F481880
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 812 | 380 | 1624 | 296 |
Family's Representative Sequence
| Representative Sequence | 3300009098|Ga0105245_10327570|Ga0105245_103275702 |
| Length | 338 |
| Sequence | LVLEKKRVLTAHRLDNIAADRENTGLNVLFSFPTPNFEEPTVSEYDKQLQKVKNDKGFIAALDQSGGSTPKALKLYGVNEDAWTNEQGMYDVVHQMRSRIMTSPAFTGKRLLGAILFENTMDRDVAGKPTPTYLWEVKGVVPFLKVDKGLADEKDGVQMMKPMPDLDALLKKAKSKNVFGTKMRSVIKQANAAAIDAVVKQQFEVGKQILAAGLMPIIEPEVDIKTPNKDKAEELLKAAILKELNQLKPDQRVMLKLTIPEKDNLYADLIKHPNVLRVVALSGGYSREESNKRLARQNGMTASFSRALSEGLTKQQSDEEFNKALDASIESIYRASIT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 4 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 5 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 6 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 7 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 8 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 9 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 10 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 48 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 55 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 61 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 63 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 64 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 66 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 67 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 68 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 69 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 70 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 71 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 72 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 73 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 74 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 75 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 76 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 77 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 78 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 80 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 82 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 84 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 85 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 86 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 87 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 88 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 89 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 90 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 91 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 92 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 94 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 95 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 96 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 97 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 126 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 128 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 132 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 197 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 198 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 203 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 207 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 208 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 209 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 210 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 211 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 212 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 213 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 214 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 215 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 216 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 217 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 218 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 219 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 220 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 221 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 222 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 223 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 224 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 225 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 226 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 227 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 228 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 229 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 230 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 231 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 232 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 233 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 234 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 235 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 236 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 237 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 238 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 239 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 240 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 241 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 242 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 243 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 244 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 245 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 246 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 247 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 248 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 249 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 250 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 251 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 252 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 253 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 254 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 255 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 256 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 257 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 258 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 259 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 260 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 261 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 262 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 263 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 264 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 265 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 266 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 267 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 268 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 269 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 270 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 271 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 272 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 273 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 274 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 275 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 294 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 295 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 296 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 297 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 298 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 299 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 300 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 301 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 302 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 303 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 304 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 305 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 306 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 307 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 308 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 309 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 310 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 311 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 314 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 315 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 318 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 319 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 320 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 321 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 322 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 323 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 324 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 326 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 327 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 328 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 329 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 333 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 334 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 335 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 336 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 337 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 338 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 340 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 342 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 343 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 344 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 345 | 3300053726 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere | Metagenome | Endosphere |
| 346 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 347 | 2519899754 | Flavobacterium sp. F52 | Isolate | Rhizosphere |
| 348 | 2643221563 | Sphingopyxis sp. Root154 | Isolate | Unclassified |
| 349 | 2643221600 | Flavobacterium sp. Root186 | Isolate | Unclassified |
| 350 | 2643221608 | Sphingopyxis sp. Root214 | Isolate | Unclassified |
| 351 | 2643221667 | Flavobacterium sp. Root420 | Isolate | Unclassified |
| 352 | 2643221716 | Flavobacterium sp. Root901 | Isolate | Unclassified |
| 353 | 2643221725 | Flavobacterium sp. Root935 | Isolate | Unclassified |
| 354 | 2738541279 | Flavobacterium sp. GV069 | Isolate | Unclassified |
| 355 | 2738541285 | Flavobacterium sp. GV030 | Isolate | Unclassified |
| 356 | 2738543007 | Flavobacterium sp. GV063 | Isolate | Unclassified |
| 357 | 2739367857 | Flavobacterium sp. GV029 | Isolate | Unclassified |
| 358 | 2739367858 | Flavobacterium sp. GV028 | Isolate | Unclassified |
| 359 | 2802428842 | Flavobacterium sp. S87F.05.LMB.W.Kidney.N | Isolate | Unclassified |
| 360 | 2816332280 | Flavobacterium johnsoniae GSE09 | Isolate | Unclassified |
| 361 | 2818991441 | Niallia circulans 3243 | Isolate | Rhizosphere |
| 362 | 2852653556 | Sphingopyxis sp. JAI108 | Isolate | Rhizosphere |
| 363 | 2857472729 | Cohnella sp. R-74144 | Isolate | Unclassified |
| 364 | 2857613821 | Flavobacterium sp. R-72247 | Isolate | Unclassified |
| 365 | 2881359912 | Flavobacterium ustbae T13 | Isolate | Rhizosphere |
| 366 | 2882806704 | Pelagerythrobacter rhizovicinus AY-3R | Isolate | Rhizosphere |
