F481914
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 812 | 543 | 587 | 432 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2721755755|2723845983 |
| Length | 474 |
| Sequence | IDVAQAAEAGPGQGSVLDHLLMRDEEGQLRREFVEEIARAIHAADRPLLCEVVAELHEADLGDLIAALEPEDRVTLVEITGTDFDFSALNEVDDAVREEILEELEPETVAEGVRELESDDAVQLLQGLDEEDQEEILEKLPPPERVAIERVLLYPENSAGRRMQTEFIAVPPDWTVGQAIDYMRDTPDLPDRFYEIYAVDSEQHWQGAVSLDTLLRARRPVPLVDLIEEDRRRVSVLDDQEEVARMFGKYNLVAAPVVDTTNRLVGVITIDDVVDVIEEEADEDLKALGGVTSDEELSDNVWTIARGRFNWLLVNLATAFLASSVLGLFEGQLEKMVALAVLAPIVASQGGNAATQTMTVAVRALATRELGSNNAFRVVMREAMVGLVNGLAFAVITGVAAVAWFKIPGLGVVIGLAIICNLVAGALGGILIPMVLERVRADPAVASGTFVTTITDVVGFFSFLGIATLWFGLK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 5 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 6 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 7 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 8 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 9 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 10 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 11 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 12 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 13 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 14 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 15 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 16 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 17 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 18 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 19 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 20 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 21 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 22 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 23 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 24 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 25 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 26 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 27 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 28 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 29 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 30 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 31 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 32 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 33 | 2791355199 | |||
| 34 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 35 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 36 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 37 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 38 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 39 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 40 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 41 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 42 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 43 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 44 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 45 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 46 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 47 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 48 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 49 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 50 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 51 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 52 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 53 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 54 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 55 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 56 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 57 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 58 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 59 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 60 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 61 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 62 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 63 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 64 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 65 | 2842694124 | Methylopila sp. R-72369 | Isolate | Unclassified |
| 66 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 67 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 68 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 69 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 70 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 71 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 72 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 73 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 74 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 75 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 76 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 77 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 78 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 79 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 80 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 81 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 82 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 83 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 84 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 85 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 86 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 87 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 88 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 89 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 90 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 91 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 92 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 93 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 94 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 95 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 96 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 97 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 98 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 99 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 100 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 101 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 102 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 103 | 2904699407 | |||
| 104 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 105 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 106 | 2906610324 | |||
| 107 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 108 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 109 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 110 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 111 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 112 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 113 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 114 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 115 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 116 | 2922368715 | |||
| 117 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 118 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 119 | 2922425934 | |||
| 120 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 121 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 122 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 123 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 124 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 125 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 126 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 127 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 128 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 129 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 130 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 131 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 132 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 133 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 134 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 135 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 136 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 137 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 138 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 139 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 140 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 141 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 142 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 143 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 144 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 145 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 146 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 147 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 148 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 149 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 150 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 151 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 152 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 153 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 154 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 155 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 156 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 157 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 158 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 159 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 160 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 161 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 162 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 163 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 164 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 165 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 166 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 167 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 168 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 169 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 170 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 171 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 172 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 173 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 174 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 175 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 176 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 177 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 178 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 179 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 180 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 181 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 182 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 183 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 184 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 185 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 186 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 187 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 188 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 189 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 190 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 191 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 192 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 193 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 194 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 195 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 196 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 197 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 198 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 199 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 200 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 201 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 202 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 203 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 204 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 205 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 206 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 207 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 208 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 209 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 210 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 211 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 212 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 213 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 214 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 215 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 216 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 217 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 218 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 219 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 220 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 221 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 222 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 223 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 224 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 225 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 226 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 227 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 228 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 229 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 230 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 231 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 232 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 233 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 234 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 235 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 236 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 237 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 238 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 239 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 240 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 241 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 242 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 243 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 244 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 245 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 247 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 248 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 249 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 250 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 251 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 252 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 253 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 254 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 256 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 257 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 259 