F481880

General Info

Members Datasets Scaffolds Average Seq Length
812 380 1624 296

Family's Representative Sequence

Representative Sequence 3300009098|Ga0105245_10327570|Ga0105245_103275702
Length 338
Sequence LVLEKKRVLTAHRLDNIAADRENTGLNVLFSFPTPNFEEPTVSEYDKQLQKVKNDKGFIAALDQSGGSTPKALKLYGVNEDAWTNEQGMYDVVHQMRSRIMTSPAFTGKRLLGAILFENTMDRDVAGKPTPTYLWEVKGVVPFLKVDKGLADEKDGVQMMKPMPDLDALLKKAKSKNVFGTKMRSVIKQANAAAIDAVVKQQFEVGKQILAAGLMPIIEPEVDIKTPNKDKAEELLKAAILKELNQLKPDQRVMLKLTIPEKDNLYADLIKHPNVLRVVALSGGYSREESNKRLARQNGMTASFSRALSEGLTKQQSDEEFNKALDASIESIYRASIT

Samples

Sample ID Description Type Environment
1 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
6 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
7 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
8 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
42 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
50 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
51 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
77 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
78 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
79 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
80 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
81 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
85 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
86 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
87 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
88 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
89 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
90 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
91 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
92 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
94 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
95 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
96 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
97 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
98 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
99 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
100 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
102 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
104 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
105 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
106 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
107 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
108 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
109 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
110 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
111 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
112 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
113 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
114 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
115 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
116 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
117 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
118 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
119 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
120 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
121 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
122 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
123 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
124 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
125 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
126 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
127 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
132 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
134 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
197 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
198 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
203 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
207 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
208 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
209 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
210 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
211 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
212 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
213 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
214 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
215 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
216 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
217 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
218 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
219 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
220 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
221 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
222 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
223 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
224 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
225 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
226 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
227 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
228 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
229 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
230 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
231 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
232 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
233 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
234 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
235 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
236 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
237 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
238 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
239 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
240 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
241 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
242 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
243 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
244 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
245 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
246 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
247 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
248 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
249 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
250 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
251 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
252 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
253 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
254 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
255 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
256 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
257 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
258 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
259 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
260 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
261 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
262 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
263 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
264 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
265 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
266 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
267 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
268 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
269 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
270 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
271 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
272 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
273 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
274 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
275 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
276 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
277 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
278 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
279 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
280 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
281 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
282 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
283 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
284 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
285 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
286 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
287 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
288 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
289 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
290 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
291 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
292 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
293 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
294 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
295 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
296 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
297 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
298 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
299 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