| 367 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 368 | 2903895155 | Flavobacterium sp. HBTb2-11-1 | Isolate | Rhizosphere |
| 369 | 2904555929 | Flavobacterium sp. 1750 | Isolate | Rhizosphere |
| 370 | 2907202186 | Paenibacillus sp. HJL G12 | Isolate | Unclassified |
| 371 | 2919191525 | Flavobacterium sp. 2755 | Isolate | Rhizosphere |
| 372 | 2919513703 | Luteimonas sp. 3794 | Isolate | Unclassified |
| 373 | 2919675420 | Luteimonas terrae 4099 | Isolate | Unclassified |
| 374 | 2958458903 | Flavobacterium anhuiense RCM74 | Isolate | Rhizosphere |
| 375 | 2977268062 | Flavobacterium sp. SORGH_AS 622 | Isolate | Unclassified |
| 376 | 3006969106 | Bacillus sp. FJAT-50079 | Isolate | Rhizosphere |
| 377 | 3006988479 | Bacillus sp. FJAT-49711 | Isolate | Rhizosphere |
| 378 | 8054307821 | Flavobacterium soyae SCIV07 | Isolate | Rhizosphere |
| 379 | 8055419101 | Flavobacterium tyrosinilyticum KCTC 42726 | Isolate | Rhizosphere |
| 380 | 8055632911 | Paenibacillus radicibacter N1-5-1-14 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.57 |
| Metatranscriptomes | 0.25 |
| Isolates | 4.19 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.68 |
| Nodule | 0.99 |
| Rhizoplane | 2.96 |
| Rhizosphere | 85.84 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.37 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0105245_10327570 | 3300009098 | Bacteria | 1511 |
| 2 | SwRhRL2b_contig_1200904 | 2162886007 | Bacteria | 1316 |
| 3 | JGI25406J46586_10011250 | 3300003203 | Bacteria | 3932 |
| 4 | rootH2_10036006 | 3300003320 | Unclassified | 4796 |
| 5 | Ga0055535_1009958 | 3300003761 | Bacteria | 1595 |
| 6 | Ga0055530_10000095 | 3300003791 | Bacteria | 74707 |
| 7 | Ga0055530_10024324 | 3300003791 | Bacteria | 1720 |
| 8 | Ga0055531_10002750 | 3300003794 | Bacteria | 11546 |
| 9 | Ga0055531_10004838 | 3300003794 | Bacteria | 8035 |
| 10 | Ga0055541_1004028 | 3300003841 | Bacteria | 2705 |
| 11 | Ga0065712_10034659 | 3300005290 | Bacteria | 1416 |
| 12 | Ga0065715_10113248 | 3300005293 | Bacteria | 2496 |
| 13 | Ga0065707_10001302 | 3300005295 | Bacteria | 13694 |
| 14 | Ga0065707_10247678 | 3300005295 | Bacteria | 1135 |
| 15 | Ga0070676_10044650 | 3300005328 | Bacteria | 2580 |
| 16 | Ga0070676_10046627 | 3300005328 | Bacteria | 2528 |
| 17 | Ga0070676_10114050 | 3300005328 | Bacteria | 1687 |
| 18 | Ga0070690_100072792 | 3300005330 | Bacteria | 2235 |
| 19 | Ga0070690_100189801 | 3300005330 | Bacteria | 1424 |
| 20 | Ga0070690_100290753 | 3300005330 | Bacteria | 1168 |
| 21 | Ga0070670_100002372 | 3300005331 | Bacteria | 15519 |
| 22 | Ga0070670_100016454 | 3300005331 | Bacteria | 6351 |
| 23 | Ga0070670_100036862 | 3300005331 | Bacteria | 4207 |
| 24 | Ga0070670_100069322 | 3300005331 | Bacteria | 3027 |
| 25 | Ga0070670_100088663 | 3300005331 | Bacteria | 2659 |
| 26 | Ga0070670_100404492 | 3300005331 | Bacteria | 1205 |
| 27 | Ga0068869_100009681 | 3300005334 | Bacteria | 6257 |
| 28 | Ga0068869_100070150 | 3300005334 | Bacteria | 2592 |
| 29 | Ga0068869_100104841 | 3300005334 | Bacteria | 2144 |
| 30 | Ga0070666_10007408 | 3300005335 | Bacteria | 6764 |
| 31 | Ga0070666_10021517 | 3300005335 | Bacteria | 4182 |
| 32 | Ga0070666_10038577 | 3300005335 | Bacteria | 3179 |
| 33 | Ga0070666_10340433 | 3300005335 | Bacteria | 1072 |
| 34 | Ga0070680_100201120 | 3300005336 | Bacteria | 1680 |
| 35 | Ga0070682_100007256 | 3300005337 | Bacteria | 6247 |
| 36 | Ga0068868_100010385 | 3300005338 | Bacteria | 6738 |
| 37 | Ga0068868_100010777 | 3300005338 | Bacteria | 6629 |
| 38 | Ga0068868_100053432 | 3300005338 | Bacteria | 3182 |
| 39 | Ga0070660_100081063 | 3300005339 | Bacteria | 2547 |
| 40 | Ga0070660_100098032 | 3300005339 | Bacteria | 2320 |
| 41 | Ga0070660_100214305 | 3300005339 | Bacteria | 1564 |
| 42 | Ga0070689_100224106 | 3300005340 | Bacteria | 1543 |
| 43 | Ga0070689_100452621 | 3300005340 | Bacteria | 1093 |
| 44 | Ga0070691_10002104 | 3300005341 | Bacteria | 8806 |
| 45 | Ga0070687_100155325 | 3300005343 | Bacteria | 1347 |
| 46 | Ga0070692_10038830 | 3300005345 | Bacteria | 2429 |
| 47 | Ga0070668_100003541 | 3300005347 | Bacteria | 11518 |
| 48 | Ga0070668_100008311 | 3300005347 | Bacteria | 7704 |
| 49 | Ga0070668_100009156 | 3300005347 | Bacteria | 7346 |
| 50 | Ga0070668_100025721 | 3300005347 | Bacteria | 4464 |
| 51 | Ga0070668_100043584 | 3300005347 | Bacteria | 3441 |
| 52 | Ga0070668_100093435 | 3300005347 | Bacteria | 2374 |
| 53 | Ga0070668_100115903 | 3300005347 | Bacteria | 2136 |
| 54 | Ga0070668_100185480 | 3300005347 | Bacteria | 1701 |
| 55 | Ga0070669_100054641 | 3300005353 | Bacteria | 2925 |
| 56 | Ga0070669_100063261 | 3300005353 | Bacteria | 2723 |
| 57 | Ga0070675_100013399 | 3300005354 | Bacteria | 6444 |
| 58 | Ga0070675_100018757 | 3300005354 | Bacteria | 5507 |
| 59 | Ga0070675_100087113 | 3300005354 | Bacteria | 2611 |
| 60 | Ga0070671_100007579 | 3300005355 | Bacteria | 8678 |
| 61 | Ga0070671_100023116 | 3300005355 | Bacteria | 5082 |
| 62 | Ga0070671_100024813 | 3300005355 | Bacteria | 4912 |
| 63 | Ga0070671_100025962 | 3300005355 | Bacteria | 4810 |
| 64 | Ga0070674_100003696 | 3300005356 | Bacteria | 8621 |
| 65 | Ga0070674_100046640 | 3300005356 | Bacteria | 2966 |
| 66 | Ga0070674_100130282 | 3300005356 | Bacteria | 1874 |
| 67 | Ga0070674_100154285 | 3300005356 | Bacteria | 1736 |
| 68 | Ga0070674_100159097 | 3300005356 | Bacteria | 1712 |
| 69 | Ga0070674_100236272 | 3300005356 | Bacteria | 1429 |
| 70 | Ga0070673_100000655 | 3300005364 | Bacteria | 18982 |
| 71 | Ga0070673_100051077 | 3300005364 | Bacteria | 3236 |
| 72 | Ga0070673_100134718 | 3300005364 | Bacteria | 2078 |
| 73 | Ga0070673_100174380 | 3300005364 | Bacteria | 1837 |
| 74 | Ga0070673_100276634 | 3300005364 | Bacteria | 1471 |
| 75 | Ga0070673_100282809 | 3300005364 | Bacteria | 1455 |
| 76 | Ga0070659_100046732 | 3300005366 | Bacteria | 3393 |
| 77 | Ga0070659_100061193 | 3300005366 | Bacteria | 2975 |
| 78 | Ga0070659_100089500 | 3300005366 | Bacteria | 2466 |
| 79 | Ga0070659_100180024 | 3300005366 | Bacteria | 1734 |
| 80 | Ga0070667_100022052 | 3300005367 | Bacteria | 5284 |
| 81 | Ga0070667_100049692 | 3300005367 | Bacteria | 3533 |
| 82 | Ga0070667_100144558 | 3300005367 | Bacteria | 2085 |
| 83 | Ga0070667_100163160 | 3300005367 | Bacteria | 1964 |
| 84 | Ga0070709_10056874 | 3300005434 | Bacteria | 2475 |
| 85 | Ga0070714_100047289 | 3300005435 | Bacteria | 3654 |
| 86 | Ga0070714_100102162 | 3300005435 | Bacteria | 2527 |
| 87 | Ga0070713_100000129 | 3300005436 | Bacteria | 49577 |
| 88 | Ga0070713_100011017 | 3300005436 | Bacteria | 6563 |
| 89 | Ga0070713_100227997 | 3300005436 | Bacteria | 1692 |
| 90 | Ga0070710_10025987 | 3300005437 | Bacteria | 3106 |
| 91 | Ga0070701_10018566 | 3300005438 | Bacteria | 3271 |
| 92 | Ga0070701_10128777 | 3300005438 | Bacteria | 1436 |
| 93 | Ga0070711_100053234 | 3300005439 | Bacteria | 2788 |
| 94 | Ga0070705_100059544 | 3300005440 | Bacteria | 2262 |
| 95 | Ga0070700_100107989 | 3300005441 | Bacteria | 1845 |
| 96 | Ga0070694_100023303 | 3300005444 | Bacteria | 3980 |
| 97 | Ga0070708_100210850 | 3300005445 | Bacteria | 1820 |
| 98 | Ga0070663_100002768 | 3300005455 | Bacteria | 9944 |
| 99 | Ga0070663_100058868 | 3300005455 | Bacteria | 2760 |
| 100 | Ga0070663_100384310 | 3300005455 | Bacteria | 1144 |
| 101 | Ga0070678_100016864 | 3300005456 | Bacteria | 4685 |
| 102 | Ga0070678_100058624 | 3300005456 | Bacteria | 2827 |
| 103 | Ga0070678_100087487 | 3300005456 | Bacteria | 2380 |
| 104 | Ga0070678_100099566 | 3300005456 | Bacteria | 2249 |
| 105 | Ga0070678_100111900 | 3300005456 | Bacteria | 2137 |
| 106 | Ga0070678_100188719 | 3300005456 | Bacteria | 1693 |
| 107 | Ga0070662_100027611 | 3300005457 | Bacteria | 3942 |
| 108 | Ga0070662_100032993 | 3300005457 | Bacteria | 3643 |
| 109 | Ga0070681_10036085 | 3300005458 | Bacteria | 4966 |
| 110 | Ga0068867_100008910 | 3300005459 | Bacteria | 7080 |
| 111 | Ga0068867_100012739 | 3300005459 | Bacteria | 5951 |
| 112 | Ga0068867_100060218 | 3300005459 | Bacteria | 2816 |
| 113 | Ga0068867_100130818 | 3300005459 | Bacteria | 1950 |
| 114 | Ga0068867_100144524 | 3300005459 | Bacteria | 1862 |
| 115 | Ga0070685_10059630 | 3300005466 | Bacteria | 2229 |
| 116 | Ga0070685_10075512 | 3300005466 | Bacteria | 2008 |
| 117 | Ga0070706_100159173 | 3300005467 | Unclassified | 2108 |
| 118 | Ga0070707_100016769 | 3300005468 | Bacteria | 6877 |
| 119 | Ga0070699_100000708 | 3300005518 | Bacteria | 30920 |
| 120 | Ga0070679_100018240 | 3300005530 | Bacteria | 6806 |
| 121 | Ga0070679_100148494 | 3300005530 | Bacteria | 2321 |
| 122 | Ga0070679_100240896 | 3300005530 | Bacteria | 1766 |
| 123 | Ga0070684_100059898 | 3300005535 | Bacteria | 3329 |
| 124 | Ga0068853_100009347 | 3300005539 | Bacteria | 7903 |
| 125 | Ga0068853_100026886 | 3300005539 | Bacteria | 4834 |
| 126 | Ga0070672_100003611 | 3300005543 | Bacteria | 10031 |
| 127 | Ga0070672_100037283 | 3300005543 | Bacteria | 3708 |
| 128 | Ga0070672_100335838 | 3300005543 | Bacteria | 1286 |
| 129 | Ga0070686_100189910 | 3300005544 | Bacteria | 1465 |
| 130 | Ga0070693_100008277 | 3300005547 | Bacteria | 5116 |
| 131 | Ga0070665_100036933 | 3300005548 | Bacteria | 4912 |
| 132 | Ga0070665_100042010 | 3300005548 | Bacteria | 4596 |
| 133 | Ga0070665_100056106 | 3300005548 | Bacteria | 3950 |
| 134 | Ga0070665_100233743 | 3300005548 | Bacteria | 1839 |
| 135 | Ga0070704_100010008 | 3300005549 | Bacteria | 5760 |
| 136 | Ga0068855_100104113 | 3300005563 | Bacteria | 3265 |
| 137 | Ga0068855_100214605 | 3300005563 | Bacteria | 2161 |
| 138 | Ga0070664_100004030 | 3300005564 | Bacteria | 11799 |
| 139 | Ga0070664_100121064 | 3300005564 | Bacteria | 2291 |
| 140 | Ga0068854_100012579 | 3300005578 | Bacteria | 5545 |
| 141 | Ga0068854_100025046 | 3300005578 | Bacteria | 4093 |
| 142 | Ga0068856_100004065 | 3300005614 | Bacteria | 14642 |
| 143 | Ga0070702_100003679 | 3300005615 | Bacteria | 6902 |
| 144 | Ga0070702_100031295 | 3300005615 | Bacteria | 2909 |
| 145 | Ga0070702_100068191 | 3300005615 | Bacteria | 2092 |
| 146 | Ga0068852_100039684 | 3300005616 | Bacteria | 3965 |
| 147 | Ga0068852_100041014 | 3300005616 | Bacteria | 3909 |
| 148 | Ga0068852_100157893 | 3300005616 | Bacteria | 2115 |
| 149 | Ga0068852_100183993 | 3300005616 | Bacteria | 1966 |
| 150 | Ga0068852_100262884 | 3300005616 | Bacteria | 1658 |
| 151 | Ga0068859_100025822 | 3300005617 | Bacteria | 5894 |
| 152 | Ga0068859_100032362 | 3300005617 | Bacteria | 5254 |
| 153 | Ga0068859_100035474 | 3300005617 | Bacteria | 5004 |
| 154 | Ga0068859_100042445 | 3300005617 | Bacteria | 4568 |
| 155 | Ga0068859_100079439 | 3300005617 | Bacteria | 3321 |
| 156 | Ga0068859_100674452 | 3300005617 | Bacteria | 1125 |
| 157 | Ga0068864_100027348 | 3300005618 | Bacteria | 4817 |
| 158 | Ga0068864_100095074 | 3300005618 | Bacteria | 2635 |
| 159 | Ga0068864_100116887 | 3300005618 | Bacteria | 2380 |
| 160 | Ga0068864_100122909 | 3300005618 | Bacteria | 2323 |
| 161 | Ga0068864_100149781 | 3300005618 | Bacteria | 2112 |
| 162 | Ga0068864_100283518 | 3300005618 | Bacteria | 1547 |
| 163 | Ga0068866_10118921 | 3300005718 | Bacteria | 1486 |
| 164 | Ga0068861_100003730 | 3300005719 | Bacteria | 10161 |
| 165 | Ga0068861_100095142 | 3300005719 | Bacteria | 2358 |