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 260 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 261 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 262 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 263 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 264 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 265 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 266 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 267 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 268 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 269 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 270 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 271 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 272 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 273 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 274 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 275 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 276 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 277 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 278 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 279 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 280 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 281 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 282 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 283 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 284 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 285 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 286 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 287 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 288 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 289 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 290 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 291 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 292 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 293 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 294 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 295 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 296 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 297 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 298 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 299 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 300 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 301 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 302 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 303 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 304 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 305 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 306 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 307 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 308 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 309 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 310 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 311 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 312 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 313 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 314 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 315 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 316 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 317 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 318 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 319 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 320 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 321 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 322 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 323 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 324 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 325 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 326 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 327 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 328 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 329 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 330 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 331 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 332 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 333 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 334 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 335 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 336 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 337 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 338 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 339 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 340 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 341 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 342 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 343 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 344 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 345 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 346 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 347 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 348 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 349 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 350 | 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Metagenome | Unclassified |
| 351 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 352 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 353 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 354 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 355 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 356 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 357 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 358 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 359 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 360 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 361 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 362 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 363 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 364 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 365 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 366 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 367 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 368 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 369 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 370 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 371 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 372 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 373 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 374 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 375 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 376 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 377 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 378 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 379 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 380 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 381 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 433 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 434 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 435 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 436 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 437 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 438 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 439 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 440 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 441 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 442 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 443 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 444 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 445 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 446 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 447 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 448 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 449 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 450 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 451 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 452 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 453 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 454 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 455 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 456 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 457 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 458 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 459 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 460 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 461 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 462 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 463 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 464 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 465 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 466 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 467 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 468 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 469 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 470 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 471 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 472 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 473 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 474 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 475 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 476 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 477 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 478 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 479 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 480 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 481 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 482 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 483 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 484 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 485 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 486 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 487 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 488 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 489 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 490 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 491 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 492 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 493 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 494 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 495 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 496 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 497 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 498 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 499 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 500 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 501 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 502 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 503 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 504 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 505 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 506 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 507 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 508 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 509 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 510 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 511 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 512 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 513 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 514 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 515 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 516 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 517 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 518 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 519 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 520 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 521 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 522 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 523 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 524 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 525 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 526 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 527 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 528 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 529 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 530 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 531 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 532 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 533 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 534 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 535 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 536 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 537 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 538 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 539 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 540 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 541 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 542 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 543 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 72.74 |
| Metatranscriptomes | 0 |
| Isolates | 27.26 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 13.05 |
| Nodule | 21.67 |
| Rhizoplane | 4.56 |
| Rhizosphere | 45.94 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 14.78 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10002137 | 3300001979 | Bacteria | 9028 |
| 2 | JGI24737J22298_10002974 | 3300001990 | Bacteria | 6006 |
| 3 | JGI24735J21928_10016183 | 3300002067 | Bacteria | 2319 |
| 4 | JGI25406J46586_10000026 | 3300003203 | Bacteria | 70727 |
| 5 | JGI25406J46586_10006773 | 3300003203 | Bacteria | 5263 |
| 6 | JGI25165J46597_1005476 | 3300003214 | Bacteria | 2435 |
| 7 | JGI25153J46596_10000985 | 3300003215 | Bacteria | 17294 |
| 8 | JGI25153J46596_10004178 | 3300003215 | Bacteria | 7834 |
| 9 | JGI25153J46596_10005451 | 3300003215 | Bacteria | 6677 |
| 10 | JGI25160J50197_1000471 | 3300003354 | Bacteria | 24649 |
| 11 | JGI25160J50197_1000905 | 3300003354 | Bacteria | 15612 |
| 12 | JGI25160J50197_1009760 | 3300003354 | Bacteria | 3528 |
| 13 | JGI25404J52841_10003281 | 3300003659 | Bacteria | 3180 |
| 14 | Ga0055531_10006158 | 3300003794 | Bacteria | 6862 |
| 15 | Ga0065165_1000676 | 3300005262 | Bacteria | 49091 |
| 16 | Ga0065165_1001028 | 3300005262 | Bacteria | 33815 |
| 17 | Ga0065165_1004302 | 3300005262 | Bacteria | 8962 |
| 18 | Ga0070658_10080165 | 3300005327 | Bacteria | 2681 |
| 19 | Ga0070683_100036193 | 3300005329 | Bacteria | 4516 |