300 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
301 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
302 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
303 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
304 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
305 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
306 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
307 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
308 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
309 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
310 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
311 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
312 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
313 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
314 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
315 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
316 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
317 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
318 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
319 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
320 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
321 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
322 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
323 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
324 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
325 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
326 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
327 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
328 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
329 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
330 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
331 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
332 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
333 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
334 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
335 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
336 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
337 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
338 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
339 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
340 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
341 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
342 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
343 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
344 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
345 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
346 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
347 2519899754 Flavobacterium sp. F52 Isolate Rhizosphere
348 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
349 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
350 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
351 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
352 2643221716 Flavobacterium sp. Root901 Isolate Unclassified
353 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
354 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
355 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
356 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
357 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
358 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
359 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
360 2816332280 Flavobacterium johnsoniae GSE09 Isolate Unclassified
361 2818991441 Niallia circulans 3243 Isolate Rhizosphere
362 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
363 2857472729 Cohnella sp. R-74144 Isolate Unclassified
364 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
365 2881359912 Flavobacterium ustbae T13 Isolate Rhizosphere
366 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
367 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
368 2903895155 Flavobacterium sp. HBTb2-11-1 Isolate Rhizosphere
369 2904555929 Flavobacterium sp. 1750 Isolate Rhizosphere
370 2907202186 Paenibacillus sp. HJL G12 Isolate Unclassified
371 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
372 2919513703 Luteimonas sp. 3794 Isolate Unclassified
373 2919675420 Luteimonas terrae 4099 Isolate Unclassified
374 2958458903 Flavobacterium anhuiense RCM74 Isolate Rhizosphere
375 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
376 3006969106 Bacillus sp. FJAT-50079 Isolate Rhizosphere
377 3006988479 Bacillus sp. FJAT-49711 Isolate Rhizosphere
378 8054307821 Flavobacterium soyae SCIV07 Isolate Rhizosphere
379 8055419101 Flavobacterium tyrosinilyticum KCTC 42726 Isolate Rhizosphere
380 8055632911 Paenibacillus radicibacter N1-5-1-14 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.57
Metatranscriptomes 0.25
Isolates 4.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.68
Nodule 0.99
Rhizoplane 2.96
Rhizosphere 85.84
Stem 0
Stem Tuber 0
Unclassified 0.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105245_10327570 3300009098 Bacteria 1511
2 SwRhRL2b_contig_1200904 2162886007 Bacteria 1316
3 JGI25406J46586_10011250 3300003203 Bacteria 3932
4 rootH2_10036006 3300003320 Unclassified 4796
5 Ga0055535_1009958 3300003761 Bacteria 1595
6 Ga0055530_10000095 3300003791 Bacteria 74707
7 Ga0055530_10024324 3300003791 Bacteria 1720
8 Ga0055531_10002750 3300003794 Bacteria 11546
9 Ga0055531_10004838 3300003794 Bacteria 8035
10 Ga0055541_1004028 3300003841 Bacteria 2705
11 Ga0065712_10034659 3300005290 Bacteria 1416
12 Ga0065715_10113248 3300005293 Bacteria 2496
13 Ga0065707_10001302 3300005295 Bacteria 13694
14 Ga0065707_10247678 3300005295 Bacteria 1135
15 Ga0070676_10044650 3300005328 Bacteria 2580
16 Ga0070676_10046627 3300005328 Bacteria 2528
17 Ga0070676_10114050 3300005328 Bacteria 1687
18 Ga0070690_100072792 3300005330 Bacteria 2235
19 Ga0070690_100189801 3300005330 Bacteria 1424
20 Ga0070690_100290753 3300005330 Bacteria 1168
21 Ga0070670_100002372 3300005331 Bacteria 15519
22 Ga0070670_100016454 3300005331 Bacteria 6351
23 Ga0070670_100036862 3300005331 Bacteria 4207
24 Ga0070670_100069322 3300005331 Bacteria 3027
25 Ga0070670_100088663 3300005331 Bacteria 2659
26 Ga0070670_100404492 3300005331 Bacteria 1205
27 Ga0068869_100009681 3300005334 Bacteria 6257
28 Ga0068869_100070150 3300005334 Bacteria 2592
29 Ga0068869_100104841 3300005334 Bacteria 2144
30 Ga0070666_10007408 3300005335 Bacteria 6764
31 Ga0070666_10021517 3300005335 Bacteria 4182
32 Ga0070666_10038577 3300005335 Bacteria 3179
33 Ga0070666_10340433 3300005335 Bacteria 1072
34 Ga0070680_100201120 3300005336 Bacteria 1680
35 Ga0070682_100007256 3300005337 Bacteria 6247
36 Ga0068868_100010385 3300005338 Bacteria 6738
37 Ga0068868_100010777 3300005338 Bacteria 6629
38 Ga0068868_100053432 3300005338 Bacteria 3182
39 Ga0070660_100081063 3300005339 Bacteria 2547
40 Ga0070660_100098032 3300005339 Bacteria 2320
41 Ga0070660_100214305 3300005339 Bacteria 1564
42 Ga0070689_100224106 3300005340 Bacteria 1543
43 Ga0070689_100452621 3300005340 Bacteria 1093
44 Ga0070691_10002104 3300005341 Bacteria 8806
45 Ga0070687_100155325 3300005343 Bacteria 1347
46 Ga0070692_10038830 3300005345 Bacteria 2429
47 Ga0070668_100003541 3300005347 Bacteria 11518
48 Ga0070668_100008311 3300005347 Bacteria 7704
49 Ga0070668_100009156 3300005347 Bacteria 7346
50 Ga0070668_100025721 3300005347 Bacteria 4464
51 Ga0070668_100043584 3300005347 Bacteria 3441
52 Ga0070668_100093435 3300005347 Bacteria 2374
53 Ga0070668_100115903 3300005347 Bacteria 2136
54 Ga0070668_100185480 3300005347 Bacteria 1701
55 Ga0070669_100054641 3300005353 Bacteria 2925
56 Ga0070669_100063261 3300005353 Bacteria 2723
57 Ga0070675_100013399 3300005354 Bacteria 6444
58 Ga0070675_100018757 3300005354 Bacteria 5507
59 Ga0070675_100087113 3300005354 Bacteria 2611
60 Ga0070671_100007579 3300005355 Bacteria 8678
61 Ga0070671_100023116 3300005355 Bacteria 5082
62 Ga0070671_100024813 3300005355 Bacteria 4912
63 Ga0070671_100025962 3300005355 Bacteria 4810
64 Ga0070674_100003696 3300005356 Bacteria 8621
65 Ga0070674_100046640 3300005356 Bacteria 2966
66 Ga0070674_100130282 3300005356 Bacteria 1874
67 Ga0070674_100154285 3300005356 Bacteria 1736
68 Ga0070674_100159097 3300005356 Bacteria 1712
69 Ga0070674_100236272 3300005356 Bacteria 1429
70 Ga0070673_100000655 3300005364 Bacteria 18982
71 Ga0070673_100051077 3300005364 Bacteria 3236
72 Ga0070673_100134718 3300005364 Bacteria 2078
73 Ga0070673_100174380 3300005364 Bacteria 1837
74 Ga0070673_100276634 3300005364 Bacteria 1471
75 Ga0070673_100282809 3300005364 Bacteria 1455
76 Ga0070659_100046732 3300005366 Bacteria 3393
77 Ga0070659_100061193 3300005366 Bacteria 2975
78 Ga0070659_100089500 3300005366 Bacteria 2466
79 Ga0070659_100180024 3300005366 Bacteria 1734
80 Ga0070667_100022052 3300005367 Bacteria 5284
81 Ga0070667_100049692 3300005367 Bacteria 3533
82 Ga0070667_100144558 3300005367 Bacteria 2085
83 Ga0070667_100163160 3300005367 Bacteria 1964
84 Ga0070709_10056874 3300005434 Bacteria 2475
85 Ga0070714_100047289 3300005435 Bacteria 3654
86 Ga0070714_100102162 3300005435 Bacteria 2527
87 Ga0070713_100000129 3300005436 Bacteria 49577
88 Ga0070713_100011017 3300005436 Bacteria 6563