| 166 | Ga0068861_100127650 | 3300005719 | Bacteria | 2060 |
| 167 | Ga0068861_100220865 | 3300005719 | Bacteria | 1602 |
| 168 | Ga0068851_10001051 | 3300005834 | Bacteria | 11959 |
| 169 | Ga0068851_10009294 | 3300005834 | Bacteria | 4564 |
| 170 | Ga0068851_10077806 | 3300005834 | Bacteria | 1727 |
| 171 | Ga0068851_10081757 | 3300005834 | Bacteria | 1688 |
| 172 | Ga0068870_10001962 | 3300005840 | Bacteria | 8504 |
| 173 | Ga0068870_10051449 | 3300005840 | Bacteria | 2180 |
| 174 | Ga0068870_10192874 | 3300005840 | Bacteria | 1230 |
| 175 | Ga0068863_100003730 | 3300005841 | Bacteria | 15066 |
| 176 | Ga0068863_100016873 | 3300005841 | Bacteria | 7003 |
| 177 | Ga0068863_100087307 | 3300005841 | Bacteria | 2955 |
| 178 | Ga0068858_100010789 | 3300005842 | Bacteria | 8636 |
| 179 | Ga0068858_100020301 | 3300005842 | Bacteria | 6213 |
| 180 | Ga0068858_100076998 | 3300005842 | Bacteria | 3098 |
| 181 | Ga0068858_100145629 | 3300005842 | Bacteria | 2225 |
| 182 | Ga0068858_100211914 | 3300005842 | Bacteria | 1833 |
| 183 | Ga0068858_100402097 | 3300005842 | Bacteria | 1316 |
| 184 | Ga0068858_100585921 | 3300005842 | Bacteria | 1081 |
| 185 | Ga0068860_100022098 | 3300005843 | Bacteria | 6158 |
| 186 | Ga0068860_100126704 | 3300005843 | Bacteria | 2447 |
| 187 | Ga0068860_100198483 | 3300005843 | Bacteria | 1944 |
| 188 | Ga0068860_100515916 | 3300005843 | Bacteria | 1195 |
| 189 | Ga0068862_100008255 | 3300005844 | Bacteria | 8614 |
| 190 | Ga0068862_100011911 | 3300005844 | Bacteria | 7183 |
| 191 | Ga0068862_100030190 | 3300005844 | Bacteria | 4567 |
| 192 | Ga0068862_100174977 | 3300005844 | Bacteria | 1924 |
| 193 | Ga0068862_100178804 | 3300005844 | Bacteria | 1903 |
| 194 | Ga0068862_100485875 | 3300005844 | Bacteria | 1170 |
| 195 | Ga0081455_10042044 | 3300005937 | Bacteria | 4013 |
| 196 | Ga0081455_10086820 | 3300005937 | Bacteria | 2547 |
| 197 | Ga0081539_10000927 | 3300005985 | Bacteria | 55152 |
| 198 | Ga0081539_10045116 | 3300005985 | Bacteria | 2538 |
| 199 | Ga0070717_10012513 | 3300006028 | Bacteria | 6473 |
| 200 | Ga0070717_10070126 | 3300006028 | Bacteria | 2920 |
| 201 | Ga0070717_10080300 | 3300006028 | Bacteria | 2736 |
| 202 | Ga0070717_10216537 | 3300006028 | Bacteria | 1682 |
| 203 | Ga0070717_10620385 | 3300006028 | Bacteria | 981 |
| 204 | Ga0075365_10118627 | 3300006038 | Bacteria | 1823 |
| 205 | Ga0075365_10193734 | 3300006038 | Bacteria | 1423 |
| 206 | Ga0075365_10204591 | 3300006038 | Bacteria | 1383 |
| 207 | Ga0070712_100201659 | 3300006175 | Bacteria | 1563 |
| 208 | Ga0075367_10039793 | 3300006178 | Bacteria | 2742 |
| 209 | Ga0075367_10283228 | 3300006178 | Bacteria | 1042 |
| 210 | Ga0097621_100014203 | 3300006237 | Bacteria | 5954 |
| 211 | Ga0097621_100030796 | 3300006237 | Bacteria | 4252 |
| 212 | Ga0097621_100349621 | 3300006237 | Bacteria | 1314 |
| 213 | Ga0068871_100022746 | 3300006358 | Bacteria | 4838 |
| 214 | Ga0068871_100031530 | 3300006358 | Bacteria | 4181 |
| 215 | Ga0068871_100043670 | 3300006358 | Bacteria | 3602 |
| 216 | Ga0068871_100047252 | 3300006358 | Bacteria | 3470 |
| 217 | Ga0068871_100075727 | 3300006358 | Bacteria | 2778 |
| 218 | Ga0068871_100275157 | 3300006358 | Bacteria | 1471 |
| 219 | Ga0075428_100190255 | 3300006844 | Bacteria | 2220 |
| 220 | Ga0075428_100261056 | 3300006844 | Bacteria | 1865 |
| 221 | Ga0075430_100075967 | 3300006846 | Bacteria | 2816 |
| 222 | Ga0075430_100131372 | 3300006846 | Bacteria | 2087 |
| 223 | Ga0075430_100335223 | 3300006846 | Bacteria | 1250 |
| 224 | Ga0075431_100036988 | 3300006847 | Bacteria | 5028 |
| 225 | Ga0075431_100072856 | 3300006847 | Bacteria | 3544 |
| 226 | Ga0075431_100154691 | 3300006847 | Bacteria | 2360 |
| 227 | Ga0075433_10011974 | 3300006852 | Bacteria | 6993 |
| 228 | Ga0075434_100008016 | 3300006871 | Bacteria | 9788 |
| 229 | Ga0075429_100150497 | 3300006880 | Bacteria | 2038 |
| 230 | Ga0075429_100185014 | 3300006880 | Bacteria | 1825 |
| 231 | Ga0068865_100008038 | 3300006881 | Bacteria | 6512 |
| 232 | Ga0075436_100010195 | 3300006914 | Bacteria | 6435 |
| 233 | Ga0097620_100025822 | 3300006931 | Bacteria | 5894 |
| 234 | Ga0097620_100032362 | 3300006931 | Bacteria | 5254 |
| 235 | Ga0097620_100035474 | 3300006931 | Bacteria | 5004 |
| 236 | Ga0097620_100042445 | 3300006931 | Bacteria | 4568 |
| 237 | Ga0097620_100079438 | 3300006931 | Bacteria | 3321 |
| 238 | Ga0097620_100674499 | 3300006931 | Bacteria | 1125 |
| 239 | Ga0099824_1007872 | 3300006942 | Bacteria | 13879 |
| 240 | Ga0079104_1000146 | 3300006946 | Bacteria | 99148 |
| 241 | Ga0079104_1016660 | 3300006946 | Bacteria | 2140 |
| 242 | Ga0079104_1023901 | 3300006946 | Bacteria | 1618 |
| 243 | Ga0099826_10005057 | 3300006948 | Bacteria | 9372 |
| 244 | Ga0075435_100012598 | 3300007076 | Bacteria | 6264 |
| 245 | Ga0105251_10055930 | 3300009011 | Bacteria | 1869 |
| 246 | Ga0105250_10000006 | 3300009092 | Bacteria | 390071 |
| 247 | Ga0105240_10010715 | 3300009093 | Bacteria | 12862 |
| 248 | Ga0105240_10017187 | 3300009093 | Bacteria | 9759 |
| 249 | Ga0105240_10089075 | 3300009093 | Bacteria | 3775 |
| 250 | Ga0111539_10057862 | 3300009094 | Bacteria | 4602 |
| 251 | Ga0111539_10071416 | 3300009094 | Bacteria | 4096 |
| 252 | Ga0111539_10120566 | 3300009094 | Bacteria | 3073 |
| 253 | Ga0111539_10307347 | 3300009094 | Bacteria | 1845 |
| 254 | Ga0111539_10336516 | 3300009094 | Bacteria | 1757 |
| 255 | Ga0111539_10683653 | 3300009094 | Bacteria | 1195 |
| 256 | Ga0105245_10008219 | 3300009098 | Bacteria | 9124 |
| 257 | Ga0105245_10026816 | 3300009098 | Bacteria | 5073 |
| 258 | Ga0105245_10448387 | 3300009098 | Bacteria | 1298 |
| 259 | Ga0105247_10004007 | 3300009101 | Bacteria | 9476 |
| 260 | Ga0105247_10148587 | 3300009101 | Bacteria | 1542 |
| 261 | Ga0114129_10069834 | 3300009147 | Bacteria | 4897 |
| 262 | Ga0114129_10520896 | 3300009147 | Bacteria | 1550 |
| 263 | Ga0105243_10034179 | 3300009148 | Bacteria | 3934 |
| 264 | Ga0105241_10025396 | 3300009174 | Bacteria | 4402 |
| 265 | Ga0105241_10104068 | 3300009174 | Bacteria | 2261 |
| 266 | Ga0105241_10195305 | 3300009174 | Bacteria | 1687 |
| 267 | Ga0105242_10088775 | 3300009176 | Bacteria | 2598 |
| 268 | Ga0105248_10016488 | 3300009177 | Bacteria | 8132 |
| 269 | Ga0105248_10113758 | 3300009177 | Bacteria | 3052 |
| 270 | Ga0105248_10218452 | 3300009177 | Bacteria | 2146 |
| 271 | Ga0105237_10013036 | 3300009545 | Bacteria | 8728 |
| 272 | Ga0105237_10046598 | 3300009545 | Bacteria | 4360 |
| 273 | Ga0105237_10209728 | 3300009545 | Bacteria | 1948 |
| 274 | Ga0105238_10067892 | 3300009551 | Bacteria | 3566 |
| 275 | Ga0105238_10142509 | 3300009551 | Bacteria | 2373 |
| 276 | Ga0105249_10014648 | 3300009553 | Bacteria | 6932 |
| 277 | Ga0105249_10107042 | 3300009553 | Bacteria | 2638 |
| 278 | Ga0105249_10259151 | 3300009553 | Bacteria | 1727 |
| 279 | Ga0105239_10000037 | 3300010375 | Bacteria | 206779 |
| 280 | Ga0105239_10056407 | 3300010375 | Bacteria | 4309 |
| 281 | Ga0105239_10111081 | 3300010375 | Bacteria | 3038 |
| 282 | Ga0105239_10648910 | 3300010375 | Bacteria | 1205 |
| 283 | Ga0105246_10007529 | 3300011119 | Bacteria | 6678 |
| 284 | Ga0157373_10000023 | 3300013100 | Bacteria | 164200 |
| 285 | Ga0157373_10080711 | 3300013100 | Bacteria | 2294 |
| 286 | Ga0157371_10008583 | 3300013102 | Bacteria | 8122 |
| 287 | Ga0157371_10039729 | 3300013102 | Bacteria | 3364 |
| 288 | Ga0157371_10131106 | 3300013102 | Bacteria | 1783 |
| 289 | Ga0157371_10165535 | 3300013102 | Bacteria | 1579 |
| 290 | Ga0157370_10003921 | 3300013104 | Bacteria | 17335 |
| 291 | Ga0157370_10013827 | 3300013104 | Bacteria | 8291 |
| 292 | Ga0157369_10050251 | 3300013105 | Bacteria | 4516 |
| 293 | Ga0157374_10002677 | 3300013296 | Bacteria | 14989 |
| 294 | Ga0157374_10016721 | 3300013296 | Bacteria | 6454 |
| 295 | Ga0157374_10054267 | 3300013296 | Bacteria | 3738 |
| 296 | Ga0157374_10074957 | 3300013296 | Bacteria | 3197 |
| 297 | Ga0157374_10375497 | 3300013296 | Bacteria | 1416 |
| 298 | Ga0157378_10000631 | 3300013297 | Bacteria | 33043 |
| 299 | Ga0157378_10060000 | 3300013297 | Bacteria | 3394 |
| 300 | Ga0157378_10074921 | 3300013297 | Bacteria | 3046 |
| 301 | Ga0163162_10005487 | 3300013306 | Bacteria | 12255 |
| 302 | Ga0157375_10019639 | 3300013308 | Bacteria | 6152 |
| 303 | Ga0157375_10061837 | 3300013308 | Bacteria | 3719 |
| 304 | Ga0157375_10108044 | 3300013308 | Bacteria | 2876 |
| 305 | Ga0157375_10155169 | 3300013308 | Bacteria | 2428 |
| 306 | Ga0157375_10286061 | 3300013308 | Bacteria | 1812 |
| 307 | Ga0163163_10007534 | 3300014325 | Bacteria | 9609 |
| 308 | Ga0157380_10002142 | 3300014326 | Bacteria | 13248 |
| 309 | Ga0157380_10002279 | 3300014326 | Bacteria | 12894 |
| 310 | Ga0157380_10008389 | 3300014326 | Bacteria | 7371 |
| 311 | Ga0157380_10032855 | 3300014326 | Bacteria | 3993 |
| 312 | Ga0157380_10033683 | 3300014326 | Bacteria | 3946 |
| 313 | Ga0157380_10078277 | 3300014326 | Bacteria | 2697 |
| 314 | Ga0157380_10080884 | 3300014326 | Bacteria | 2656 |
| 315 | Ga0157380_10116787 | 3300014326 | Bacteria | 2253 |
| 316 | Ga0157377_10097218 | 3300014745 | Bacteria | 1748 |
| 317 | Ga0157377_10280655 | 3300014745 | Bacteria | 1092 |
| 318 | Ga0157379_10000830 | 3300014968 | Bacteria | 25057 |
| 319 | Ga0157379_10039058 | 3300014968 | Bacteria | 4235 |
| 320 | Ga0157379_10181531 | 3300014968 | Bacteria | 1901 |
| 321 | Ga0157379_10253425 | 3300014968 | Bacteria | 1598 |
| 322 | Ga0157376_10041860 | 3300014969 | Bacteria | 3753 |
| 323 | Ga0157376_10051232 | 3300014969 | Bacteria | 3429 |
| 324 | Ga0157376_10061915 | 3300014969 | Bacteria | 3147 |
| 325 | Ga0157376_10096073 | 3300014969 | Bacteria | 2578 |
| 326 | Ga0157376_10320753 | 3300014969 | Bacteria | 1473 |
| 327 | Ga0182006_1002701 | 3300015261 | Bacteria | 9523 |
| 328 | Ga0182006_1017283 | 3300015261 | Bacteria | 3066 |
| 329 | Ga0182006_1017297 | 3300015261 | Bacteria | 3065 |
| 330 | Ga0163161_10287141 | 3300017792 | Bacteria | 1292 |
| 331 | Ga0163161_10511148 | 3300017792 | Bacteria | 980 |
| 332 | Ga0206353_11795824 | 3300020082 | Bacteria | 1397 |
| 333 | Ga0209566_100052 | 3300025225 | Bacteria | 231848 |
| 334 | Ga0209147_103612 | 3300025229 | Bacteria | 2909 |
| 335 | Ga0209258_101156 | 3300025242 | Bacteria | 10794 |
| 336 | Ga0209675_1000025 | 3300025291 | Bacteria | 294102 |
| 337 | Ga0209676_1000198 | 3300025292 | Bacteria | 134708 |
| 338 | Ga0209676_1000362 | 3300025292 | Bacteria | 85770 |
| 339 | Ga0209676_1003189 | 3300025292 | Bacteria | 10409 |
| 340 | Ga0209676_1041396 | 3300025292 | Bacteria | 1288 |
| 341 | Ga0209025_1019137 | 3300025294 | Bacteria | 3826 |
| 342 | Ga0209025_1041993 | 3300025294 | Bacteria | 1949 |
| 343 | Ga0209050_1000849 | 3300025298 | Bacteria | 41596 |
| 344 | Ga0209050_1003508 | 3300025298 | Bacteria | 11474 |
| 345 | Ga0209257_1000860 | 3300025304 | Bacteria | 43237 |
| 346 | Ga0209257_1001370 | 3300025304 | Bacteria | 29369 |
| 347 | Ga0209257_1003116 | 3300025304 | Bacteria | 14836 |
| 348 | Ga0207697_10004336 | 3300025315 | Bacteria | 6790 |
| 349 | Ga0207696_1000069 | 3300025711 | Bacteria | 227744 |
| 350 | Ga0207655_1000003 | 3300025728 | Bacteria | 1081376 |
| 351 | Ga0207682_10000798 | 3300025893 | Bacteria | 14551 |
| 352 | Ga0207682_10002137 | 3300025893 | Bacteria | 8961 |