| 20 | Ga0070683_100049586 | 3300005329 | Bacteria | 3884 |
| 21 | Ga0070680_100108465 | 3300005336 | Bacteria | 2310 |
| 22 | Ga0070680_100183432 | 3300005336 | Bacteria | 1763 |
| 23 | Ga0070660_100011169 | 3300005339 | Bacteria | 6372 |
| 24 | Ga0070660_100073729 | 3300005339 | Bacteria | 2669 |
| 25 | Ga0070668_100016411 | 3300005347 | Bacteria | 5536 |
| 26 | Ga0070668_100018846 | 3300005347 | Bacteria | 5184 |
| 27 | Ga0070671_100028726 | 3300005355 | Bacteria | 4582 |
| 28 | Ga0070688_100095027 | 3300005365 | Bacteria | 1955 |
| 29 | Ga0070659_100018101 | 3300005366 | Bacteria | 5312 |
| 30 | Ga0070709_10000449 | 3300005434 | Bacteria | 24812 |
| 31 | Ga0070714_100005397 | 3300005435 | Bacteria | 9758 |
| 32 | Ga0070714_100031171 | 3300005435 | Bacteria | 4446 |
| 33 | Ga0070713_100012520 | 3300005436 | Bacteria | 6226 |
| 34 | Ga0070713_100024226 | 3300005436 | Bacteria | 4724 |
| 35 | Ga0070713_100081030 | 3300005436 | Bacteria | 2769 |
| 36 | Ga0070713_100105498 | 3300005436 | Bacteria | 2448 |
| 37 | Ga0070710_10000080 | 3300005437 | Bacteria | 43770 |
| 38 | Ga0070710_10007237 | 3300005437 | Bacteria | 5364 |
| 39 | Ga0070710_10033559 | 3300005437 | Bacteria | 2788 |
| 40 | Ga0070711_100002916 | 3300005439 | Bacteria | 9857 |
| 41 | Ga0070663_100016650 | 3300005455 | Bacteria | 4781 |
| 42 | Ga0070663_100034481 | 3300005455 | Bacteria | 3505 |
| 43 | Ga0070663_100162708 | 3300005455 | Bacteria | 1719 |
| 44 | Ga0070678_100014660 | 3300005456 | Bacteria | 4954 |
| 45 | Ga0070678_100032005 | 3300005456 | Bacteria | 3635 |
| 46 | Ga0070662_100042111 | 3300005457 | Bacteria | 3261 |
| 47 | Ga0070681_10038494 | 3300005458 | Bacteria | 4795 |
| 48 | Ga0070681_10073038 | 3300005458 | Bacteria | 3392 |
| 49 | Ga0070679_100061981 | 3300005530 | Bacteria | 3727 |
| 50 | Ga0070684_100009926 | 3300005535 | Bacteria | 7525 |
| 51 | Ga0070684_100020540 | 3300005535 | Bacteria | 5478 |
| 52 | Ga0068853_100023072 | 3300005539 | Bacteria | 5206 |
| 53 | Ga0068853_100028496 | 3300005539 | Bacteria | 4698 |
| 54 | Ga0070686_100022536 | 3300005544 | Bacteria | 3752 |
| 55 | Ga0070665_100001701 | 3300005548 | Bacteria | 25284 |
| 56 | Ga0070665_100005911 | 3300005548 | Bacteria | 12536 |
| 57 | Ga0070665_100011311 | 3300005548 | Bacteria | 9027 |
| 58 | Ga0068855_100024197 | 3300005563 | Bacteria | 7269 |
| 59 | Ga0068855_100061078 | 3300005563 | Bacteria | 4404 |
| 60 | Ga0068855_100146670 | 3300005563 | Bacteria | 2686 |
| 61 | Ga0068855_100202044 | 3300005563 | Bacteria | 2237 |
| 62 | Ga0070664_100114009 | 3300005564 | Bacteria | 2361 |
| 63 | Ga0070664_100115014 | 3300005564 | Bacteria | 2351 |
| 64 | Ga0068857_100025654 | 3300005577 | Bacteria | 5189 |
| 65 | Ga0068857_100084756 | 3300005577 | Bacteria | 2832 |
| 66 | Ga0068854_100020160 | 3300005578 | Bacteria | 4505 |
| 67 | Ga0068854_100148899 | 3300005578 | Bacteria | 1803 |
| 68 | Ga0068856_100003013 | 3300005614 | Bacteria | 17245 |
| 69 | Ga0068856_100007962 | 3300005614 | Bacteria | 10350 |
| 70 | Ga0068856_100037003 | 3300005614 | Bacteria | 4787 |
| 71 | Ga0070702_100009142 | 3300005615 | Bacteria | 4836 |
| 72 | Ga0068852_100024478 | 3300005616 | Bacteria | 4880 |
| 73 | Ga0068852_100038374 | 3300005616 | Bacteria | 4025 |
| 74 | Ga0068861_100148545 | 3300005719 | Bacteria | 1920 |
| 75 | Ga0068851_10001148 | 3300005834 | Bacteria | 11480 |
| 76 | Ga0068860_100000149 | 3300005843 | Bacteria | 113068 |
| 77 | Ga0081455_10004867 | 3300005937 | Bacteria | 14894 |
| 78 | Ga0081455_10034642 | 3300005937 | Bacteria | 4522 |
| 79 | Ga0081455_10062521 | 3300005937 | Bacteria | 3129 |
| 80 | Ga0081455_10131209 | 3300005937 | Bacteria | 1959 |
| 81 | Ga0081538_10022152 | 3300005981 | Bacteria | 4613 |
| 82 | Ga0081538_10041851 | 3300005981 | Bacteria | 2901 |
| 83 | Ga0081540_1000565 | 3300005983 | Bacteria | 35910 |
| 84 | Ga0081540_1001009 | 3300005983 | Bacteria | 25255 |
| 85 | Ga0081540_1001804 | 3300005983 | Bacteria | 17954 |
| 86 | Ga0081540_1007583 | 3300005983 | Bacteria | 7708 |
| 87 | Ga0081540_1008855 | 3300005983 | Bacteria | 6988 |
| 88 | Ga0081540_1041827 | 3300005983 | Bacteria | 2371 |
| 89 | Ga0081539_10000140 | 3300005985 | Bacteria | 166746 |
| 90 | Ga0081539_10001416 | 3300005985 | Bacteria | 41282 |
| 91 | Ga0081539_10077832 | 3300005985 | Bacteria | 1753 |
| 92 | Ga0070717_10002484 | 3300006028 | Bacteria | 13019 |
| 93 | Ga0070717_10028456 | 3300006028 | Bacteria | 4475 |
| 94 | Ga0070717_10113211 | 3300006028 | Bacteria | 2316 |
| 95 | Ga0075365_10000501 | 3300006038 | Bacteria | 14880 |
| 96 | Ga0075365_10022102 | 3300006038 | Bacteria | 3980 |
| 97 | Ga0075363_100001550 | 3300006048 | Bacteria | 8815 |
| 98 | Ga0075363_100005187 | 3300006048 | Bacteria | 5769 |
| 99 | Ga0075364_10012257 | 3300006051 | Bacteria | 5242 |
| 100 | Ga0075364_10021345 | 3300006051 | Bacteria | 4080 |
| 101 | Ga0075364_10040499 | 3300006051 | Bacteria | 3022 |
| 102 | Ga0075364_10133886 | 3300006051 | Bacteria | 1665 |
| 103 | Ga0070715_10004402 | 3300006163 | Bacteria | 4618 |
| 104 | Ga0070716_100003205 | 3300006173 | Bacteria | 7672 |
| 105 | Ga0070716_100024388 | 3300006173 | Bacteria | 3219 |
| 106 | Ga0075367_10001628 | 3300006178 | Bacteria | 9761 |
| 107 | Ga0075367_10018260 | 3300006178 | Bacteria | 3866 |
| 108 | Ga0075366_10015409 | 3300006195 | Bacteria | 4381 |
| 109 | Ga0097621_100252534 | 3300006237 | Bacteria | 1544 |
| 110 | Ga0075370_10106471 | 3300006353 | Bacteria | 1626 |
| 111 | Ga0075428_100001309 | 3300006844 | Bacteria | 26388 |
| 112 | Ga0075431_100000481 | 3300006847 | Bacteria | 33062 |
| 113 | Ga0075434_100067965 | 3300006871 | Bacteria | 3550 |
| 114 | Ga0075429_100004176 | 3300006880 | Bacteria | 12367 |
| 115 | Ga0099824_1014350 | 3300006942 | Bacteria | 7895 |
| 116 | Ga0099824_1027789 | 3300006942 | Bacteria | 2672 |
| 117 | Ga0099822_1015994 | 3300006943 | Bacteria | 8332 |
| 118 | Ga0105240_10028194 | 3300009093 | Bacteria | 7338 |
| 119 | Ga0105240_10036147 | 3300009093 | Bacteria | 6356 |
| 120 | Ga0105240_10074624 | 3300009093 | Bacteria | 4185 |
| 121 | Ga0105240_10153425 | 3300009093 | Bacteria | 2741 |
| 122 | Ga0111539_10002444 | 3300009094 | Bacteria | 24696 |
| 123 | Ga0105245_10022065 | 3300009098 | Bacteria | 5588 |
| 124 | Ga0105247_10014265 | 3300009101 | Bacteria | 4769 |
| 125 | Ga0105247_10126371 | 3300009101 | Bacteria | 1662 |
| 126 | Ga0114129_10001244 | 3300009147 | Bacteria | 33939 |
| 127 | Ga0105243_10110300 | 3300009148 | Bacteria | 2300 |
| 128 | Ga0105241_10004323 | 3300009174 | Bacteria | 10508 |
| 129 | Ga0105242_10032961 | 3300009176 | Bacteria | 4145 |
| 130 | Ga0105242_10073447 | 3300009176 | Bacteria | 2844 |
| 131 | Ga0105237_10009290 | 3300009545 | Bacteria | 10534 |
| 132 | Ga0105237_10011062 | 3300009545 | Bacteria | 9567 |
| 133 | Ga0105237_10047580 | 3300009545 | Bacteria | 4312 |
| 134 | Ga0105237_10062127 | 3300009545 | Bacteria | 3734 |
| 135 | Ga0105237_10079494 | 3300009545 | Bacteria | 3269 |
| 136 | Ga0105238_10011154 | 3300009551 | Bacteria | 9038 |
| 137 | Ga0105238_10011212 | 3300009551 | Bacteria | 9017 |
| 138 | Ga0105238_10021238 | 3300009551 | Bacteria | 6615 |
| 139 | Ga0105238_10025526 | 3300009551 | Bacteria | 6024 |
| 140 | Ga0099796_10000263 | 3300010159 | Bacteria | 8331 |
| 141 | Ga0105239_10003480 | 3300010375 | Bacteria | 19264 |
| 142 | Ga0105239_10011760 | 3300010375 | Bacteria | 9770 |
| 143 | Ga0105239_10065770 | 3300010375 | Bacteria | 3983 |
| 144 | Ga0105239_10084754 | 3300010375 | Bacteria | 3491 |
| 145 | Ga0105239_10094674 | 3300010375 | Bacteria | 3299 |
| 146 | Ga0105239_10118417 | 3300010375 | Bacteria | 2939 |
| 147 | Ga0157371_10146057 | 3300013102 | Bacteria | 1685 |
| 148 | Ga0157370_10040094 | 3300013104 | Bacteria | 4521 |
| 149 | Ga0157370_10045350 | 3300013104 | Bacteria | 4218 |
| 150 | Ga0157370_10114184 | 3300013104 | Bacteria | 2523 |
| 151 | Ga0157370_10208642 | 3300013104 | Bacteria | 1811 |
| 152 | Ga0157369_10002568 | 3300013105 | Bacteria | 21726 |
| 153 | Ga0157369_10006143 | 3300013105 | Bacteria | 13941 |
| 154 | Ga0157369_10007826 | 3300013105 | Bacteria | 12301 |
| 155 | Ga0157369_10042037 | 3300013105 | Bacteria | 4987 |
| 156 | Ga0157374_10027530 | 3300013296 | Bacteria | 5131 |
| 157 | Ga0157378_10003347 | 3300013297 | Bacteria | 14261 |
| 158 | Ga0157378_10096739 | 3300013297 | Bacteria | 2690 |
| 159 | Ga0157375_10112031 | 3300013308 | Bacteria | 2828 |
| 160 | Ga0157379_10147012 | 3300014968 | Bacteria | 2126 |
| 161 | Ga0157376_10002196 | 3300014969 | Bacteria | 13158 |
| 162 | Ga0214544_1005900 | 3300021320 | Bacteria | 23196 |
| 163 | Ga0214542_1000002 | 3300021321 | Bacteria | 720798 |
| 164 | Ga0214545_1000002 | 3300021324 | Bacteria | 727485 |
| 165 | Ga0214543_1000013 | 3300021327 | Bacteria | 329117 |
| 166 | Ga0213876_10002558 | 3300021384 | Bacteria | 10644 |
| 167 | Ga0213875_10000089 | 3300021388 | Bacteria | 105772 |
| 168 | Ga0209563_103109 | 3300025230 | Bacteria | 3515 |
| 169 | Ga0209677_100317 | 3300025253 | Bacteria | 31458 |
| 170 | Ga0209677_104466 | 3300025253 | Bacteria | 4021 |
| 171 | Ga0209148_1002077 | 3300025254 | Bacteria | 7657 |
| 172 | Ga0209233_1001148 | 3300025261 | Bacteria | 10790 |
| 173 | Ga0209455_1002461 | 3300025272 | Bacteria | 7133 |
| 174 | Ga0209455_1003127 | 3300025272 | Bacteria | 6029 |
| 175 | Ga0209564_1001156 | 3300025295 | Bacteria | 30779 |
| 176 | Ga0209564_1011460 | 3300025295 | Bacteria | 3970 |
| 177 | Ga0209564_1011750 | 3300025295 | Bacteria | 3889 |
| 178 | Ga0209758_1000100 | 3300025297 | Bacteria | 227948 |
| 179 | Ga0209758_1000138 | 3300025297 | Bacteria | 175187 |
| 180 | Ga0209758_1001091 | 3300025297 | Bacteria | 35146 |
| 181 | Ga0209758_1001346 | 3300025297 | Bacteria | 29651 |
| 182 | Ga0209758_1004633 | 3300025297 | Bacteria | 11268 |
| 183 | Ga0209758_1004795 | 3300025297 | Bacteria | 10934 |
| 184 | Ga0207426_1000575 | 3300025302 | Bacteria | 49342 |
| 185 | Ga0207426_1000611 | 3300025302 | Bacteria | 46127 |
| 186 | Ga0207426_1003097 | 3300025302 | Bacteria | 9505 |
| 187 | Ga0207426_1011857 | 3300025302 | Bacteria | 3298 |
| 188 | Ga0209257_1002068 | 3300025304 | Bacteria | 21183 |
| 189 | Ga0207697_10046903 | 3300025315 | Bacteria | 1780 |
| 190 | Ga0207656_10028559 | 3300025321 | Bacteria | 2290 |
| 191 | Ga0207692_10001336 | 3300025898 | Bacteria | 9193 |
| 192 | Ga0207692_10031465 | 3300025898 | Bacteria | 2542 |
| 193 | Ga0207680_10095354 | 3300025903 | Bacteria | 1901 |
| 194 | Ga0207647_10001716 | 3300025904 | Bacteria | 16822 |
| 195 | Ga0207647_10002180 | 3300025904 | Bacteria | 14930 |
| 196 | Ga0207699_10000664 | 3300025906 | Bacteria | 16532 |
| 197 | Ga0207699_10023020 | 3300025906 | Bacteria | 3385 |
| 198 | Ga0207645_10139343 | 3300025907 | Bacteria | 1580 |
| 199 | Ga0207654_10008431 | 3300025911 | Bacteria | 5210 |
| 200 | Ga0207707_10001819 | 3300025912 | Bacteria | 19559 |
| 201 | Ga0207707_10027529 | 3300025912 | Bacteria | 4971 |
| 202 | Ga0207707_10035918 | 3300025912 | Bacteria | 4333 |
| 203 | Ga0207707_10056163 | 3300025912 | Bacteria | 3425 |
| 204 | Ga0207707_10125546 | 3300025912 | Bacteria | 2244 |
| 205 | Ga0207695_10000883 | 3300025913 | Bacteria | 54495 |
| 206 | Ga0207695_10024523 | 3300025913 | Bacteria | 6781 |
| 207 | Ga0207695_10094686 | 3300025913 | Bacteria | 2993 |
| 208 | Ga0207671_10030544 | 3300025914 | Bacteria | 4018 |
| 209 | Ga0207671_10032489 | 3300025914 | Bacteria | 3885 |
| 210 | Ga0207671_10085135 | 3300025914 | Bacteria | 2375 |
| 211 | Ga0207671_10143460 | 3300025914 | Bacteria | 1841 |
| 212 | Ga0207693_10012619 | 3300025915 | Bacteria | 6827 |
| 213 | Ga0207693_10062417 | 3300025915 | Bacteria | 2919 |
| 214 | Ga0207663_10074620 | 3300025916 | Bacteria | 2198 |
| 215 | Ga0207660_10060137 | 3300025917 | Bacteria | 2730 |
| 216 | Ga0207660_10107581 | 3300025917 | Bacteria | 2093 |
| 217 | Ga0207660_10108926 | 3300025917 | Bacteria | 2081 |
| 218 | Ga0207657_10032851 | 3300025919 | Bacteria | 4683 |
| 219 | Ga0207657_10154476 | 3300025919 | Bacteria | 1867 |
| 220 | Ga0207649_10015585 | 3300025920 | Bacteria | 4269 |
| 221 | Ga0207652_10056483 | 3300025921 | Bacteria | 3379 |
| 222 | Ga0207646_10124224 | 3300025922 | Bacteria | 2320 |
| 223 | Ga0207694_10000436 | 3300025924 | Bacteria | 38791 |
| 224 | Ga0207694_10012321 | 3300025924 | Bacteria | 6447 |
| 225 | Ga0207694_10057660 | 3300025924 | Bacteria | 3019 |
| 226 | Ga0207700_10018027 | 3300025928 | Bacteria | 4731 |
| 227 | Ga0207700_10076545 | 3300025928 | Bacteria | 2596 |
| 228 | Ga0207700_10100452 | 3300025928 | Bacteria | 2306 |
| 229 | Ga0207664_10013089 | 3300025929 | Bacteria | 5947 |
| 230 | Ga0207706_10011445 | 3300025933 | Bacteria | 8081 |
| 231 | Ga0207686_10089188 | 3300025934 | Bacteria | 2032 |
| 232 | Ga0207669_10050729 | 3300025937 | Bacteria | 2482 |
| 233 | Ga0207704_10160824 | 3300025938 | Bacteria | 1598 |
| 234 | Ga0207665_10005731 | 3300025939 | Bacteria | 8269 |
| 235 | Ga0207665_10036936 | 3300025939 | Bacteria | 3250 |
| 236 | Ga0207665_10101381 | 3300025939 | Bacteria | 2010 |
| 237 | Ga0207661_10005117 | 3300025944 | Bacteria | 9206 |
| 238 | Ga0207667_10022504 | 3300025949 | Bacteria | 6960 |
| 239 | Ga0207667_10029290 | 3300025949 | Bacteria | 5972 |
| 240 | Ga0207667_10032844 | 3300025949 | Bacteria | 5586 |
| 241 | Ga0207667_10053024 | 3300025949 | Bacteria | 4268 |
| 242 | Ga0207667_10161717 | 3300025949 | Bacteria | 2303 |
| 243 | Ga0207712_10163361 | 3300025961 | Bacteria | 1733 |
| 244 | Ga0207640_10012053 | 3300025981 | Bacteria | 4914 |
| 245 | Ga0207640_10085324 | 3300025981 | Bacteria | 2171 |
| 246 | Ga0207639_10049883 | 3300026041 | Bacteria | 3176 |
| 247 | Ga0207639_10086285 | 3300026041 | Bacteria | 2499 |
| 248 | Ga0207678_10047972 | 3300026067 | Bacteria | 3692 |
| 249 | Ga0207678_10187027 | 3300026067 | Bacteria | 1769 |
| 250 | Ga0207702_10000005 | 3300026078 | Bacteria | 420296 |
| 251 | Ga0207702_10000365 | 3300026078 | Bacteria | 51814 |
| 252 | Ga0207702_10070046 | 3300026078 | Bacteria | 3016 |
| 253 | Ga0207702_10126676 | 3300026078 | Bacteria | 2294 |
| 254 | Ga0207674_10020453 | 3300026116 | Bacteria | 7150 |
| 255 | Ga0207674_10022794 | 3300026116 | Bacteria | 6719 |
| 256 | Ga0207674_10049929 | 3300026116 | Bacteria | 4276 |
| 257 | Ga0207674_10064122 | 3300026116 | Bacteria | 3706 |
| 258 | Ga0207675_100078766 | 3300026118 | Bacteria | 3088 |
| 259 | Ga0207683_10046767 | 3300026121 | Bacteria | 3788 |
| 260 | Ga0207683_10071290 | 3300026121 | Bacteria | 3071 |
| 261 | Ga0207683_10147718 | 3300026121 | Bacteria | 2121 |
| 262 | Ga0207698_10015737 | 3300026142 | Bacteria | 5077 |
| 263 | Ga0207698_10044750 | 3300026142 | Bacteria | 3329 |
| 264 | Ga0207698_10216343 | 3300026142 | Bacteria | 1728 |
| 265 | Ga0207698_10267413 | 3300026142 | Bacteria | 1574 |
| 266 | Ga0209389_1000094 | 3300027296 | Bacteria | 80555 |
| 267 | Ga0209389_1000189 | 3300027296 | Bacteria | 46457 |
| 268 | Ga0209589_1000030 | 3300027357 | Bacteria | 147457 |
| 269 | Ga0209589_1000845 | 3300027357 | Bacteria | 46457 |
| 270 | Ga0209489_100056 | 3300027361 | Bacteria | 147457 |