89 Ga0070713_100227997 3300005436 Bacteria 1692
90 Ga0070710_10025987 3300005437 Bacteria 3106
91 Ga0070701_10018566 3300005438 Bacteria 3271
92 Ga0070701_10128777 3300005438 Bacteria 1436
93 Ga0070711_100053234 3300005439 Bacteria 2788
94 Ga0070705_100059544 3300005440 Bacteria 2262
95 Ga0070700_100107989 3300005441 Bacteria 1845
96 Ga0070694_100023303 3300005444 Bacteria 3980
97 Ga0070708_100210850 3300005445 Bacteria 1820
98 Ga0070663_100002768 3300005455 Bacteria 9944
99 Ga0070663_100058868 3300005455 Bacteria 2760
100 Ga0070663_100384310 3300005455 Bacteria 1144
101 Ga0070678_100016864 3300005456 Bacteria 4685
102 Ga0070678_100058624 3300005456 Bacteria 2827
103 Ga0070678_100087487 3300005456 Bacteria 2380
104 Ga0070678_100099566 3300005456 Bacteria 2249
105 Ga0070678_100111900 3300005456 Bacteria 2137
106 Ga0070678_100188719 3300005456 Bacteria 1693
107 Ga0070662_100027611 3300005457 Bacteria 3942
108 Ga0070662_100032993 3300005457 Bacteria 3643
109 Ga0070681_10036085 3300005458 Bacteria 4966
110 Ga0068867_100008910 3300005459 Bacteria 7080
111 Ga0068867_100012739 3300005459 Bacteria 5951
112 Ga0068867_100060218 3300005459 Bacteria 2816
113 Ga0068867_100130818 3300005459 Bacteria 1950
114 Ga0068867_100144524 3300005459 Bacteria 1862
115 Ga0070685_10059630 3300005466 Bacteria 2229
116 Ga0070685_10075512 3300005466 Bacteria 2008
117 Ga0070706_100159173 3300005467 Unclassified 2108
118 Ga0070707_100016769 3300005468 Bacteria 6877
119 Ga0070699_100000708 3300005518 Bacteria 30920
120 Ga0070679_100018240 3300005530 Bacteria 6806
121 Ga0070679_100148494 3300005530 Bacteria 2321
122 Ga0070679_100240896 3300005530 Bacteria 1766
123 Ga0070684_100059898 3300005535 Bacteria 3329
124 Ga0068853_100009347 3300005539 Bacteria 7903
125 Ga0068853_100026886 3300005539 Bacteria 4834
126 Ga0070672_100003611 3300005543 Bacteria 10031
127 Ga0070672_100037283 3300005543 Bacteria 3708
128 Ga0070672_100335838 3300005543 Bacteria 1286
129 Ga0070686_100189910 3300005544 Bacteria 1465
130 Ga0070693_100008277 3300005547 Bacteria 5116
131 Ga0070665_100036933 3300005548 Bacteria 4912
132 Ga0070665_100042010 3300005548 Bacteria 4596
133 Ga0070665_100056106 3300005548 Bacteria 3950
134 Ga0070665_100233743 3300005548 Bacteria 1839
135 Ga0070704_100010008 3300005549 Bacteria 5760
136 Ga0068855_100104113 3300005563 Bacteria 3265
137 Ga0068855_100214605 3300005563 Bacteria 2161
138 Ga0070664_100004030 3300005564 Bacteria 11799
139 Ga0070664_100121064 3300005564 Bacteria 2291
140 Ga0068854_100012579 3300005578 Bacteria 5545
141 Ga0068854_100025046 3300005578 Bacteria 4093
142 Ga0068856_100004065 3300005614 Bacteria 14642
143 Ga0070702_100003679 3300005615 Bacteria 6902
144 Ga0070702_100031295 3300005615 Bacteria 2909
145 Ga0070702_100068191 3300005615 Bacteria 2092
146 Ga0068852_100039684 3300005616 Bacteria 3965
147 Ga0068852_100041014 3300005616 Bacteria 3909
148 Ga0068852_100157893 3300005616 Bacteria 2115
149 Ga0068852_100183993 3300005616 Bacteria 1966
150 Ga0068852_100262884 3300005616 Bacteria 1658
151 Ga0068859_100025822 3300005617 Bacteria 5894
152 Ga0068859_100032362 3300005617 Bacteria 5254
153 Ga0068859_100035474 3300005617 Bacteria 5004
154 Ga0068859_100042445 3300005617 Bacteria 4568
155 Ga0068859_100079439 3300005617 Bacteria 3321
156 Ga0068859_100674452 3300005617 Bacteria 1125
157 Ga0068864_100027348 3300005618 Bacteria 4817
158 Ga0068864_100095074 3300005618 Bacteria 2635
159 Ga0068864_100116887 3300005618 Bacteria 2380
160 Ga0068864_100122909 3300005618 Bacteria 2323
161 Ga0068864_100149781 3300005618 Bacteria 2112
162 Ga0068864_100283518 3300005618 Bacteria 1547
163 Ga0068866_10118921 3300005718 Bacteria 1486
164 Ga0068861_100003730 3300005719 Bacteria 10161
165 Ga0068861_100095142 3300005719 Bacteria 2358
166 Ga0068861_100127650 3300005719 Bacteria 2060
167 Ga0068861_100220865 3300005719 Bacteria 1602
168 Ga0068851_10001051 3300005834 Bacteria 11959
169 Ga0068851_10009294 3300005834 Bacteria 4564
170 Ga0068851_10077806 3300005834 Bacteria 1727
171 Ga0068851_10081757 3300005834 Bacteria 1688
172 Ga0068870_10001962 3300005840 Bacteria 8504
173 Ga0068870_10051449 3300005840 Bacteria 2180
174 Ga0068870_10192874 3300005840 Bacteria 1230
175 Ga0068863_100003730 3300005841 Bacteria 15066
176 Ga0068863_100016873 3300005841 Bacteria 7003
177 Ga0068863_100087307 3300005841 Bacteria 2955
178 Ga0068858_100010789 3300005842 Bacteria 8636
179 Ga0068858_100020301 3300005842 Bacteria 6213
180 Ga0068858_100076998 3300005842 Bacteria 3098
181 Ga0068858_100145629 3300005842 Bacteria 2225
182 Ga0068858_100211914 3300005842 Bacteria 1833
183 Ga0068858_100402097 3300005842 Bacteria 1316
184 Ga0068858_100585921 3300005842 Bacteria 1081
185 Ga0068860_100022098 3300005843 Bacteria 6158
186 Ga0068860_100126704 3300005843 Bacteria 2447
187 Ga0068860_100198483 3300005843 Bacteria 1944
188 Ga0068860_100515916 3300005843 Bacteria 1195
189 Ga0068862_100008255 3300005844 Bacteria 8614
190 Ga0068862_100011911 3300005844 Bacteria 7183
191 Ga0068862_100030190 3300005844 Bacteria 4567
192 Ga0068862_100174977 3300005844 Bacteria 1924
193 Ga0068862_100178804 3300005844 Bacteria 1903
194 Ga0068862_100485875 3300005844 Bacteria 1170
195 Ga0081455_10042044 3300005937 Bacteria 4013
196 Ga0081455_10086820 3300005937 Bacteria 2547
197 Ga0081539_10000927 3300005985 Bacteria 55152
198 Ga0081539_10045116 3300005985 Bacteria 2538
199 Ga0070717_10012513 3300006028 Bacteria 6473
200 Ga0070717_10070126 3300006028 Bacteria 2920
201 Ga0070717_10080300 3300006028 Bacteria 2736
202 Ga0070717_10216537 3300006028 Bacteria 1682
203 Ga0070717_10620385 3300006028 Bacteria 981
204 Ga0075365_10118627 3300006038 Bacteria 1823
205 Ga0075365_10193734 3300006038 Bacteria 1423
206 Ga0075365_10204591 3300006038 Bacteria 1383
207 Ga0070712_100201659 3300006175 Bacteria 1563
208 Ga0075367_10039793 3300006178 Bacteria 2742
209 Ga0075367_10283228 3300006178 Bacteria 1042
210 Ga0097621_100014203 3300006237 Bacteria 5954
211 Ga0097621_100030796 3300006237 Bacteria 4252
212 Ga0097621_100349621 3300006237 Bacteria 1314
213 Ga0068871_100022746 3300006358 Bacteria 4838
214 Ga0068871_100031530 3300006358 Bacteria 4181
215 Ga0068871_100043670 3300006358 Bacteria 3602
216 Ga0068871_100047252 3300006358 Bacteria 3470
217 Ga0068871_100075727 3300006358 Bacteria 2778
218 Ga0068871_100275157 3300006358 Bacteria 1471
219 Ga0075428_100190255 3300006844 Bacteria 2220
220 Ga0075428_100261056 3300006844 Bacteria 1865
221 Ga0075430_100075967 3300006846 Bacteria 2816
222 Ga0075430_100131372 3300006846 Bacteria 2087
223 Ga0075430_100335223 3300006846 Bacteria 1250
224 Ga0075431_100036988 3300006847 Bacteria 5028
225 Ga0075431_100072856 3300006847 Bacteria 3544
226 Ga0075431_100154691 3300006847 Bacteria 2360
227 Ga0075433_10011974 3300006852 Bacteria 6993
228 Ga0075434_100008016 3300006871 Bacteria 9788
229 Ga0075429_100150497 3300006880 Bacteria 2038
230 Ga0075429_100185014 3300006880 Bacteria 1825
231 Ga0068865_100008038 3300006881 Bacteria 6512
232 Ga0075436_100010195 3300006914 Bacteria 6435
233 Ga0097620_100025822 3300006931 Bacteria 5894
234 Ga0097620_100032362 3300006931 Bacteria 5254
235 Ga0097620_100035474 3300006931 Bacteria 5004
236 Ga0097620_100042445 3300006931 Bacteria 4568
237 Ga0097620_100079438 3300006931 Bacteria 3321
238 Ga0097620_100674499 3300006931 Bacteria 1125
239 Ga0099824_1007872 3300006942 Bacteria 13879
240 Ga0079104_1000146 3300006946 Bacteria 99148
241 Ga0079104_1016660 3300006946 Bacteria 2140
242 Ga0079104_1023901 3300006946 Bacteria 1618
243 Ga0099826_10005057 3300006948 Bacteria 9372
244 Ga0075435_100012598 3300007076 Bacteria 6264
245 Ga0105251_10055930 3300009011 Bacteria 1869
246 Ga0105250_10000006 3300009092 Bacteria 390071
247 Ga0105240_10010715 3300009093 Bacteria 12862
248 Ga0105240_10017187 3300009093 Bacteria 9759
249 Ga0105240_10089075 3300009093 Bacteria 3775
250 Ga0111539_10057862 3300009094 Bacteria 4602
251 Ga0111539_10071416 3300009094 Bacteria 4096
252 Ga0111539_10120566 3300009094 Bacteria 3073
253 Ga0111539_10307347 3300009094 Bacteria 1845
254 Ga0111539_10336516 3300009094 Bacteria 1757
255 Ga0111539_10683653 3300009094 Bacteria 1195
256 Ga0105245_10008219 3300009098 Bacteria 9124
257 Ga0105245_10026816 3300009098 Bacteria 5073
258 Ga0105245_10448387 3300009098 Bacteria 1298
259 Ga0105247_10004007 3300009101 Bacteria 9476
260 Ga0105247_10148587 3300009101 Bacteria 1542
261 Ga0114129_10069834 3300009147 Bacteria 4897
262 Ga0114129_10520896 3300009147 Bacteria 1550
263 Ga0105243_10034179 3300009148 Bacteria 3934
264 Ga0105241_10025396 3300009174 Bacteria 4402
265 Ga0105241_10104068 3300009174 Bacteria 2261
266 Ga0105241_10195305 3300009174 Bacteria 1687
267 Ga0105242_10088775 3300009176 Bacteria 2598
268 Ga0105248_10016488 3300009177 Bacteria 8132
269 Ga0105248_10113758 3300009177 Bacteria 3052
270 Ga0105248_10218452 3300009177 Bacteria 2146
271 Ga0105237_10013036 3300009545 Bacteria 8728
272 Ga0105237_10046598 3300009545 Bacteria 4360
273 Ga0105237_10209728 3300009545 Bacteria 1948
274 Ga0105238_10067892 3300009551 Bacteria 3566
275 Ga0105238_10142509 3300009551 Bacteria 2373
276 Ga0105249_10014648 3300009553 Bacteria 6932
277 Ga0105249_10107042 3300009553 Bacteria 2638
278 Ga0105249_10259151 3300009553 Bacteria 1727
279 Ga0105239_10000037 3300010375 Bacteria 206779