| 353 | Ga0207682_10015311 | 3300025893 | Bacteria | 2984 |
| 354 | Ga0207642_10025189 | 3300025899 | Bacteria | 2403 |
| 355 | Ga0207642_10031370 | 3300025899 | Bacteria | 2225 |
| 356 | Ga0207642_10246690 | 3300025899 | Bacteria | 1011 |
| 357 | Ga0207710_10015418 | 3300025900 | Bacteria | 3229 |
| 358 | Ga0207688_10032338 | 3300025901 | Bacteria | 2891 |
| 359 | Ga0207688_10048236 | 3300025901 | Bacteria | 2379 |
| 360 | Ga0207688_10066672 | 3300025901 | Bacteria | 2036 |
| 361 | Ga0207680_10030105 | 3300025903 | Bacteria | 3057 |
| 362 | Ga0207680_10108620 | 3300025903 | Bacteria | 1795 |
| 363 | Ga0207647_10146562 | 3300025904 | Bacteria | 1381 |
| 364 | Ga0207647_10167662 | 3300025904 | Bacteria | 1279 |
| 365 | Ga0207699_10004323 | 3300025906 | Bacteria | 6796 |
| 366 | Ga0207645_10001048 | 3300025907 | Bacteria | 22872 |
| 367 | Ga0207645_10047151 | 3300025907 | Bacteria | 2752 |
| 368 | Ga0207645_10055042 | 3300025907 | Bacteria | 2540 |
| 369 | Ga0207645_10094092 | 3300025907 | Bacteria | 1929 |
| 370 | Ga0207645_10119781 | 3300025907 | Bacteria | 1708 |
| 371 | Ga0207643_10000594 | 3300025908 | Bacteria | 22954 |
| 372 | Ga0207643_10046706 | 3300025908 | Bacteria | 2448 |
| 373 | Ga0207643_10123129 | 3300025908 | Bacteria | 1538 |
| 374 | Ga0207654_10134043 | 3300025911 | Bacteria | 1571 |
| 375 | Ga0207695_10001017 | 3300025913 | Bacteria | 49429 |
| 376 | Ga0207695_10031430 | 3300025913 | Bacteria | 5823 |
| 377 | Ga0207695_10046636 | 3300025913 | Bacteria | 4592 |
| 378 | Ga0207695_10109233 | 3300025913 | Bacteria | 2748 |
| 379 | Ga0207671_10004808 | 3300025914 | Bacteria | 12723 |
| 380 | Ga0207671_10052375 | 3300025914 | Bacteria | 3025 |
| 381 | Ga0207671_10091997 | 3300025914 | Bacteria | 2286 |
| 382 | Ga0207693_10024239 | 3300025915 | Bacteria | 4817 |
| 383 | Ga0207663_10016077 | 3300025916 | Bacteria | 4141 |
| 384 | Ga0207660_10007800 | 3300025917 | Bacteria | 6928 |
| 385 | Ga0207660_10028542 | 3300025917 | Bacteria | 3817 |
| 386 | Ga0207662_10155727 | 3300025918 | Bacteria | 1456 |
| 387 | Ga0207657_10022327 | 3300025919 | Bacteria | 5924 |
| 388 | Ga0207657_10076906 | 3300025919 | Bacteria | 2815 |
| 389 | Ga0207657_10085036 | 3300025919 | Bacteria | 2651 |
| 390 | Ga0207649_10002784 | 3300025920 | Bacteria | 9659 |
| 391 | Ga0207652_10122608 | 3300025921 | Bacteria | 2313 |
| 392 | Ga0207652_10354277 | 3300025921 | Bacteria | 1325 |
| 393 | Ga0207646_10001356 | 3300025922 | Bacteria | 30379 |
| 394 | Ga0207681_10012027 | 3300025923 | Bacteria | 5331 |
| 395 | Ga0207681_10045203 | 3300025923 | Bacteria | 2955 |
| 396 | Ga0207681_10080936 | 3300025923 | Bacteria | 2292 |
| 397 | Ga0207681_10186577 | 3300025923 | Bacteria | 1583 |
| 398 | Ga0207694_10248910 | 3300025924 | Bacteria | 1454 |
| 399 | Ga0207650_10001016 | 3300025925 | Bacteria | 21075 |
| 400 | Ga0207650_10001564 | 3300025925 | Bacteria | 16366 |
| 401 | Ga0207650_10003470 | 3300025925 | Bacteria | 10830 |
| 402 | Ga0207650_10040514 | 3300025925 | Bacteria | 3409 |
| 403 | Ga0207659_10002573 | 3300025926 | Bacteria | 10802 |
| 404 | Ga0207659_10011881 | 3300025926 | Bacteria | 5516 |
| 405 | Ga0207659_10019574 | 3300025926 | Bacteria | 4459 |
| 406 | Ga0207659_10236941 | 3300025926 | Bacteria | 1474 |
| 407 | Ga0207687_10030832 | 3300025927 | Bacteria | 3619 |
| 408 | Ga0207700_10000044 | 3300025928 | Bacteria | 89454 |
| 409 | Ga0207700_10001414 | 3300025928 | Bacteria | 13622 |
| 410 | Ga0207700_10071401 | 3300025928 | Bacteria | 2673 |
| 411 | Ga0207664_10005921 | 3300025929 | Bacteria | 8365 |
| 412 | Ga0207664_10036227 | 3300025929 | Bacteria | 3813 |
| 413 | Ga0207664_10449804 | 3300025929 | Bacteria | 1150 |
| 414 | Ga0207644_10002140 | 3300025931 | Bacteria | 12809 |
| 415 | Ga0207644_10003507 | 3300025931 | Bacteria | 10153 |
| 416 | Ga0207644_10089931 | 3300025931 | Bacteria | 2286 |
| 417 | Ga0207690_10074617 | 3300025932 | Bacteria | 2349 |
| 418 | Ga0207690_10194039 | 3300025932 | Bacteria | 1538 |
| 419 | Ga0207690_10227839 | 3300025932 | Bacteria | 1429 |
| 420 | Ga0207706_10006526 | 3300025933 | Bacteria | 10815 |
| 421 | Ga0207706_10015081 | 3300025933 | Bacteria | 6995 |
| 422 | Ga0207706_10022657 | 3300025933 | Bacteria | 5637 |
| 423 | Ga0207706_10261322 | 3300025933 | Bacteria | 1511 |
| 424 | Ga0207709_10052850 | 3300025935 | Bacteria | 2497 |
| 425 | Ga0207709_10081325 | 3300025935 | Bacteria | 2088 |
| 426 | Ga0207709_10149120 | 3300025935 | Bacteria | 1618 |
| 427 | Ga0207670_10051408 | 3300025936 | Bacteria | 2767 |
| 428 | Ga0207670_10157127 | 3300025936 | Bacteria | 1694 |
| 429 | Ga0207670_10380867 | 3300025936 | Bacteria | 1124 |
| 430 | Ga0207669_10002485 | 3300025937 | Bacteria | 7864 |
| 431 | Ga0207669_10007588 | 3300025937 | Bacteria | 5031 |
| 432 | Ga0207669_10067523 | 3300025937 | Bacteria | 2229 |
| 433 | Ga0207669_10077647 | 3300025937 | Bacteria | 2113 |
| 434 | Ga0207669_10517847 | 3300025937 | Bacteria | 957 |
| 435 | Ga0207704_10030885 | 3300025938 | Bacteria | 3010 |
| 436 | Ga0207704_10190312 | 3300025938 | Bacteria | 1492 |
| 437 | Ga0207665_10384990 | 3300025939 | Bacteria | 1065 |
| 438 | Ga0207691_10000180 | 3300025940 | Bacteria | 59800 |
| 439 | Ga0207691_10003262 | 3300025940 | Bacteria | 15803 |
| 440 | Ga0207691_10007125 | 3300025940 | Bacteria | 10793 |
| 441 | Ga0207691_10038037 | 3300025940 | Bacteria | 4452 |
| 442 | Ga0207691_10054083 | 3300025940 | Bacteria | 3663 |
| 443 | Ga0207691_10060715 | 3300025940 | Bacteria | 3435 |
| 444 | Ga0207691_10120971 | 3300025940 | Bacteria | 2320 |
| 445 | Ga0207691_10136420 | 3300025940 | Bacteria | 2164 |
| 446 | Ga0207711_10005883 | 3300025941 | Bacteria | 10354 |
| 447 | Ga0207711_10092518 | 3300025941 | Bacteria | 2661 |
| 448 | Ga0207711_10142554 | 3300025941 | Bacteria | 2157 |
| 449 | Ga0207689_10001431 | 3300025942 | Bacteria | 22792 |
| 450 | Ga0207689_10024871 | 3300025942 | Bacteria | 5020 |
| 451 | Ga0207689_10049684 | 3300025942 | Bacteria | 3460 |
| 452 | Ga0207689_10199433 | 3300025942 | Bacteria | 1652 |
| 453 | Ga0207661_10003516 | 3300025944 | Bacteria | 10885 |
| 454 | Ga0207661_10080148 | 3300025944 | Bacteria | 2693 |
| 455 | Ga0207679_10043675 | 3300025945 | Bacteria | 3229 |
| 456 | Ga0207667_10360925 | 3300025949 | Bacteria | 1481 |
| 457 | Ga0207651_10074105 | 3300025960 | Bacteria | 2423 |
| 458 | Ga0207651_10075588 | 3300025960 | Bacteria | 2404 |
| 459 | Ga0207651_10141206 | 3300025960 | Bacteria | 1861 |
| 460 | Ga0207651_10401937 | 3300025960 | Bacteria | 1165 |
| 461 | Ga0207668_10000060 | 3300025972 | Bacteria | 89732 |
| 462 | Ga0207668_10007605 | 3300025972 | Bacteria | 6450 |
| 463 | Ga0207668_10050245 | 3300025972 | Bacteria | 2872 |
| 464 | Ga0207668_10092305 | 3300025972 | Bacteria | 2228 |
| 465 | Ga0207658_10023664 | 3300025986 | Bacteria | 4290 |
| 466 | Ga0207658_10041264 | 3300025986 | Bacteria | 3341 |
| 467 | Ga0207658_10076747 | 3300025986 | Bacteria | 2547 |
| 468 | Ga0207658_10418344 | 3300025986 | Bacteria | 1181 |
| 469 | Ga0207677_10072693 | 3300026023 | Bacteria | 2432 |
| 470 | Ga0207677_10094007 | 3300026023 | Bacteria | 2187 |
| 471 | Ga0207677_10551133 | 3300026023 | Bacteria | 1005 |
| 472 | Ga0207703_10012833 | 3300026035 | Bacteria | 6533 |
| 473 | Ga0207703_10041853 | 3300026035 | Bacteria | 3673 |
| 474 | Ga0207703_10069667 | 3300026035 | Bacteria | 2901 |
| 475 | Ga0207703_10371529 | 3300026035 | Bacteria | 1321 |
| 476 | Ga0207639_10082507 | 3300026041 | Bacteria | 2548 |
| 477 | Ga0207639_10109132 | 3300026041 | Bacteria | 2251 |
| 478 | Ga0207678_10001818 | 3300026067 | Bacteria | 19546 |
| 479 | Ga0207678_10008182 | 3300026067 | Bacteria | 9223 |
| 480 | Ga0207678_10214587 | 3300026067 | Bacteria | 1647 |
| 481 | Ga0207708_10006356 | 3300026075 | Bacteria | 8756 |
| 482 | Ga0207708_10034973 | 3300026075 | Bacteria | 3822 |
| 483 | Ga0207708_10053197 | 3300026075 | Bacteria | 3084 |
| 484 | Ga0207708_10127160 | 3300026075 | Bacteria | 1990 |
| 485 | Ga0207702_10001992 | 3300026078 | Bacteria | 19810 |
| 486 | Ga0207702_10021932 | 3300026078 | Bacteria | 5289 |
| 487 | Ga0207641_10010191 | 3300026088 | Bacteria | 7729 |
| 488 | Ga0207641_10031263 | 3300026088 | Bacteria | 4415 |
| 489 | Ga0207641_10041337 | 3300026088 | Bacteria | 3863 |
| 490 | Ga0207648_10005794 | 3300026089 | Bacteria | 12379 |
| 491 | Ga0207648_10012777 | 3300026089 | Bacteria | 7845 |
| 492 | Ga0207648_10017845 | 3300026089 | Bacteria | 6440 |
| 493 | Ga0207648_10048341 | 3300026089 | Bacteria | 3725 |
| 494 | Ga0207648_10077587 | 3300026089 | Bacteria | 2896 |
| 495 | Ga0207648_10111844 | 3300026089 | Bacteria | 2398 |
| 496 | Ga0207648_10118701 | 3300026089 | Bacteria | 2325 |
| 497 | Ga0207648_10170115 | 3300026089 | Bacteria | 1926 |
| 498 | Ga0207676_10000896 | 3300026095 | Bacteria | 23105 |
| 499 | Ga0207676_10005522 | 3300026095 | Bacteria | 8948 |
| 500 | Ga0207676_10060724 | 3300026095 | Bacteria | 2991 |
| 501 | Ga0207676_10104749 | 3300026095 | Bacteria | 2353 |
| 502 | Ga0207676_10112461 | 3300026095 | Bacteria | 2281 |
| 503 | Ga0207676_10155031 | 3300026095 | Bacteria | 1977 |
| 504 | Ga0207674_10030489 | 3300026116 | Bacteria | 5668 |
| 505 | Ga0207675_100015760 | 3300026118 | Bacteria | 7048 |
| 506 | Ga0207675_100023333 | 3300026118 | Bacteria | 5754 |
| 507 | Ga0207675_100039045 | 3300026118 | Bacteria | 4431 |
| 508 | Ga0207675_100086921 | 3300026118 | Bacteria | 2936 |
| 509 | Ga0207675_100450507 | 3300026118 | Bacteria | 1275 |
| 510 | Ga0207675_100594747 | 3300026118 | Bacteria | 1109 |
| 511 | Ga0207683_10000146 | 3300026121 | Bacteria | 58543 |
| 512 | Ga0207683_10001721 | 3300026121 | Bacteria | 19553 |
| 513 | Ga0207683_10001789 | 3300026121 | Bacteria | 19023 |
| 514 | Ga0207683_10065769 | 3300026121 | Bacteria | 3197 |
| 515 | Ga0207683_10163499 | 3300026121 | Bacteria | 2013 |
| 516 | Ga0207683_10180368 | 3300026121 | Bacteria | 1915 |
| 517 | Ga0207683_10346564 | 3300026121 | Bacteria | 1363 |
| 518 | Ga0207698_10002118 | 3300026142 | Bacteria | 11709 |
| 519 | Ga0207698_10026942 | 3300026142 | Bacteria | 4073 |
| 520 | Ga0207698_10062486 | 3300026142 | Bacteria | 2908 |
| 521 | Ga0209281_1000045 | 3300027111 | Bacteria | 328124 |
| 522 | Ga0209281_1004536 | 3300027111 | Bacteria | 4131 |
| 523 | Ga0209489_108520 | 3300027361 | Bacteria | 13879 |
| 524 | Ga0210002_1018120 | 3300027617 | Bacteria | 1124 |
| 525 | Ga0209971_1003179 | 3300027682 | Bacteria | 3915 |
| 526 | Ga0209966_1005269 | 3300027695 | Bacteria | 2218 |
| 527 | Ga0209974_10014042 | 3300027876 | Bacteria | 2668 |
| 528 | Ga0209974_10056085 | 3300027876 | Bacteria | 1329 |
| 529 | Ga0209974_10109539 | 3300027876 | Bacteria | 971 |
| 530 | Ga0207428_10015402 | 3300027907 | Bacteria | 6615 |
| 531 | Ga0207428_10214012 | 3300027907 | Bacteria | 1447 |
| 532 | Ga0268266_10028457 | 3300028379 | Bacteria | 4750 |
| 533 | Ga0268266_10208928 | 3300028379 | Bacteria | 1790 |
| 534 | Ga0268266_10287376 | 3300028379 | Bacteria | 1530 |
| 535 | Ga0268265_10007031 | 3300028380 | Bacteria | 7610 |
| 536 | Ga0268265_10050752 | 3300028380 | Bacteria | 3127 |
| 537 | Ga0268264_10008954 | 3300028381 | Bacteria | 8308 |
| 538 | Ga0268264_10018610 | 3300028381 | Bacteria | 5679 |
| 539 | Ga0268264_10086517 | 3300028381 | Bacteria | 2693 |
| 540 | Ga0268264_10095159 | 3300028381 | Bacteria | 2577 |