| 271 | Ga0209489_101612 | 3300027361 | Bacteria | 46456 |
| 272 | Ga0209489_110925 | 3300027361 | Bacteria | 9734 |
| 273 | Ga0209700_100059 | 3300027363 | Bacteria | 147457 |
| 274 | Ga0209700_100374 | 3300027363 | Bacteria | 81273 |
| 275 | Ga0209179_1002897 | 3300027512 | Bacteria | 2394 |
| 276 | Ga0209813_10019792 | 3300027866 | Bacteria | 1876 |
| 277 | Ga0207428_10001178 | 3300027907 | Bacteria | 28140 |
| 278 | Ga0268266_10002227 | 3300028379 | Bacteria | 21177 |
| 279 | Ga0268266_10034792 | 3300028379 | Bacteria | 4285 |
| 280 | Ga0268266_10052050 | 3300028379 | Bacteria | 3515 |
| 281 | Ga0268266_10155010 | 3300028379 | Bacteria | 2068 |
| 282 | Ga0268264_10000084 | 3300028381 | Bacteria | 242128 |
| 283 | Ga0265334_10017182 | 3300028573 | Bacteria | 2992 |
| 284 | Ga0265323_10009250 | 3300028653 | Bacteria | 4032 |
| 285 | Ga0265336_10003221 | 3300028666 | Bacteria | 6474 |
| 286 | Ga0307517_10001070 | 3300028786 | Bacteria | 46406 |
| 287 | Ga0265338_10000306 | 3300028800 | Bacteria | 88631 |
| 288 | Ga0307511_10046287 | 3300030521 | Bacteria | 3580 |
| 289 | Ga0265330_10022333 | 3300031235 | Bacteria | 2879 |
| 290 | Ga0265330_10036168 | 3300031235 | Bacteria | 2201 |
| 291 | Ga0265340_10005613 | 3300031247 | Bacteria | 6952 |
| 292 | Ga0265331_10059075 | 3300031250 | Bacteria | 1814 |
| 293 | Ga0307509_10227595 | 3300031507 | Bacteria | 1671 |
| 294 | Ga0265314_10126271 | 3300031711 | Bacteria | 1602 |
| 295 | Ga0307516_10019104 | 3300031730 | Bacteria | 7105 |
| 296 | Ga0307516_10035156 | 3300031730 | Bacteria | 5029 |
| 297 | Ga0307516_10039406 | 3300031730 | Bacteria | 4710 |
| 298 | Ga0307413_10044697 | 3300031824 | Bacteria | 2620 |
| 299 | Ga0307507_10046137 | 3300033179 | Bacteria | 4276 |
| 300 | Ga0307510_10043883 | 3300033180 | Bacteria | 4853 |
| 301 | Ga0307510_10055257 | 3300033180 | Bacteria | 4149 |
| 302 | Ga0307510_10091352 | 3300033180 | Bacteria | 2887 |
| 303 | Ga0315911_1000020 | 3300033442 | Bacteria | 139809 |
| 304 | Ga0316215_1002160 | 3300033544 | Bacteria | 1859 |
| 305 | Ga0373959_0007535 | 3300034820 | Bacteria | 1832 |
| 306 | Ga0373926_0006349 | 3300035083 | Bacteria | 3925 |
| 307 | Ga0373929_0012980 | 3300035085 | Bacteria | 1591 |
| 308 | Ga0373934_0001625 | 3300035086 | Bacteria | 8244 |
| 309 | Ga0373952_0010315 | 3300035092 | Unclassified | 1803 |
| 310 | Ga0373923_0000728 | 3300035111 | Bacteria | 8477 |
| 311 | Ga0373923_0014602 | 3300035111 | Bacteria | 2953 |
| 312 | Ga0373953_0001784 | 3300035117 | Bacteria | 6357 |
| 313 | Ga0373953_0005032 | 3300035117 | Bacteria | 4260 |
| 314 | Ga0373954_0012962 | 3300035118 | Bacteria | 3712 |
| 315 | Ga0373956_0005702 | 3300035119 | Bacteria | 4978 |
| 316 | Ga0373956_0026766 | 3300035119 | Bacteria | 2500 |
| 317 | Ga0373957_0000700 | 3300035120 | Bacteria | 8682 |
| 318 | Ga0373960_0027339 | 3300035121 | Bacteria | 1566 |
| 319 | Ga0373955_0000682 | 3300035172 | Bacteria | 14514 |
| 320 | Ga0373955_0032561 | 3300035172 | Bacteria | 2737 |
| 321 | Ga0373924_0002550 | 3300035410 | Bacteria | 6148 |
| 322 | Ga0373931_0003895 | 3300035691 | Bacteria | 6750 |
| 323 | Ga0373935_0013240 | 3300035692 | Bacteria | 4975 |
| 324 | Ga0373935_0037039 | 3300035692 | Bacteria | 3052 |
| 325 | Ga0373935_0080551 | 3300035692 | Bacteria | 2115 |
| 326 | Ga0373927_0022562 | 3300035695 | Bacteria | 4123 |
| 327 | Ga0373927_0025245 | 3300035695 | Bacteria | 3884 |
| 328 | Ga0373927_0031239 | 3300035695 | Bacteria | 3472 |
| 329 | Ga0373927_0108354 | 3300035695 | Bacteria | 1809 |
| 330 | Ga0373933_0000276 | 3300035724 | Bacteria | 33468 |
| 331 | Ga0373933_0002551 | 3300035724 | Bacteria | 10216 |
| 332 | Ga0373933_0033581 | 3300035724 | Bacteria | 2985 |
| 333 | Ga0373947_0014079 | 3300035725 | Bacteria | 4585 |
| 334 | Ga0373947_0053457 | 3300035725 | Bacteria | 2435 |
| 335 | Ga0373937_0205402 | 3300036401 | Bacteria | 1852 |
| 336 | Ga0373925_0020120 | 3300037068 | Bacteria | 4857 |
| 337 | Ga0373925_0122281 | 3300037068 | Bacteria | 2021 |
| 338 | Ga0373925_0192576 | 3300037068 | Bacteria | 1618 |
| 339 | Ga0373925_0195652 | 3300037068 | Bacteria | 1606 |
| 340 | Ga0395900_0000601 | 3300037418 | Bacteria | 49219 |
| 341 | Ga0395900_0062773 | 3300037418 | Bacteria | 3819 |
| 342 | Ga0395898_0204433 | 3300037466 | Bacteria | 1885 |
| 343 | Ga0395905_0003686 | 3300037471 | Bacteria | 16219 |
| 344 | Ga0436364_0571570 | 3300037853 | Bacteria | 2326 |
| 345 | Ga0436364_0768079 | 3300037853 | Bacteria | 31728 |
| 346 | Ga0395901_0053569 | 3300038443 | Bacteria | 4192 |
| 347 | Ga0395901_0100710 | 3300038443 | Bacteria | 3031 |
| 348 | Ga0395901_0103703 | 3300038443 | Bacteria | 2984 |
| 349 | Ga0436365_0871323 | 3300039437 | Bacteria | 58014 |
| 350 | Ga0436365_1157755 | 3300039437 | Bacteria | 2049 |
| 351 | Ga0436365_1461999 | 3300039437 | Bacteria | 6432 |
| 352 | Ga0436365_1867827 | 3300039437 | Bacteria | 2196 |
| 353 | Ga0466972_0000206 | 3300044658 | Bacteria | 42982 |
| 354 | Ga0466961_0000082 | 3300044693 | Bacteria | 59328 |
| 355 | Ga0466963_0044837 | 3300044694 | Bacteria | 2911 |
| 356 | Ga0466959_0008199 | 3300045049 | Bacteria | 7372 |
| 357 | Ga0495603_0010909 | 3300046455 | Bacteria | 5512 |
| 358 | Ga0495603_0013008 | 3300046455 | Bacteria | 5031 |
| 359 | Ga0495603_0013682 | 3300046455 | Bacteria | 4909 |
| 360 | Ga0495629_0000450 | 3300046459 | Bacteria | 34200 |
| 361 | Ga0495629_0001771 | 3300046459 | Bacteria | 16939 |
| 362 | Ga0495629_0103888 | 3300046459 | Bacteria | 1982 |
| 363 | Ga0495638_0003230 | 3300046460 | Bacteria | 12885 |
| 364 | Ga0495651_0003667 | 3300046462 | Bacteria | 11763 |
| 365 | Ga0495651_0024660 | 3300046462 | Bacteria | 4679 |
| 366 | Ga0495651_0038481 | 3300046462 | Bacteria | 3724 |
| 367 | Ga0495653_0001326 | 3300046463 | Bacteria | 19200 |
| 368 | Ga0495580_0004175 | 3300046472 | Bacteria | 12153 |
| 369 | Ga0495580_0091584 | 3300046472 | Bacteria | 2116 |
| 370 | Ga0495580_0096750 | 3300046472 | Bacteria | 2053 |
| 371 | Ga0495582_0014658 | 3300046473 | Bacteria | 4307 |
| 372 | Ga0495639_0006594 | 3300046475 | Bacteria | 4993 |
| 373 | Ga0495662_0053759 | 3300046476 | Bacteria | 1945 |
| 374 | Ga0495594_0060186 | 3300046499 | Bacteria | 2100 |
| 375 | Ga0495606_0005859 | 3300046507 | Bacteria | 11583 |
| 376 | Ga0495606_0006244 | 3300046507 | Bacteria | 11061 |
| 377 | Ga0495608_0000519 | 3300046511 | Bacteria | 26476 |
| 378 | Ga0495608_0086977 | 3300046511 | Bacteria | 2025 |
| 379 | Ga0495610_0020870 | 3300046512 | Bacteria | 3621 |
| 380 | Ga0495610_0039694 | 3300046512 | Bacteria | 2378 |
| 381 | Ga0495616_0055620 | 3300046513 | Bacteria | 1958 |
| 382 | Ga0495628_0084298 | 3300046516 | Bacteria | 2466 |
| 383 | Ga0495630_0078635 | 3300046517 | Bacteria | 2487 |
| 384 | Ga0495643_0004362 | 3300046522 | Bacteria | 9919 |
| 385 | Ga0495644_0028199 | 3300046523 | Bacteria | 2125 |
| 386 | Ga0495648_0004756 | 3300046524 | Bacteria | 11492 |
| 387 | Ga0495648_0055892 | 3300046524 | Bacteria | 2377 |
| 388 | Ga0495652_0105929 | 3300046529 | Bacteria | 2271 |
| 389 | Ga0495652_0139817 | 3300046529 | Bacteria | 1905 |
| 390 | Ga0495665_0006975 | 3300046531 | Bacteria | 6093 |
| 391 | Ga0495586_0064243 | 3300046535 | Bacteria | 2000 |
| 392 | Ga0495587_0010165 | 3300046536 | Bacteria | 6003 |
| 393 | Ga0495645_0027571 | 3300046543 | Bacteria | 4127 |
| 394 | Ga0495645_0106070 | 3300046543 | Bacteria | 1993 |
| 395 | Ga0495633_0028152 | 3300046558 | Bacteria | 2741 |
| 396 | Ga0495667_0022688 | 3300046559 | Bacteria | 4228 |
| 397 | Ga0495667_0047031 | 3300046559 | Bacteria | 2851 |
| 398 | Ga0495668_0037587 | 3300046616 | Bacteria | 2709 |
| 399 | Ga0495668_0077050 | 3300046616 | Bacteria | 1831 |
| 400 | Ga0495634_0023795 | 3300046642 | Bacteria | 4303 |
| 401 | Ga0495634_0029860 | 3300046642 | Bacteria | 3770 |
| 402 | Ga0495611_0011021 | 3300046648 | Bacteria | 3829 |
| 403 | Ga0495635_0000949 | 3300046663 | Bacteria | 19120 |
| 404 | Ga0495635_0002315 | 3300046663 | Bacteria | 12949 |
| 405 | Ga0495635_0028172 | 3300046663 | Bacteria | 3904 |
| 406 | Ga0495588_0081907 | 3300046674 | Bacteria | 1685 |
| 407 | Ga0495657_0026545 | 3300046675 | Bacteria | 4100 |
| 408 | Ga0495657_0040214 | 3300046675 | Bacteria | 3209 |
| 409 | Ga0495599_0001298 | 3300046678 | Bacteria | 14185 |
| 410 | Ga0495623_0004108 | 3300046679 | Bacteria | 9593 |
| 411 | Ga0495623_0067875 | 3300046679 | Bacteria | 2225 |
| 412 | Ga0495646_0053097 | 3300046680 | Bacteria | 2445 |
| 413 | Ga0495647_0001492 | 3300046681 | Bacteria | 7260 |
| 414 | Ga0495658_0009441 | 3300046683 | Bacteria | 4863 |
| 415 | Ga0495669_0004566 | 3300046684 | Bacteria | 5731 |
| 416 | Ga0495613_0088406 | 3300046689 | Bacteria | 2245 |
| 417 | Ga0495624_0073887 | 3300046690 | Bacteria | 2119 |
| 418 | Ga0495600_0025985 | 3300046809 | Bacteria | 3776 |
| 419 | Ga0495600_0028790 | 3300046809 | Bacteria | 3595 |
| 420 | Ga0495600_0140416 | 3300046809 | Bacteria | 1567 |
| 421 | Ga0495581_0028348 | 3300047315 | Bacteria | 3246 |
| 422 | Ga0495581_0125207 | 3300047315 | Bacteria | 1496 |
| 423 | Ga0495604_0002058 | 3300047317 | Bacteria | 16236 |
| 424 | Ga0495604_0052524 | 3300047317 | Bacteria | 3155 |
| 425 | Ga0495604_0096684 | 3300047317 | Bacteria | 2178 |
| 426 | Ga0495674_0004477 | 3300047319 | Bacteria | 13445 |
| 427 | Ga0495672_0005547 | 3300047320 | Bacteria | 9981 |
| 428 | Ga0495672_0017919 | 3300047320 | Bacteria | 4722 |
| 429 | Ga0495672_0018944 | 3300047320 | Bacteria | 4554 |
| 430 | Ga0495676_0050331 | 3300047321 | Bacteria | 3342 |
| 431 | Ga0495676_0127008 | 3300047321 | Bacteria | 1847 |
| 432 | Ga0495680_0000314 | 3300047322 | Bacteria | 54452 |
| 433 | Ga0495680_0035823 | 3300047322 | Bacteria | 3991 |
| 434 | Ga0495687_004018 | 3300047443 | Bacteria | 10214 |
| 435 | Ga0495675_0069520 | 3300047444 | Bacteria | 2223 |
| 436 | Ga0495675_0076651 | 3300047444 | Bacteria | 2107 |
| 437 | Ga0495684_0015304 | 3300047471 | Bacteria | 5908 |
| 438 | Ga0495593_0007958 | 3300047673 | Bacteria | 6175 |
| 439 | Ga0495593_0013821 | 3300047673 | Bacteria | 4598 |
| 440 | Ga0496100_0041695 | 3300048903 | Bacteria | 2928 |
| 441 | Ga0496101_0003025 | 3300048904 | Bacteria | 10368 |
| 442 | Ga0496101_0036310 | 3300048904 | Bacteria | 3490 |
| 443 | Ga0496102_0212867 | 3300048905 | Bacteria | 1822 |
| 444 | Ga0496103_0020192 | 3300048906 | Bacteria | 4001 |
| 445 | Ga0496103_0030869 | 3300048906 | Bacteria | 3262 |
| 446 | Ga0496104_0000871 | 3300048907 | Bacteria | 25996 |
| 447 | Ga0496104_0054348 | 3300048907 | Bacteria | 3785 |
| 448 | Ga0496105_0000692 | 3300048908 | Bacteria | 22697 |
| 449 | Ga0496105_0016067 | 3300048908 | Bacteria | 5972 |
| 450 | Ga0496105_0090051 | 3300048908 | Bacteria | 2534 |
| 451 | Ga0496105_0122039 | 3300048908 | Bacteria | 2148 |
| 452 | Ga0496105_0259542 | 3300048908 | Bacteria | 1405 |
| 453 | Ga0496106_0000664 | 3300048909 | Bacteria | 24642 |
| 454 | Ga0496106_0061398 | 3300048909 | Bacteria | 2851 |
| 455 | Ga0496106_0139181 | 3300048909 | Bacteria | 1908 |
| 456 | Ga0496107_0028502 | 3300048910 | Bacteria | 3968 |
| 457 | Ga0496108_0000464 | 3300048911 | Bacteria | 32517 |
| 458 | Ga0496108_0011933 | 3300048911 | Bacteria | 7068 |
| 459 | Ga0496108_0072438 | 3300048911 | Bacteria | 2908 |
| 460 | Ga0496108_0096499 | 3300048911 | Bacteria | 2518 |
| 461 | Ga0496109_0002389 | 3300048912 | Bacteria | 15696 |
| 462 | Ga0496109_0002448 | 3300048912 | Bacteria | 15545 |
| 463 | Ga0496109_0133502 | 3300048912 | Bacteria | 2318 |
| 464 | Ga0496110_0013700 | 3300048913 | Bacteria | 6717 |
| 465 | Ga0496111_0019393 | 3300048914 | Bacteria | 4722 |
| 466 | Ga0496111_0029699 | 3300048914 | Bacteria | 3884 |
| 467 | Ga0496112_0000004 | 3300048915 | Bacteria | 553294 |
| 468 | Ga0496112_0003189 | 3300048915 | Bacteria | 13489 |
| 469 | Ga0496112_0046911 | 3300048915 | Bacteria | 4238 |
| 470 | Ga0496114_0021145 | 3300048917 | Bacteria | 5291 |
| 471 | Ga0496114_0036871 | 3300048917 | Bacteria | 4041 |
| 472 | Ga0496114_0138011 | 3300048917 | Bacteria | 2109 |
| 473 | Ga0496115_0007995 | 3300048918 | Bacteria | 7806 |
| 474 | Ga0496115_0034257 | 3300048918 | Bacteria | 4013 |
| 475 | Ga0496116_0004328 | 3300048919 | Bacteria | 13582 |
| 476 | Ga0496116_0016391 | 3300048919 | Bacteria | 5799 |
| 477 | Ga0496117_0034299 | 3300048920 | Bacteria | 3825 |
| 478 | Ga0496118_0027054 | 3300048921 | Bacteria | 4864 |
| 479 | Ga0496118_0056890 | 3300048921 | Bacteria | 2936 |
| 480 | Ga0496119_0007355 | 3300048922 | Bacteria | 9952 |
| 481 | Ga0496119_0039898 | 3300048922 | Bacteria | 3012 |
| 482 | Ga0496120_0011482 | 3300048923 | Bacteria | 6088 |
| 483 | Ga0496120_0034063 | 3300048923 | Bacteria | 3055 |
| 484 | Ga0496121_0000077 | 3300048924 | Bacteria | 235293 |
| 485 | Ga0496121_0000616 | 3300048924 | Bacteria | 66339 |
| 486 | Ga0496121_0000902 | 3300048924 | Bacteria | 53572 |
| 487 | Ga0496121_0005105 | 3300048924 | Bacteria | 17110 |
| 488 | Ga0496121_0005157 | 3300048924 | Bacteria | 16971 |
| 489 | Ga0496121_0028377 | 3300048924 | Bacteria | 5210 |
| 490 | Ga0496121_0030084 | 3300048924 | Bacteria | 4998 |
| 491 | Ga0496121_0144038 | 3300048924 | Bacteria | 1763 |
| 492 | Ga0496122_0026245 | 3300048925 | Bacteria | 5029 |
| 493 | Ga0496123_0008882 | 3300048926 | Bacteria | 9145 |
| 494 | Ga0496124_0006148 | 3300048927 | Bacteria | 13170 |
| 495 | Ga0496124_0058370 | 3300048927 | Bacteria | 3246 |
| 496 | Ga0496124_0164896 | 3300048927 | Bacteria | 1723 |
| 497 | Ga0496125_0000125 | 3300048928 | Bacteria | 169979 |
| 498 | Ga0496125_0000681 | 3300048928 | Bacteria | 56691 |
| 499 | Ga0496125_0001203 | 3300048928 | Bacteria | 38917 |
| 500 | Ga0496125_0031400 | 3300048928 | Bacteria | 4735 |
| 501 | Ga0496125_0036601 | 3300048928 | Bacteria | 4281 |
| 502 | Ga0496125_0066115 | 3300048928 | Bacteria | 2859 |
| 503 | Ga0496126_0003238 | 3300048929 | Bacteria | 20812 |
| 504 | Ga0496126_0010498 | 3300048929 | Bacteria | 9700 |
| 505 | Ga0496126_0012314 | 3300048929 | Bacteria | 8776 |
| 506 | Ga0496126_0014159 | 3300048929 | Bacteria | 8072 |
| 507 | Ga0496126_0015017 | 3300048929 | Bacteria | 7806 |
| 508 | Ga0496126_0018799 | 3300048929 | Bacteria | 6832 |
| 509 | Ga0496126_0031960 | 3300048929 | Bacteria | 4965 |
| 510 | Ga0496126_0050756 | 3300048929 | Bacteria | 3779 |
| 511 | Ga0496126_0111299 | 3300048929 | Bacteria | 2385 |
| 512 | Ga0496126_0208345 | 3300048929 | Bacteria | 1647 |
| 513 | Ga0501067_0039519 | 3300049583 | Bacteria | 2620 |
| 514 | Ga0501070_0036123 | 3300049586 | Bacteria | 4126 |
| 515 | Ga0501073_0029897 | 3300049589 | Bacteria | 3891 |
| 516 | Ga0501080_0022925 | 3300049742 | Bacteria | 5788 |
| 517 | Ga0501044_0024513 | 3300049823 | Bacteria | 6402 |
| 518 | nmdc:mga03n38_6679_c1 | 3300050490 | Bacteria | 4028 |
| 519 | nmdc:mga03n38_6784_c1 | 3300050490 | Bacteria | 4008 |
| 520 | nmdc:mga00v17_23171_c1 | 3300050491 | Bacteria | 3589 |
| 521 | nmdc:mga00v17_6414_c2 | 3300050491 | Bacteria | 3294 |
| 522 | nmdc:mga0yw44_13867_c1 | 3300050492 | Bacteria | 4259 |
| 523 | nmdc:mga0yw44_16799_c1 | 3300050492 | Bacteria | 3964 |