280 Ga0105239_10056407 3300010375 Bacteria 4309
281 Ga0105239_10111081 3300010375 Bacteria 3038
282 Ga0105239_10648910 3300010375 Bacteria 1205
283 Ga0105246_10007529 3300011119 Bacteria 6678
284 Ga0157373_10000023 3300013100 Bacteria 164200
285 Ga0157373_10080711 3300013100 Bacteria 2294
286 Ga0157371_10008583 3300013102 Bacteria 8122
287 Ga0157371_10039729 3300013102 Bacteria 3364
288 Ga0157371_10131106 3300013102 Bacteria 1783
289 Ga0157371_10165535 3300013102 Bacteria 1579
290 Ga0157370_10003921 3300013104 Bacteria 17335
291 Ga0157370_10013827 3300013104 Bacteria 8291
292 Ga0157369_10050251 3300013105 Bacteria 4516
293 Ga0157374_10002677 3300013296 Bacteria 14989
294 Ga0157374_10016721 3300013296 Bacteria 6454
295 Ga0157374_10054267 3300013296 Bacteria 3738
296 Ga0157374_10074957 3300013296 Bacteria 3197
297 Ga0157374_10375497 3300013296 Bacteria 1416
298 Ga0157378_10000631 3300013297 Bacteria 33043
299 Ga0157378_10060000 3300013297 Bacteria 3394
300 Ga0157378_10074921 3300013297 Bacteria 3046
301 Ga0163162_10005487 3300013306 Bacteria 12255
302 Ga0157375_10019639 3300013308 Bacteria 6152
303 Ga0157375_10061837 3300013308 Bacteria 3719
304 Ga0157375_10108044 3300013308 Bacteria 2876
305 Ga0157375_10155169 3300013308 Bacteria 2428
306 Ga0157375_10286061 3300013308 Bacteria 1812
307 Ga0163163_10007534 3300014325 Bacteria 9609
308 Ga0157380_10002142 3300014326 Bacteria 13248
309 Ga0157380_10002279 3300014326 Bacteria 12894
310 Ga0157380_10008389 3300014326 Bacteria 7371
311 Ga0157380_10032855 3300014326 Bacteria 3993
312 Ga0157380_10033683 3300014326 Bacteria 3946
313 Ga0157380_10078277 3300014326 Bacteria 2697
314 Ga0157380_10080884 3300014326 Bacteria 2656
315 Ga0157380_10116787 3300014326 Bacteria 2253
316 Ga0157377_10097218 3300014745 Bacteria 1748
317 Ga0157377_10280655 3300014745 Bacteria 1092
318 Ga0157379_10000830 3300014968 Bacteria 25057
319 Ga0157379_10039058 3300014968 Bacteria 4235
320 Ga0157379_10181531 3300014968 Bacteria 1901
321 Ga0157379_10253425 3300014968 Bacteria 1598
322 Ga0157376_10041860 3300014969 Bacteria 3753
323 Ga0157376_10051232 3300014969 Bacteria 3429
324 Ga0157376_10061915 3300014969 Bacteria 3147
325 Ga0157376_10096073 3300014969 Bacteria 2578
326 Ga0157376_10320753 3300014969 Bacteria 1473
327 Ga0182006_1002701 3300015261 Bacteria 9523
328 Ga0182006_1017283 3300015261 Bacteria 3066
329 Ga0182006_1017297 3300015261 Bacteria 3065
330 Ga0163161_10287141 3300017792 Bacteria 1292
331 Ga0163161_10511148 3300017792 Bacteria 980
332 Ga0206353_11795824 3300020082 Bacteria 1397
333 Ga0209566_100052 3300025225 Bacteria 231848
334 Ga0209147_103612 3300025229 Bacteria 2909
335 Ga0209258_101156 3300025242 Bacteria 10794
336 Ga0209675_1000025 3300025291 Bacteria 294102
337 Ga0209676_1000198 3300025292 Bacteria 134708
338 Ga0209676_1000362 3300025292 Bacteria 85770
339 Ga0209676_1003189 3300025292 Bacteria 10409
340 Ga0209676_1041396 3300025292 Bacteria 1288
341 Ga0209025_1019137 3300025294 Bacteria 3826
342 Ga0209025_1041993 3300025294 Bacteria 1949
343 Ga0209050_1000849 3300025298 Bacteria 41596
344 Ga0209050_1003508 3300025298 Bacteria 11474
345 Ga0209257_1000860 3300025304 Bacteria 43237
346 Ga0209257_1001370 3300025304 Bacteria 29369
347 Ga0209257_1003116 3300025304 Bacteria 14836
348 Ga0207697_10004336 3300025315 Bacteria 6790
349 Ga0207696_1000069 3300025711 Bacteria 227744
350 Ga0207655_1000003 3300025728 Bacteria 1081376
351 Ga0207682_10000798 3300025893 Bacteria 14551
352 Ga0207682_10002137 3300025893 Bacteria 8961
353 Ga0207682_10015311 3300025893 Bacteria 2984
354 Ga0207642_10025189 3300025899 Bacteria 2403
355 Ga0207642_10031370 3300025899 Bacteria 2225
356 Ga0207642_10246690 3300025899 Bacteria 1011
357 Ga0207710_10015418 3300025900 Bacteria 3229
358 Ga0207688_10032338 3300025901 Bacteria 2891
359 Ga0207688_10048236 3300025901 Bacteria 2379
360 Ga0207688_10066672 3300025901 Bacteria 2036
361 Ga0207680_10030105 3300025903 Bacteria 3057
362 Ga0207680_10108620 3300025903 Bacteria 1795
363 Ga0207647_10146562 3300025904 Bacteria 1381
364 Ga0207647_10167662 3300025904 Bacteria 1279
365 Ga0207699_10004323 3300025906 Bacteria 6796
366 Ga0207645_10001048 3300025907 Bacteria 22872
367 Ga0207645_10047151 3300025907 Bacteria 2752
368 Ga0207645_10055042 3300025907 Bacteria 2540
369 Ga0207645_10094092 3300025907 Bacteria 1929
370 Ga0207645_10119781 3300025907 Bacteria 1708
371 Ga0207643_10000594 3300025908 Bacteria 22954
372 Ga0207643_10046706 3300025908 Bacteria 2448
373 Ga0207643_10123129 3300025908 Bacteria 1538
374 Ga0207654_10134043 3300025911 Bacteria 1571
375 Ga0207695_10001017 3300025913 Bacteria 49429
376 Ga0207695_10031430 3300025913 Bacteria 5823
377 Ga0207695_10046636 3300025913 Bacteria 4592
378 Ga0207695_10109233 3300025913 Bacteria 2748
379 Ga0207671_10004808 3300025914 Bacteria 12723
380 Ga0207671_10052375 3300025914 Bacteria 3025
381 Ga0207671_10091997 3300025914 Bacteria 2286
382 Ga0207693_10024239 3300025915 Bacteria 4817
383 Ga0207663_10016077 3300025916 Bacteria 4141
384 Ga0207660_10007800 3300025917 Bacteria 6928
385 Ga0207660_10028542 3300025917 Bacteria 3817
386 Ga0207662_10155727 3300025918 Bacteria 1456
387 Ga0207657_10022327 3300025919 Bacteria 5924
388 Ga0207657_10076906 3300025919 Bacteria 2815
389 Ga0207657_10085036 3300025919 Bacteria 2651
390 Ga0207649_10002784 3300025920 Bacteria 9659
391 Ga0207652_10122608 3300025921 Bacteria 2313
392 Ga0207652_10354277 3300025921 Bacteria 1325
393 Ga0207646_10001356 3300025922 Bacteria 30379
394 Ga0207681_10012027 3300025923 Bacteria 5331
395 Ga0207681_10045203 3300025923 Bacteria 2955
396 Ga0207681_10080936 3300025923 Bacteria 2292
397 Ga0207681_10186577 3300025923 Bacteria 1583
398 Ga0207694_10248910 3300025924 Bacteria 1454
399 Ga0207650_10001016 3300025925 Bacteria 21075
400 Ga0207650_10001564 3300025925 Bacteria 16366
401 Ga0207650_10003470 3300025925 Bacteria 10830
402 Ga0207650_10040514 3300025925 Bacteria 3409
403 Ga0207659_10002573 3300025926 Bacteria 10802
404 Ga0207659_10011881 3300025926 Bacteria 5516
405 Ga0207659_10019574 3300025926 Bacteria 4459
406 Ga0207659_10236941 3300025926 Bacteria 1474
407 Ga0207687_10030832 3300025927 Bacteria 3619
408 Ga0207700_10000044 3300025928 Bacteria 89454
409 Ga0207700_10001414 3300025928 Bacteria 13622
410 Ga0207700_10071401 3300025928 Bacteria 2673
411 Ga0207664_10005921 3300025929 Bacteria 8365
412 Ga0207664_10036227 3300025929 Bacteria 3813
413 Ga0207664_10449804 3300025929 Bacteria 1150
414 Ga0207644_10002140 3300025931 Bacteria 12809
415 Ga0207644_10003507 3300025931 Bacteria 10153
416 Ga0207644_10089931 3300025931 Bacteria 2286
417 Ga0207690_10074617 3300025932 Bacteria 2349
418 Ga0207690_10194039 3300025932 Bacteria 1538
419 Ga0207690_10227839 3300025932 Bacteria 1429
420 Ga0207706_10006526 3300025933 Bacteria 10815
421 Ga0207706_10015081 3300025933 Bacteria 6995
422 Ga0207706_10022657 3300025933 Bacteria 5637
423 Ga0207706_10261322 3300025933 Bacteria 1511
424 Ga0207709_10052850 3300025935 Bacteria 2497
425 Ga0207709_10081325 3300025935 Bacteria 2088
426 Ga0207709_10149120 3300025935 Bacteria 1618
427 Ga0207670_10051408 3300025936 Bacteria 2767
428 Ga0207670_10157127 3300025936 Bacteria 1694
429 Ga0207670_10380867 3300025936 Bacteria 1124
430 Ga0207669_10002485 3300025937 Bacteria 7864
431 Ga0207669_10007588 3300025937 Bacteria 5031
432 Ga0207669_10067523 3300025937 Bacteria 2229
433 Ga0207669_10077647 3300025937 Bacteria 2113
434 Ga0207669_10517847 3300025937 Bacteria 957
435 Ga0207704_10030885 3300025938 Bacteria 3010
436 Ga0207704_10190312 3300025938 Bacteria 1492
437 Ga0207665_10384990 3300025939 Bacteria 1065
438 Ga0207691_10000180 3300025940 Bacteria 59800
439 Ga0207691_10003262 3300025940 Bacteria 15803
440 Ga0207691_10007125 3300025940 Bacteria 10793
441 Ga0207691_10038037 3300025940 Bacteria 4452
442 Ga0207691_10054083 3300025940 Bacteria 3663
443 Ga0207691_10060715 3300025940 Bacteria 3435
444 Ga0207691_10120971 3300025940 Bacteria 2320
445 Ga0207691_10136420 3300025940 Bacteria 2164
446 Ga0207711_10005883 3300025941 Bacteria 10354
447 Ga0207711_10092518 3300025941 Bacteria 2661
448 Ga0207711_10142554 3300025941 Bacteria 2157
449 Ga0207689_10001431 3300025942 Bacteria 22792
450 Ga0207689_10024871 3300025942 Bacteria 5020
451 Ga0207689_10049684 3300025942 Bacteria 3460
452 Ga0207689_10199433 3300025942 Bacteria 1652
453 Ga0207661_10003516 3300025944 Bacteria 10885
454 Ga0207661_10080148 3300025944 Bacteria 2693
455 Ga0207679_10043675 3300025945 Bacteria 3229
456 Ga0207667_10360925 3300025949 Bacteria 1481
457 Ga0207651_10074105 3300025960 Bacteria 2423
458 Ga0207651_10075588 3300025960 Bacteria 2404
459 Ga0207651_10141206 3300025960 Bacteria 1861
460 Ga0207651_10401937 3300025960 Bacteria 1165
461 Ga0207668_10000060 3300025972 Bacteria 89732
462 Ga0207668_10007605 3300025972 Bacteria 6450
463 Ga0207668_10050245 3300025972 Bacteria 2872
464 Ga0207668_10092305 3300025972 Bacteria 2228
465 Ga0207658_10023664 3300025986 Bacteria 4290
466 Ga0207658_10041264 3300025986 Bacteria 3341
467 Ga0207658_10076747 3300025986 Bacteria 2547
468 Ga0207658_10418344 3300025986 Bacteria 1181
469 Ga0207677_10072693 3300026023 Bacteria 2432
470 Ga0207677_10094007 3300026023 Bacteria 2187
471 Ga0207677_10551133 3300026023 Bacteria 1005