| 541 | Ga0268264_10207103 | 3300028381 | Bacteria | 1798 |
| 542 | Ga0268264_10282555 | 3300028381 | Bacteria | 1555 |
| 543 | Ga0265334_10016887 | 3300028573 | Bacteria | 3018 |
| 544 | Ga0265318_10011555 | 3300028577 | Bacteria | 3795 |
| 545 | Ga0265338_10015955 | 3300028800 | Bacteria | 8213 |
| 546 | Ga0265330_10030331 | 3300031235 | Bacteria | 2429 |
| 547 | Ga0265332_10014637 | 3300031238 | Bacteria | 3468 |
| 548 | Ga0265340_10092203 | 3300031247 | Bacteria | 1415 |
| 549 | Ga0265331_10008258 | 3300031250 | Bacteria | 5934 |
| 550 | Ga0265316_10018778 | 3300031344 | Bacteria | 5935 |
| 551 | Ga0307408_100000475 | 3300031548 | Bacteria | 35093 |
| 552 | Ga0307408_100163213 | 3300031548 | Bacteria | 1771 |
| 553 | Ga0307408_100404560 | 3300031548 | Bacteria | 1173 |
| 554 | Ga0307408_100438842 | 3300031548 | Bacteria | 1130 |
| 555 | Ga0316575_10076015 | 3300031665 | Bacteria | 1352 |
| 556 | Ga0316579_10005942 | 3300031691 | Bacteria | 4950 |
| 557 | Ga0265314_10000595 | 3300031711 | Bacteria | 45508 |
| 558 | Ga0265342_10051906 | 3300031712 | Bacteria | 2445 |
| 559 | Ga0316576_10004148 | 3300031727 | Bacteria | 8646 |
| 560 | Ga0316576_10087355 | 3300031727 | Bacteria | 2320 |
| 561 | Ga0316576_10125682 | 3300031727 | Bacteria | 1927 |
| 562 | Ga0316576_10145717 | 3300031727 | Bacteria | 1783 |
| 563 | Ga0316578_10017721 | 3300031728 | Bacteria | 3882 |
| 564 | Ga0316578_10166068 | 3300031728 | Bacteria | 1330 |
| 565 | Ga0307405_10010037 | 3300031731 | Bacteria | 4885 |
| 566 | Ga0316577_10028417 | 3300031733 | Bacteria | 3120 |
| 567 | Ga0316577_10072127 | 3300031733 | Bacteria | 1927 |
| 568 | Ga0316577_10122595 | 3300031733 | Bacteria | 1461 |
| 569 | Ga0307413_10014744 | 3300031824 | Bacteria | 3982 |
| 570 | Ga0307413_10201004 | 3300031824 | Bacteria | 1439 |
| 571 | Ga0307410_10005332 | 3300031852 | Bacteria | 6791 |
| 572 | Ga0307410_10009576 | 3300031852 | Bacteria | 5442 |
| 573 | Ga0307410_10018238 | 3300031852 | Bacteria | 4237 |
| 574 | Ga0307410_10020706 | 3300031852 | Bacteria | 4030 |
| 575 | Ga0307406_10000062 | 3300031901 | Bacteria | 60112 |
| 576 | Ga0307406_10030734 | 3300031901 | Bacteria | 3264 |
| 577 | Ga0307407_10000440 | 3300031903 | Bacteria | 12687 |
| 578 | Ga0307407_10001616 | 3300031903 | Bacteria | 8325 |
| 579 | Ga0307407_10043850 | 3300031903 | Bacteria | 2517 |
| 580 | Ga0307412_10111294 | 3300031911 | Bacteria | 1956 |
| 581 | Ga0307412_10151594 | 3300031911 | Bacteria | 1711 |
| 582 | Ga0307409_100007763 | 3300031995 | Bacteria | 6451 |
| 583 | Ga0307409_100078235 | 3300031995 | Bacteria | 2660 |
| 584 | Ga0307409_100089516 | 3300031995 | Bacteria | 2516 |
| 585 | Ga0307409_100275035 | 3300031995 | Bacteria | 1553 |
| 586 | Ga0307416_100000394 | 3300032002 | Bacteria | 22418 |
| 587 | Ga0307416_100008628 | 3300032002 | Bacteria | 6596 |
| 588 | Ga0307416_100910466 | 3300032002 | Bacteria | 980 |
| 589 | Ga0307414_10000027 | 3300032004 | Bacteria | 192277 |
| 590 | Ga0307414_10026665 | 3300032004 | Bacteria | 3722 |
| 591 | Ga0307414_10048545 | 3300032004 | Bacteria | 2929 |
| 592 | Ga0307414_10052365 | 3300032004 | Bacteria | 2840 |
| 593 | Ga0307414_10085742 | 3300032004 | Bacteria | 2321 |
| 594 | Ga0307411_10037604 | 3300032005 | Bacteria | 3045 |
| 595 | Ga0307411_10217284 | 3300032005 | Bacteria | 1480 |
| 596 | Ga0307415_100057771 | 3300032126 | Bacteria | 2668 |
| 597 | Ga0307415_100150460 | 3300032126 | Bacteria | 1791 |
| 598 | Ga0316583_10030367 | 3300032133 | Bacteria | 1925 |
| 599 | Ga0316585_10025747 | 3300032137 | Bacteria | 1826 |
| 600 | Ga0316580_10002895 | 3300032139 | Bacteria | 4804 |
| 601 | Ga0316580_10041620 | 3300032139 | Bacteria | 1419 |
| 602 | Ga0316596_1027287 | 3300033541 | Bacteria | 1473 |
| 603 | Ga0373955_0107256 | 3300035172 | Bacteria | 1611 |
| 604 | Ga0316574_0000018 | 3300035398 | Bacteria | 40938 |
| 605 | Ga0316574_0006270 | 3300035398 | Bacteria | 6413 |
| 606 | Ga0316574_0030139 | 3300035398 | Bacteria | 3283 |
| 607 | Ga0316574_0031913 | 3300035398 | Bacteria | 3198 |
| 608 | Ga0316574_0033376 | 3300035398 | Bacteria | 3133 |
| 609 | Ga0316574_0035454 | 3300035398 | Bacteria | 3049 |
| 610 | Ga0316574_0132803 | 3300035398 | Bacteria | 1602 |
| 611 | Ga0316574_0241715 | 3300035398 | Bacteria | 1154 |
| 612 | Ga0373931_0039649 | 3300035691 | Bacteria | 2468 |
| 613 | Ga0373933_0015401 | 3300035724 | Bacteria | 4261 |
| 614 | Ga0373937_0067615 | 3300036401 | Bacteria | 3292 |
| 615 | Ga0316582_0035066 | 3300036647 | Bacteria | 3095 |
| 616 | Ga0316582_0043967 | 3300036647 | Bacteria | 2805 |
| 617 | Ga0316582_0151651 | 3300036647 | Bacteria | 1567 |
| 618 | Ga0316582_0236407 | 3300036647 | Bacteria | 1251 |
| 619 | Ga0316584_0034958 | 3300036712 | Bacteria | 3727 |
| 620 | Ga0316584_0067765 | 3300036712 | Bacteria | 2675 |
| 621 | Ga0316584_0080062 | 3300036712 | Bacteria | 2448 |
| 622 | Ga0316584_0095372 | 3300036712 | Bacteria | 2227 |
| 623 | Ga0316584_0127517 | 3300036712 | Bacteria | 1900 |
| 624 | Ga0316584_0320366 | 3300036712 | Bacteria | 1119 |
| 625 | Ga0316584_0324251 | 3300036712 | Bacteria | 1110 |
| 626 | Ga0373925_0019723 | 3300037068 | Bacteria | 4907 |
| 627 | Ga0395899_0010439 | 3300037312 | Bacteria | 7114 |
| 628 | Ga0395899_0014021 | 3300037312 | Bacteria | 6119 |
| 629 | Ga0395900_0029177 | 3300037418 | Bacteria | 5658 |
| 630 | Ga0395900_0115958 | 3300037418 | Bacteria | 2749 |
| 631 | Ga0395900_0246709 | 3300037418 | Bacteria | 1789 |
| 632 | Ga0395898_0009056 | 3300037466 | Bacteria | 10481 |
| 633 | Ga0395898_0252324 | 3300037466 | Bacteria | 1682 |
| 634 | Ga0395905_0115294 | 3300037471 | Bacteria | 2525 |
| 635 | Ga0395905_0427804 | 3300037471 | Bacteria | 1220 |
| 636 | Ga0395901_0022229 | 3300038443 | Bacteria | 6497 |
| 637 | Ga0395901_0055805 | 3300038443 | Bacteria | 4109 |
| 638 | Ga0395901_0083749 | 3300038443 | Bacteria | 3334 |
| 639 | Ga0395901_0168108 | 3300038443 | Bacteria | 2301 |
| 640 | Ga0395901_0628756 | 3300038443 | Bacteria | 1079 |
| 641 | Ga0400486_08083 | 3300038742 | Bacteria | 5590 |
| 642 | Ga0400483_016889 | 3300039062 | Bacteria | 7256 |
| 643 | Ga0400483_147849 | 3300039062 | Bacteria | 9474 |
| 644 | Ga0400483_194805 | 3300039062 | Bacteria | 6341 |
| 645 | Ga0400483_203034 | 3300039062 | Bacteria | 3617 |
| 646 | Ga0436365_0011767 | 3300039437 | Bacteria | 7798 |
| 647 | Ga0436365_0608669 | 3300039437 | Bacteria | 1249 |
| 648 | Ga0436363_0917267 | 3300039450 | Bacteria | 2766 |
| 649 | Ga0436363_1703617 | 3300039450 | Bacteria | 1642 |
| 650 | Ga0451841_0883964 | 3300041498 | Bacteria | 2308 |
| 651 | Ga0451845_0381021 | 3300041501 | Bacteria | 1428 |
| 652 | Ga0451849_0418948 | 3300041505 | Bacteria | 1313 |
| 653 | Ga0451851_0575292 | 3300041507 | Bacteria | 1915 |
| 654 | Ga0439445_0000682 | 3300042004 | Bacteria | 7053 |
| 655 | Ga0439450_038040 | 3300042008 | Bacteria | 1108 |
| 656 | Ga0439452_037084 | 3300042010 | Bacteria | 1164 |
| 657 | Ga0450923_045122 | 3300042125 | Bacteria | 935 |
| 658 | Ga0439459_0021161 | 3300042438 | Bacteria | 1247 |
| 659 | Ga0439464_0023228 | 3300042439 | Bacteria | 1711 |
| 660 | Ga0439464_0040721 | 3300042439 | Bacteria | 1324 |
| 661 | Ga0439460_0041204 | 3300042461 | Bacteria | 1356 |
| 662 | Ga0453683_0119545 | 3300044673 | Bacteria | 1658 |
| 663 | Ga0453683_0153970 | 3300044673 | Bacteria | 1453 |
| 664 | Ga0466966_0043210 | 3300044684 | Bacteria | 2890 |
| 665 | Ga0466961_0171589 | 3300044693 | Bacteria | 1349 |
| 666 | Ga0466963_0066008 | 3300044694 | Bacteria | 2427 |
| 667 | Ga0466964_0007088 | 3300044706 | Bacteria | 4193 |
| 668 | Ga0453684_0161279 | 3300044712 | Bacteria | 2652 |
| 669 | Ga0466970_0042262 | 3300044765 | Bacteria | 2424 |
| 670 | Ga0466970_0210179 | 3300044765 | Bacteria | 1084 |
| 671 | Ga0466959_0037588 | 3300045049 | Bacteria | 3578 |
| 672 | Ga0451576_0000007 | 3300045051 | Bacteria | 782228 |
| 673 | Ga0451576_0758093 | 3300045051 | Bacteria | 1019 |
| 674 | Ga0466967_0097591 | 3300045976 | Bacteria | 2682 |
| 675 | Ga0495603_0059340 | 3300046455 | Bacteria | 2262 |
| 676 | Ga0495629_0146620 | 3300046459 | Bacteria | 1641 |
| 677 | Ga0495629_0345730 | 3300046459 | Bacteria | 1015 |
| 678 | Ga0495618_0159939 | 3300046514 | Bacteria | 1436 |
| 679 | Ga0495630_0373600 | 3300046517 | Bacteria | 1092 |
| 680 | Ga0495642_0072212 | 3300046528 | Bacteria | 1445 |
| 681 | Ga0495642_0095299 | 3300046528 | Bacteria | 1263 |
| 682 | Ga0495640_0178135 | 3300046533 | Bacteria | 1356 |
| 683 | Ga0495586_0251815 | 3300046535 | Bacteria | 1008 |
| 684 | Ga0495621_0005070 | 3300046539 | Bacteria | 3757 |
| 685 | Ga0495633_0079868 | 3300046558 | Bacteria | 1523 |
| 686 | Ga0495668_0035028 | 3300046616 | Bacteria | 2814 |
| 687 | Ga0495625_0000362 | 3300046660 | Bacteria | 69497 |
| 688 | Ga0495635_0170574 | 3300046663 | Bacteria | 1480 |
| 689 | Ga0495659_0029872 | 3300046664 | Bacteria | 1894 |
| 690 | Ga0495658_0056293 | 3300046683 | Bacteria | 2242 |
| 691 | Ga0495658_0160091 | 3300046683 | Bacteria | 1388 |
| 692 | Ga0495670_0090065 | 3300046691 | Bacteria | 1569 |
| 693 | Ga0495670_0190264 | 3300046691 | Bacteria | 1085 |
| 694 | Ga0495600_0013633 | 3300046809 | Bacteria | 5113 |
| 695 | Ga0495684_0024548 | 3300047471 | Bacteria | 4641 |
| 696 | Ga0495615_0055313 | 3300048090 | Bacteria | 1033 |
| 697 | Ga0496100_0234764 | 3300048903 | Bacteria | 1351 |
| 698 | Ga0496102_0161621 | 3300048905 | Bacteria | 2107 |
| 699 | Ga0496104_0014412 | 3300048907 | Bacteria | 7142 |
| 700 | Ga0496104_0046317 | 3300048907 | Bacteria | 4095 |
| 701 | Ga0496105_0006061 | 3300048908 | Bacteria | 9250 |
| 702 | Ga0496105_0028078 | 3300048908 | Bacteria | 4602 |
| 703 | Ga0496106_0009636 | 3300048909 | Bacteria | 7133 |
| 704 | Ga0496107_0003209 | 3300048910 | Bacteria | 10881 |
| 705 | Ga0496108_0037240 | 3300048911 | Bacteria | 4051 |
| 706 | Ga0496109_0047196 | 3300048912 | Bacteria | 3915 |
| 707 | Ga0496110_0017616 | 3300048913 | Bacteria | 5972 |
| 708 | Ga0496110_0199281 | 3300048913 | Bacteria | 1819 |
| 709 | Ga0496110_0270079 | 3300048913 | Bacteria | 1548 |
| 710 | Ga0496111_0001084 | 3300048914 | Bacteria | 15034 |
| 711 | Ga0496112_0009721 | 3300048915 | Bacteria | 8681 |
| 712 | Ga0496113_0004957 | 3300048916 | Bacteria | 8246 |
| 713 | Ga0496113_0056701 | 3300048916 | Bacteria | 2942 |
| 714 | Ga0496114_0003135 | 3300048917 | Bacteria | 12684 |
| 715 | Ga0496114_0021201 | 3300048917 | Bacteria | 5284 |
| 716 | Ga0496115_0024228 | 3300048918 | Bacteria | 4715 |
| 717 | Ga0496115_0088840 | 3300048918 | Bacteria | 2523 |
| 718 | Ga0496115_0177399 | 3300048918 | Bacteria | 1762 |
| 719 | Ga0496115_0273823 | 3300048918 | Unclassified | 1386 |
| 720 | Ga0496115_0391865 | 3300048918 | Bacteria | 1128 |
| 721 | Ga0496118_0082097 | 3300048921 | Bacteria | 2260 |
| 722 | Ga0496121_0009176 | 3300048924 | Bacteria | 11433 |
| 723 | Ga0496121_0026347 | 3300048924 | Bacteria | 5482 |
| 724 | Ga0496121_0035138 | 3300048924 | Bacteria | 4496 |
| 725 | Ga0496123_0128533 | 3300048926 | Bacteria | 1409 |
| 726 | Ga0496126_0000123 | 3300048929 | Bacteria | 182726 |
| 727 | Ga0496126_0015086 | 3300048929 | Bacteria | 7785 |
| 728 | Ga0496126_0024582 | 3300048929 | Bacteria | 5813 |
| 729 | Ga0496126_0055530 | 3300048929 | Bacteria | 3583 |
| 730 | Ga0496126_0180615 | 3300048929 | Bacteria | 1793 |
