300031247 Ga0265340_10005613 Ga0265340_100056134 401
707 3300033180 Ga0307510_10055257 Ga0307510_100552572 401
708 3300033180 Ga0307510_10091352 Ga0307510_100913523 401
709 3300033442 Ga0315911_1000020 Ga0315911_100002058 401
710 3300035083 Ga0373926_0006349 Ga0373926_0006349_2090_3511 401
711 3300035086 Ga0373934_0001625 Ga0373934_0001625_5387_6805 401
712 3300035092 Ga0373952_0010315 Ga0373952_0010315_88_1770 401
713 3300035111 Ga0373923_0000728 Ga0373923_0000728_152_1570 401
714 3300035111 Ga0373923_0014602 Ga0373923_0014602_1385_2806 401
715 3300035117 Ga0373953_0001784 Ga0373953_0001784_1671_3089 401
716 3300035117 Ga0373953_0005032 Ga0373953_0005032_1747_3168 401
717 3300035118 Ga0373954_0012962 Ga0373954_0012962_1222_2643 401
718 3300035119 Ga0373956_0005702 Ga0373956_0005702_141_1559 401
719 3300035119 Ga0373956_0026766 Ga0373956_0026766_142_1563 401
720 3300035120 Ga0373957_0000700 Ga0373957_0000700_6586_8004 401
721 3300035172 Ga0373955_0000682 Ga0373955_0000682_11539_12957 401
722 3300035410 Ga0373924_0002550 Ga0373924_0002550_4031_5449 401
723 3300035692 Ga0373935_0037039 Ga0373935_0037039_610_2028 401
724 3300035692 Ga0373935_0080551 Ga0373935_0080551_20_1441 401
725 3300035695 Ga0373927_0025245 Ga0373927_0025245_275_1696 401
726 3300035724 Ga0373933_0002551 Ga0373933_0002551_7153_8571 401
727 3300035724 Ga0373933_0033581 Ga0373933_0033581_1067_2488 401
728 3300035725 Ga0373947_0053457 Ga0373947_0053457_992_2413 401
729 3300037068 Ga0373925_0122281 Ga0373925_0122281_534_1955 401
730 3300037418 Ga0395900_0062773 Ga0395900_0062773_2145_3566 401
731 3300038443 Ga0395901_0100710 Ga0395901_0100710_1224_2645 401
732 3300039437 Ga0436365_0871323 Ga0436365_0871323_44536_45957 401
733 3300046455 Ga0495603_0013682 Ga0495603_0013682_996_2417 401
734 3300046459 Ga0495629_0000450 Ga0495629_0000450_22609_24027 401
735 3300046459 Ga0495629_0103888 Ga0495629_0103888_540_1961 401
736 3300046462 Ga0495651_0003667 Ga0495651_0003667_1200_2618 401
737 3300046462 Ga0495651_0038481 Ga0495651_0038481_178_1599 401
738 3300046463 Ga0495653_0001326 Ga0495653_0001326_7255_8673 401
739 3300046472 Ga0495580_0004175 Ga0495580_0004175_693_2114 401
740 3300046472 Ga0495580_0091584 Ga0495580_0091584_250_1671 401
741 3300046473 Ga0495582_0014658 Ga0495582_0014658_2171_3592 401
742 3300046475 Ga0495639_0006594 Ga0495639_0006594_1471_2892 401
743 3300046476 Ga0495662_0053759 Ga0495662_0053759_175_1596 401
744 3300046511 Ga0495608_0000519 Ga0495608_0000519_1784_3202 401
745 3300046516 Ga0495628_0084298 Ga0495628_0084298_869_2290 401
746 3300046517 Ga0495630_0078635 Ga0495630_0078635_720_2141 401
747 3300046523 Ga0495644_0028199 Ga0495644_0028199_569_2005 401
748 3300046529 Ga0495652_0105929 Ga0495652_0105929_201_1622 401
749 3300046529 Ga0495652_0139817 Ga0495652_0139817_114_1535 401
750 3300046531 Ga0495665_0006975 Ga0495665_0006975_2249_3670 401
751 3300046535 Ga0495586_0064243 Ga0495586_0064243_567_1988 401
752 3300046536 Ga0495587_0010165 Ga0495587_0010165_534_1955 401
753 3300046543 Ga0495645_0027571 Ga0495645_0027571_2295_3713 401
754 3300046543 Ga0495645_0106070 Ga0495645_0106070_412_1833 401
755 3300046559 Ga0495667_0022688 Ga0495667_0022688_572_1990 401
756 3300046559 Ga0495667_0047031 Ga0495667_0047031_1304_2725 401
757 3300046642 Ga0495634_0023795 Ga0495634_0023795_2064_3485 401
758 3300046642 Ga0495634_0029860 Ga0495634_0029860_2066_3484 401
759 3300046648 Ga0495611_0011021 Ga0495611_0011021_2165_3586 401
760 3300046663 Ga0495635_0000949 Ga0495635_0000949_15464_16882 401
761 3300046663 Ga0495635_0028172 Ga0495635_0028172_899_2320 401