472 Ga0207703_10012833 3300026035 Bacteria 6533
473 Ga0207703_10041853 3300026035 Bacteria 3673
474 Ga0207703_10069667 3300026035 Bacteria 2901
475 Ga0207703_10371529 3300026035 Bacteria 1321
476 Ga0207639_10082507 3300026041 Bacteria 2548
477 Ga0207639_10109132 3300026041 Bacteria 2251
478 Ga0207678_10001818 3300026067 Bacteria 19546
479 Ga0207678_10008182 3300026067 Bacteria 9223
480 Ga0207678_10214587 3300026067 Bacteria 1647
481 Ga0207708_10006356 3300026075 Bacteria 8756
482 Ga0207708_10034973 3300026075 Bacteria 3822
483 Ga0207708_10053197 3300026075 Bacteria 3084
484 Ga0207708_10127160 3300026075 Bacteria 1990
485 Ga0207702_10001992 3300026078 Bacteria 19810
486 Ga0207702_10021932 3300026078 Bacteria 5289
487 Ga0207641_10010191 3300026088 Bacteria 7729
488 Ga0207641_10031263 3300026088 Bacteria 4415
489 Ga0207641_10041337 3300026088 Bacteria 3863
490 Ga0207648_10005794 3300026089 Bacteria 12379
491 Ga0207648_10012777 3300026089 Bacteria 7845
492 Ga0207648_10017845 3300026089 Bacteria 6440
493 Ga0207648_10048341 3300026089 Bacteria 3725
494 Ga0207648_10077587 3300026089 Bacteria 2896
495 Ga0207648_10111844 3300026089 Bacteria 2398
496 Ga0207648_10118701 3300026089 Bacteria 2325
497 Ga0207648_10170115 3300026089 Bacteria 1926
498 Ga0207676_10000896 3300026095 Bacteria 23105
499 Ga0207676_10005522 3300026095 Bacteria 8948
500 Ga0207676_10060724 3300026095 Bacteria 2991
501 Ga0207676_10104749 3300026095 Bacteria 2353
502 Ga0207676_10112461 3300026095 Bacteria 2281
503 Ga0207676_10155031 3300026095 Bacteria 1977
504 Ga0207674_10030489 3300026116 Bacteria 5668
505 Ga0207675_100015760 3300026118 Bacteria 7048
506 Ga0207675_100023333 3300026118 Bacteria 5754
507 Ga0207675_100039045 3300026118 Bacteria 4431
508 Ga0207675_100086921 3300026118 Bacteria 2936
509 Ga0207675_100450507 3300026118 Bacteria 1275
510 Ga0207675_100594747 3300026118 Bacteria 1109
511 Ga0207683_10000146 3300026121 Bacteria 58543
512 Ga0207683_10001721 3300026121 Bacteria 19553
513 Ga0207683_10001789 3300026121 Bacteria 19023
514 Ga0207683_10065769 3300026121 Bacteria 3197
515 Ga0207683_10163499 3300026121 Bacteria 2013
516 Ga0207683_10180368 3300026121 Bacteria 1915
517 Ga0207683_10346564 3300026121 Bacteria 1363
518 Ga0207698_10002118 3300026142 Bacteria 11709
519 Ga0207698_10026942 3300026142 Bacteria 4073
520 Ga0207698_10062486 3300026142 Bacteria 2908
521 Ga0209281_1000045 3300027111 Bacteria 328124
522 Ga0209281_1004536 3300027111 Bacteria 4131
523 Ga0209489_108520 3300027361 Bacteria 13879
524 Ga0210002_1018120 3300027617 Bacteria 1124
525 Ga0209971_1003179 3300027682 Bacteria 3915
526 Ga0209966_1005269 3300027695 Bacteria 2218
527 Ga0209974_10014042 3300027876 Bacteria 2668
528 Ga0209974_10056085 3300027876 Bacteria 1329
529 Ga0209974_10109539 3300027876 Bacteria 971
530 Ga0207428_10015402 3300027907 Bacteria 6615
531 Ga0207428_10214012 3300027907 Bacteria 1447
532 Ga0268266_10028457 3300028379 Bacteria 4750
533 Ga0268266_10208928 3300028379 Bacteria 1790
534 Ga0268266_10287376 3300028379 Bacteria 1530
535 Ga0268265_10007031 3300028380 Bacteria 7610
536 Ga0268265_10050752 3300028380 Bacteria 3127
537 Ga0268264_10008954 3300028381 Bacteria 8308
538 Ga0268264_10018610 3300028381 Bacteria 5679
539 Ga0268264_10086517 3300028381 Bacteria 2693
540 Ga0268264_10095159 3300028381 Bacteria 2577
541 Ga0268264_10207103 3300028381 Bacteria 1798
542 Ga0268264_10282555 3300028381 Bacteria 1555
543 Ga0265334_10016887 3300028573 Bacteria 3018
544 Ga0265318_10011555 3300028577 Bacteria 3795
545 Ga0265338_10015955 3300028800 Bacteria 8213
546 Ga0265330_10030331 3300031235 Bacteria 2429
547 Ga0265332_10014637 3300031238 Bacteria 3468
548 Ga0265340_10092203 3300031247 Bacteria 1415
549 Ga0265331_10008258 3300031250 Bacteria 5934
550 Ga0265316_10018778 3300031344 Bacteria 5935
551 Ga0307408_100000475 3300031548 Bacteria 35093
552 Ga0307408_100163213 3300031548 Bacteria 1771
553 Ga0307408_100404560 3300031548 Bacteria 1173
554 Ga0307408_100438842 3300031548 Bacteria 1130
555 Ga0316575_10076015 3300031665 Bacteria 1352
556 Ga0316579_10005942 3300031691 Bacteria 4950
557 Ga0265314_10000595 3300031711 Bacteria 45508
558 Ga0265342_10051906 3300031712 Bacteria 2445
559 Ga0316576_10004148 3300031727 Bacteria 8646
560 Ga0316576_10087355 3300031727 Bacteria 2320
561 Ga0316576_10125682 3300031727 Bacteria 1927
562 Ga0316576_10145717 3300031727 Bacteria 1783
563 Ga0316578_10017721 3300031728 Bacteria 3882
564 Ga0316578_10166068 3300031728 Bacteria 1330
565 Ga0307405_10010037 3300031731 Bacteria 4885
566 Ga0316577_10028417 3300031733 Bacteria 3120
567 Ga0316577_10072127 3300031733 Bacteria 1927
568 Ga0316577_10122595 3300031733 Bacteria 1461
569 Ga0307413_10014744 3300031824 Bacteria 3982
570 Ga0307413_10201004 3300031824 Bacteria 1439
571 Ga0307410_10005332 3300031852 Bacteria 6791
572 Ga0307410_10009576 3300031852 Bacteria 5442
573 Ga0307410_10018238 3300031852 Bacteria 4237
574 Ga0307410_10020706 3300031852 Bacteria 4030
575 Ga0307406_10000062 3300031901 Bacteria 60112
576 Ga0307406_10030734 3300031901 Bacteria 3264
577 Ga0307407_10000440 3300031903 Bacteria 12687
578 Ga0307407_10001616 3300031903 Bacteria 8325
579 Ga0307407_10043850 3300031903 Bacteria 2517
580 Ga0307412_10111294 3300031911 Bacteria 1956
581 Ga0307412_10151594 3300031911 Bacteria 1711
582 Ga0307409_100007763 3300031995 Bacteria 6451
583 Ga0307409_100078235 3300031995 Bacteria 2660
584 Ga0307409_100089516 3300031995 Bacteria 2516
585 Ga0307409_100275035 3300031995 Bacteria 1553
586 Ga0307416_100000394 3300032002 Bacteria 22418
587 Ga0307416_100008628 3300032002 Bacteria 6596
588 Ga0307416_100910466 3300032002 Bacteria 980
589 Ga0307414_10000027 3300032004 Bacteria 192277
590 Ga0307414_10026665 3300032004 Bacteria 3722
591 Ga0307414_10048545 3300032004 Bacteria 2929
592 Ga0307414_10052365 3300032004 Bacteria 2840
593 Ga0307414_10085742 3300032004 Bacteria 2321
594 Ga0307411_10037604 3300032005 Bacteria 3045
595 Ga0307411_10217284 3300032005 Bacteria 1480
596 Ga0307415_100057771 3300032126 Bacteria 2668
597 Ga0307415_100150460 3300032126 Bacteria 1791
598 Ga0316583_10030367 3300032133 Bacteria 1925
599 Ga0316585_10025747 3300032137 Bacteria 1826
600 Ga0316580_10002895 3300032139 Bacteria 4804
601 Ga0316580_10041620 3300032139 Bacteria 1419
602 Ga0316596_1027287 3300033541 Bacteria 1473
603 Ga0373955_0107256 3300035172 Bacteria 1611
604 Ga0316574_0000018 3300035398 Bacteria 40938
605 Ga0316574_0006270 3300035398 Bacteria 6413
606 Ga0316574_0030139 3300035398 Bacteria 3283
607 Ga0316574_0031913 3300035398 Bacteria 3198
608 Ga0316574_0033376 3300035398 Bacteria 3133
609 Ga0316574_0035454 3300035398 Bacteria 3049
610 Ga0316574_0132803 3300035398 Bacteria 1602
611 Ga0316574_0241715 3300035398 Bacteria 1154
612 Ga0373931_0039649 3300035691 Bacteria 2468
613 Ga0373933_0015401 3300035724 Bacteria 4261
614 Ga0373937_0067615 3300036401 Bacteria 3292
615 Ga0316582_0035066 3300036647 Bacteria 3095
616 Ga0316582_0043967 3300036647 Bacteria 2805
617 Ga0316582_0151651 3300036647 Bacteria 1567
618 Ga0316582_0236407 3300036647 Bacteria 1251
619 Ga0316584_0034958 3300036712 Bacteria 3727
620 Ga0316584_0067765 3300036712 Bacteria 2675
621 Ga0316584_0080062 3300036712 Bacteria 2448
622 Ga0316584_0095372 3300036712 Bacteria 2227
623 Ga0316584_0127517 3300036712 Bacteria 1900
624 Ga0316584_0320366 3300036712 Bacteria 1119
625 Ga0316584_0324251 3300036712 Bacteria 1110
626 Ga0373925_0019723 3300037068 Bacteria 4907
627 Ga0395899_0010439 3300037312 Bacteria 7114
628 Ga0395899_0014021 3300037312 Bacteria 6119
629 Ga0395900_0029177 3300037418 Bacteria 5658
630 Ga0395900_0115958 3300037418 Bacteria 2749
631 Ga0395900_0246709 3300037418 Bacteria 1789
632 Ga0395898_0009056 3300037466 Bacteria 10481
633 Ga0395898_0252324 3300037466 Bacteria 1682
634 Ga0395905_0115294 3300037471 Bacteria 2525
635 Ga0395905_0427804 3300037471 Bacteria 1220
636 Ga0395901_0022229 3300038443 Bacteria 6497
637 Ga0395901_0055805 3300038443 Bacteria 4109
638 Ga0395901_0083749 3300038443 Bacteria 3334
639 Ga0395901_0168108 3300038443 Bacteria 2301
640 Ga0395901_0628756 3300038443 Bacteria 1079
641 Ga0400486_08083 3300038742 Bacteria 5590
642 Ga0400483_016889 3300039062 Bacteria 7256
643 Ga0400483_147849 3300039062 Bacteria 9474
644 Ga0400483_194805 3300039062 Bacteria 6341
645 Ga0400483_203034 3300039062 Bacteria 3617
646 Ga0436365_0011767 3300039437 Bacteria 7798
647 Ga0436365_0608669 3300039437 Bacteria 1249
648 Ga0436363_0917267 3300039450 Bacteria 2766
649 Ga0436363_1703617 3300039450 Bacteria 1642
650 Ga0451841_0883964 3300041498 Bacteria 2308
651 Ga0451845_0381021 3300041501 Bacteria 1428
652 Ga0451849_0418948 3300041505 Bacteria 1313
653 Ga0451851_0575292 3300041507 Bacteria 1915
654 Ga0439445_0000682 3300042004 Bacteria 7053
655 Ga0439450_038040 3300042008 Bacteria 1108
656 Ga0439452_037084 3300042010 Bacteria 1164
657 Ga0450923_045122 3300042125 Bacteria 935
658 Ga0439459_0021161 3300042438 Bacteria 1247
659 Ga0439464_0023228 3300042439 Bacteria 1711
660 Ga0439464_0040721 3300042439 Bacteria 1324
661 Ga0439460_0041204 3300042461 Bacteria 1356
662 Ga0453683_0119545 3300044673 Bacteria 1658
663 Ga0453683_0153970 3300044673 Bacteria 1453
664 Ga0466966_0043210 3300044684 Bacteria 2890
665 Ga0466961_0171589 3300044693 Bacteria 1349