| 731 | Ga0501033_0006962 | 3300049570 | Bacteria | 8829 |
| 732 | Ga0501034_0002561 | 3300049571 | Bacteria | 21656 |
| 733 | Ga0501034_0308997 | 3300049571 | Bacteria | 1516 |
| 734 | Ga0501034_0318569 | 3300049571 | Bacteria | 1488 |
| 735 | Ga0501036_0395699 | 3300049572 | Bacteria | 1153 |
| 736 | Ga0501040_0048797 | 3300049576 | Bacteria | 2894 |
| 737 | Ga0501047_0177112 | 3300049581 | Bacteria | 2000 |
| 738 | Ga0501070_0111884 | 3300049586 | Bacteria | 2257 |
| 739 | Ga0501072_0306719 | 3300049588 | Bacteria | 1262 |
| 740 | Ga0501072_0414436 | 3300049588 | Bacteria | 1068 |
| 741 | Ga0501233_056965 | 3300049668 | Bacteria | 961 |
| 742 | Ga0501238_000149 | 3300049671 | Bacteria | 10810 |
| 743 | Ga0501241_016649 | 3300049758 | Bacteria | 1341 |
| 744 | Ga0501269_001740 | 3300049766 | Bacteria | 2779 |
| 745 | Ga0501280_000708 | 3300049776 | Bacteria | 7365 |
| 746 | Ga0501282_005616 | 3300049778 | Bacteria | 1342 |
| 747 | Ga0501282_006148 | 3300049778 | Bacteria | 1284 |
| 748 | Ga0501044_0006427 | 3300049823 | Bacteria | 12984 |
| 749 | Ga0501044_0517754 | 3300049823 | Bacteria | 1093 |
| 750 | nmdc:mga00v17_48861_c1 | 3300050491 | Bacteria | 2565 |
| 751 | nmdc:mga0yw44_105839_c1 | 3300050492 | Bacteria | 1797 |
| 752 | nmdc:mga0yw44_124646_c1 | 3300050492 | Bacteria | 1662 |
| 753 | nmdc:mga06z11_29810_c1 | 3300050494 | Bacteria | 2632 |
| 754 | nmdc:mga07m45_142566_c1 | 3300050496 | Bacteria | 1388 |
| 755 | nmdc:mga05p37_325549_c1 | 3300050507 | Bacteria | 1817 |
| 756 | nmdc:mga09592_223429_c1 | 3300050508 | Bacteria | 1631 |
| 757 | nmdc:mga09592_36737_c1 | 3300050508 | Bacteria | 4104 |
| 758 | nmdc:mga0qj67_63704_c1 | 3300050509 | Bacteria | 2932 |
| 759 | nmdc:mga06r32_6485_c1 | 3300050510 | Bacteria | 10514 |
| 760 | nmdc:mga06r32_71459_c1 | 3300050510 | Bacteria | 3358 |
| 761 | nmdc:mga08y16_158678_c1 | 3300050511 | Bacteria | 2350 |
| 762 | nmdc:mga08y16_528942_c1 | 3300050511 | Bacteria | 1195 |
| 763 | nmdc:mga08y16_80191_c1 | 3300050511 | Bacteria | 3403 |
| 764 | nmdc:mga0n895_19450_c1 | 3300050512 | Bacteria | 6313 |
| 765 | nmdc:mga0rr50_6191_c1 | 3300050513 | Bacteria | 7250 |
| 766 | nmdc:mga08x19_76538_c1 | 3300050514 | Bacteria | 2190 |
| 767 | nmdc:mga0a205_361699_c1 | 3300050515 | Bacteria | 1318 |
| 768 | nmdc:mga0a205_601820_c1 | 3300050515 | Bacteria | 952 |
| 769 | Ga0495601_0019377 | 3300053077 | Bacteria | 4150 |
| 770 | Ga0500635_0002767 | 3300053080 | Bacteria | 4356 |
| 771 | Ga0495619_0126831 | 3300053085 | Bacteria | 1752 |
| 772 | Ga0500646_0047985 | 3300053090 | Bacteria | 1223 |
| 773 | Ga0500641_0017281 | 3300053096 | Bacteria | 2696 |
| 774 | Ga0500559_0015243 | 3300053136 | Bacteria | 3246 |
| 775 | Ga0500568_0000724 | 3300053139 | Bacteria | 23628 |
| 776 | Ga0500568_0003410 | 3300053139 | Bacteria | 8874 |
| 777 | Ga0500584_009662 | 3300053726 | Bacteria | 4294 |
| 778 | Ga0501084_0000216 | 3300054114 | Bacteria | 44550 |
| 779 | 2520880368 | 2519899754 | Bacteria | 5336938 |
| 780 | 2643835659 | 2643221563 | Bacteria | 4726935 |
| 781 | 2644012242 | 2643221600 | Bacteria | 5530138 |
| 782 | 2644056585 | 2643221608 | Bacteria | 4724829 |
| 783 | 2644374455 | 2643221667 | Bacteria | 5627472 |
| 784 | 2644641524 | 2643221716 | Bacteria | 4986332 |
| 785 | 2644682366 | 2643221725 | Bacteria | 5087956 |
| 786 | 2738735933 | 2738541279 | Bacteria | 6149495 |
| 787 | 2738768510 | 2738541285 | Bacteria | 6150075 |
| 788 | 2739217515 | 2738543007 | Bacteria | 6149845 |
| 789 | 2740000475 | 2739367857 | Bacteria | 5433684 |
| 790 | 2740005291 | 2739367858 | Bacteria | 5432813 |
| 791 | 2802651138 | 2802428842 | Bacteria | 4926114 |
| 792 | 2817414026 | 2816332280 | Bacteria | 5109718 |
| 793 | 2819570210 | 2818991441 | Bacteria | 5062707 |
| 794 | 2852655214 | 2852653556 | Bacteria | 4050083 |
| 795 | 2857474403 | 2857472729 | Bacteria | 6568124 |
| 796 | 2857616246 | 2857613821 | Bacteria | 4917088 |
| 797 | 2881361323 | 2881359912 | Bacteria | 4935907 |
| 798 | 2882807950 | 2882806704 | Bacteria | 3007728 |
| 799 | 2895882595 | 2895880812 | Bacteria | 11255272 |
| 800 | 2903896569 | 2903895155 | Bacteria | 5258610 |
| 801 | 2904557657 | 2904555929 | Bacteria | 5218588 |
| 802 | 2907204250 | 2907202186 | Bacteria | 6632024 |
| 803 | 2919195828 | 2919191525 | Bacteria | 5765973 |
| 804 | 2919514161 | 2919513703 | Bacteria | 3844312 |
| 805 | 2919676067 | 2919675420 | Bacteria | 3969095 |
| 806 | 2958461781 | 2958458903 | Bacteria | 5301041 |
| 807 | 2977272549 | 2977268062 | Bacteria | 5243061 |
| 808 | 3006970355 | 3006969106 | Bacteria | 4739423 |
| 809 | 3006990362 | 3006988479 | Bacteria | 4767936 |
| 810 | 8054310983 | 8054307821 | Bacteria | 5212224 |
| 811 | 8055420243 | 8055419101 | Bacteria | 5289643 |
| 812 | 8055637247 | 8055632911 | Bacteria | 5283357 |
| 813 | Ga0105245_10327570 | |||
| 814 | SwRhRL2b_contig_1200904 | |||
| 815 | JGI25406J46586_10011250 | |||
| 816 | rootH2_10036006 | |||
| 817 | Ga0055535_1009958 | |||
| 818 | Ga0055530_10000095 | |||
| 819 | Ga0055530_10024324 | |||
| 820 | Ga0055531_10002750 | |||
| 821 | Ga0055531_10004838 | |||
| 822 | Ga0055541_1004028 | |||
| 823 | Ga0065712_10034659 | |||
| 824 | Ga0065715_10113248 | |||
| 825 | Ga0065707_10001302 | |||
| 826 | Ga0065707_10247678 | |||
| 827 | Ga0070676_10044650 | |||
| 828 | Ga0070676_10046627 | |||
| 829 | Ga0070676_10114050 | |||
| 830 | Ga0070690_100072792 | |||
| 831 | Ga0070690_100189801 | |||
| 832 | Ga0070690_100290753 | |||
| 833 | Ga0070670_100002372 | |||
| 834 | Ga0070670_100016454 | |||
| 835 | Ga0070670_100036862 | |||
| 836 | Ga0070670_100069322 | |||
| 837 | Ga0070670_100088663 | |||
| 838 | Ga0070670_100404492 | |||
| 839 | Ga0068869_100009681 | |||
| 840 | Ga0068869_100070150 | |||
| 841 | Ga0068869_100104841 | |||
| 842 | Ga0070666_10007408 | |||
| 843 | Ga0070666_10021517 | |||
| 844 | Ga0070666_10038577 | |||
| 845 | Ga0070666_10340433 | |||
| 846 | Ga0070680_100201120 | |||
| 847 | Ga0070682_100007256 | |||
| 848 | Ga0068868_100010385 | |||
| 849 | Ga0068868_100010777 | |||
| 850 | Ga0068868_100053432 | |||
| 851 | Ga0070660_100081063 | |||
| 852 | Ga0070660_100098032 | |||
| 853 | Ga0070660_100214305 | |||
| 854 | Ga0070689_100224106 | |||
| 855 | Ga0070689_100452621 | |||
| 856 | Ga0070691_10002104 | |||
| 857 | Ga0070687_100155325 | |||
| 858 | Ga0070692_10038830 | |||
| 859 | Ga0070668_100003541 | |||
| 860 | Ga0070668_100008311 | |||
| 861 | Ga0070668_100009156 | |||
| 862 | Ga0070668_100025721 | |||
| 863 | Ga0070668_100043584 | |||
| 864 | Ga0070668_100093435 | |||
| 865 | Ga0070668_100115903 | |||
| 866 | Ga0070668_100185480 | |||
| 867 | Ga0070669_100054641 | |||
| 868 | Ga0070669_100063261 | |||
| 869 | Ga0070675_100013399 | |||
| 870 | Ga0070675_100018757 | |||
| 871 | Ga0070675_100087113 | |||
| 872 | Ga0070671_100007579 | |||
| 873 | Ga0070671_100023116 | |||
| 874 | Ga0070671_100024813 | |||
| 875 | Ga0070671_100025962 | |||
| 876 | Ga0070674_100003696 | |||
| 877 | Ga0070674_100046640 | |||
| 878 | Ga0070674_100130282 | |||
| 879 | Ga0070674_100154285 | |||
| 880 | Ga0070674_100159097 | |||
| 881 | Ga0070674_100236272 | |||
| 882 | Ga0070673_100000655 | |||
| 883 | Ga0070673_100051077 | |||
| 884 | Ga0070673_100134718 | |||
| 885 | Ga0070673_100174380 | |||
| 886 | Ga0070673_100276634 | |||
| 887 | Ga0070673_100282809 | |||
| 888 | Ga0070659_100046732 | |||
| 889 | Ga0070659_100061193 | |||
| 890 | Ga0070659_100089500 | |||
| 891 | Ga0070659_100180024 | |||
| 892 | Ga0070667_100022052 | |||
| 893 | Ga0070667_100049692 | |||
| 894 | Ga0070667_100144558 | |||
| 895 | Ga0070667_100163160 | |||
| 896 | Ga0070709_10056874 | |||
| 897 | Ga0070714_100047289 | |||
| 898 | Ga0070714_100102162 | |||
| 899 | Ga0070713_100000129 | |||
| 900 | Ga0070713_100011017 | |||
| 901 | Ga0070713_100227997 | |||
| 902 | Ga0070710_10025987 | |||
| 903 | Ga0070701_10018566 | |||
| 904 | Ga0070701_10128777 | |||
| 905 | Ga0070711_100053234 | |||
| 906 | Ga0070705_100059544 | |||
| 907 | Ga0070700_100107989 | |||
| 908 | Ga0070694_100023303 | |||
| 909 | Ga0070708_100210850 | |||
| 910 | Ga0070663_100002768 | |||
| 911 | Ga0070663_100058868 | |||
| 912 | Ga0070663_100384310 | |||
| 913 | Ga0070678_100016864 | |||
| 914 | Ga0070678_100058624 | |||
| 915 | Ga0070678_100087487 | |||
| 916 | Ga0070678_100099566 | |||
| 917 | Ga0070678_100111900 | |||
| 918 | Ga0070678_100188719 | |||
| 919 | Ga0070662_100027611 | |||
| 920 | Ga0070662_100032993 | |||
| 921 | Ga0070681_10036085 | |||
| 922 | Ga0068867_100008910 | |||
| 923 | Ga0068867_100012739 | |||
| 924 | Ga0068867_100060218 | |||
| 925 | Ga0068867_100130818 | |||
| 926 | Ga0068867_100144524 | |||
| 927 | Ga0070685_10059630 | |||
| 928 | Ga0070685_10075512 | |||
| 929 | Ga0070706_100159173 | |||
| 930 | Ga0070707_100016769 | |||
| 931 | Ga0070699_100000708 | |||
| 932 | Ga0070679_100018240 | |||
| 933 | Ga0070679_100148494 | |||
| 934 | Ga0070679_100240896 | |||
| 935 | Ga0070684_100059898 | |||
| 936 | Ga0068853_100009347 | |||
| 937 | Ga0068853_100026886 | |||
| 938 | Ga0070672_100003611 | |||
| 939 | Ga0070672_100037283 | |||
| 940 | Ga0070672_100335838 | |||
| 941 | Ga0070686_100189910 | |||
| 942 | Ga0070693_100008277 | |||
| 943 | Ga0070665_100036933 | |||
| 944 | Ga0070665_100042010 | |||
| 945 | Ga0070665_100056106 | |||
| 946 | Ga0070665_100233743 | |||
| 947 | Ga0070704_100010008 | |||
| 948 | Ga0068855_100104113 | |||
| 949 | Ga0068855_100214605 | |||
| 950 | Ga0070664_100004030 | |||
| 951 | Ga0070664_100121064 | |||
| 952 | Ga0068854_100012579 | |||
| 953 | Ga0068854_100025046 | |||
| 954 | Ga0068856_100004065 | |||
| 955 | Ga0070702_100003679 | |||
| 956 | Ga0070702_100031295 | |||
| 957 | Ga0070702_100068191 | |||
| 958 | Ga0068852_100039684 | |||
| 959 | Ga0068852_100041014 | |||
| 960 | Ga0068852_100157893 | |||
| 961 | Ga0068852_100183993 | |||
| 962 | Ga0068852_100262884 | |||
| 963 | Ga0068859_100025822 | |||
| 964 | Ga0068859_100032362 | |||
| 965 | Ga0068859_100035474 | |||
| 966 | Ga0068859_100042445 | |||
| 967 | Ga0068859_100079439 | |||
| 968 | Ga0068859_100674452 | |||
| 969 | Ga0068864_100027348 | |||
| 970 | Ga0068864_100095074 | |||
| 971 | Ga0068864_100116887 | |||
| 972 | Ga0068864_100122909 | |||
| 973 | Ga0068864_100149781 | |||
| 974 | Ga0068864_100283518 | |||
| 975 | Ga0068866_10118921 | |||
| 976 | Ga0068861_100003730 | |||
| 977 | Ga0068861_100095142 | |||
| 978 | Ga0068861_100127650 | |||
| 979 | Ga0068861_100220865 | |||
| 980 | Ga0068851_10001051 | |||
| 981 | Ga0068851_10009294 | |||
| 982 | Ga0068851_10077806 | |||
| 983 | Ga0068851_10081757 | |||
| 984 | Ga0068870_10001962 | |||
| 985 | Ga0068870_10051449 | |||
| 986 | Ga0068870_10192874 | |||
| 987 | Ga0068863_100003730 | |||
| 988 | Ga0068863_100016873 | |||
| 989 | Ga0068863_100087307 | |||
| 990 | Ga0068858_100010789 | |||
| 991 | Ga0068858_100020301 | |||
| 992 | Ga0068858_100076998 | |||
| 993 | Ga0068858_100145629 | |||
| 994 | Ga0068858_100211914 | |||
| 995 | Ga0068858_100402097 | |||
| 996 | Ga0068858_100585921 | |||
| 997 | Ga0068860_100022098 | |||
| 998 | Ga0068860_100126704 | |||
| 999 | Ga0068860_100198483 | |||
| 1000 | Ga0068860_100515916 | |||
| 1001 | Ga0068862_100008255 | |||
| 1002 | Ga0068862_100011911 | |||
| 1003 | Ga0068862_100030190 | |||