762 3300046675 Ga0495657_0026545 Ga0495657_0026545_444_1862 401
763 3300046675 Ga0495657_0040214 Ga0495657_0040214_1220_2641 401
764 3300046678 Ga0495599_0001298 Ga0495599_0001298_9545_10963 401
765 3300046679 Ga0495623_0004108 Ga0495623_0004108_1200_2618 401
766 3300046680 Ga0495646_0053097 Ga0495646_0053097_638_2059 401
767 3300046681 Ga0495647_0001492 Ga0495647_0001492_4838_6259 401
768 3300046683 Ga0495658_0009441 Ga0495658_0009441_403_1824 401
769 3300046684 Ga0495669_0004566 Ga0495669_0004566_4027_5463 401
770 3300046689 Ga0495613_0088406 Ga0495613_0088406_236_1657 401
771 3300046690 Ga0495624_0073887 Ga0495624_0073887_244_1665 401
772 3300046809 Ga0495600_0025985 Ga0495600_0025985_1854_3275 401
773 3300046809 Ga0495600_0140416 Ga0495600_0140416_136_1554 401
774 3300047317 Ga0495604_0002058 Ga0495604_0002058_1562_2980 401
775 3300047317 Ga0495604_0052524 Ga0495604_0052524_1074_2495 401
776 3300047319 Ga0495674_0004477 Ga0495674_0004477_8172_9593 401
777 3300047321 Ga0495676_0127008 Ga0495676_0127008_358_1779 401
778 3300047322 Ga0495680_0000314 Ga0495680_0000314_12258_13676 401
779 3300047322 Ga0495680_0035823 Ga0495680_0035823_156_1577 401
780 3300047444 Ga0495675_0069520 Ga0495675_0069520_22_1440 401
781 3300047444 Ga0495675_0076651 Ga0495675_0076651_556_1977 401
782 3300047471 Ga0495684_0015304 Ga0495684_0015304_1820_3241 401
783 3300047673 Ga0495593_0007958 Ga0495593_0007958_449_1870 401
784 3300047673 Ga0495593_0013821 Ga0495593_0013821_2525_3943 401
785 3300048905 Ga0496102_0212867 Ga0496102_0212867_217_1638 401
786 3300048911 Ga0496108_0000464 Ga0496108_0000464_13490_14911 401
787 3300048912 Ga0496109_0002389 Ga0496109_0002389_12932_14353 401
788 3300048912 Ga0496109_0133502 Ga0496109_0133502_411_1832 401
789 3300048914 Ga0496111_0029699 Ga0496111_0029699_1633_3054 401
790 3300048915 Ga0496112_0000004 Ga0496112_0000004_131579_133009 401
791 3300048918 Ga0496115_0034257 Ga0496115_0034257_2259_3680 401
792 3300048924 Ga0496121_0000902 Ga0496121_0000902_19863_21290 401
793 3300048924 Ga0496121_0028377 Ga0496121_0028377_3126_4562 401
794 3300048929 Ga0496126_0010498 Ga0496126_0010498_4471_5898 401
795 3300048929 Ga0496126_0015017 Ga0496126_0015017_2915_4336 401
796 3300050492 nmdc:mga0yw44_16799_c1 nmdc:mga0yw44_16799_c1_1380_2801 401
797 3300050511 nmdc:mga08y16_97546_c1 nmdc:mga08y16_97546_c1_833_2269 401
798 3300053077 Ga0495601_0084926 Ga0495601_0084926_572_1990 401
799 3300053080 Ga0500635_0001559 Ga0500635_0001559_2552_3973 401
800 3300053084 Ga0495595_0000602 Ga0495595_0000602_676_2094 401
801 3300053085 Ga0495619_0002618 Ga0495619_0002618_572_1990 401
802 3300053087 Ga0500643_000114 Ga0500643_000114_80161_81582 401
803 3300053094 Ga0500566_0012626 Ga0500566_0012626_1364_2785 401
804 3300053119 Ga0500595_003362 Ga0500595_003362_856_2280 401
805 3300053131 Ga0500652_054228 Ga0500652_054228_59_1480 401
806 3300053136 Ga0500559_0000205 Ga0500559_0000205_36308_37729 401
807 3300053150 Ga0500603_001043 Ga0500603_001043_3202_4623 401
808 3300053153 Ga0500616_0004067 Ga0500616_0004067_7656_9083 401
809 3300053162 Ga0500638_003387 Ga0500638_003387_3365_4789 401
810 3300053163 Ga0500639_019770 Ga0500639_019770_1882_3303 401
811 3300053178 Ga0500637_0016041 Ga0500637_0016041_1714_3135 401
812 3300055283 Ga0500661_000462 Ga0500661_000462_3564_4988 401

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03448

MgtE_N

MgtE intracellular N domain

56

157

0.99

PF01769

MgtE

Divalent cation transporter

343

466

0.98

PF00571

CBS

CBS domain

227

279

0.9

Feature Viewer

pLDDT pTM Quality
71.45 0.4 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map