666 Ga0466963_0066008 3300044694 Bacteria 2427
667 Ga0466964_0007088 3300044706 Bacteria 4193
668 Ga0453684_0161279 3300044712 Bacteria 2652
669 Ga0466970_0042262 3300044765 Bacteria 2424
670 Ga0466970_0210179 3300044765 Bacteria 1084
671 Ga0466959_0037588 3300045049 Bacteria 3578
672 Ga0451576_0000007 3300045051 Bacteria 782228
673 Ga0451576_0758093 3300045051 Bacteria 1019
674 Ga0466967_0097591 3300045976 Bacteria 2682
675 Ga0495603_0059340 3300046455 Bacteria 2262
676 Ga0495629_0146620 3300046459 Bacteria 1641
677 Ga0495629_0345730 3300046459 Bacteria 1015
678 Ga0495618_0159939 3300046514 Bacteria 1436
679 Ga0495630_0373600 3300046517 Bacteria 1092
680 Ga0495642_0072212 3300046528 Bacteria 1445
681 Ga0495642_0095299 3300046528 Bacteria 1263
682 Ga0495640_0178135 3300046533 Bacteria 1356
683 Ga0495586_0251815 3300046535 Bacteria 1008
684 Ga0495621_0005070 3300046539 Bacteria 3757
685 Ga0495633_0079868 3300046558 Bacteria 1523
686 Ga0495668_0035028 3300046616 Bacteria 2814
687 Ga0495625_0000362 3300046660 Bacteria 69497
688 Ga0495635_0170574 3300046663 Bacteria 1480
689 Ga0495659_0029872 3300046664 Bacteria 1894
690 Ga0495658_0056293 3300046683 Bacteria 2242
691 Ga0495658_0160091 3300046683 Bacteria 1388
692 Ga0495670_0090065 3300046691 Bacteria 1569
693 Ga0495670_0190264 3300046691 Bacteria 1085
694 Ga0495600_0013633 3300046809 Bacteria 5113
695 Ga0495684_0024548 3300047471 Bacteria 4641
696 Ga0495615_0055313 3300048090 Bacteria 1033
697 Ga0496100_0234764 3300048903 Bacteria 1351
698 Ga0496102_0161621 3300048905 Bacteria 2107
699 Ga0496104_0014412 3300048907 Bacteria 7142
700 Ga0496104_0046317 3300048907 Bacteria 4095
701 Ga0496105_0006061 3300048908 Bacteria 9250
702 Ga0496105_0028078 3300048908 Bacteria 4602
703 Ga0496106_0009636 3300048909 Bacteria 7133
704 Ga0496107_0003209 3300048910 Bacteria 10881
705 Ga0496108_0037240 3300048911 Bacteria 4051
706 Ga0496109_0047196 3300048912 Bacteria 3915
707 Ga0496110_0017616 3300048913 Bacteria 5972
708 Ga0496110_0199281 3300048913 Bacteria 1819
709 Ga0496110_0270079 3300048913 Bacteria 1548
710 Ga0496111_0001084 3300048914 Bacteria 15034
711 Ga0496112_0009721 3300048915 Bacteria 8681
712 Ga0496113_0004957 3300048916 Bacteria 8246
713 Ga0496113_0056701 3300048916 Bacteria 2942
714 Ga0496114_0003135 3300048917 Bacteria 12684
715 Ga0496114_0021201 3300048917 Bacteria 5284
716 Ga0496115_0024228 3300048918 Bacteria 4715
717 Ga0496115_0088840 3300048918 Bacteria 2523
718 Ga0496115_0177399 3300048918 Bacteria 1762
719 Ga0496115_0273823 3300048918 Unclassified 1386
720 Ga0496115_0391865 3300048918 Bacteria 1128
721 Ga0496118_0082097 3300048921 Bacteria 2260
722 Ga0496121_0009176 3300048924 Bacteria 11433
723 Ga0496121_0026347 3300048924 Bacteria 5482
724 Ga0496121_0035138 3300048924 Bacteria 4496
725 Ga0496123_0128533 3300048926 Bacteria 1409
726 Ga0496126_0000123 3300048929 Bacteria 182726
727 Ga0496126_0015086 3300048929 Bacteria 7785
728 Ga0496126_0024582 3300048929 Bacteria 5813
729 Ga0496126_0055530 3300048929 Bacteria 3583
730 Ga0496126_0180615 3300048929 Bacteria 1793
731 Ga0501033_0006962 3300049570 Bacteria 8829
732 Ga0501034_0002561 3300049571 Bacteria 21656
733 Ga0501034_0308997 3300049571 Bacteria 1516
734 Ga0501034_0318569 3300049571 Bacteria 1488
735 Ga0501036_0395699 3300049572 Bacteria 1153
736 Ga0501040_0048797 3300049576 Bacteria 2894
737 Ga0501047_0177112 3300049581 Bacteria 2000
738 Ga0501070_0111884 3300049586 Bacteria 2257
739 Ga0501072_0306719 3300049588 Bacteria 1262
740 Ga0501072_0414436 3300049588 Bacteria 1068
741 Ga0501233_056965 3300049668 Bacteria 961
742 Ga0501238_000149 3300049671 Bacteria 10810
743 Ga0501241_016649 3300049758 Bacteria 1341
744 Ga0501269_001740 3300049766 Bacteria 2779
745 Ga0501280_000708 3300049776 Bacteria 7365
746 Ga0501282_005616 3300049778 Bacteria 1342
747 Ga0501282_006148 3300049778 Bacteria 1284
748 Ga0501044_0006427 3300049823 Bacteria 12984
749 Ga0501044_0517754 3300049823 Bacteria 1093
750 nmdc:mga00v17_48861_c1 3300050491 Bacteria 2565
751 nmdc:mga0yw44_105839_c1 3300050492 Bacteria 1797
752 nmdc:mga0yw44_124646_c1 3300050492 Bacteria 1662
753 nmdc:mga06z11_29810_c1 3300050494 Bacteria 2632
754 nmdc:mga07m45_142566_c1 3300050496 Bacteria 1388
755 nmdc:mga05p37_325549_c1 3300050507 Bacteria 1817
756 nmdc:mga09592_223429_c1 3300050508 Bacteria 1631
757 nmdc:mga09592_36737_c1 3300050508 Bacteria 4104
758 nmdc:mga0qj67_63704_c1 3300050509 Bacteria 2932
759 nmdc:mga06r32_6485_c1 3300050510 Bacteria 10514
760 nmdc:mga06r32_71459_c1 3300050510 Bacteria 3358
761 nmdc:mga08y16_158678_c1 3300050511 Bacteria 2350
762 nmdc:mga08y16_528942_c1 3300050511 Bacteria 1195
763 nmdc:mga08y16_80191_c1 3300050511 Bacteria 3403
764 nmdc:mga0n895_19450_c1 3300050512 Bacteria 6313
765 nmdc:mga0rr50_6191_c1 3300050513 Bacteria 7250
766 nmdc:mga08x19_76538_c1 3300050514 Bacteria 2190
767 nmdc:mga0a205_361699_c1 3300050515 Bacteria 1318
768 nmdc:mga0a205_601820_c1 3300050515 Bacteria 952
769 Ga0495601_0019377 3300053077 Bacteria 4150
770 Ga0500635_0002767 3300053080 Bacteria 4356
771 Ga0495619_0126831 3300053085 Bacteria 1752
772 Ga0500646_0047985 3300053090 Bacteria 1223
773 Ga0500641_0017281 3300053096 Bacteria 2696
774 Ga0500559_0015243 3300053136 Bacteria 3246
775 Ga0500568_0000724 3300053139 Bacteria 23628
776 Ga0500568_0003410 3300053139 Bacteria 8874
777 Ga0500584_009662 3300053726 Bacteria 4294
778 Ga0501084_0000216 3300054114 Bacteria 44550
779 2520880368 2519899754 Bacteria 5336938
780 2643835659 2643221563 Bacteria 4726935
781 2644012242 2643221600 Bacteria 5530138
782 2644056585 2643221608 Bacteria 4724829
783 2644374455 2643221667 Bacteria 5627472
784 2644641524 2643221716 Bacteria 4986332
785 2644682366 2643221725 Bacteria 5087956
786 2738735933 2738541279 Bacteria 6149495
787 2738768510 2738541285 Bacteria 6150075
788 2739217515 2738543007 Bacteria 6149845
789 2740000475 2739367857 Bacteria 5433684
790 2740005291 2739367858 Bacteria 5432813
791 2802651138 2802428842 Bacteria 4926114
792 2817414026 2816332280 Bacteria 5109718
793 2819570210 2818991441 Bacteria 5062707
794 2852655214 2852653556 Bacteria 4050083
795 2857474403 2857472729 Bacteria 6568124
796 2857616246 2857613821 Bacteria 4917088
797 2881361323 2881359912 Bacteria 4935907
798 2882807950 2882806704 Bacteria 3007728
799 2895882595 2895880812 Bacteria 11255272
800 2903896569 2903895155 Bacteria 5258610
801 2904557657 2904555929 Bacteria 5218588
802 2907204250 2907202186 Bacteria 6632024
803 2919195828 2919191525 Bacteria 5765973
804 2919514161 2919513703 Bacteria 3844312
805 2919676067 2919675420 Bacteria 3969095
806 2958461781 2958458903 Bacteria 5301041
807 2977272549 2977268062 Bacteria 5243061
808 3006970355 3006969106 Bacteria 4739423
809 3006990362 3006988479 Bacteria 4767936
810 8054310983 8054307821 Bacteria 5212224
811 8055420243 8055419101 Bacteria 5289643
812 8055637247 8055632911 Bacteria 5283357
813 Ga0105245_10327570
814 SwRhRL2b_contig_1200904
815 JGI25406J46586_10011250
816 rootH2_10036006
817 Ga0055535_1009958
818 Ga0055530_10000095
819 Ga0055530_10024324
820 Ga0055531_10002750
821 Ga0055531_10004838
822 Ga0055541_1004028
823 Ga0065712_10034659
824 Ga0065715_10113248
825 Ga0065707_10001302
826 Ga0065707_10247678
827 Ga0070676_10044650
828 Ga0070676_10046627
829 Ga0070676_10114050
830 Ga0070690_100072792
831 Ga0070690_100189801
832 Ga0070690_100290753
833 Ga0070670_100002372
834 Ga0070670_100016454
835 Ga0070670_100036862
836 Ga0070670_100069322
837 Ga0070670_100088663
838 Ga0070670_100404492
839 Ga0068869_100009681
840 Ga0068869_100070150
841 Ga0068869_100104841
842 Ga0070666_10007408
843 Ga0070666_10021517
844 Ga0070666_10038577
845 Ga0070666_10340433
846 Ga0070680_100201120
847 Ga0070682_100007256
848 Ga0068868_100010385
849 Ga0068868_100010777
850 Ga0068868_100053432
851 Ga0070660_100081063
852 Ga0070660_100098032
853 Ga0070660_100214305
854 Ga0070689_100224106
855 Ga0070689_100452621
856 Ga0070691_10002104
857 Ga0070687_100155325
858 Ga0070692_10038830
859 Ga0070668_100003541
860 Ga0070668_100008311
861 Ga0070668_100009156
862 Ga0070668_100025721
863 Ga0070668_100043584
864 Ga0070668_100093435
865 Ga0070668_100115903
866 Ga0070668_100185480
867 Ga0070669_100054641
868 Ga0070669_100063261
869 Ga0070675_100013399
870 Ga0070675_100018757
871 Ga0070675_100087113
872 Ga0070671_100007579
873 Ga0070671_100023116
874 Ga0070671_100024813
875 Ga0070671_100025962
876 Ga0070674_100003696
877 Ga0070674_100046640
878 Ga0070674_100130282
879 Ga0070674_100154285
880 Ga0070674_100159097
881 Ga0070674_100236272
882 Ga0070673_100000655
883 Ga0070673_100051077
884 Ga0070673_100134718
885 Ga0070673_100174380
886 Ga0070673_100276634
887 Ga0070673_100282809
888 Ga0070659_100046732
889 Ga0070659_100061193
890 Ga0070659_100089500
891 Ga0070659_100180024
892 Ga0070667_100022052
893 Ga0070667_100049692
894 Ga0070667_100144558
895 Ga0070667_100163160
896 Ga0070709_10056874
897 Ga0070714_100047289
898 Ga0070714_100102162
899 Ga0070713_100000129
900 Ga0070713_100011017
901 Ga0070713_100227997
902 Ga0070710_10025987
903 Ga0070701_10018566
904 Ga0070701_10128777
905 Ga0070711_100053234
906 Ga0070705_100059544
907 Ga0070700_100107989
908 Ga0070694_100023303
909 Ga0070708_100210850
910 Ga0070663_100002768
911 Ga0070663_100058868