| 1004 | Ga0068862_100174977 | |||
| 1005 | Ga0068862_100178804 | |||
| 1006 | Ga0068862_100485875 | |||
| 1007 | Ga0081455_10042044 | |||
| 1008 | Ga0081455_10086820 | |||
| 1009 | Ga0081539_10000927 | |||
| 1010 | Ga0081539_10045116 | |||
| 1011 | Ga0070717_10012513 | |||
| 1012 | Ga0070717_10070126 | |||
| 1013 | Ga0070717_10080300 | |||
| 1014 | Ga0070717_10216537 | |||
| 1015 | Ga0070717_10620385 | |||
| 1016 | Ga0075365_10118627 | |||
| 1017 | Ga0075365_10193734 | |||
| 1018 | Ga0075365_10204591 | |||
| 1019 | Ga0070712_100201659 | |||
| 1020 | Ga0075367_10039793 | |||
| 1021 | Ga0075367_10283228 | |||
| 1022 | Ga0097621_100014203 | |||
| 1023 | Ga0097621_100030796 | |||
| 1024 | Ga0097621_100349621 | |||
| 1025 | Ga0068871_100022746 | |||
| 1026 | Ga0068871_100031530 | |||
| 1027 | Ga0068871_100043670 | |||
| 1028 | Ga0068871_100047252 | |||
| 1029 | Ga0068871_100075727 | |||
| 1030 | Ga0068871_100275157 | |||
| 1031 | Ga0075428_100190255 | |||
| 1032 | Ga0075428_100261056 | |||
| 1033 | Ga0075430_100075967 | |||
| 1034 | Ga0075430_100131372 | |||
| 1035 | Ga0075430_100335223 | |||
| 1036 | Ga0075431_100036988 | |||
| 1037 | Ga0075431_100072856 | |||
| 1038 | Ga0075431_100154691 | |||
| 1039 | Ga0075433_10011974 | |||
| 1040 | Ga0075434_100008016 | |||
| 1041 | Ga0075429_100150497 | |||
| 1042 | Ga0075429_100185014 | |||
| 1043 | Ga0068865_100008038 | |||
| 1044 | Ga0075436_100010195 | |||
| 1045 | Ga0097620_100025822 | |||
| 1046 | Ga0097620_100032362 | |||
| 1047 | Ga0097620_100035474 | |||
| 1048 | Ga0097620_100042445 | |||
| 1049 | Ga0097620_100079438 | |||
| 1050 | Ga0097620_100674499 | |||
| 1051 | Ga0099824_1007872 | |||
| 1052 | Ga0079104_1000146 | |||
| 1053 | Ga0079104_1016660 | |||
| 1054 | Ga0079104_1023901 | |||
| 1055 | Ga0099826_10005057 | |||
| 1056 | Ga0075435_100012598 | |||
| 1057 | Ga0105251_10055930 | |||
| 1058 | Ga0105250_10000006 | |||
| 1059 | Ga0105240_10010715 | |||
| 1060 | Ga0105240_10017187 | |||
| 1061 | Ga0105240_10089075 | |||
| 1062 | Ga0111539_10057862 | |||
| 1063 | Ga0111539_10071416 | |||
| 1064 | Ga0111539_10120566 | |||
| 1065 | Ga0111539_10307347 | |||
| 1066 | Ga0111539_10336516 | |||
| 1067 | Ga0111539_10683653 | |||
| 1068 | Ga0105245_10008219 | |||
| 1069 | Ga0105245_10026816 | |||
| 1070 | Ga0105245_10448387 | |||
| 1071 | Ga0105247_10004007 | |||
| 1072 | Ga0105247_10148587 | |||
| 1073 | Ga0114129_10069834 | |||
| 1074 | Ga0114129_10520896 | |||
| 1075 | Ga0105243_10034179 | |||
| 1076 | Ga0105241_10025396 | |||
| 1077 | Ga0105241_10104068 | |||
| 1078 | Ga0105241_10195305 | |||
| 1079 | Ga0105242_10088775 | |||
| 1080 | Ga0105248_10016488 | |||
| 1081 | Ga0105248_10113758 | |||
| 1082 | Ga0105248_10218452 | |||
| 1083 | Ga0105237_10013036 | |||
| 1084 | Ga0105237_10046598 | |||
| 1085 | Ga0105237_10209728 | |||
| 1086 | Ga0105238_10067892 | |||
| 1087 | Ga0105238_10142509 | |||
| 1088 | Ga0105249_10014648 | |||
| 1089 | Ga0105249_10107042 | |||
| 1090 | Ga0105249_10259151 | |||
| 1091 | Ga0105239_10000037 | |||
| 1092 | Ga0105239_10056407 | |||
| 1093 | Ga0105239_10111081 | |||
| 1094 | Ga0105239_10648910 | |||
| 1095 | Ga0105246_10007529 | |||
| 1096 | Ga0157373_10000023 | |||
| 1097 | Ga0157373_10080711 | |||
| 1098 | Ga0157371_10008583 | |||
| 1099 | Ga0157371_10039729 | |||
| 1100 | Ga0157371_10131106 | |||
| 1101 | Ga0157371_10165535 | |||
| 1102 | Ga0157370_10003921 | |||
| 1103 | Ga0157370_10013827 | |||
| 1104 | Ga0157369_10050251 | |||
| 1105 | Ga0157374_10002677 | |||
| 1106 | Ga0157374_10016721 | |||
| 1107 | Ga0157374_10054267 | |||
| 1108 | Ga0157374_10074957 | |||
| 1109 | Ga0157374_10375497 | |||
| 1110 | Ga0157378_10000631 | |||
| 1111 | Ga0157378_10060000 | |||
| 1112 | Ga0157378_10074921 | |||
| 1113 | Ga0163162_10005487 | |||
| 1114 | Ga0157375_10019639 | |||
| 1115 | Ga0157375_10061837 | |||
| 1116 | Ga0157375_10108044 | |||
| 1117 | Ga0157375_10155169 | |||
| 1118 | Ga0157375_10286061 | |||
| 1119 | Ga0163163_10007534 | |||
| 1120 | Ga0157380_10002142 | |||
| 1121 | Ga0157380_10002279 | |||
| 1122 | Ga0157380_10008389 | |||
| 1123 | Ga0157380_10032855 | |||
| 1124 | Ga0157380_10033683 | |||
| 1125 | Ga0157380_10078277 | |||
| 1126 | Ga0157380_10080884 | |||
| 1127 | Ga0157380_10116787 | |||
| 1128 | Ga0157377_10097218 | |||
| 1129 | Ga0157377_10280655 | |||
| 1130 | Ga0157379_10000830 | |||
| 1131 | Ga0157379_10039058 | |||
| 1132 | Ga0157379_10181531 | |||
| 1133 | Ga0157379_10253425 | |||
| 1134 | Ga0157376_10041860 | |||
| 1135 | Ga0157376_10051232 | |||
| 1136 | Ga0157376_10061915 | |||
| 1137 | Ga0157376_10096073 | |||
| 1138 | Ga0157376_10320753 | |||
| 1139 | Ga0182006_1002701 | |||
| 1140 | Ga0182006_1017283 | |||
| 1141 | Ga0182006_1017297 | |||
| 1142 | Ga0163161_10287141 | |||
| 1143 | Ga0163161_10511148 | |||
| 1144 | Ga0206353_11795824 | |||
| 1145 | Ga0209566_100052 | |||
| 1146 | Ga0209147_103612 | |||
| 1147 | Ga0209258_101156 | |||
| 1148 | Ga0209675_1000025 | |||
| 1149 | Ga0209676_1000198 | |||
| 1150 | Ga0209676_1000362 | |||
| 1151 | Ga0209676_1003189 | |||
| 1152 | Ga0209676_1041396 | |||
| 1153 | Ga0209025_1019137 | |||
| 1154 | Ga0209025_1041993 | |||
| 1155 | Ga0209050_1000849 | |||
| 1156 | Ga0209050_1003508 | |||
| 1157 | Ga0209257_1000860 | |||
| 1158 | Ga0209257_1001370 | |||
| 1159 | Ga0209257_1003116 | |||
| 1160 | Ga0207697_10004336 | |||
| 1161 | Ga0207696_1000069 | |||
| 1162 | Ga0207655_1000003 | |||
| 1163 | Ga0207682_10000798 | |||
| 1164 | Ga0207682_10002137 | |||
| 1165 | Ga0207682_10015311 | |||
| 1166 | Ga0207642_10025189 | |||
| 1167 | Ga0207642_10031370 | |||
| 1168 | Ga0207642_10246690 | |||
| 1169 | Ga0207710_10015418 | |||
| 1170 | Ga0207688_10032338 | |||
| 1171 | Ga0207688_10048236 | |||
| 1172 | Ga0207688_10066672 | |||
| 1173 | Ga0207680_10030105 | |||
| 1174 | Ga0207680_10108620 | |||
| 1175 | Ga0207647_10146562 | |||
| 1176 | Ga0207647_10167662 | |||
| 1177 | Ga0207699_10004323 | |||
| 1178 | Ga0207645_10001048 | |||
| 1179 | Ga0207645_10047151 | |||
| 1180 | Ga0207645_10055042 | |||
| 1181 | Ga0207645_10094092 | |||
| 1182 | Ga0207645_10119781 | |||
| 1183 | Ga0207643_10000594 | |||
| 1184 | Ga0207643_10046706 | |||
| 1185 | Ga0207643_10123129 | |||
| 1186 | Ga0207654_10134043 | |||
| 1187 | Ga0207695_10001017 | |||
| 1188 | Ga0207695_10031430 | |||
| 1189 | Ga0207695_10046636 | |||
| 1190 | Ga0207695_10109233 | |||
| 1191 | Ga0207671_10004808 | |||
| 1192 | Ga0207671_10052375 | |||
| 1193 | Ga0207671_10091997 | |||
| 1194 | Ga0207693_10024239 | |||
| 1195 | Ga0207663_10016077 | |||
| 1196 | Ga0207660_10007800 | |||
| 1197 | Ga0207660_10028542 | |||
| 1198 | Ga0207662_10155727 | |||
| 1199 | Ga0207657_10022327 | |||
| 1200 | Ga0207657_10076906 | |||
| 1201 | Ga0207657_10085036 | |||
| 1202 | Ga0207649_10002784 | |||
| 1203 | Ga0207652_10122608 | |||
| 1204 | Ga0207652_10354277 | |||
| 1205 | Ga0207646_10001356 | |||
| 1206 | Ga0207681_10012027 | |||
| 1207 | Ga0207681_10045203 | |||
| 1208 | Ga0207681_10080936 | |||
| 1209 | Ga0207681_10186577 | |||
| 1210 | Ga0207694_10248910 | |||
| 1211 | Ga0207650_10001016 | |||
| 1212 | Ga0207650_10001564 | |||
| 1213 | Ga0207650_10003470 | |||
| 1214 | Ga0207650_10040514 | |||
| 1215 | Ga0207659_10002573 | |||
| 1216 | Ga0207659_10011881 | |||
| 1217 | Ga0207659_10019574 | |||
| 1218 | Ga0207659_10236941 | |||
| 1219 | Ga0207687_10030832 | |||
| 1220 | Ga0207700_10000044 | |||
| 1221 | Ga0207700_10001414 | |||
| 1222 | Ga0207700_10071401 | |||
| 1223 | Ga0207664_10005921 | |||
| 1224 | Ga0207664_10036227 | |||
| 1225 | Ga0207664_10449804 | |||
| 1226 | Ga0207644_10002140 | |||
| 1227 | Ga0207644_10003507 | |||
| 1228 | Ga0207644_10089931 | |||
| 1229 | Ga0207690_10074617 | |||
| 1230 | Ga0207690_10194039 | |||
| 1231 | Ga0207690_10227839 | |||
| 1232 | Ga0207706_10006526 | |||
| 1233 | Ga0207706_10015081 | |||
| 1234 | Ga0207706_10022657 | |||
| 1235 | Ga0207706_10261322 | |||
| 1236 | Ga0207709_10052850 | |||
| 1237 | Ga0207709_10081325 | |||
| 1238 | Ga0207709_10149120 | |||
| 1239 | Ga0207670_10051408 | |||
| 1240 | Ga0207670_10157127 | |||
| 1241 | Ga0207670_10380867 | |||
| 1242 | Ga0207669_10002485 | |||
| 1243 | Ga0207669_10007588 | |||
| 1244 | Ga0207669_10067523 | |||
| 1245 | Ga0207669_10077647 | |||
| 1246 | Ga0207669_10517847 | |||
| 1247 | Ga0207704_10030885 | |||
| 1248 | Ga0207704_10190312 | |||
| 1249 | Ga0207665_10384990 | |||
| 1250 | Ga0207691_10000180 | |||
| 1251 | Ga0207691_10003262 | |||
| 1252 | Ga0207691_10007125 | |||
| 1253 | Ga0207691_10038037 | |||
| 1254 | Ga0207691_10054083 | |||
| 1255 | Ga0207691_10060715 | |||
| 1256 | Ga0207691_10120971 | |||
| 1257 | Ga0207691_10136420 | |||
| 1258 | Ga0207711_10005883 | |||
| 1259 | Ga0207711_10092518 | |||
| 1260 | Ga0207711_10142554 | |||
| 1261 | Ga0207689_10001431 | |||
| 1262 | Ga0207689_10024871 | |||
| 1263 | Ga0207689_10049684 | |||
| 1264 | Ga0207689_10199433 | |||
| 1265 | Ga0207661_10003516 | |||
| 1266 | Ga0207661_10080148 | |||
| 1267 | Ga0207679_10043675 | |||
| 1268 | Ga0207667_10360925 | |||
| 1269 | Ga0207651_10074105 | |||
| 1270 | Ga0207651_10075588 | |||
| 1271 | Ga0207651_10141206 | |||
| 1272 | Ga0207651_10401937 | |||
| 1273 | Ga0207668_10000060 | |||
| 1274 | Ga0207668_10007605 | |||
| 1275 | Ga0207668_10050245 | |||
| 1276 | Ga0207668_10092305 | |||
| 1277 | Ga0207658_10023664 | |||
| 1278 | Ga0207658_10041264 | |||
| 1279 | Ga0207658_10076747 | |||
| 1280 | Ga0207658_10418344 | |||
| 1281 | Ga0207677_10072693 | |||
| 1282 | Ga0207677_10094007 | |||
| 1283 | Ga0207677_10551133 | |||
| 1284 | Ga0207703_10012833 | |||
| 1285 | Ga0207703_10041853 | |||
| 1286 | Ga0207703_10069667 | |||
| 1287 | Ga0207703_10371529 | |||
| 1288 | Ga0207639_10082507 | |||
| 1289 | Ga0207639_10109132 | |||
| 1290 | Ga0207678_10001818 | |||
| 1291 | Ga0207678_10008182 | |||
| 1292 | Ga0207678_10214587 | |||
| 1293 | Ga0207708_10006356 | |||
| 1294 | Ga0207708_10034973 | |||
| 1295 | Ga0207708_10053197 | |||
| 1296 | Ga0207708_10127160 | |||
| 1297 | Ga0207702_10001992 | |||
| 1298 | Ga0207702_10021932 | |||
| 1299 | Ga0207641_10010191 | |||
| 1300 | Ga0207641_10031263 | |||
| 1301 | Ga0207641_10041337 | |||
| 1302 | Ga0207648_10005794 | |||
| 1303 | Ga0207648_10012777 | |||
| 1304 | Ga0207648_10017845 | |||
| 1305 | Ga0207648_10048341 | |||
| 1306 | Ga0207648_10077587 | |||
| 1307 | Ga0207648_10111844 | |||
| 1308 | Ga0207648_10118701 | |||
| 1309 | Ga0207648_10170115 | |||
| 1310 | Ga0207676_10000896 | |||
| 1311 | Ga0207676_10005522 | |||
| 1312 | Ga0207676_10060724 | |||
| 1313 | Ga0207676_10104749 | |||
| 1314 | Ga0207676_10112461 | |||
| 1315 | Ga0207676_10155031 | |||
| 1316 | Ga0207674_10030489 | |||
| 1317 | Ga0207675_100015760 | |||
| 1318 | Ga0207675_100023333 | |||
| 1319 | Ga0207675_100039045 | |||
| 1320 | Ga0207675_100086921 | |||
| 1321 | Ga0207675_100450507 | |||
| 1322 | Ga0207675_100594747 | |||
| 1323 | Ga0207683_10000146 | |||
| 1324 | Ga0207683_10001721 | |||
| 1325 | Ga0207683_10001789 | |||
| 1326 | Ga0207683_10065769 | |||
| 1327 | Ga0207683_10163499 | |||
| 1328 | Ga0207683_10180368 | |||
| 1329 | Ga0207683_10346564 | |||
| 1330 | Ga0207698_10002118 | |||
| 1331 | Ga0207698_10026942 | |||
| 1332 | Ga0207698_10062486 | |||
| 1333 | Ga0209281_1000045 | |||
| 1334 | Ga0209281_1004536 | |||
| 1335 | Ga0209489_108520 | |||