| 524 | nmdc:mga0yw44_27522_c1 | 3300050492 | Bacteria | 3258 |
| 525 | nmdc:mga0k408_14814_c1 | 3300050493 | Bacteria | 4302 |
| 526 | nmdc:mga04h51_10426_c1 | 3300050495 | Bacteria | 2552 |
| 527 | nmdc:mga04h51_21243_c1 | 3300050495 | Bacteria | 1951 |
| 528 | nmdc:mga05p37_332212_c1 | 3300050507 | Bacteria | 1795 |
| 529 | nmdc:mga05p37_528_c1 | 3300050507 | Bacteria | 42336 |
| 530 | nmdc:mga09592_704_c1 | 3300050508 | Bacteria | 25621 |
| 531 | nmdc:mga06r32_1819_c1 | 3300050510 | Bacteria | 19037 |
| 532 | nmdc:mga08y16_427_c1 | 3300050511 | Bacteria | 38825 |
| 533 | nmdc:mga08y16_97546_c1 | 3300050511 | Bacteria | 3061 |
| 534 | Ga0495601_0084926 | 3300053077 | Bacteria | 2033 |
| 535 | Ga0500635_0001559 | 3300053080 | Bacteria | 5514 |
| 536 | Ga0495595_0000602 | 3300053084 | Bacteria | 13704 |
| 537 | Ga0495619_0002618 | 3300053085 | Bacteria | 11755 |
| 538 | Ga0500578_0126885 | 3300053086 | Bacteria | 1602 |
| 539 | Ga0500643_000114 | 3300053087 | Bacteria | 84221 |
| 540 | Ga0500643_011390 | 3300053087 | Bacteria | 3248 |
| 541 | Ga0500646_0001099 | 3300053090 | Bacteria | 7353 |
| 542 | Ga0500647_0021187 | 3300053091 | Bacteria | 3031 |
| 543 | Ga0500651_0025879 | 3300053093 | Bacteria | 3684 |
| 544 | Ga0500566_0000021 | 3300053094 | Bacteria | 82710 |
| 545 | Ga0500566_0000569 | 3300053094 | Bacteria | 20772 |
| 546 | Ga0500566_0012626 | 3300053094 | Bacteria | 4970 |
| 547 | Ga0500641_0002087 | 3300053096 | Bacteria | 7087 |
| 548 | Ga0500650_0000314 | 3300053098 | Bacteria | 11712 |
| 549 | Ga0500556_0000002 | 3300053104 | Bacteria | 773626 |
| 550 | Ga0500556_0000009 | 3300053104 | Bacteria | 288111 |
| 551 | Ga0500557_000001 | 3300053105 | Bacteria | 241298 |
| 552 | Ga0500562_016678 | 3300053108 | Bacteria | 1889 |
| 553 | Ga0500569_009149 | 3300053109 | Bacteria | 2293 |
| 554 | Ga0500572_000012 | 3300053111 | Bacteria | 56206 |
| 555 | Ga0500595_003362 | 3300053119 | Bacteria | 7506 |
| 556 | Ga0500595_007948 | 3300053119 | Bacteria | 4359 |
| 557 | Ga0500595_017615 | 3300053119 | Bacteria | 2632 |
| 558 | Ga0500607_024182 | 3300053121 | Bacteria | 3394 |
| 559 | Ga0500608_008858 | 3300053122 | Bacteria | 4249 |
| 560 | Ga0500642_0000016 | 3300053130 | Bacteria | 176560 |
| 561 | Ga0500642_0000077 | 3300053130 | Bacteria | 53422 |
| 562 | Ga0500642_0023665 | 3300053130 | Bacteria | 2469 |
| 563 | Ga0500652_054228 | 3300053131 | Bacteria | 1642 |
| 564 | Ga0500559_0000205 | 3300053136 | Bacteria | 47084 |
| 565 | Ga0500559_0000675 | 3300053136 | Bacteria | 22834 |
| 566 | Ga0500559_0005464 | 3300053136 | Bacteria | 5844 |
| 567 | Ga0500559_0030489 | 3300053136 | Bacteria | 2312 |
| 568 | Ga0500568_0000994 | 3300053139 | Bacteria | 19383 |
| 569 | Ga0500568_0004711 | 3300053139 | Bacteria | 7235 |
| 570 | Ga0500568_0007793 | 3300053139 | Bacteria | 5217 |
| 571 | Ga0500577_0000249 | 3300053142 | Bacteria | 13959 |
| 572 | Ga0500590_046065 | 3300053148 | Bacteria | 2230 |
| 573 | Ga0500603_000044 | 3300053150 | Bacteria | 30278 |
| 574 | Ga0500603_001043 | 3300053150 | Bacteria | 6506 |
| 575 | Ga0500604_0019610 | 3300053151 | Bacteria | 1895 |
| 576 | Ga0500616_0001314 | 3300053153 | Bacteria | 24544 |
| 577 | Ga0500616_0004067 | 3300053153 | Bacteria | 10637 |
| 578 | Ga0500622_0070111 | 3300053156 | Bacteria | 1773 |
| 579 | Ga0500638_003387 | 3300053162 | Bacteria | 5890 |
| 580 | Ga0500639_000004 | 3300053163 | Bacteria | 216921 |
| 581 | Ga0500639_019770 | 3300053163 | Bacteria | 3552 |
| 582 | Ga0500636_0001512 | 3300053177 | Bacteria | 12652 |
| 583 | Ga0500637_0016041 | 3300053178 | Bacteria | 3986 |
| 584 | Ga0500637_0029788 | 3300053178 | Bacteria | 3031 |
| 585 | Ga0500576_015385 | 3300053725 | Bacteria | 3459 |
| 586 | Ga0500601_000646 | 3300053737 | Bacteria | 4793 |
| 587 | Ga0500661_000462 | 3300055283 | Bacteria | 7505 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025928 | Ga0207700_10018027 | Ga0207700_100180273 | 354 |
| 2 | 3300025929 | Ga0207664_10013089 | Ga0207664_100130893 | 354 |
| 3 | 3300026121 | Ga0207683_10147718 | Ga0207683_101477182 | 364 |
| 4 | 3300035695 | Ga0373927_0022562 | Ga0373927_0022562_1127_2548 | 365 |
| 5 | 3300037068 | Ga0373925_0192576 | Ga0373925_0192576_106_1527 | 365 |
| 6 | 3300046455 | Ga0495603_0013008 | Ga0495603_0013008_1558_2979 | 365 |
| 7 | 3300046674 | Ga0495588_0081907 | Ga0495588_0081907_139_1560 | 365 |
| 8 | 3300049586 | Ga0501070_0036123 | Ga0501070_0036123_188_1597 | 365 |
| 9 | 3300049589 | Ga0501073_0029897 | Ga0501073_0029897_699_2108 | 365 |
| 10 | 3300049742 | Ga0501080_0022925 | Ga0501080_0022925_2635_4044 | 365 |
| 11 | 3300049823 | Ga0501044_0024513 | Ga0501044_0024513_3586_4995 | 365 |
| 12 | 3300005336 | Ga0070680_100183432 | Ga0070680_1001834322 | 368 |
| 13 | 3300025912 | Ga0207707_10125546 | Ga0207707_101255462 | 368 |
| 14 | 3300025917 | Ga0207660_10107581 | Ga0207660_101075812 | 368 |
| 15 | 3300048928 | Ga0496125_0000681 | Ga0496125_0000681_37873_39288 | 368 |
| 16 | 3300028573 | Ga0265334_10017182 | Ga0265334_100171821 | 372 |
| 17 | 3300028653 | Ga0265323_10009250 | Ga0265323_100092502 | 372 |
| 18 | 3300028666 | Ga0265336_10003221 | Ga0265336_100032215 | 372 |
| 19 | 3300028800 | Ga0265338_10000306 | Ga0265338_1000030687 | 372 |
| 20 | 3300053142 | Ga0500577_0000249 | Ga0500577_0000249_4304_5734 | 372 |
| 21 | 3300003215 | JGI25153J46596_10000985 | JGI25153J46596_1000098513 | 374 |
| 22 | 3300006237 | Ga0097621_100252534 | Ga0097621_1002525341 | 374 |
| 23 | 3300025297 | Ga0209758_1004795 | Ga0209758_10047959 | 374 |
| 24 | 3300037466 | Ga0395898_0204433 | Ga0395898_0204433_12_1373 | 375 |
| 25 | 3300013105 | Ga0157369_10002568 | Ga0157369_1000256819 | 376 |
| 26 | 3300025295 | Ga0209564_1001156 | Ga0209564_100115617 | 376 |
| 27 | 3300005437 | Ga0070710_10033559 | Ga0070710_100335592 | 377 |
| 28 | 3300009176 | Ga0105242_10032961 | Ga0105242_100329613 | 378 |
| 29 | 3300048909 | Ga0496106_0061398 | Ga0496106_0061398_1081_2442 | 378 |
| 30 | 3300048910 | Ga0496107_0028502 | Ga0496107_0028502_450_1811 | 378 |
| 31 | 3300048913 | Ga0496110_0013700 | Ga0496110_0013700_425_1786 | 378 |
| 32 | 3300005436 | Ga0070713_100105498 | Ga0070713_1001054981 | 379 |
| 33 | 3300005437 | Ga0070710_10007237 | Ga0070710_100072373 | 379 |
| 34 | 3300005548 | Ga0070665_100005911 | Ga0070665_1000059117 | 379 |
| 35 | 3300010375 | Ga0105239_10094674 | Ga0105239_100946743 | 379 |
| 36 | 3300025898 | Ga0207692_10031465 | Ga0207692_100314652 | 379 |
| 37 | 3300025915 | Ga0207693_10062417 | Ga0207693_100624173 | 379 |
| 38 | 3300025928 | Ga0207700_10100452 | Ga0207700_101004523 | 379 |
| 39 | 3300030521 | Ga0307511_10046287 | Ga0307511_100462873 | 379 |
| 40 | 3300033179 | Ga0307507_10046137 | Ga0307507_100461373 | 379 |
| 41 | 3300035692 | Ga0373935_0013240 | Ga0373935_0013240_1005_2441 | 379 |
| 42 | 3300037068 | Ga0373925_0020120 | Ga0373925_0020120_3280_4716 | 379 |
| 43 | 3300048909 | Ga0496106_0000664 | Ga0496106_0000664_19298_20734 | 379 |
| 44 | 3300048924 | Ga0496121_0000077 | Ga0496121_0000077_181386_182822 | 379 |
| 45 | 3300048924 | Ga0496121_0030084 | Ga0496121_0030084_48_1409 | 379 |
| 46 | 3300048927 | Ga0496124_0006148 | Ga0496124_0006148_4787_6223 | 379 |
| 47 | 3300053130 | Ga0500642_0000016 | Ga0500642_0000016_163300_164730 | 379 |
| 48 | 3300053136 | Ga0500559_0030489 | Ga0500559_0030489_583_2019 | 379 |
| 49 | 3300005366 | Ga0070659_100018101 | Ga0070659_1000181013 | 380 |
| 50 | 3300005456 | Ga0070678_100014660 | Ga0070678_1000146603 | 380 |
| 51 | 3300005458 | Ga0070681_10073038 | Ga0070681_100730383 | 380 |
| 52 | 3300005578 | Ga0068854_100148899 | Ga0068854_1001488992 | 380 |
| 53 | 3300005616 | Ga0068852_100024478 | Ga0068852_1000244784 | 380 |
| 54 | 3300025912 | Ga0207707_10056163 | Ga0207707_100561633 | 380 |
| 55 | 3300026121 | Ga0207683_10046767 | Ga0207683_100467673 | 380 |
| 56 | 3300026142 | Ga0207698_10267413 | Ga0207698_102674131 | 380 |
| 57 | 3300053094 | Ga0500566_0000021 | Ga0500566_0000021_2939_4351 | 380 |
| 58 | 3300053111 | Ga0500572_000012 | Ga0500572_000012_33407_34819 | 380 |
| 59 | 3300053136 | Ga0500559_0005464 | Ga0500559_0005464_904_2316 | 380 |
| 60 | 3300053150 | Ga0500603_000044 | Ga0500603_000044_23758_25170 | 380 |
| 61 | 3300053163 | Ga0500639_000004 | Ga0500639_000004_75906_77318 | 380 |
| 62 | 3300053178 | Ga0500637_0029788 | Ga0500637_0029788_495_1907 | 380 |
| 63 | 3300006353 | Ga0075370_10106471 | Ga0075370_101064712 | 381 |
| 64 | 3300050495 | nmdc:mga04h51_10426_c1 | nmdc:mga04h51_10426_c1_360_1793 | 381 |
| 65 | 3300031730 | Ga0307516_10019104 | Ga0307516_100191043 | 382 |
| 66 | 3300048908 | Ga0496105_0259542 | Ga0496105_0259542_19_1380 | 382 |
| 67 | 3300013102 | Ga0157371_10146057 | Ga0157371_101460571 | 383 |
| 68 | 3300025253 | Ga0209677_100317 | Ga0209677_10031720 | 383 |
| 69 | 3300035172 | Ga0373955_0032561 | Ga0373955_0032561_1354_2715 | 383 |
| 70 | 3300035695 | Ga0373927_0108354 | Ga0373927_0108354_436_1797 | 383 |
| 71 | 3300036401 | Ga0373937_0205402 | Ga0373937_0205402_48_1409 | 383 |
| 72 | 3300039437 | Ga0436365_1867827 | Ga0436365_1867827_783_2144 | 383 |
| 73 | 3300048903 | Ga0496100_0041695 | Ga0496100_0041695_259_1620 | 383 |
| 74 | 3300048921 | Ga0496118_0027054 | Ga0496118_0027054_2262_3623 | 383 |
| 75 | 3300048924 | Ga0496121_0144038 | Ga0496121_0144038_29_1390 | 383 |
| 76 | 3300048928 | Ga0496125_0066115 | Ga0496125_0066115_180_1598 | 383 |
| 77 | 3300048929 | Ga0496126_0050756 | Ga0496126_0050756_2398_3759 | 383 |
| 78 | 3300053725 | Ga0500576_015385 | Ga0500576_015385_12_1373 | 383 |
| 79 | 3300039437 | Ga0436365_1157755 | Ga0436365_1157755_576_1997 | 385 |
| 80 | 3300046524 | Ga0495648_0004756 | Ga0495648_0004756_8761_10191 | 386 |
| 81 | 3300048929 | Ga0496126_0012314 | Ga0496126_0012314_1264_2685 | 386 |
| 82 | 3300009545 | Ga0105237_10009290 | Ga0105237_100092909 | 387 |
| 83 | 3300025914 | Ga0207671_10030544 | Ga0207671_100305443 | 387 |
| 84 | 3300046455 | Ga0495603_0010909 | Ga0495603_0010909_1072_2505 | 387 |
| 85 | 3300046472 | Ga0495580_0096750 | Ga0495580_0096750_327_1760 | 388 |
| 86 | 3300046499 | Ga0495594_0060186 | Ga0495594_0060186_375_1808 | 388 |
| 87 | 3300048919 | Ga0496116_0016391 | Ga0496116_0016391_3652_5061 | 388 |
| 88 | 3300053093 | Ga0500651_0025879 | Ga0500651_0025879_2276_3655 | 388 |
| 89 | 3300053737 | Ga0500601_000646 | Ga0500601_000646_1184_2593 | 388 |
| 90 | 3300005985 | Ga0081539_10077832 | Ga0081539_100778322 | 389 |
| 91 | 3300046460 | Ga0495638_0003230 | Ga0495638_0003230_5174_6583 | 389 |
| 92 | 3300048920 | Ga0496117_0034299 | Ga0496117_0034299_715_2145 | 389 |
| 93 | 3300048925 | Ga0496122_0026245 | Ga0496122_0026245_446_1876 | 389 |
| 94 | 3300048926 | Ga0496123_0008882 | Ga0496123_0008882_4366_5796 | 389 |
| 95 | 3300053090 | Ga0500646_0001099 | Ga0500646_0001099_3288_4718 | 389 |
| 96 | 3300053094 | Ga0500566_0000569 | Ga0500566_0000569_15391_16821 | 389 |
| 97 | 3300053109 | Ga0500569_009149 | Ga0500569_009149_423_1853 | 389 |
| 98 | 3300053122 | Ga0500608_008858 | Ga0500608_008858_970_2400 | 389 |
| 99 | 3300053136 | Ga0500559_0000675 | Ga0500559_0000675_11489_12919 | 389 |
| 100 | 3300053139 | Ga0500568_0000994 | Ga0500568_0000994_7509_8939 | 389 |
| 101 | 3300053151 | Ga0500604_0019610 | Ga0500604_0019610_399_1829 | 389 |
| 102 | iso_pu_bacteria | 8019597564 | 8019602191 | 389 |
| 103 | 3300003214 | JGI25165J46597_1005476 | JGI25165J46597_10054762 | 390 |
| 104 | 3300025261 | Ga0209233_1001148 | Ga0209233_10011482 | 390 |
| 105 | 3300037471 | Ga0395905_0003686 | Ga0395905_0003686_2843_4264 | 390 |
| 106 | 3300038443 | Ga0395901_0103703 | Ga0395901_0103703_380_1801 | 390 |
| 107 | 3300046512 | Ga0495610_0020870 | Ga0495610_0020870_2023_3453 | 390 |
| 108 | 3300047320 | Ga0495672_0017919 | Ga0495672_0017919_2352_3782 | 390 |
| 109 | 3300048923 | Ga0496120_0034063 | Ga0496120_0034063_217_1647 | 390 |
| 110 | 3300048924 | Ga0496121_0005157 | Ga0496121_0005157_9841_11271 | 390 |
| 111 | 3300048928 | Ga0496125_0001203 | Ga0496125_0001203_33754_35184 | 390 |
| 112 | 3300048929 | Ga0496126_0014159 | Ga0496126_0014159_1160_2578 | 390 |
| 113 | 3300053087 | Ga0500643_011390 | Ga0500643_011390_1560_2990 | 390 |
| 114 | 3300053098 | Ga0500650_0000314 | Ga0500650_0000314_54_1484 | 390 |
| 115 | 3300053104 | Ga0500556_0000002 | Ga0500556_0000002_453259_454689 | 390 |
| 116 | 3300053104 | Ga0500556_0000009 | Ga0500556_0000009_123088_124470 | 390 |
| 117 | 3300053108 | Ga0500562_016678 | Ga0500562_016678_408_1838 | 390 |
| 118 | 3300053153 | Ga0500616_0001314 | Ga0500616_0001314_8277_9707 | 390 |
| 119 | 3300003354 | JGI25160J50197_1009760 | JGI25160J50197_10097602 | 391 |
| 120 | 3300005262 | Ga0065165_1001028 | Ga0065165_100102822 | 391 |
| 121 | 3300005436 | Ga0070713_100024226 | Ga0070713_1000242262 | 391 |
| 122 | 3300006028 | Ga0070717_10002484 | Ga0070717_1000248410 | 391 |
| 123 | 3300025302 | Ga0207426_1003097 | Ga0207426_10030974 | 391 |
| 124 | 3300025928 | Ga0207700_10076545 | Ga0207700_100765452 | 391 |
| 125 | 3300025939 | Ga0207665_10101381 | Ga0207665_101013812 | 391 |
| 126 | 3300053121 | Ga0500607_024182 | Ga0500607_024182_1603_3012 | 391 |
| 127 | 3300003203 | JGI25406J46586_10006773 | JGI25406J46586_100067736 | 392 |
| 128 | 3300005327 | Ga0070658_10080165 | Ga0070658_100801653 | 392 |
| 129 | 3300005985 | Ga0081539_10001416 | Ga0081539_1000141617 | 392 |
| 130 | 3300044694 | Ga0466963_0044837 | Ga0466963_0044837_1261_2682 | 392 |
| 131 | 3300046616 | Ga0495668_0037587 | Ga0495668_0037587_793_2214 | 392 |
| 132 | 3300048928 | Ga0496125_0000125 | Ga0496125_0000125_70483_71898 | 392 |
| 133 | 3300048929 | Ga0496126_0018799 | Ga0496126_0018799_4275_5696 | 392 |
| 134 | 3300049583 | Ga0501067_0039519 | Ga0501067_0039519_165_1586 | 392 |
| 135 | iso_pu_bacteria | 2842694124 | 2842694323 | 392 |
| 136 | 3300003659 | JGI25404J52841_10003281 | JGI25404J52841_100032812 | 393 |
| 137 | 3300005937 | Ga0081455_10034642 | Ga0081455_100346422 | 393 |
| 138 | 3300005983 | Ga0081540_1001804 | Ga0081540_10018045 | 393 |
| 139 | 3300006871 | Ga0075434_100067965 | Ga0075434_1000679653 | 393 |
| 140 | 3300026121 | Ga0207683_10071290 | Ga0207683_100712902 | 393 |
| 141 | 3300044693 | Ga0466961_0000082 | Ga0466961_0000082_9464_10873 | 393 |
| 142 | 3300045049 | Ga0466959_0008199 | Ga0466959_0008199_4793_6202 | 393 |
| 143 | 3300046512 | Ga0495610_0039694 | Ga0495610_0039694_735_2156 | 393 |
| 144 | 3300048908 | Ga0496105_0090051 | Ga0496105_0090051_29_1450 | 393 |
| 145 | 3300048921 | Ga0496118_0056890 | Ga0496118_0056890_709_2130 | 393 |
| 146 | 3300048922 | Ga0496119_0039898 | Ga0496119_0039898_1270_2679 | 393 |
| 147 | 3300053156 | Ga0500622_0070111 | Ga0500622_0070111_259_1680 | 393 |
| 148 | iso_pu_bacteria | 2847930680 | 2847935029 | 393 |
| 149 | iso_pu_bacteria | 2874612657 | 2874613255 | 393 |
| 150 | iso_pu_bacteria | 2879083081 | 2879086422 | 393 |
| 151 | iso_pu_bacteria | 2906643746 | 2906652250 | 393 |
| 152 | 3300005614 | Ga0068856_100003013 | Ga0068856_10000301312 | 394 |
| 153 | 3300005937 | Ga0081455_10062521 | Ga0081455_100625213 | 394 |