912 Ga0070663_100384310
913 Ga0070678_100016864
914 Ga0070678_100058624
915 Ga0070678_100087487
916 Ga0070678_100099566
917 Ga0070678_100111900
918 Ga0070678_100188719
919 Ga0070662_100027611
920 Ga0070662_100032993
921 Ga0070681_10036085
922 Ga0068867_100008910
923 Ga0068867_100012739
924 Ga0068867_100060218
925 Ga0068867_100130818
926 Ga0068867_100144524
927 Ga0070685_10059630
928 Ga0070685_10075512
929 Ga0070706_100159173
930 Ga0070707_100016769
931 Ga0070699_100000708
932 Ga0070679_100018240
933 Ga0070679_100148494
934 Ga0070679_100240896
935 Ga0070684_100059898
936 Ga0068853_100009347
937 Ga0068853_100026886
938 Ga0070672_100003611
939 Ga0070672_100037283
940 Ga0070672_100335838
941 Ga0070686_100189910
942 Ga0070693_100008277
943 Ga0070665_100036933
944 Ga0070665_100042010
945 Ga0070665_100056106
946 Ga0070665_100233743
947 Ga0070704_100010008
948 Ga0068855_100104113
949 Ga0068855_100214605
950 Ga0070664_100004030
951 Ga0070664_100121064
952 Ga0068854_100012579
953 Ga0068854_100025046
954 Ga0068856_100004065
955 Ga0070702_100003679
956 Ga0070702_100031295
957 Ga0070702_100068191
958 Ga0068852_100039684
959 Ga0068852_100041014
960 Ga0068852_100157893
961 Ga0068852_100183993
962 Ga0068852_100262884
963 Ga0068859_100025822
964 Ga0068859_100032362
965 Ga0068859_100035474
966 Ga0068859_100042445
967 Ga0068859_100079439
968 Ga0068859_100674452
969 Ga0068864_100027348
970 Ga0068864_100095074
971 Ga0068864_100116887
972 Ga0068864_100122909
973 Ga0068864_100149781
974 Ga0068864_100283518
975 Ga0068866_10118921
976 Ga0068861_100003730
977 Ga0068861_100095142
978 Ga0068861_100127650
979 Ga0068861_100220865
980 Ga0068851_10001051
981 Ga0068851_10009294
982 Ga0068851_10077806
983 Ga0068851_10081757
984 Ga0068870_10001962
985 Ga0068870_10051449
986 Ga0068870_10192874
987 Ga0068863_100003730
988 Ga0068863_100016873
989 Ga0068863_100087307
990 Ga0068858_100010789
991 Ga0068858_100020301
992 Ga0068858_100076998
993 Ga0068858_100145629
994 Ga0068858_100211914
995 Ga0068858_100402097
996 Ga0068858_100585921
997 Ga0068860_100022098
998 Ga0068860_100126704
999 Ga0068860_100198483
1000 Ga0068860_100515916
1001 Ga0068862_100008255
1002 Ga0068862_100011911
1003 Ga0068862_100030190
1004 Ga0068862_100174977
1005 Ga0068862_100178804
1006 Ga0068862_100485875
1007 Ga0081455_10042044
1008 Ga0081455_10086820
1009 Ga0081539_10000927
1010 Ga0081539_10045116
1011 Ga0070717_10012513
1012 Ga0070717_10070126
1013 Ga0070717_10080300
1014 Ga0070717_10216537
1015 Ga0070717_10620385
1016 Ga0075365_10118627
1017 Ga0075365_10193734
1018 Ga0075365_10204591
1019 Ga0070712_100201659
1020 Ga0075367_10039793
1021 Ga0075367_10283228
1022 Ga0097621_100014203
1023 Ga0097621_100030796
1024 Ga0097621_100349621
1025 Ga0068871_100022746
1026 Ga0068871_100031530
1027 Ga0068871_100043670
1028 Ga0068871_100047252
1029 Ga0068871_100075727
1030 Ga0068871_100275157
1031 Ga0075428_100190255
1032 Ga0075428_100261056
1033 Ga0075430_100075967
1034 Ga0075430_100131372
1035 Ga0075430_100335223
1036 Ga0075431_100036988
1037 Ga0075431_100072856
1038 Ga0075431_100154691
1039 Ga0075433_10011974
1040 Ga0075434_100008016
1041 Ga0075429_100150497
1042 Ga0075429_100185014
1043 Ga0068865_100008038
1044 Ga0075436_100010195
1045 Ga0097620_100025822
1046 Ga0097620_100032362
1047 Ga0097620_100035474
1048 Ga0097620_100042445
1049 Ga0097620_100079438
1050 Ga0097620_100674499
1051 Ga0099824_1007872
1052 Ga0079104_1000146
1053 Ga0079104_1016660
1054 Ga0079104_1023901
1055 Ga0099826_10005057
1056 Ga0075435_100012598
1057 Ga0105251_10055930
1058 Ga0105250_10000006
1059 Ga0105240_10010715
1060 Ga0105240_10017187
1061 Ga0105240_10089075
1062 Ga0111539_10057862
1063 Ga0111539_10071416
1064 Ga0111539_10120566
1065 Ga0111539_10307347
1066 Ga0111539_10336516
1067 Ga0111539_10683653
1068 Ga0105245_10008219
1069 Ga0105245_10026816
1070 Ga0105245_10448387
1071 Ga0105247_10004007
1072 Ga0105247_10148587
1073 Ga0114129_10069834
1074 Ga0114129_10520896
1075 Ga0105243_10034179
1076 Ga0105241_10025396
1077 Ga0105241_10104068
1078 Ga0105241_10195305
1079 Ga0105242_10088775
1080 Ga0105248_10016488
1081 Ga0105248_10113758
1082 Ga0105248_10218452
1083 Ga0105237_10013036
1084 Ga0105237_10046598
1085 Ga0105237_10209728
1086 Ga0105238_10067892
1087 Ga0105238_10142509
1088 Ga0105249_10014648
1089 Ga0105249_10107042
1090 Ga0105249_10259151
1091 Ga0105239_10000037
1092 Ga0105239_10056407
1093 Ga0105239_10111081
1094 Ga0105239_10648910
1095 Ga0105246_10007529
1096 Ga0157373_10000023
1097 Ga0157373_10080711
1098 Ga0157371_10008583
1099 Ga0157371_10039729
1100 Ga0157371_10131106
1101 Ga0157371_10165535
1102 Ga0157370_10003921
1103 Ga0157370_10013827
1104 Ga0157369_10050251
1105 Ga0157374_10002677
1106 Ga0157374_10016721
1107 Ga0157374_10054267
1108 Ga0157374_10074957
1109 Ga0157374_10375497
1110 Ga0157378_10000631
1111 Ga0157378_10060000
1112 Ga0157378_10074921
1113 Ga0163162_10005487
1114 Ga0157375_10019639
1115 Ga0157375_10061837
1116 Ga0157375_10108044
1117 Ga0157375_10155169
1118 Ga0157375_10286061
1119 Ga0163163_10007534
1120 Ga0157380_10002142
1121 Ga0157380_10002279
1122 Ga0157380_10008389
1123 Ga0157380_10032855
1124 Ga0157380_10033683
1125 Ga0157380_10078277
1126 Ga0157380_10080884
1127 Ga0157380_10116787
1128 Ga0157377_10097218
1129 Ga0157377_10280655
1130 Ga0157379_10000830
1131 Ga0157379_10039058
1132 Ga0157379_10181531
1133 Ga0157379_10253425
1134 Ga0157376_10041860
1135 Ga0157376_10051232
1136 Ga0157376_10061915
1137 Ga0157376_10096073
1138 Ga0157376_10320753
1139 Ga0182006_1002701
1140 Ga0182006_1017283
1141 Ga0182006_1017297
1142 Ga0163161_10287141
1143 Ga0163161_10511148
1144 Ga0206353_11795824
1145 Ga0209566_100052
1146 Ga0209147_103612
1147 Ga0209258_101156
1148 Ga0209675_1000025
1149 Ga0209676_1000198
1150 Ga0209676_1000362
1151 Ga0209676_1003189
1152 Ga0209676_1041396
1153 Ga0209025_1019137
1154 Ga0209025_1041993
1155 Ga0209050_1000849
1156 Ga0209050_1003508
1157 Ga0209257_1000860
1158 Ga0209257_1001370
1159 Ga0209257_1003116
1160 Ga0207697_10004336
1161 Ga0207696_1000069
1162 Ga0207655_1000003
1163 Ga0207682_10000798
1164 Ga0207682_10002137
1165 Ga0207682_10015311
1166 Ga0207642_10025189
1167 Ga0207642_10031370
1168 Ga0207642_10246690
1169 Ga0207710_10015418
1170 Ga0207688_10032338
1171 Ga0207688_10048236
1172 Ga0207688_10066672
1173 Ga0207680_10030105
1174 Ga0207680_10108620
1175 Ga0207647_10146562
1176 Ga0207647_10167662
1177 Ga0207699_10004323
1178 Ga0207645_10001048
1179 Ga0207645_10047151
1180 Ga0207645_10055042
1181 Ga0207645_10094092
1182 Ga0207645_10119781
1183 Ga0207643_10000594
1184 Ga0207643_10046706
1185 Ga0207643_10123129
1186 Ga0207654_10134043
1187 Ga0207695_10001017
1188 Ga0207695_10031430
1189 Ga0207695_10046636
1190 Ga0207695_10109233
1191 Ga0207671_10004808
1192 Ga0207671_10052375
1193 Ga0207671_10091997
1194 Ga0207693_10024239
1195 Ga0207663_10016077
1196 Ga0207660_10007800
1197 Ga0207660_10028542
1198 Ga0207662_10155727
1199 Ga0207657_10022327
1200 Ga0207657_10076906
1201 Ga0207657_10085036
1202 Ga0207649_10002784
1203 Ga0207652_10122608
1204 Ga0207652_10354277
1205 Ga0207646_10001356
1206 Ga0207681_10012027
1207 Ga0207681_10045203
1208 Ga0207681_10080936
1209 Ga0207681_10186577
1210 Ga0207694_10248910
1211 Ga0207650_10001016
1212 Ga0207650_10001564
1213 Ga0207650_10003470
1214 Ga0207650_10040514
1215 Ga0207659_10002573
1216 Ga0207659_10011881
1217 Ga0207659_10019574
1218 Ga0207659_10236941
1219 Ga0207687_10030832
1220 Ga0207700_10000044
1221 Ga0207700_10001414
1222 Ga0207700_10071401
1223 Ga0207664_10005921
1224 Ga0207664_10036227
1225 Ga0207664_10449804
1226 Ga0207644_10002140
1227 Ga0207644_10003507
1228 Ga0207644_10089931
1229 Ga0207690_10074617
1230 Ga0207690_10194039
1231 Ga0207690_10227839
1232 Ga0207706_10006526
1233 Ga0207706_10015081
1234 Ga0207706_10022657
1235 Ga0207706_10261322
1236 Ga0207709_10052850
1237 Ga0207709_10081325
1238 Ga0207709_10149120
1239 Ga0207670_10051408
1240 Ga0207670_10157127
1241 Ga0207670_10380867
1242 Ga0207669_10002485
1243 Ga0207669_10007588
1244 Ga0207669_10067523
1245 Ga0207669_10077647
1246 Ga0207669_10517847
1247 Ga0207704_10030885
1248 Ga0207704_10190312
1249 Ga0207665_10384990
1250 Ga0207691_10000180
1251 Ga0207691_10003262
1252 Ga0207691_10007125
1253 Ga0207691_10038037
1254 Ga0207691_10054083
1255 Ga0207691_10060715
1256 Ga0207691_10120971
1257 Ga0207691_10136420
1258 Ga0207711_10005883
1259 Ga0207711_10092518
1260 Ga0207711_10142554
1261 Ga0207689_10001431
1262 Ga0207689_10024871
1263 Ga0207689_10049684
1264 Ga0207689_10199433
1265 Ga0207661_10003516
1266 Ga0207661_10080148
1267 Ga0207679_10043675
1268 Ga0207667_10360925
1269 Ga0207651_10074105
1270 Ga0207651_10075588
1271 Ga0207651_10141206
1272 Ga0207651_10401937
1273 Ga0207668_10000060
1274 Ga0207668_10007605
1275 Ga0207668_10050245
1276 Ga0207668_10092305
1277 Ga0207658_10023664
1278 Ga0207658_10041264
1279 Ga0207658_10076747
1280 Ga0207658_10418344
1281 Ga0207677_10072693
1282 Ga0207677_10094007
1283 Ga0207677_10551133
1284 Ga0207703_10012833
1285 Ga0207703_10041853
1286 Ga0207703_10069667
1287 Ga0207703_10371529
1288 Ga0207639_10082507
1289 Ga0207639_10109132
1290 Ga0207678_10001818
1291 Ga0207678_10008182
1292 Ga0207678_10214587
1293 Ga0207708_10006356
1294 Ga0207708_10034973
1295 Ga0207708_10053197
1296 Ga0207708_10127160
1297 Ga0207702_10001992