| 1336 | Ga0210002_1018120 | |||
| 1337 | Ga0209971_1003179 | |||
| 1338 | Ga0209966_1005269 | |||
| 1339 | Ga0209974_10014042 | |||
| 1340 | Ga0209974_10056085 | |||
| 1341 | Ga0209974_10109539 | |||
| 1342 | Ga0207428_10015402 | |||
| 1343 | Ga0207428_10214012 | |||
| 1344 | Ga0268266_10028457 | |||
| 1345 | Ga0268266_10208928 | |||
| 1346 | Ga0268266_10287376 | |||
| 1347 | Ga0268265_10007031 | |||
| 1348 | Ga0268265_10050752 | |||
| 1349 | Ga0268264_10008954 | |||
| 1350 | Ga0268264_10018610 | |||
| 1351 | Ga0268264_10086517 | |||
| 1352 | Ga0268264_10095159 | |||
| 1353 | Ga0268264_10207103 | |||
| 1354 | Ga0268264_10282555 | |||
| 1355 | Ga0265334_10016887 | |||
| 1356 | Ga0265318_10011555 | |||
| 1357 | Ga0265338_10015955 | |||
| 1358 | Ga0265330_10030331 | |||
| 1359 | Ga0265332_10014637 | |||
| 1360 | Ga0265340_10092203 | |||
| 1361 | Ga0265331_10008258 | |||
| 1362 | Ga0265316_10018778 | |||
| 1363 | Ga0307408_100000475 | |||
| 1364 | Ga0307408_100163213 | |||
| 1365 | Ga0307408_100404560 | |||
| 1366 | Ga0307408_100438842 | |||
| 1367 | Ga0316575_10076015 | |||
| 1368 | Ga0316579_10005942 | |||
| 1369 | Ga0265314_10000595 | |||
| 1370 | Ga0265342_10051906 | |||
| 1371 | Ga0316576_10004148 | |||
| 1372 | Ga0316576_10087355 | |||
| 1373 | Ga0316576_10125682 | |||
| 1374 | Ga0316576_10145717 | |||
| 1375 | Ga0316578_10017721 | |||
| 1376 | Ga0316578_10166068 | |||
| 1377 | Ga0307405_10010037 | |||
| 1378 | Ga0316577_10028417 | |||
| 1379 | Ga0316577_10072127 | |||
| 1380 | Ga0316577_10122595 | |||
| 1381 | Ga0307413_10014744 | |||
| 1382 | Ga0307413_10201004 | |||
| 1383 | Ga0307410_10005332 | |||
| 1384 | Ga0307410_10009576 | |||
| 1385 | Ga0307410_10018238 | |||
| 1386 | Ga0307410_10020706 | |||
| 1387 | Ga0307406_10000062 | |||
| 1388 | Ga0307406_10030734 | |||
| 1389 | Ga0307407_10000440 | |||
| 1390 | Ga0307407_10001616 | |||
| 1391 | Ga0307407_10043850 | |||
| 1392 | Ga0307412_10111294 | |||
| 1393 | Ga0307412_10151594 | |||
| 1394 | Ga0307409_100007763 | |||
| 1395 | Ga0307409_100078235 | |||
| 1396 | Ga0307409_100089516 | |||
| 1397 | Ga0307409_100275035 | |||
| 1398 | Ga0307416_100000394 | |||
| 1399 | Ga0307416_100008628 | |||
| 1400 | Ga0307416_100910466 | |||
| 1401 | Ga0307414_10000027 | |||
| 1402 | Ga0307414_10026665 | |||
| 1403 | Ga0307414_10048545 | |||
| 1404 | Ga0307414_10052365 | |||
| 1405 | Ga0307414_10085742 | |||
| 1406 | Ga0307411_10037604 | |||
| 1407 | Ga0307411_10217284 | |||
| 1408 | Ga0307415_100057771 | |||
| 1409 | Ga0307415_100150460 | |||
| 1410 | Ga0316583_10030367 | |||
| 1411 | Ga0316585_10025747 | |||
| 1412 | Ga0316580_10002895 | |||
| 1413 | Ga0316580_10041620 | |||
| 1414 | Ga0316596_1027287 | |||
| 1415 | Ga0373955_0107256 | |||
| 1416 | Ga0316574_0000018 | |||
| 1417 | Ga0316574_0006270 | |||
| 1418 | Ga0316574_0030139 | |||
| 1419 | Ga0316574_0031913 | |||
| 1420 | Ga0316574_0033376 | |||
| 1421 | Ga0316574_0035454 | |||
| 1422 | Ga0316574_0132803 | |||
| 1423 | Ga0316574_0241715 | |||
| 1424 | Ga0373931_0039649 | |||
| 1425 | Ga0373933_0015401 | |||
| 1426 | Ga0373937_0067615 | |||
| 1427 | Ga0316582_0035066 | |||
| 1428 | Ga0316582_0043967 | |||
| 1429 | Ga0316582_0151651 | |||
| 1430 | Ga0316582_0236407 | |||
| 1431 | Ga0316584_0034958 | |||
| 1432 | Ga0316584_0067765 | |||
| 1433 | Ga0316584_0080062 | |||
| 1434 | Ga0316584_0095372 | |||
| 1435 | Ga0316584_0127517 | |||
| 1436 | Ga0316584_0320366 | |||
| 1437 | Ga0316584_0324251 | |||
| 1438 | Ga0373925_0019723 | |||
| 1439 | Ga0395899_0010439 | |||
| 1440 | Ga0395899_0014021 | |||
| 1441 | Ga0395900_0029177 | |||
| 1442 | Ga0395900_0115958 | |||
| 1443 | Ga0395900_0246709 | |||
| 1444 | Ga0395898_0009056 | |||
| 1445 | Ga0395898_0252324 | |||
| 1446 | Ga0395905_0115294 | |||
| 1447 | Ga0395905_0427804 | |||
| 1448 | Ga0395901_0022229 | |||
| 1449 | Ga0395901_0055805 | |||
| 1450 | Ga0395901_0083749 | |||
| 1451 | Ga0395901_0168108 | |||
| 1452 | Ga0395901_0628756 | |||
| 1453 | Ga0400486_08083 | |||
| 1454 | Ga0400483_016889 | |||
| 1455 | Ga0400483_147849 | |||
| 1456 | Ga0400483_194805 | |||
| 1457 | Ga0400483_203034 | |||
| 1458 | Ga0436365_0011767 | |||
| 1459 | Ga0436365_0608669 | |||
| 1460 | Ga0436363_0917267 | |||
| 1461 | Ga0436363_1703617 | |||
| 1462 | Ga0451841_0883964 | |||
| 1463 | Ga0451845_0381021 | |||
| 1464 | Ga0451849_0418948 | |||
| 1465 | Ga0451851_0575292 | |||
| 1466 | Ga0439445_0000682 | |||
| 1467 | Ga0439450_038040 | |||
| 1468 | Ga0439452_037084 | |||
| 1469 | Ga0450923_045122 | |||
| 1470 | Ga0439459_0021161 | |||
| 1471 | Ga0439464_0023228 | |||
| 1472 | Ga0439464_0040721 | |||
| 1473 | Ga0439460_0041204 | |||
| 1474 | Ga0453683_0119545 | |||
| 1475 | Ga0453683_0153970 | |||
| 1476 | Ga0466966_0043210 | |||
| 1477 | Ga0466961_0171589 | |||
| 1478 | Ga0466963_0066008 | |||
| 1479 | Ga0466964_0007088 | |||
| 1480 | Ga0453684_0161279 | |||
| 1481 | Ga0466970_0042262 | |||
| 1482 | Ga0466970_0210179 | |||
| 1483 | Ga0466959_0037588 | |||
| 1484 | Ga0451576_0000007 | |||
| 1485 | Ga0451576_0758093 | |||
| 1486 | Ga0466967_0097591 | |||
| 1487 | Ga0495603_0059340 | |||
| 1488 | Ga0495629_0146620 | |||
| 1489 | Ga0495629_0345730 | |||
| 1490 | Ga0495618_0159939 | |||
| 1491 | Ga0495630_0373600 | |||
| 1492 | Ga0495642_0072212 | |||
| 1493 | Ga0495642_0095299 | |||
| 1494 | Ga0495640_0178135 | |||
| 1495 | Ga0495586_0251815 | |||
| 1496 | Ga0495621_0005070 | |||
| 1497 | Ga0495633_0079868 | |||
| 1498 | Ga0495668_0035028 | |||
| 1499 | Ga0495625_0000362 | |||
| 1500 | Ga0495635_0170574 | |||
| 1501 | Ga0495659_0029872 | |||
| 1502 | Ga0495658_0056293 | |||
| 1503 | Ga0495658_0160091 | |||
| 1504 | Ga0495670_0090065 | |||
| 1505 | Ga0495670_0190264 | |||
| 1506 | Ga0495600_0013633 | |||
| 1507 | Ga0495684_0024548 | |||
| 1508 | Ga0495615_0055313 | |||
| 1509 | Ga0496100_0234764 | |||
| 1510 | Ga0496102_0161621 | |||
| 1511 | Ga0496104_0014412 | |||
| 1512 | Ga0496104_0046317 | |||
| 1513 | Ga0496105_0006061 | |||
| 1514 | Ga0496105_0028078 | |||
| 1515 | Ga0496106_0009636 | |||
| 1516 | Ga0496107_0003209 | |||
| 1517 | Ga0496108_0037240 | |||
| 1518 | Ga0496109_0047196 | |||
| 1519 | Ga0496110_0017616 | |||
| 1520 | Ga0496110_0199281 | |||
| 1521 | Ga0496110_0270079 | |||
| 1522 | Ga0496111_0001084 | |||
| 1523 | Ga0496112_0009721 | |||
| 1524 | Ga0496113_0004957 | |||
| 1525 | Ga0496113_0056701 | |||
| 1526 | Ga0496114_0003135 | |||
| 1527 | Ga0496114_0021201 | |||
| 1528 | Ga0496115_0024228 | |||
| 1529 | Ga0496115_0088840 | |||
| 1530 | Ga0496115_0177399 | |||
| 1531 | Ga0496115_0273823 | |||
| 1532 | Ga0496115_0391865 | |||
| 1533 | Ga0496118_0082097 | |||
| 1534 | Ga0496121_0009176 | |||
| 1535 | Ga0496121_0026347 | |||
| 1536 | Ga0496121_0035138 | |||
| 1537 | Ga0496123_0128533 | |||
| 1538 | Ga0496126_0000123 | |||
| 1539 | Ga0496126_0015086 | |||
| 1540 | Ga0496126_0024582 | |||
| 1541 | Ga0496126_0055530 | |||
| 1542 | Ga0496126_0180615 | |||
| 1543 | Ga0501033_0006962 | |||
| 1544 | Ga0501034_0002561 | |||
| 1545 | Ga0501034_0308997 | |||
| 1546 | Ga0501034_0318569 | |||
| 1547 | Ga0501036_0395699 | |||
| 1548 | Ga0501040_0048797 | |||
| 1549 | Ga0501047_0177112 | |||
| 1550 | Ga0501070_0111884 | |||
| 1551 | Ga0501072_0306719 | |||
| 1552 | Ga0501072_0414436 | |||
| 1553 | Ga0501233_056965 | |||
| 1554 | Ga0501238_000149 | |||
| 1555 | Ga0501241_016649 | |||
| 1556 | Ga0501269_001740 | |||
| 1557 | Ga0501280_000708 | |||
| 1558 | Ga0501282_005616 | |||
| 1559 | Ga0501282_006148 | |||
| 1560 | Ga0501044_0006427 | |||
| 1561 | Ga0501044_0517754 | |||
| 1562 | nmdc:mga00v17_48861_c1 | |||
| 1563 | nmdc:mga0yw44_105839_c1 | |||
| 1564 | nmdc:mga0yw44_124646_c1 | |||
| 1565 | nmdc:mga06z11_29810_c1 | |||
| 1566 | nmdc:mga07m45_142566_c1 | |||
| 1567 | nmdc:mga05p37_325549_c1 | |||
| 1568 | nmdc:mga09592_223429_c1 | |||
| 1569 | nmdc:mga09592_36737_c1 | |||
| 1570 | nmdc:mga0qj67_63704_c1 | |||
| 1571 | nmdc:mga06r32_6485_c1 | |||
| 1572 | nmdc:mga06r32_71459_c1 | |||
| 1573 | nmdc:mga08y16_158678_c1 | |||
| 1574 | nmdc:mga08y16_528942_c1 | |||
| 1575 | nmdc:mga08y16_80191_c1 | |||
| 1576 | nmdc:mga0n895_19450_c1 | |||
| 1577 | nmdc:mga0rr50_6191_c1 | |||
| 1578 | nmdc:mga08x19_76538_c1 | |||
| 1579 | nmdc:mga0a205_361699_c1 | |||
| 1580 | nmdc:mga0a205_601820_c1 | |||
| 1581 | Ga0495601_0019377 | |||
| 1582 | Ga0500635_0002767 | |||
| 1583 | Ga0495619_0126831 | |||
| 1584 | Ga0500646_0047985 | |||
| 1585 | Ga0500641_0017281 | |||
| 1586 | Ga0500559_0015243 | |||
| 1587 | Ga0500568_0000724 | |||
| 1588 | Ga0500568_0003410 | |||
| 1589 | Ga0500584_009662 | |||
| 1590 | Ga0501084_0000216 | |||
| 1591 | 2520880368 | |||
| 1592 | 2643835659 | |||
| 1593 | 2644012242 | |||
| 1594 | 2644056585 | |||
| 1595 | 2644374455 | |||
| 1596 | 2644641524 | |||
| 1597 | 2644682366 | |||
| 1598 | 2738735933 | |||
| 1599 | 2738768510 | |||
| 1600 | 2739217515 | |||
| 1601 | 2740000475 | |||
| 1602 | 2740005291 | |||
| 1603 | 2802651138 | |||
| 1604 | 2817414026 | |||
| 1605 | 2819570210 | |||
| 1606 | 2852655214 | |||
| 1607 | 2857474403 | |||
| 1608 | 2857616246 | |||
| 1609 | 2881361323 | |||
| 1610 | 2882807950 | |||
| 1611 | 2895882595 | |||
| 1612 | 2903896569 | |||
| 1613 | 2904557657 | |||
| 1614 | 2907204250 | |||
| 1615 | 2919195828 | |||
| 1616 | 2919514161 | |||
| 1617 | 2919676067 | |||
| 1618 | 2958461781 | |||
| 1619 | 2977272549 | |||
| 1620 | 3006970355 | |||
| 1621 | 3006990362 | |||
| 1622 | 8054310983 | |||
| 1623 | 8055420243 | |||
| 1624 | 8055637247 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2iqt-assembly1.cif.gz_A-2 | crystal structure of fructose-bisphosphate aldolase, class i from porphyromonas gingivalis | 0.988 | 4 | 297 |
| 2iqt-assembly1.cif.gz_A-2 | crystal structure of fructose-bisphosphate aldolase, class i from porphyromonas gingivalis | 0.9747 | 4 | 297 |
| 7efs-assembly1.cif.gz_B | fructose-bisphosphate aldolase in artemisia sieversiana pollen | 0.8177 | 1 | 294 |
| 7b2n-assembly1.cif.gz_B | crystal structure of chlamydomonas reinhardtii chloroplastic fructose bisphosphate aldolase | 0.817 | 4 | 294 |
| 6xmh-assembly1.cif.gz_B-2 | human aldolase a wild type | 0.8165 | 1 | 294 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FV17_1_294_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.998 | 5 | 297 | 3.20.20.70 |
| af_Q2FV17_1_294_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9879 | 5 | 297 | 3.20.20.70 |
| af_A0A1D6JVQ3_1_141_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.8591 | 11 | 142 | 3.20.20.70 |
| af_A0A1D6FD79_26_183_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.8297 | 4 | 140 | 3.20.20.70 |
| 3mbdA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.817 | 4 | 294 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A432GXV0-F1-model_v4 | Class I fructose-bisphosphate aldolase (EC 4.1.2.13) | 1.005 | 236 | 297 |
GO:0004332
|
| AF-A0A7X8K759-F1-model_v4 | Class I fructose-bisphosphate aldolase (EC 4.1.2.13) | 1.003 | 239 | 295 |
GO:0004332
|
| AF-A0A645JEX5-F1-model_v4 | Fructose-bisphosphate aldolase class 1 (EC 4.1.2.13) | 1.002 | 215 | 297 |
GO:0004332
|
| AF-A0A2V9RUV5-F1-model_v4 | fructose-bisphosphate aldolase (EC 4.1.2.13) (Fructose-bisphosphate aldolase class I) | 1 | 5 | 197 |
GO:0004332
GO:0006096 |
| AF-A0A509Y451-F1-model_v4 | deleted | 0.9998 | 213 | 297 |
|