| 154 | 3300005983 | Ga0081540_1001009 | Ga0081540_100100915 | 394 |
| 155 | 3300005983 | Ga0081540_1041827 | Ga0081540_10418272 | 394 |
| 156 | 3300026078 | Ga0207702_10000365 | Ga0207702_1000036523 | 394 |
| 157 | 3300046507 | Ga0495606_0006244 | Ga0495606_0006244_5783_7192 | 394 |
| 158 | iso_pu_bacteria | 2906610324 | 2906617446 | 394 |
| 159 | 3300005843 | Ga0068860_100000149 | Ga0068860_10000014969 | 395 |
| 160 | 3300010159 | Ga0099796_10000263 | Ga0099796_100002638 | 395 |
| 161 | 3300028381 | Ga0268264_10000084 | Ga0268264_10000084106 | 395 |
| 162 | 3300031507 | Ga0307509_10227595 | Ga0307509_102275951 | 395 |
| 163 | 3300035121 | Ga0373960_0027339 | Ga0373960_0027339_72_1505 | 395 |
| 164 | 3300035691 | Ga0373931_0003895 | Ga0373931_0003895_4165_5598 | 395 |
| 165 | 3300035724 | Ga0373933_0000276 | Ga0373933_0000276_14815_16236 | 395 |
| 166 | 3300037068 | Ga0373925_0195652 | Ga0373925_0195652_61_1494 | 395 |
| 167 | 3300048908 | Ga0496105_0122039 | Ga0496105_0122039_89_1522 | 395 |
| 168 | 3300048917 | Ga0496114_0036871 | Ga0496114_0036871_724_2157 | 395 |
| 169 | 3300053139 | Ga0500568_0007793 | Ga0500568_0007793_964_2397 | 395 |
| 170 | 3300053148 | Ga0500590_046065 | Ga0500590_046065_322_1743 | 395 |
| 171 | 3300053177 | Ga0500636_0001512 | Ga0500636_0001512_5787_7208 | 395 |
| 172 | 3300003215 | JGI25153J46596_10005451 | JGI25153J46596_100054514 | 396 |
| 173 | 3300003354 | JGI25160J50197_1000471 | JGI25160J50197_100047121 | 396 |
| 174 | 3300003354 | JGI25160J50197_1000905 | JGI25160J50197_100090517 | 396 |
| 175 | 3300009545 | Ga0105237_10062127 | Ga0105237_100621274 | 396 |
| 176 | 3300010375 | Ga0105239_10011760 | Ga0105239_100117604 | 396 |
| 177 | 3300025297 | Ga0209758_1001091 | Ga0209758_100109117 | 396 |
| 178 | 3300025302 | Ga0207426_1000611 | Ga0207426_100061132 | 396 |
| 179 | 3300046513 | Ga0495616_0055620 | Ga0495616_0055620_149_1558 | 396 |
| 180 | 3300046522 | Ga0495643_0004362 | Ga0495643_0004362_2762_4171 | 396 |
| 181 | 3300047443 | Ga0495687_004018 | Ga0495687_004018_2734_4143 | 396 |
| 182 | 3300048904 | Ga0496101_0036310 | Ga0496101_0036310_969_2378 | 396 |
| 183 | 3300048906 | Ga0496103_0030869 | Ga0496103_0030869_1499_2908 | 396 |
| 184 | 3300048907 | Ga0496104_0054348 | Ga0496104_0054348_453_1862 | 396 |
| 185 | 3300048911 | Ga0496108_0096499 | Ga0496108_0096499_990_2399 | 396 |
| 186 | 3300048928 | Ga0496125_0031400 | Ga0496125_0031400_729_2150 | 396 |
| 187 | 3300050490 | nmdc:mga03n38_6784_c1 | nmdc:mga03n38_6784_c1_481_1890 | 396 |
| 188 | 3300050491 | nmdc:mga00v17_23171_c1 | nmdc:mga00v17_23171_c1_993_2414 | 396 |
| 189 | 3300050492 | nmdc:mga0yw44_27522_c1 | nmdc:mga0yw44_27522_c1_245_1654 | 396 |
| 190 | 3300050493 | nmdc:mga0k408_14814_c1 | nmdc:mga0k408_14814_c1_2627_4036 | 396 |
| 191 | 3300050495 | nmdc:mga04h51_21243_c1 | nmdc:mga04h51_21243_c1_36_1445 | 396 |
| 192 | iso_pu_bacteria | 2513237101 | 2513691591 | 396 |
| 193 | iso_pu_bacteria | 2874604998 | 2874609356 | 396 |
| 194 | iso_pu_bacteria | 2876808645 | 2876811554 | 396 |
| 195 | iso_pu_bacteria | 2879110137 | 2879110425 | 396 |
| 196 | iso_pu_bacteria | 2904690495 | 2904696822 | 396 |
| 197 | iso_pu_bacteria | 2908756301 | 2908759517 | 396 |
| 198 | iso_pu_bacteria | 8006994254 | 8006996241 | 396 |
| 199 | iso_pu_bacteria | 8056673599 | 8056680616 | 396 |
| 200 | iso_pu_bacteria | 8056689827 | 8056694198 | 396 |
| 201 | 3300001990 | JGI24737J22298_10002974 | JGI24737J22298_100029742 | 397 |
| 202 | 3300002067 | JGI24735J21928_10016183 | JGI24735J21928_100161832 | 397 |
| 203 | 3300005435 | Ga0070714_100031171 | Ga0070714_1000311714 | 397 |
| 204 | 3300005457 | Ga0070662_100042111 | Ga0070662_1000421113 | 397 |
| 205 | 3300005564 | Ga0070664_100114009 | Ga0070664_1001140092 | 397 |
| 206 | 3300005981 | Ga0081538_10022152 | Ga0081538_100221523 | 397 |
| 207 | 3300006028 | Ga0070717_10113211 | Ga0070717_101132112 | 397 |
| 208 | 3300006163 | Ga0070715_10004402 | Ga0070715_100044022 | 397 |
| 209 | 3300006173 | Ga0070716_100024388 | Ga0070716_1000243882 | 397 |
| 210 | 3300009093 | Ga0105240_10074624 | Ga0105240_100746243 | 397 |
| 211 | 3300009545 | Ga0105237_10079494 | Ga0105237_100794943 | 397 |
| 212 | 3300009551 | Ga0105238_10011212 | Ga0105238_1001121210 | 397 |
| 213 | 3300010375 | Ga0105239_10065770 | Ga0105239_100657703 | 397 |
| 214 | 3300021388 | Ga0213875_10000089 | Ga0213875_1000008950 | 397 |
| 215 | 3300025904 | Ga0207647_10002180 | Ga0207647_1000218016 | 397 |
| 216 | 3300025913 | Ga0207695_10094686 | Ga0207695_100946862 | 397 |
| 217 | 3300025914 | Ga0207671_10143460 | Ga0207671_101434601 | 397 |
| 218 | 3300025939 | Ga0207665_10036936 | Ga0207665_100369362 | 397 |
| 219 | 3300025949 | Ga0207667_10053024 | Ga0207667_100530243 | 397 |
| 220 | 3300026041 | Ga0207639_10086285 | Ga0207639_100862852 | 397 |
| 221 | 3300026078 | Ga0207702_10070046 | Ga0207702_100700463 | 397 |
| 222 | 3300026116 | Ga0207674_10022794 | Ga0207674_100227945 | 397 |
| 223 | 3300026142 | Ga0207698_10044750 | Ga0207698_100447503 | 397 |
| 224 | 3300037853 | Ga0436364_0571570 | Ga0436364_0571570_101_1507 | 397 |
| 225 | 3300037853 | Ga0436364_0768079 | Ga0436364_0768079_5308_6714 | 397 |
| 226 | 3300039437 | Ga0436365_1461999 | Ga0436365_1461999_2179_3585 | 397 |
| 227 | 3300046459 | Ga0495629_0001771 | Ga0495629_0001771_1568_2989 | 397 |
| 228 | 3300046462 | Ga0495651_0024660 | Ga0495651_0024660_2880_4301 | 397 |
| 229 | 3300046511 | Ga0495608_0086977 | Ga0495608_0086977_147_1568 | 397 |
| 230 | 3300046663 | Ga0495635_0002315 | Ga0495635_0002315_143_1564 | 397 |
| 231 | 3300046809 | Ga0495600_0028790 | Ga0495600_0028790_1750_3171 | 397 |
| 232 | 3300047315 | Ga0495581_0125207 | Ga0495581_0125207_26_1447 | 397 |
| 233 | 3300047317 | Ga0495604_0096684 | Ga0495604_0096684_728_2149 | 397 |
| 234 | 3300047321 | Ga0495676_0050331 | Ga0495676_0050331_73_1581 | 397 |
| 235 | 3300048907 | Ga0496104_0000871 | Ga0496104_0000871_20087_21508 | 397 |
| 236 | 3300048908 | Ga0496105_0000692 | Ga0496105_0000692_14907_16328 | 397 |
| 237 | 3300048922 | Ga0496119_0007355 | Ga0496119_0007355_6542_7963 | 397 |
| 238 | 3300048923 | Ga0496120_0011482 | Ga0496120_0011482_4415_5836 | 397 |
| 239 | 3300048927 | Ga0496124_0058370 | Ga0496124_0058370_1762_3183 | 397 |
| 240 | 3300048929 | Ga0496126_0031960 | Ga0496126_0031960_1235_2656 | 397 |
| 241 | iso_pu_bacteria | 2507262055 | 2507509596 | 397 |
| 242 | iso_pu_bacteria | 2508501009 | 2508543635 | 397 |
| 243 | iso_pu_bacteria | 2508501042 | 2508698574 | 397 |
| 244 | iso_pu_bacteria | 2511231028 | 2511401402 | 397 |
| 245 | iso_pu_bacteria | 2513237092 | 2513626621 | 397 |
| 246 | iso_pu_bacteria | 2513237094 | 2513638149 | 397 |
| 247 | iso_pu_bacteria | 2513237095 | 2513646301 | 397 |
| 248 | iso_pu_bacteria | 2513237096 | 2513659660 | 397 |
| 249 | iso_pu_bacteria | 2513237098 | 2513673634 | 397 |
| 250 | iso_pu_bacteria | 2513237102 | 2513700957 | 397 |
| 251 | iso_pu_bacteria | 2513237104 | 2513719008 | 397 |
| 252 | iso_pu_bacteria | 2513237137 | 2513862689 | 397 |
| 253 | iso_pu_bacteria | 2513237139 | 2513875318 | 397 |
| 254 | iso_pu_bacteria | 2513237145 | 2513921620 | 397 |
| 255 | iso_pu_bacteria | 2513237161 | 2514016111 | 397 |
| 256 | iso_pu_bacteria | 2515154112 | 2515629069 | 397 |
| 257 | iso_pu_bacteria | 2517093001 | 2517103671 | 397 |
| 258 | iso_pu_bacteria | 2517572143 | 2517893349 | 397 |
| 259 | iso_pu_bacteria | 2524023205 | 2524439650 | 397 |
| 260 | iso_pu_bacteria | 2524023210 | 2524467631 | 397 |
| 261 | iso_pu_bacteria | 2524023228 | 2524539921 | 397 |
| 262 | iso_pu_bacteria | 2528768022 | 2528853368 | 397 |
| 263 | iso_pu_bacteria | 2602042107 | 2603856711 | 397 |
| 264 | iso_pu_bacteria | 2617270735 | 2617349104 | 397 |
| 265 | iso_pu_bacteria | 2617270741 | 2617376702 | 397 |
| 266 | iso_pu_bacteria | 2667528175 | 2671117986 | 397 |
| 267 | iso_pu_bacteria | 2721755755 | 2723845983 | 397 |
| 268 | iso_pu_bacteria | 2728368998 | 2728750596 | 397 |
| 269 | iso_pu_bacteria | 2744054633 | 2745082105 | 397 |
| 270 | iso_pu_bacteria | 2791355196 | 2793060419 | 397 |
| 271 | iso_pu_bacteria | 2791355197 | 2793071896 | 397 |
| 272 | iso_pu_bacteria | 2791355199 | 2793079686 | 397 |
| 273 | iso_pu_bacteria | 2802429603 | 2805921946 | 397 |
| 274 | iso_pu_bacteria | 2816332527 | 2818241360 | 397 |
| 275 | iso_pu_bacteria | 2824600985 | 2824608971 | 397 |
| 276 | iso_pu_bacteria | 2824609381 | 2824610260 | 397 |
| 277 | iso_pu_bacteria | 2824617872 | 2824624353 | 397 |
| 278 | iso_pu_bacteria | 2824626560 | 2824630877 | 397 |
| 279 | iso_pu_bacteria | 2824635225 | 2824643295 | 397 |
| 280 | iso_pu_bacteria | 2824644064 | 2824651709 | 397 |
| 281 | iso_pu_bacteria | 2824653114 | 2824661234 | 397 |
| 282 | iso_pu_bacteria | 2824661429 | 2824666931 | 397 |
| 283 | iso_pu_bacteria | 2824671348 | 2824679140 | 397 |
| 284 | iso_pu_bacteria | 2824679649 | 2824686431 | 397 |
| 285 | iso_pu_bacteria | 2824687955 | 2824695058 | 397 |
| 286 | iso_pu_bacteria | 2824696289 | 2824703689 | 397 |
| 287 | iso_pu_bacteria | 2824704595 | 2824712165 | 397 |
| 288 | iso_pu_bacteria | 2824714736 | 2824721821 | 397 |
| 289 | iso_pu_bacteria | 2824723954 | 2824731686 | 397 |
| 290 | iso_pu_bacteria | 2824732956 | 2824740081 | 397 |
| 291 | iso_pu_bacteria | 2824746037 | 2824748242 | 397 |
| 292 | iso_pu_bacteria | 2824753945 | 2824759607 | 397 |
| 293 | iso_pu_bacteria | 2824763712 | 2824766714 | 397 |
| 294 | iso_pu_bacteria | 2824773399 | 2824773846 | 397 |
| 295 | iso_pu_bacteria | 2838122688 | 2838128743 | 397 |
| 296 | iso_pu_bacteria | 2841941048 | 2841941051 | 397 |
| 297 | iso_pu_bacteria | 2841949485 | 2841956431 | 397 |
| 298 | iso_pu_bacteria | 2841957949 | 2841962380 | 397 |
| 299 | iso_pu_bacteria | 2841966195 | 2841967202 | 397 |
| 300 | iso_pu_bacteria | 2841974524 | 2841979398 | 397 |
| 301 | iso_pu_bacteria | 2841983080 | 2841989876 | 397 |
| 302 | iso_pu_bacteria | 2842038055 | 2842039996 | 397 |
| 303 | iso_pu_bacteria | 2842045827 | 2842047059 | 397 |
| 304 | iso_pu_bacteria | 2844315083 | 2844318157 | 397 |
| 305 | iso_pu_bacteria | 2847939898 | 2847945585 | 397 |
| 306 | iso_pu_bacteria | 2849076700 | 2849080255 | 397 |
| 307 | iso_pu_bacteria | 2857509624 | 2857510381 | 397 |
| 308 | iso_pu_bacteria | 2857524615 | 2857528188 | 397 |
| 309 | iso_pu_bacteria | 2874590934 | 2874595288 | 397 |
| 310 | iso_pu_bacteria | 2874620515 | 2874626923 | 397 |
| 311 | iso_pu_bacteria | 2874628541 | 2874636506 | 397 |
| 312 | iso_pu_bacteria | 2874645413 | 2874651129 | 397 |
| 313 | iso_pu_bacteria | 2876761206 | 2876761264 | 397 |
| 314 | iso_pu_bacteria | 2876771140 | 2876775224 | 397 |
| 315 | iso_pu_bacteria | 2876818435 | 2876824039 | 397 |
| 316 | iso_pu_bacteria | 2879074833 | 2879080667 | 397 |
| 317 | iso_pu_bacteria | 2879099564 | 2879109473 | 397 |
| 318 | iso_pu_bacteria | 2879127579 | 2879134748 | 397 |
| 319 | iso_pu_bacteria | 2879142872 | 2879144208 | 397 |
| 320 | iso_pu_bacteria | 2881364244 | 2881366478 | 397 |
| 321 | iso_pu_bacteria | 2881665667 | 2881673031 | 397 |
| 322 | iso_pu_bacteria | 2885366525 | 2885373477 | 397 |
| 323 | iso_pu_bacteria | 2885374607 | 2885380285 | 397 |
| 324 | iso_pu_bacteria | 2885383462 | 2885391789 | 397 |
| 325 | iso_pu_bacteria | 2885409591 | 2885416711 | 397 |
| 326 | iso_pu_bacteria | 2888378607 | 2888383001 | 397 |
| 327 | iso_pu_bacteria | 2888388044 | 2888394828 | 397 |
| 328 | iso_pu_bacteria | 2888419890 | 2888423463 | 397 |
| 329 | iso_pu_bacteria | 2889033259 | 2889040848 | 397 |
| 330 | iso_pu_bacteria | 2893066018 | 2893068633 | 397 |
| 331 | iso_pu_bacteria | 2903727486 | 2903734140 | 397 |
| 332 | iso_pu_bacteria | 2903748898 | 2903752908 | 397 |
| 333 | iso_pu_bacteria | 2904666416 | 2904669624 | 397 |
| 334 | iso_pu_bacteria | 2904699407 | 2904701937 | 397 |
| 335 | iso_pu_bacteria | 2904711408 | 2904716887 | 397 |
| 336 | iso_pu_bacteria | 2906602504 | 2906608415 | 397 |
| 337 | iso_pu_bacteria | 2906626472 | 2906628123 | 397 |
| 338 | iso_pu_bacteria | 2906635258 | 2906636079 | 397 |
| 339 | iso_pu_bacteria | 2906660503 | 2906665786 | 397 |
| 340 | iso_pu_bacteria | 2908739725 | 2908743747 | 397 |
| 341 | iso_pu_bacteria | 2908775508 | 2908779149 | 397 |
| 342 | iso_pu_bacteria | 2919073203 | 2919075616 | 397 |
| 343 | iso_pu_bacteria | 2922361189 | 2922367940 | 397 |
| 344 | iso_pu_bacteria | 2922368715 | 2922373177 | 397 |
| 345 | iso_pu_bacteria | 2922386360 | 2922392171 | 397 |
| 346 | iso_pu_bacteria | 2922393267 | 2922395393 | 397 |
| 347 | iso_pu_bacteria | 2922425934 | 2922429122 | 397 |
| 348 | iso_pu_bacteria | 2929615660 | 2929615769 | 397 |
| 349 | iso_pu_bacteria | 2929624759 | 2929630382 | 397 |
| 350 | iso_pu_bacteria | 2932784394 | 2932792027 | 397 |
| 351 | iso_pu_bacteria | 2932794094 | 2932796261 | 397 |
| 352 | iso_pu_bacteria | 2932801729 | 2932804433 | 397 |
| 353 | iso_pu_bacteria | 2932809354 | 2932814106 | 397 |
| 354 | iso_pu_bacteria | 2932818245 | 2932819406 | 397 |
| 355 | iso_pu_bacteria | 2932828146 | 2932833885 | 397 |
| 356 | iso_pu_bacteria | 2933577622 | 2933578945 | 397 |
| 357 | iso_pu_bacteria | 2935608549 | 2935611528 | 397 |
| 358 | iso_pu_bacteria | 2935616580 | 2935618585 | 397 |
| 359 | iso_pu_bacteria | 2935630451 | 2935634288 | 397 |
| 360 | iso_pu_bacteria | 2935638405 | 2935644572 | 397 |
| 361 | iso_pu_bacteria | 2935648319 | 2935648902 | 397 |
| 362 | iso_pu_bacteria | 2935656913 | 2935657016 | 397 |
| 363 | iso_pu_bacteria | 2935665750 | 2935673537 | 397 |
| 364 | iso_pu_bacteria | 2935675223 | 2935678424 | 397 |
| 365 | iso_pu_bacteria | 2935684952 | 2935688147 | 397 |
| 366 | iso_pu_bacteria | 2935694250 | 2935698813 | 397 |
| 367 | iso_pu_bacteria | 2935703347 | 2935708429 | 397 |
| 368 | iso_pu_bacteria | 2935713505 | 2935715166 | 397 |
| 369 | iso_pu_bacteria | 2935722832 | 2935726269 | 397 |
| 370 | iso_pu_bacteria | 2935732158 | 2935733985 | 397 |
| 371 | iso_pu_bacteria | 2935741537 | 2935743364 | 397 |
| 372 | iso_pu_bacteria | 2935750917 | 2935754598 | 397 |
| 373 | iso_pu_bacteria | 2935760218 | 2935765377 | 397 |
| 374 | iso_pu_bacteria | 2935769743 | 2935777037 | 397 |
| 375 | iso_pu_bacteria | 2935777560 | 2935784111 | 397 |
| 376 | iso_pu_bacteria | 2935785616 | 2935790356 | 397 |
| 377 | iso_pu_bacteria | 2935793552 | 2935798939 | 397 |
| 378 | iso_pu_bacteria | 2935801545 | 2935805328 | 397 |
| 379 | iso_pu_bacteria | 2935810662 | 2935816626 | 397 |
| 380 | iso_pu_bacteria | 2935819856 | 2935821005 | 397 |
| 381 | iso_pu_bacteria | 2935827899 | 2935833679 | 397 |
| 382 | iso_pu_bacteria | 2935837841 | 2935839635 | 397 |
| 383 | iso_pu_bacteria | 2935847175 | 2935850735 | 397 |
| 384 | iso_pu_bacteria | 2935855204 | 2935856950 | 397 |
| 385 | iso_pu_bacteria | 2935864058 | 2935871221 | 397 |
| 386 | iso_pu_bacteria | 2935873716 | 2935876276 | 397 |
| 387 | iso_pu_bacteria | 2935883170 | 2935888845 | 397 |
| 388 | iso_pu_bacteria | 2935908558 | 2935913896 | 397 |
| 389 | iso_pu_bacteria | 2935916978 | 2935920114 | 397 |
| 390 | iso_pu_bacteria | 2935926038 | 2935930453 | 397 |