1298 Ga0207702_10021932
1299 Ga0207641_10010191
1300 Ga0207641_10031263
1301 Ga0207641_10041337
1302 Ga0207648_10005794
1303 Ga0207648_10012777
1304 Ga0207648_10017845
1305 Ga0207648_10048341
1306 Ga0207648_10077587
1307 Ga0207648_10111844
1308 Ga0207648_10118701
1309 Ga0207648_10170115
1310 Ga0207676_10000896
1311 Ga0207676_10005522
1312 Ga0207676_10060724
1313 Ga0207676_10104749
1314 Ga0207676_10112461
1315 Ga0207676_10155031
1316 Ga0207674_10030489
1317 Ga0207675_100015760
1318 Ga0207675_100023333
1319 Ga0207675_100039045
1320 Ga0207675_100086921
1321 Ga0207675_100450507
1322 Ga0207675_100594747
1323 Ga0207683_10000146
1324 Ga0207683_10001721
1325 Ga0207683_10001789
1326 Ga0207683_10065769
1327 Ga0207683_10163499
1328 Ga0207683_10180368
1329 Ga0207683_10346564
1330 Ga0207698_10002118
1331 Ga0207698_10026942
1332 Ga0207698_10062486
1333 Ga0209281_1000045
1334 Ga0209281_1004536
1335 Ga0209489_108520
1336 Ga0210002_1018120
1337 Ga0209971_1003179
1338 Ga0209966_1005269
1339 Ga0209974_10014042
1340 Ga0209974_10056085
1341 Ga0209974_10109539
1342 Ga0207428_10015402
1343 Ga0207428_10214012
1344 Ga0268266_10028457
1345 Ga0268266_10208928
1346 Ga0268266_10287376
1347 Ga0268265_10007031
1348 Ga0268265_10050752
1349 Ga0268264_10008954
1350 Ga0268264_10018610
1351 Ga0268264_10086517
1352 Ga0268264_10095159
1353 Ga0268264_10207103
1354 Ga0268264_10282555
1355 Ga0265334_10016887
1356 Ga0265318_10011555
1357 Ga0265338_10015955
1358 Ga0265330_10030331
1359 Ga0265332_10014637
1360 Ga0265340_10092203
1361 Ga0265331_10008258
1362 Ga0265316_10018778
1363 Ga0307408_100000475
1364 Ga0307408_100163213
1365 Ga0307408_100404560
1366 Ga0307408_100438842
1367 Ga0316575_10076015
1368 Ga0316579_10005942
1369 Ga0265314_10000595
1370 Ga0265342_10051906
1371 Ga0316576_10004148
1372 Ga0316576_10087355
1373 Ga0316576_10125682
1374 Ga0316576_10145717
1375 Ga0316578_10017721
1376 Ga0316578_10166068
1377 Ga0307405_10010037
1378 Ga0316577_10028417
1379 Ga0316577_10072127
1380 Ga0316577_10122595
1381 Ga0307413_10014744
1382 Ga0307413_10201004
1383 Ga0307410_10005332
1384 Ga0307410_10009576
1385 Ga0307410_10018238
1386 Ga0307410_10020706
1387 Ga0307406_10000062
1388 Ga0307406_10030734
1389 Ga0307407_10000440
1390 Ga0307407_10001616
1391 Ga0307407_10043850
1392 Ga0307412_10111294
1393 Ga0307412_10151594
1394 Ga0307409_100007763
1395 Ga0307409_100078235
1396 Ga0307409_100089516
1397 Ga0307409_100275035
1398 Ga0307416_100000394
1399 Ga0307416_100008628
1400 Ga0307416_100910466
1401 Ga0307414_10000027
1402 Ga0307414_10026665
1403 Ga0307414_10048545
1404 Ga0307414_10052365
1405 Ga0307414_10085742
1406 Ga0307411_10037604
1407 Ga0307411_10217284
1408 Ga0307415_100057771
1409 Ga0307415_100150460
1410 Ga0316583_10030367
1411 Ga0316585_10025747
1412 Ga0316580_10002895
1413 Ga0316580_10041620
1414 Ga0316596_1027287
1415 Ga0373955_0107256
1416 Ga0316574_0000018
1417 Ga0316574_0006270
1418 Ga0316574_0030139
1419 Ga0316574_0031913
1420 Ga0316574_0033376
1421 Ga0316574_0035454
1422 Ga0316574_0132803
1423 Ga0316574_0241715
1424 Ga0373931_0039649
1425 Ga0373933_0015401
1426 Ga0373937_0067615
1427 Ga0316582_0035066
1428 Ga0316582_0043967
1429 Ga0316582_0151651
1430 Ga0316582_0236407
1431 Ga0316584_0034958
1432 Ga0316584_0067765
1433 Ga0316584_0080062
1434 Ga0316584_0095372
1435 Ga0316584_0127517
1436 Ga0316584_0320366
1437 Ga0316584_0324251
1438 Ga0373925_0019723
1439 Ga0395899_0010439
1440 Ga0395899_0014021
1441 Ga0395900_0029177
1442 Ga0395900_0115958
1443 Ga0395900_0246709
1444 Ga0395898_0009056
1445 Ga0395898_0252324
1446 Ga0395905_0115294
1447 Ga0395905_0427804
1448 Ga0395901_0022229
1449 Ga0395901_0055805
1450 Ga0395901_0083749
1451 Ga0395901_0168108
1452 Ga0395901_0628756
1453 Ga0400486_08083
1454 Ga0400483_016889
1455 Ga0400483_147849
1456 Ga0400483_194805
1457 Ga0400483_203034
1458 Ga0436365_0011767
1459 Ga0436365_0608669
1460 Ga0436363_0917267
1461 Ga0436363_1703617
1462 Ga0451841_0883964
1463 Ga0451845_0381021
1464 Ga0451849_0418948
1465 Ga0451851_0575292
1466 Ga0439445_0000682
1467 Ga0439450_038040
1468 Ga0439452_037084
1469 Ga0450923_045122
1470 Ga0439459_0021161
1471 Ga0439464_0023228
1472 Ga0439464_0040721
1473 Ga0439460_0041204
1474 Ga0453683_0119545
1475 Ga0453683_0153970
1476 Ga0466966_0043210
1477 Ga0466961_0171589
1478 Ga0466963_0066008
1479 Ga0466964_0007088
1480 Ga0453684_0161279
1481 Ga0466970_0042262
1482 Ga0466970_0210179
1483 Ga0466959_0037588
1484 Ga0451576_0000007
1485 Ga0451576_0758093
1486 Ga0466967_0097591
1487 Ga0495603_0059340
1488 Ga0495629_0146620
1489 Ga0495629_0345730
1490 Ga0495618_0159939
1491 Ga0495630_0373600
1492 Ga0495642_0072212
1493 Ga0495642_0095299
1494 Ga0495640_0178135
1495 Ga0495586_0251815
1496 Ga0495621_0005070
1497 Ga0495633_0079868
1498 Ga0495668_0035028
1499 Ga0495625_0000362
1500 Ga0495635_0170574
1501 Ga0495659_0029872
1502 Ga0495658_0056293
1503 Ga0495658_0160091
1504 Ga0495670_0090065
1505 Ga0495670_0190264
1506 Ga0495600_0013633
1507 Ga0495684_0024548
1508 Ga0495615_0055313
1509 Ga0496100_0234764
1510 Ga0496102_0161621
1511 Ga0496104_0014412
1512 Ga0496104_0046317
1513 Ga0496105_0006061
1514 Ga0496105_0028078
1515 Ga0496106_0009636
1516 Ga0496107_0003209
1517 Ga0496108_0037240
1518 Ga0496109_0047196
1519 Ga0496110_0017616
1520 Ga0496110_0199281
1521 Ga0496110_0270079
1522 Ga0496111_0001084
1523 Ga0496112_0009721
1524 Ga0496113_0004957
1525 Ga0496113_0056701
1526 Ga0496114_0003135
1527 Ga0496114_0021201
1528 Ga0496115_0024228
1529 Ga0496115_0088840
1530 Ga0496115_0177399
1531 Ga0496115_0273823
1532 Ga0496115_0391865
1533 Ga0496118_0082097
1534 Ga0496121_0009176
1535 Ga0496121_0026347
1536 Ga0496121_0035138
1537 Ga0496123_0128533
1538 Ga0496126_0000123
1539 Ga0496126_0015086
1540 Ga0496126_0024582
1541 Ga0496126_0055530
1542 Ga0496126_0180615
1543 Ga0501033_0006962
1544 Ga0501034_0002561
1545 Ga0501034_0308997
1546 Ga0501034_0318569
1547 Ga0501036_0395699
1548 Ga0501040_0048797
1549 Ga0501047_0177112
1550 Ga0501070_0111884
1551 Ga0501072_0306719
1552 Ga0501072_0414436
1553 Ga0501233_056965
1554 Ga0501238_000149
1555 Ga0501241_016649
1556 Ga0501269_001740
1557 Ga0501280_000708
1558 Ga0501282_005616
1559 Ga0501282_006148
1560 Ga0501044_0006427
1561 Ga0501044_0517754
1562 nmdc:mga00v17_48861_c1
1563 nmdc:mga0yw44_105839_c1
1564 nmdc:mga0yw44_124646_c1
1565 nmdc:mga06z11_29810_c1
1566 nmdc:mga07m45_142566_c1
1567 nmdc:mga05p37_325549_c1
1568 nmdc:mga09592_223429_c1
1569 nmdc:mga09592_36737_c1
1570 nmdc:mga0qj67_63704_c1
1571 nmdc:mga06r32_6485_c1
1572 nmdc:mga06r32_71459_c1
1573 nmdc:mga08y16_158678_c1
1574 nmdc:mga08y16_528942_c1
1575 nmdc:mga08y16_80191_c1
1576 nmdc:mga0n895_19450_c1
1577 nmdc:mga0rr50_6191_c1
1578 nmdc:mga08x19_76538_c1
1579 nmdc:mga0a205_361699_c1
1580 nmdc:mga0a205_601820_c1
1581 Ga0495601_0019377
1582 Ga0500635_0002767
1583 Ga0495619_0126831
1584 Ga0500646_0047985
1585 Ga0500641_0017281
1586 Ga0500559_0015243
1587 Ga0500568_0000724
1588 Ga0500568_0003410
1589 Ga0500584_009662
1590 Ga0501084_0000216
1591 2520880368
1592 2643835659
1593 2644012242
1594 2644056585
1595 2644374455
1596 2644641524
1597 2644682366
1598 2738735933
1599 2738768510
1600 2739217515
1601 2740000475
1602 2740005291
1603 2802651138
1604 2817414026
1605 2819570210
1606 2852655214
1607 2857474403
1608 2857616246
1609 2881361323
1610 2882807950
1611 2895882595
1612 2903896569
1613 2904557657
1614 2907204250
1615 2919195828
1616 2919514161
1617 2919676067
1618 2958461781
1619 2977272549
1620 3006970355
1621 3006990362
1622 8054310983
1623 8055420243
1624 8055637247

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00274

Glycolytic

Fructose-bisphosphate aldolase class-I

45

265

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
2iqt-assembly1.cif.gz_A-2 crystal structure of fructose-bisphosphate aldolase, class i from porphyromonas gingivalis 0.988 4 297
2iqt-assembly1.cif.gz_A-2 crystal structure of fructose-bisphosphate aldolase, class i from porphyromonas gingivalis 0.9747 4 297
7efs-assembly1.cif.gz_B fructose-bisphosphate aldolase in artemisia sieversiana pollen 0.8177 1 294
7b2n-assembly1.cif.gz_B crystal structure of chlamydomonas reinhardtii chloroplastic fructose bisphosphate aldolase 0.817 4 294
6xmh-assembly1.cif.gz_B-2 human aldolase a wild type 0.8165 1 294
ID Description Score Start End Superfamily
af_Q2FV17_1_294_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.998 5 297 3.20.20.70
af_Q2FV17_1_294_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9879 5 297 3.20.20.70
af_A0A1D6JVQ3_1_141_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8591 11 142 3.20.20.70
af_A0A1D6FD79_26_183_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8297 4 140 3.20.20.70
3mbdA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.817 4 294 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A432GXV0-F1-model_v4 Class I fructose-bisphosphate aldolase (EC 4.1.2.13) 1.005 236 297 GO:0004332
AF-A0A7X8K759-F1-model_v4 Class I fructose-bisphosphate aldolase (EC 4.1.2.13) 1.003 239 295 GO:0004332
AF-A0A645JEX5-F1-model_v4 Fructose-bisphosphate aldolase class 1 (EC 4.1.2.13) 1.002 215 297 GO:0004332
AF-A0A2V9RUV5-F1-model_v4 fructose-bisphosphate aldolase (EC 4.1.2.13) (Fructose-bisphosphate aldolase class I) 1 5 197 GO:0004332
GO:0006096
AF-A0A509Y451-F1-model_v4 deleted 0.9998 213 297

Map