| 391 | iso_pu_bacteria | 2935934488 | 2935939574 | 397 |
| 392 | iso_pu_bacteria | 2935942939 | 2935946523 | 397 |
| 393 | iso_pu_bacteria | 2935951376 | 2935955638 | 397 |
| 394 | iso_pu_bacteria | 2935959822 | 2935964564 | 397 |
| 395 | iso_pu_bacteria | 2935967501 | 2935972652 | 397 |
| 396 | iso_pu_bacteria | 2935975950 | 2935981525 | 397 |
| 397 | iso_pu_bacteria | 2935984226 | 2935989083 | 397 |
| 398 | iso_pu_bacteria | 2935992306 | 2935997762 | 397 |
| 399 | iso_pu_bacteria | 2936002035 | 2936007274 | 397 |
| 400 | iso_pu_bacteria | 2936011229 | 2936011812 | 397 |
| 401 | iso_pu_bacteria | 2936019824 | 2936020407 | 397 |
| 402 | iso_pu_bacteria | 2936028420 | 2936029101 | 397 |
| 403 | iso_pu_bacteria | 2936037263 | 2936043112 | 397 |
| 404 | iso_pu_bacteria | 2936046547 | 2936047130 | 397 |
| 405 | iso_pu_bacteria | 2936055302 | 2936061360 | 397 |
| 406 | iso_pu_bacteria | 2940556831 | 2940560025 | 397 |
| 407 | iso_pu_bacteria | 2941507105 | 2941511178 | 397 |
| 408 | iso_pu_bacteria | 2941515067 | 2941518562 | 397 |
| 409 | iso_pu_bacteria | 2941523033 | 2941527175 | 397 |
| 410 | iso_pu_bacteria | 2941531003 | 2941533906 | 397 |
| 411 | iso_pu_bacteria | 2941538514 | 2941540324 | 397 |
| 412 | iso_pu_bacteria | 3005474847 | 3005479292 | 397 |
| 413 | iso_pu_bacteria | 3005483717 | 3005489997 | 397 |
| 414 | iso_pu_bacteria | 3005506211 | 3005507887 | 397 |
| 415 | iso_pu_bacteria | 3005587118 | 3005590312 | 397 |
| 416 | iso_pu_bacteria | 3005594810 | 3005598208 | 397 |
| 417 | iso_pu_bacteria | 3005710791 | 3005713924 | 397 |
| 418 | iso_pu_bacteria | 3005718088 | 3005721387 | 397 |
| 419 | iso_pu_bacteria | 8006933436 | 8006941855 | 397 |
| 420 | iso_pu_bacteria | 8006964411 | 8006971363 | 397 |
| 421 | iso_pu_bacteria | 8006973647 | 8006981604 | 397 |
| 422 | iso_pu_bacteria | 8006984368 | 8006990489 | 397 |
| 423 | iso_pu_bacteria | 8016511872 | 8016514544 | 397 |
| 424 | iso_pu_bacteria | 8016522445 | 8016530627 | 397 |
| 425 | iso_pu_bacteria | 8016557553 | 8016561424 | 397 |
| 426 | iso_pu_bacteria | 8016566248 | 8016574257 | 397 |
| 427 | iso_pu_bacteria | 8016575299 | 8016578356 | 397 |
| 428 | iso_pu_bacteria | 8016583857 | 8016591487 | 397 |
| 429 | iso_pu_bacteria | 8016595262 | 8016599273 | 397 |
| 430 | iso_pu_bacteria | 8016603502 | 8016611769 | 397 |
| 431 | iso_pu_bacteria | 8016613128 | 8016622033 | 397 |
| 432 | iso_pu_bacteria | 8016630954 | 8016632136 | 397 |
| 433 | iso_pu_bacteria | 8017057580 | 8017061882 | 397 |
| 434 | iso_pu_bacteria | 8019530166 | 8019535636 | 397 |
| 435 | iso_pu_bacteria | 8019538911 | 8019543846 | 397 |
| 436 | iso_pu_bacteria | 8019547302 | 8019554931 | 397 |
| 437 | iso_pu_bacteria | 8019555841 | 8019557768 | 397 |
| 438 | iso_pu_bacteria | 8019576017 | 8019581414 | 397 |
| 439 | iso_pu_bacteria | 8019608314 | 8019616370 | 397 |
| 440 | iso_pu_bacteria | 8019619141 | 8019627039 | 397 |
| 441 | iso_pu_bacteria | 8019638758 | 8019644199 | 397 |
| 442 | iso_pu_bacteria | 8019648815 | 8019657254 | 397 |
| 443 | iso_pu_bacteria | 8019659431 | 8019663314 | 397 |
| 444 | iso_pu_bacteria | 8019668869 | 8019672932 | 397 |
| 445 | iso_pu_bacteria | 8019678201 | 8019683209 | 397 |
| 446 | iso_pu_bacteria | 8019687851 | 8019688916 | 397 |
| 447 | iso_pu_bacteria | 8055742211 | 8055747416 | 397 |
| 448 | iso_pu_bacteria | 8056681323 | 8056684033 | 397 |
| 449 | iso_pu_bacteria | 8056967851 | 8056972513 | 397 |
| 450 | 3300005436 | Ga0070713_100012520 | Ga0070713_1000125202 | 398 |
| 451 | 3300005937 | Ga0081455_10131209 | Ga0081455_101312092 | 398 |
| 452 | 3300005983 | Ga0081540_1008855 | Ga0081540_10088558 | 398 |
| 453 | 3300006844 | Ga0075428_100001309 | Ga0075428_10000130913 | 398 |
| 454 | 3300006847 | Ga0075431_100000481 | Ga0075431_1000004812 | 398 |
| 455 | 3300006880 | Ga0075429_100004176 | Ga0075429_1000041767 | 398 |
| 456 | 3300009094 | Ga0111539_10002444 | Ga0111539_1000244424 | 398 |
| 457 | 3300009147 | Ga0114129_10001244 | Ga0114129_1000124433 | 398 |
| 458 | 3300025915 | Ga0207693_10012619 | Ga0207693_100126196 | 398 |
| 459 | 3300027512 | Ga0209179_1002897 | Ga0209179_10028972 | 398 |
| 460 | 3300027907 | Ga0207428_10001178 | Ga0207428_1000117819 | 398 |
| 461 | 3300028786 | Ga0307517_10001070 | Ga0307517_100010705 | 398 |
| 462 | 3300031711 | Ga0265314_10126271 | Ga0265314_101262711 | 398 |
| 463 | 3300031730 | Ga0307516_10035156 | Ga0307516_100351563 | 398 |
| 464 | 3300031730 | Ga0307516_10039406 | Ga0307516_100394062 | 398 |
| 465 | 3300046524 | Ga0495648_0055892 | Ga0495648_0055892_132_1553 | 398 |
| 466 | 3300047315 | Ga0495581_0028348 | Ga0495581_0028348_1008_2441 | 398 |
| 467 | 3300048917 | Ga0496114_0138011 | Ga0496114_0138011_98_1519 | 398 |
| 468 | 3300048929 | Ga0496126_0003238 | Ga0496126_0003238_16308_17735 | 398 |
| 469 | 3300050507 | nmdc:mga05p37_332212_c1 | nmdc:mga05p37_332212_c1_137_1555 | 398 |
| 470 | 3300050507 | nmdc:mga05p37_528_c1 | nmdc:mga05p37_528_c1_22021_23427 | 398 |
| 471 | 3300050508 | nmdc:mga09592_704_c1 | nmdc:mga09592_704_c1_5517_6923 | 398 |
| 472 | 3300050510 | nmdc:mga06r32_1819_c1 | nmdc:mga06r32_1819_c1_2789_4195 | 398 |
| 473 | 3300050511 | nmdc:mga08y16_427_c1 | nmdc:mga08y16_427_c1_22400_23806 | 398 |
| 474 | 3300005548 | Ga0070665_100011311 | Ga0070665_1000113116 | 399 |
| 475 | 3300010375 | Ga0105239_10118417 | Ga0105239_101184172 | 399 |
| 476 | 3300013104 | Ga0157370_10208642 | Ga0157370_102086421 | 399 |
| 477 | 3300013296 | Ga0157374_10027530 | Ga0157374_100275303 | 399 |
| 478 | 3300025912 | Ga0207707_10027529 | Ga0207707_100275294 | 399 |
| 479 | 3300028379 | Ga0268266_10034792 | Ga0268266_100347922 | 399 |
| 480 | 3300031250 | Ga0265331_10059075 | Ga0265331_100590752 | 399 |
| 481 | 3300044658 | Ga0466972_0000206 | Ga0466972_0000206_21996_23417 | 399 |
| 482 | 3300046507 | Ga0495606_0005859 | Ga0495606_0005859_7209_8633 | 399 |
| 483 | 3300046616 | Ga0495668_0077050 | Ga0495668_0077050_291_1733 | 399 |
| 484 | 3300048924 | Ga0496121_0005105 | Ga0496121_0005105_1141_2568 | 399 |
| 485 | 3300048929 | Ga0496126_0111299 | Ga0496126_0111299_535_1947 | 399 |
| 486 | 3300053091 | Ga0500647_0021187 | Ga0500647_0021187_955_2376 | 399 |
| 487 | 3300053105 | Ga0500557_000001 | Ga0500557_000001_186714_188135 | 399 |
| 488 | 3300053130 | Ga0500642_0000077 | Ga0500642_0000077_32832_34253 | 399 |
| 489 | 3300003203 | JGI25406J46586_10000026 | JGI25406J46586_1000002638 | 400 |
| 490 | 3300003215 | JGI25153J46596_10004178 | JGI25153J46596_100041782 | 400 |
| 491 | 3300005329 | Ga0070683_100036193 | Ga0070683_1000361933 | 400 |
| 492 | 3300005339 | Ga0070660_100073729 | Ga0070660_1000737292 | 400 |
| 493 | 3300005347 | Ga0070668_100016411 | Ga0070668_1000164114 | 400 |
| 494 | 3300005355 | Ga0070671_100028726 | Ga0070671_1000287262 | 400 |
| 495 | 3300005365 | Ga0070688_100095027 | Ga0070688_1000950272 | 400 |
| 496 | 3300005455 | Ga0070663_100034481 | Ga0070663_1000344814 | 400 |
| 497 | 3300005456 | Ga0070678_100032005 | Ga0070678_1000320053 | 400 |
| 498 | 3300005548 | Ga0070665_100001701 | Ga0070665_1000017013 | 400 |
| 499 | 3300005563 | Ga0068855_100146670 | Ga0068855_1001466702 | 400 |
| 500 | 3300005614 | Ga0068856_100037003 | Ga0068856_1000370034 | 400 |
| 501 | 3300005615 | Ga0070702_100009142 | Ga0070702_1000091423 | 400 |
| 502 | 3300005937 | Ga0081455_10004867 | Ga0081455_1000486711 | 400 |
| 503 | 3300005981 | Ga0081538_10041851 | Ga0081538_100418513 | 400 |
| 504 | 3300005983 | Ga0081540_1007583 | Ga0081540_10075833 | 400 |
| 505 | 3300005985 | Ga0081539_10000140 | Ga0081539_10000140158 | 400 |
| 506 | 3300006028 | Ga0070717_10028456 | Ga0070717_100284563 | 400 |
| 507 | 3300006038 | Ga0075365_10000501 | Ga0075365_1000050110 | 400 |
| 508 | 3300006038 | Ga0075365_10022102 | Ga0075365_100221021 | 400 |
| 509 | 3300006048 | Ga0075363_100001550 | Ga0075363_10000155011 | 400 |
| 510 | 3300006048 | Ga0075363_100005187 | Ga0075363_1000051874 | 400 |
| 511 | 3300006051 | Ga0075364_10012257 | Ga0075364_100122575 | 400 |
| 512 | 3300006051 | Ga0075364_10021345 | Ga0075364_100213452 | 400 |
| 513 | 3300006051 | Ga0075364_10040499 | Ga0075364_100404994 | 400 |
| 514 | 3300006051 | Ga0075364_10133886 | Ga0075364_101338862 | 400 |
| 515 | 3300006178 | Ga0075367_10001628 | Ga0075367_100016286 | 400 |
| 516 | 3300006178 | Ga0075367_10018260 | Ga0075367_100182603 | 400 |
| 517 | 3300006195 | Ga0075366_10015409 | Ga0075366_100154092 | 400 |
| 518 | 3300009093 | Ga0105240_10153425 | Ga0105240_101534252 | 400 |
| 519 | 3300009098 | Ga0105245_10022065 | Ga0105245_100220653 | 400 |
| 520 | 3300014968 | Ga0157379_10147012 | Ga0157379_101470121 | 400 |
| 521 | 3300014969 | Ga0157376_10002196 | Ga0157376_100021963 | 400 |
| 522 | 3300025230 | Ga0209563_103109 | Ga0209563_1031092 | 400 |
| 523 | 3300025253 | Ga0209677_104466 | Ga0209677_1044664 | 400 |
| 524 | 3300025295 | Ga0209564_1011750 | Ga0209564_10117503 | 400 |
| 525 | 3300025297 | Ga0209758_1004633 | Ga0209758_10046337 | 400 |
| 526 | 3300025903 | Ga0207680_10095354 | Ga0207680_100953541 | 400 |
| 527 | 3300025904 | Ga0207647_10001716 | Ga0207647_1000171619 | 400 |
| 528 | 3300025911 | Ga0207654_10008431 | Ga0207654_100084315 | 400 |
| 529 | 3300025914 | Ga0207671_10032489 | Ga0207671_100324893 | 400 |
| 530 | 3300025919 | Ga0207657_10154476 | Ga0207657_101544762 | 400 |
| 531 | 3300026067 | Ga0207678_10047972 | Ga0207678_100479723 | 400 |
| 532 | 3300026142 | Ga0207698_10216343 | Ga0207698_102163432 | 400 |
| 533 | 3300027866 | Ga0209813_10019792 | Ga0209813_100197922 | 400 |
| 534 | 3300028379 | Ga0268266_10002227 | Ga0268266_1000222721 | 400 |
| 535 | 3300028379 | Ga0268266_10052050 | Ga0268266_100520502 | 400 |
| 536 | 3300028379 | Ga0268266_10155010 | Ga0268266_101550102 | 400 |
| 537 | 3300031824 | Ga0307413_10044697 | Ga0307413_100446972 | 400 |
| 538 | 3300033180 | Ga0307510_10043883 | Ga0307510_100438835 | 400 |
| 539 | 3300033544 | Ga0316215_1002160 | Ga0316215_10021602 | 400 |
| 540 | 3300034820 | Ga0373959_0007535 | Ga0373959_0007535_14_1447 | 400 |
| 541 | 3300035085 | Ga0373929_0012980 | Ga0373929_0012980_52_1485 | 400 |
| 542 | 3300035695 | Ga0373927_0031239 | Ga0373927_0031239_1706_3127 | 400 |
| 543 | 3300035725 | Ga0373947_0014079 | Ga0373947_0014079_1802_3223 | 400 |
| 544 | 3300037418 | Ga0395900_0000601 | Ga0395900_0000601_29620_31041 | 400 |
| 545 | 3300038443 | Ga0395901_0053569 | Ga0395901_0053569_877_2298 | 400 |
| 546 | 3300046558 | Ga0495633_0028152 | Ga0495633_0028152_391_1824 | 400 |
| 547 | 3300046679 | Ga0495623_0067875 | Ga0495623_0067875_315_1751 | 400 |
| 548 | 3300047320 | Ga0495672_0005547 | Ga0495672_0005547_3100_4533 | 400 |
| 549 | 3300047320 | Ga0495672_0018944 | Ga0495672_0018944_1909_3330 | 400 |
| 550 | 3300048904 | Ga0496101_0003025 | Ga0496101_0003025_7138_8559 | 400 |
| 551 | 3300048906 | Ga0496103_0020192 | Ga0496103_0020192_681_2102 | 400 |
| 552 | 3300048908 | Ga0496105_0016067 | Ga0496105_0016067_2655_4076 | 400 |
| 553 | 3300048909 | Ga0496106_0139181 | Ga0496106_0139181_436_1869 | 400 |
| 554 | 3300048911 | Ga0496108_0011933 | Ga0496108_0011933_1948_3369 | 400 |
| 555 | 3300048911 | Ga0496108_0072438 | Ga0496108_0072438_1174_2607 | 400 |
| 556 | 3300048912 | Ga0496109_0002448 | Ga0496109_0002448_4450_5871 | 400 |
| 557 | 3300048914 | Ga0496111_0019393 | Ga0496111_0019393_1250_2671 | 400 |
| 558 | 3300048915 | Ga0496112_0003189 | Ga0496112_0003189_10288_11709 | 400 |
| 559 | 3300048915 | Ga0496112_0046911 | Ga0496112_0046911_1182_2603 | 400 |
| 560 | 3300048917 | Ga0496114_0021145 | Ga0496114_0021145_1465_2886 | 400 |
| 561 | 3300048918 | Ga0496115_0007995 | Ga0496115_0007995_48_1469 | 400 |
| 562 | 3300048919 | Ga0496116_0004328 | Ga0496116_0004328_5388_6818 | 400 |
| 563 | 3300048924 | Ga0496121_0000616 | Ga0496121_0000616_39123_40544 | 400 |
| 564 | 3300048927 | Ga0496124_0164896 | Ga0496124_0164896_97_1527 | 400 |
| 565 | 3300048928 | Ga0496125_0036601 | Ga0496125_0036601_2608_4038 | 400 |
| 566 | 3300048929 | Ga0496126_0208345 | Ga0496126_0208345_19_1446 | 400 |
| 567 | 3300050490 | nmdc:mga03n38_6679_c1 | nmdc:mga03n38_6679_c1_1736_3169 | 400 |
| 568 | 3300050491 | nmdc:mga00v17_6414_c2 | nmdc:mga00v17_6414_c2_930_2360 | 400 |
| 569 | 3300050492 | nmdc:mga0yw44_13867_c1 | nmdc:mga0yw44_13867_c1_1797_3227 | 400 |
| 570 | 3300053086 | Ga0500578_0126885 | Ga0500578_0126885_67_1500 | 400 |
| 571 | 3300053096 | Ga0500641_0002087 | Ga0500641_0002087_2969_4402 | 400 |
| 572 | 3300053119 | Ga0500595_007948 | Ga0500595_007948_342_1763 | 400 |
| 573 | 3300053119 | Ga0500595_017615 | Ga0500595_017615_920_2347 | 400 |
| 574 | 3300053130 | Ga0500642_0023665 | Ga0500642_0023665_50_1483 | 400 |
| 575 | 3300053139 | Ga0500568_0004711 | Ga0500568_0004711_291_1712 | 400 |
| 576 | 3300001979 | JGI24740J21852_10002137 | JGI24740J21852_100021376 | 401 |
| 577 | 3300003794 | Ga0055531_10006158 | Ga0055531_100061586 | 401 |
| 578 | 3300005262 | Ga0065165_1000676 | Ga0065165_100067621 | 401 |
| 579 | 3300005262 | Ga0065165_1004302 | Ga0065165_10043023 | 401 |
| 580 | 3300005329 | Ga0070683_100049586 | Ga0070683_1000495864 | 401 |
| 581 | 3300005336 | Ga0070680_100108465 | Ga0070680_1001084651 | 401 |
| 582 | 3300005339 | Ga0070660_100011169 | Ga0070660_1000111694 | 401 |
| 583 | 3300005347 | Ga0070668_100018846 | Ga0070668_1000188462 | 401 |
| 584 | 3300005434 | Ga0070709_10000449 | Ga0070709_1000044923 | 401 |
| 585 | 3300005435 | Ga0070714_100005397 | Ga0070714_1000053974 | 401 |
| 586 | 3300005436 | Ga0070713_100081030 | Ga0070713_1000810301 | 401 |
| 587 | 3300005437 | Ga0070710_10000080 | Ga0070710_1000008022 | 401 |
| 588 | 3300005439 | Ga0070711_100002916 | Ga0070711_10000291613 | 401 |
| 589 | 3300005455 | Ga0070663_100016650 | Ga0070663_1000166502 | 401 |
| 590 | 3300005455 | Ga0070663_100162708 | Ga0070663_1001627081 | 401 |
| 591 | 3300005458 | Ga0070681_10038494 | Ga0070681_100384945 | 401 |
| 592 | 3300005530 | Ga0070679_100061981 | Ga0070679_1000619813 | 401 |
| 593 | 3300005535 | Ga0070684_100009926 | Ga0070684_1000099266 | 401 |
| 594 | 3300005535 | Ga0070684_100020540 | Ga0070684_1000205405 | 401 |
| 595 | 3300005539 | Ga0068853_100023072 | Ga0068853_1000230723 | 401 |
| 596 | 3300005539 | Ga0068853_100028496 | Ga0068853_1000284962 | 401 |
| 597 | 3300005544 | Ga0070686_100022536 | Ga0070686_1000225361 | 401 |
| 598 | 3300005563 | Ga0068855_100024197 | Ga0068855_1000241974 | 401 |
| 599 | 3300005563 | Ga0068855_100061078 | Ga0068855_1000610783 | 401 |
| 600 | 3300005563 | Ga0068855_100202044 | Ga0068855_1002020442 | 401 |
| 601 | 3300005564 | Ga0070664_100115014 | Ga0070664_1001150141 | 401 |
| 602 | 3300005577 | Ga0068857_100025654 | Ga0068857_1000256544 | 401 |
| 603 | 3300005577 | Ga0068857_100084756 | Ga0068857_1000847562 | 401 |
| 604 | 3300005578 | Ga0068854_100020160 | Ga0068854_1000201603 | 401 |
| 605 | 3300005614 | Ga0068856_100007962 | Ga0068856_1000079623 | 401 |
| 606 | 3300005616 | Ga0068852_100038374 | Ga0068852_1000383743 | 401 |
| 607 | 3300005719 | Ga0068861_100148545 | Ga0068861_1001485452 | 401 |
| 608 | 3300005834 | Ga0068851_10001148 | Ga0068851_100011488 | 401 |
| 609 | 3300005983 | Ga0081540_1000565 | Ga0081540_100056522 | 401 |
| 610 | 3300006173 | Ga0070716_100003205 | Ga0070716_1000032056 | 401 |
| 611 | 3300006942 | Ga0099824_1014350 | Ga0099824_10143505 | 401 |
| 612 | 3300006942 | Ga0099824_1027789 | Ga0099824_10277891 | 401 |
| 613 | 3300006943 | Ga0099822_1015994 | Ga0099822_10159942 | 401 |
| 614 | 3300009093 | Ga0105240_10028194 | Ga0105240_100281948 | 401 |
| 615 | 3300009093 | Ga0105240_10036147 | Ga0105240_100361475 | 401 |
| 616 | 3300009101 | Ga0105247_10014265 | Ga0105247_100142651 | 401 |
| 617 | 3300009101 | Ga0105247_10126371 | Ga0105247_101263711 | 401 |
| 618 | 3300009148 | Ga0105243_10110300 | Ga0105243_101103002 | 401 |
| 619 | 3300009174 | Ga0105241_10004323 | Ga0105241_100043233 | 401 |
| 620 | 3300009176 | Ga0105242_10073447 | Ga0105242_100734471 | 401 |
| 621 | 3300009545 | Ga0105237_10011062 | Ga0105237_100110625 | 401 |
| 622 | 3300009545 | Ga0105237_10047580 | Ga0105237_100475803 | 401 |
| 623 | 3300009551 | Ga0105238_10011154 | Ga0105238_100111549 | 401 |
| 624 | 3300009551 | Ga0105238_10021238 | Ga0105238_100212382 | 401 |
| 625 | 3300009551 | Ga0105238_10025526 | Ga0105238_100255262 | 401 |
| 626 | 3300010375 | Ga0105239_10003480 | Ga0105239_100034803 | 401 |
| 627 | 3300010375 | Ga0105239_10084754 | Ga0105239_100847544 | 401 |
| 628 | 3300013104 | Ga0157370_10040094 | Ga0157370_100400944 | 401 |
| 629 | 3300013104 | Ga0157370_10045350 | Ga0157370_100453502 | 401 |
| 630 | 3300013104 | Ga0157370_10114184 | Ga0157370_101141842 | 401 |
| 631 | 3300013105 | Ga0157369_10006143 | Ga0157369_100061434 | 401 |
| 632 | 3300013105 | Ga0157369_10007826 | Ga0157369_100078265 | 401 |
| 633 | 3300013105 | Ga0157369_10042037 | Ga0157369_100420377 | 401 |
| 634 | 3300013297 | Ga0157378_10003347 | Ga0157378_1000334713 | 401 |
| 635 | 3300013297 | Ga0157378_10096739 | Ga0157378_100967392 | 401 |
| 636 | 3300013308 | Ga0157375_10112031 | Ga0157375_101120311 | 401 |
| 637 | 3300021320 | Ga0214544_1005900 | Ga0214544_100590028 | 401 |
| 638 | 3300021321 | Ga0214542_1000002 | Ga0214542_1000002408 | 401 |
| 639 | 3300021324 | Ga0214545_1000002 | Ga0214545_1000002312 | 401 |
| 640 | 3300021327 | Ga0214543_1000013 | Ga0214543_100001310 | 401 |
| 641 | 3300021384 | Ga0213876_10002558 | Ga0213876_1000255813 | 401 |
| 642 | 3300025254 | Ga0209148_1002077 | Ga0209148_10020774 | 401 |
| 643 | 3300025272 | Ga0209455_1002461 | Ga0209455_10024612 | 401 |
| 644 | 3300025272 | Ga0209455_1003127 | Ga0209455_10031273 | 401 |
| 645 | 3300025295 | Ga0209564_1011460 | Ga0209564_10114603 | 401 |
| 646 | 3300025297 | Ga0209758_1000100 | Ga0209758_1000100220 | 401 |
| 647 | 3300025297 | Ga0209758_1000138 | Ga0209758_1000138128 | 401 |
| 648 | 3300025297 | Ga0209758_1001346 | Ga0209758_100134621 | 401 |
| 649 | 3300025302 | Ga0207426_1000575 | Ga0207426_100057520 | 401 |
| 650 | 3300025302 | Ga0207426_1011857 | Ga0207426_10118573 | 401 |
| 651 | 3300025304 | Ga0209257_1002068 | Ga0209257_100206825 | 401 |
| 652 | 3300025315 | Ga0207697_10046903 | Ga0207697_100469032 | 401 |
| 653 | 3300025321 | Ga0207656_10028559 | Ga0207656_100285592 | 401 |
| 654 | 3300025898 | Ga0207692_10001336 | Ga0207692_100013368 | 401 |
| 655 | 3300025906 | Ga0207699_10000664 | Ga0207699_100006643 | 401 |
| 656 | 3300025906 | Ga0207699_10023020 | Ga0207699_100230203 | 401 |
| 657 | 3300025907 | Ga0207645_10139343 | Ga0207645_101393431 | 401 |
| 658 | 3300025912 | Ga0207707_10001819 | Ga0207707_100018192 | 401 |
| 659 | 3300025912 | Ga0207707_10035918 | Ga0207707_100359184 | 401 |
| 660 | 3300025913 | Ga0207695_10000883 | Ga0207695_1000088316 | 401 |
| 661 | 3300025913 | Ga0207695_10024523 | Ga0207695_100245232 | 401 |
| 662 | 3300025914 | Ga0207671_10085135 | Ga0207671_100851352 | 401 |
| 663 | 3300025916 | Ga0207663_10074620 | Ga0207663_100746201 | 401 |
| 664 | 3300025917 | Ga0207660_10060137 | Ga0207660_100601372 | 401 |
| 665 | 3300025917 | Ga0207660_10108926 | Ga0207660_101089262 | 401 |
| 666 | 3300025919 | Ga0207657_10032851 | Ga0207657_100328512 | 401 |
| 667 | 3300025920 | Ga0207649_10015585 | Ga0207649_100155852 | 401 |
| 668 | 3300025921 | Ga0207652_10056483 | Ga0207652_100564833 | 401 |
| 669 | 3300025922 | Ga0207646_10124224 | Ga0207646_101242242 | 401 |
| 670 | 3300025924 | Ga0207694_10000436 | Ga0207694_1000043611 | 401 |
| 671 | 3300025924 | Ga0207694_10012321 | Ga0207694_100123218 | 401 |
| 672 | 3300025924 | Ga0207694_10057660 | Ga0207694_100576603 | 401 |
| 673 | 3300025933 | Ga0207706_10011445 | Ga0207706_100114453 | 401 |
| 674 | 3300025934 | Ga0207686_10089188 | Ga0207686_100891882 | 401 |
| 675 | 3300025937 | Ga0207669_10050729 | Ga0207669_100507291 | 401 |
| 676 | 3300025938 | Ga0207704_10160824 | Ga0207704_101608241 | 401 |
| 677 | 3300025939 | Ga0207665_10005731 | Ga0207665_100057316 | 401 |
| 678 | 3300025944 | Ga0207661_10005117 | Ga0207661_100051175 | 401 |
| 679 | 3300025949 | Ga0207667_10022504 | Ga0207667_100225047 | 401 |
| 680 | 3300025949 | Ga0207667_10029290 | Ga0207667_100292907 | 401 |
| 681 | 3300025949 | Ga0207667_10032844 | Ga0207667_100328444 | 401 |
| 682 | 3300025949 | Ga0207667_10161717 | Ga0207667_101617172 | 401 |
| 683 | 3300025961 | Ga0207712_10163361 | Ga0207712_101633611 | 401 |
| 684 | 3300025981 | Ga0207640_10012053 | Ga0207640_100120534 | 401 |
| 685 | 3300025981 | Ga0207640_10085324 | Ga0207640_100853242 | 401 |
| 686 | 3300026041 | Ga0207639_10049883 | Ga0207639_100498834 | 401 |
| 687 | 3300026067 | Ga0207678_10187027 | Ga0207678_101870271 | 401 |
| 688 | 3300026078 | Ga0207702_10000005 | Ga0207702_10000005123 | 401 |
| 689 | 3300026078 | Ga0207702_10126676 | Ga0207702_101266762 | 401 |
| 690 | 3300026116 | Ga0207674_10020453 | Ga0207674_100204535 | 401 |
| 691 | 3300026116 | Ga0207674_10049929 | Ga0207674_100499293 | 401 |
| 692 | 3300026116 | Ga0207674_10064122 | Ga0207674_100641222 | 401 |
| 693 | 3300026118 | Ga0207675_100078766 | Ga0207675_1000787663 | 401 |
| 694 | 3300026142 | Ga0207698_10015737 | Ga0207698_100157372 | 401 |
| 695 | 3300027296 | Ga0209389_1000094 | Ga0209389_10000944 | 401 |
| 696 | 3300027296 | Ga0209389_1000189 | Ga0209389_10001892 | 401 |
| 697 | 3300027357 | Ga0209589_1000030 | Ga0209589_100003057 | 401 |
| 698 | 3300027357 | Ga0209589_1000845 | Ga0209589_10008452 | 401 |
| 699 | 3300027361 | Ga0209489_100056 | Ga0209489_10005657 | 401 |
| 700 | 3300027361 | Ga0209489_101612 | Ga0209489_1016122 | 401 |
| 701 | 3300027361 | Ga0209489_110925 | Ga0209489_11092511 | 401 |
| 702 | 3300027363 | Ga0209700_100059 | Ga0209700_10005957 | 401 |
| 703 | 3300027363 | Ga0209700_100374 | Ga0209700_1003745 | 401 |
| 704 | 3300031235 | Ga0265330_10022333 | Ga0265330_100223332 | 401 |
| 705 | 3300031235 | Ga0265330_10036168 | Ga0265330_100361682 | 401 |
| 706 | 3300031247 | Ga0265340_10005613 | Ga0265340_100056134 | 401 |
| 707 | 3300033180 | Ga0307510_10055257 | Ga0307510_100552572 | 401 |
| 708 | 3300033180 | Ga0307510_10091352 | Ga0307510_100913523 | 401 |
| 709 | 3300033442 | Ga0315911_1000020 | Ga0315911_100002058 | 401 |
| 710 | 3300035083 | Ga0373926_0006349 | Ga0373926_0006349_2090_3511 | 401 |
| 711 | 3300035086 | Ga0373934_0001625 | Ga0373934_0001625_5387_6805 | 401 |
| 712 | 3300035092 | Ga0373952_0010315 | Ga0373952_0010315_88_1770 | 401 |
| 713 | 3300035111 | Ga0373923_0000728 | Ga0373923_0000728_152_1570 | 401 |
| 714 | 3300035111 | Ga0373923_0014602 | Ga0373923_0014602_1385_2806 | 401 |
| 715 | 3300035117 | Ga0373953_0001784 | Ga0373953_0001784_1671_3089 | 401 |
| 716 | 3300035117 | Ga0373953_0005032 | Ga0373953_0005032_1747_3168 | 401 |
| 717 | 3300035118 | Ga0373954_0012962 | Ga0373954_0012962_1222_2643 | 401 |
| 718 | 3300035119 | Ga0373956_0005702 | Ga0373956_0005702_141_1559 | 401 |
| 719 | 3300035119 | Ga0373956_0026766 | Ga0373956_0026766_142_1563 | 401 |
| 720 | 3300035120 | Ga0373957_0000700 | Ga0373957_0000700_6586_8004 | 401 |
| 721 | 3300035172 | Ga0373955_0000682 | Ga0373955_0000682_11539_12957 | 401 |
| 722 | 3300035410 | Ga0373924_0002550 | Ga0373924_0002550_4031_5449 | 401 |
| 723 | 3300035692 | Ga0373935_0037039 | Ga0373935_0037039_610_2028 | 401 |
| 724 | 3300035692 | Ga0373935_0080551 | Ga0373935_0080551_20_1441 | 401 |
| 725 | 3300035695 | Ga0373927_0025245 | Ga0373927_0025245_275_1696 | 401 |
| 726 | 3300035724 | Ga0373933_0002551 | Ga0373933_0002551_7153_8571 | 401 |
| 727 | 3300035724 | Ga0373933_0033581 | Ga0373933_0033581_1067_2488 | 401 |
| 728 | 3300035725 | Ga0373947_0053457 | Ga0373947_0053457_992_2413 | 401 |
| 729 | 3300037068 | Ga0373925_0122281 | Ga0373925_0122281_534_1955 | 401 |
| 730 | 3300037418 | Ga0395900_0062773 | Ga0395900_0062773_2145_3566 | 401 |
| 731 | 3300038443 | Ga0395901_0100710 | Ga0395901_0100710_1224_2645 | 401 |
| 732 | 3300039437 | Ga0436365_0871323 | Ga0436365_0871323_44536_45957 | 401 |
| 733 | 3300046455 | Ga0495603_0013682 | Ga0495603_0013682_996_2417 | 401 |
| 734 | 3300046459 | Ga0495629_0000450 | Ga0495629_0000450_22609_24027 | 401 |
| 735 | 3300046459 | Ga0495629_0103888 | Ga0495629_0103888_540_1961 | 401 |
| 736 | 3300046462 | Ga0495651_0003667 | Ga0495651_0003667_1200_2618 | 401 |
| 737 | 3300046462 | Ga0495651_0038481 | Ga0495651_0038481_178_1599 | 401 |
| 738 | 3300046463 | Ga0495653_0001326 | Ga0495653_0001326_7255_8673 | 401 |
| 739 | 3300046472 | Ga0495580_0004175 | Ga0495580_0004175_693_2114 | 401 |
| 740 | 3300046472 | Ga0495580_0091584 | Ga0495580_0091584_250_1671 | 401 |
| 741 | 3300046473 | Ga0495582_0014658 | Ga0495582_0014658_2171_3592 | 401 |
| 742 | 3300046475 | Ga0495639_0006594 | Ga0495639_0006594_1471_2892 | 401 |
| 743 | 3300046476 | Ga0495662_0053759 | Ga0495662_0053759_175_1596 | 401 |
| 744 | 3300046511 | Ga0495608_0000519 | Ga0495608_0000519_1784_3202 | 401 |
| 745 | 3300046516 | Ga0495628_0084298 | Ga0495628_0084298_869_2290 | 401 |
| 746 | 3300046517 | Ga0495630_0078635 | Ga0495630_0078635_720_2141 | 401 |
| 747 | 3300046523 | Ga0495644_0028199 | Ga0495644_0028199_569_2005 | 401 |
| 748 | 3300046529 | Ga0495652_0105929 | Ga0495652_0105929_201_1622 | 401 |
| 749 | 3300046529 | Ga0495652_0139817 | Ga0495652_0139817_114_1535 | 401 |
| 750 | 3300046531 | Ga0495665_0006975 | Ga0495665_0006975_2249_3670 | 401 |
| 751 | 3300046535 | Ga0495586_0064243 | Ga0495586_0064243_567_1988 | 401 |
| 752 | 3300046536 | Ga0495587_0010165 | Ga0495587_0010165_534_1955 | 401 |
| 753 | 3300046543 | Ga0495645_0027571 | Ga0495645_0027571_2295_3713 | 401 |
| 754 | 3300046543 | Ga0495645_0106070 | Ga0495645_0106070_412_1833 | 401 |
| 755 | 3300046559 | Ga0495667_0022688 | Ga0495667_0022688_572_1990 | 401 |
| 756 | 3300046559 | Ga0495667_0047031 | Ga0495667_0047031_1304_2725 | 401 |
| 757 | 3300046642 | Ga0495634_0023795 | Ga0495634_0023795_2064_3485 | 401 |
| 758 | 3300046642 | Ga0495634_0029860 | Ga0495634_0029860_2066_3484 | 401 |
| 759 | 3300046648 | Ga0495611_0011021 | Ga0495611_0011021_2165_3586 | 401 |
| 760 | 3300046663 | Ga0495635_0000949 | Ga0495635_0000949_15464_16882 | 401 |
| 761 | 3300046663 | Ga0495635_0028172 | Ga0495635_0028172_899_2320 | 401 |
| 762 | 3300046675 | Ga0495657_0026545 | Ga0495657_0026545_444_1862 | 401 |
| 763 | 3300046675 | Ga0495657_0040214 | Ga0495657_0040214_1220_2641 | 401 |
| 764 | 3300046678 | Ga0495599_0001298 | Ga0495599_0001298_9545_10963 | 401 |
| 765 | 3300046679 | Ga0495623_0004108 | Ga0495623_0004108_1200_2618 | 401 |
| 766 | 3300046680 | Ga0495646_0053097 | Ga0495646_0053097_638_2059 | 401 |
| 767 | 3300046681 | Ga0495647_0001492 | Ga0495647_0001492_4838_6259 | 401 |
| 768 | 3300046683 | Ga0495658_0009441 | Ga0495658_0009441_403_1824 | 401 |
| 769 | 3300046684 | Ga0495669_0004566 | Ga0495669_0004566_4027_5463 | 401 |
| 770 | 3300046689 | Ga0495613_0088406 | Ga0495613_0088406_236_1657 | 401 |
| 771 | 3300046690 | Ga0495624_0073887 | Ga0495624_0073887_244_1665 | 401 |
| 772 | 3300046809 | Ga0495600_0025985 | Ga0495600_0025985_1854_3275 | 401 |
| 773 | 3300046809 | Ga0495600_0140416 | Ga0495600_0140416_136_1554 | 401 |
| 774 | 3300047317 | Ga0495604_0002058 | Ga0495604_0002058_1562_2980 | 401 |
| 775 | 3300047317 | Ga0495604_0052524 | Ga0495604_0052524_1074_2495 | 401 |
| 776 | 3300047319 | Ga0495674_0004477 | Ga0495674_0004477_8172_9593 | 401 |
| 777 | 3300047321 | Ga0495676_0127008 | Ga0495676_0127008_358_1779 | 401 |
| 778 | 3300047322 | Ga0495680_0000314 | Ga0495680_0000314_12258_13676 | 401 |
| 779 | 3300047322 | Ga0495680_0035823 | Ga0495680_0035823_156_1577 | 401 |
| 780 | 3300047444 | Ga0495675_0069520 | Ga0495675_0069520_22_1440 | 401 |
| 781 | 3300047444 | Ga0495675_0076651 | Ga0495675_0076651_556_1977 | 401 |
| 782 | 3300047471 | Ga0495684_0015304 | Ga0495684_0015304_1820_3241 | 401 |
| 783 | 3300047673 | Ga0495593_0007958 | Ga0495593_0007958_449_1870 | 401 |
| 784 | 3300047673 | Ga0495593_0013821 | Ga0495593_0013821_2525_3943 | 401 |
| 785 | 3300048905 | Ga0496102_0212867 | Ga0496102_0212867_217_1638 | 401 |
| 786 | 3300048911 | Ga0496108_0000464 | Ga0496108_0000464_13490_14911 | 401 |
| 787 | 3300048912 | Ga0496109_0002389 | Ga0496109_0002389_12932_14353 | 401 |
| 788 | 3300048912 | Ga0496109_0133502 | Ga0496109_0133502_411_1832 | 401 |
| 789 | 3300048914 | Ga0496111_0029699 | Ga0496111_0029699_1633_3054 | 401 |
| 790 | 3300048915 | Ga0496112_0000004 | Ga0496112_0000004_131579_133009 | 401 |
| 791 | 3300048918 | Ga0496115_0034257 | Ga0496115_0034257_2259_3680 | 401 |
| 792 | 3300048924 | Ga0496121_0000902 | Ga0496121_0000902_19863_21290 | 401 |
| 793 | 3300048924 | Ga0496121_0028377 | Ga0496121_0028377_3126_4562 | 401 |
| 794 | 3300048929 | Ga0496126_0010498 | Ga0496126_0010498_4471_5898 | 401 |
| 795 | 3300048929 | Ga0496126_0015017 | Ga0496126_0015017_2915_4336 | 401 |
| 796 | 3300050492 | nmdc:mga0yw44_16799_c1 | nmdc:mga0yw44_16799_c1_1380_2801 | 401 |
| 797 | 3300050511 | nmdc:mga08y16_97546_c1 | nmdc:mga08y16_97546_c1_833_2269 | 401 |
| 798 | 3300053077 | Ga0495601_0084926 | Ga0495601_0084926_572_1990 | 401 |
| 799 | 3300053080 | Ga0500635_0001559 | Ga0500635_0001559_2552_3973 | 401 |
| 800 | 3300053084 | Ga0495595_0000602 | Ga0495595_0000602_676_2094 | 401 |
| 801 | 3300053085 | Ga0495619_0002618 | Ga0495619_0002618_572_1990 | 401 |
| 802 | 3300053087 | Ga0500643_000114 | Ga0500643_000114_80161_81582 | 401 |
| 803 | 3300053094 | Ga0500566_0012626 | Ga0500566_0012626_1364_2785 | 401 |
| 804 | 3300053119 | Ga0500595_003362 | Ga0500595_003362_856_2280 | 401 |
| 805 | 3300053131 | Ga0500652_054228 | Ga0500652_054228_59_1480 | 401 |
| 806 | 3300053136 | Ga0500559_0000205 | Ga0500559_0000205_36308_37729 | 401 |
| 807 | 3300053150 | Ga0500603_001043 | Ga0500603_001043_3202_4623 | 401 |
| 808 | 3300053153 | Ga0500616_0004067 | Ga0500616_0004067_7656_9083 | 401 |
| 809 | 3300053162 | Ga0500638_003387 | Ga0500638_003387_3365_4789 | 401 |
| 810 | 3300053163 | Ga0500639_019770 | Ga0500639_019770_1882_3303 | 401 |
| 811 | 3300053178 | Ga0500637_0016041 | Ga0500637_0016041_1714_3135 | 401 |
| 812 | 3300055283 | Ga0500661_000462 | Ga0500661_000462_3564_4988 | 401 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar