F481878
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 812 | 282 | 1624 | 167 |
Family's Representative Sequence
| Representative Sequence | 3300006038|Ga0075365_10126708|Ga0075365_101267082 |
| Length | 188 |
| Sequence | VSNATVQMVDGGTQVPPGSARFALVADFDDLIAANREFAAHFTLGGFDGVAHAGVAIVTCMDSRIDPLGMVGLKPGDAKIFRNPGGRVTPQALEALVLGTHLLGVNRILVVPHTRCAMASNTEEEIRERVSASAGQDASWQTFGVITDQLQALTDDIARIRAHPLIPESTVVGGFVYDVDTGLLEQHL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 2 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 21 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 29 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 31 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 32 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 34 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 35 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 36 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 37 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 38 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 39 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 40 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 41 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 42 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 43 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 44 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 45 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 46 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 47 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 48 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 49 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 50 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 109 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 110 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 111 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 112 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 113 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 114 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 115 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 116 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 117 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 118 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 119 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 120 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 121 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 122 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 123 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 124 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 125 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 126 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 127 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 128 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 129 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 130 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 131 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 132 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 133 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 134 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 135 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 136 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 137 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 138 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 139 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 140 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 141 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 142 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 143 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 144 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 145 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 146 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 147 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 148 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 149 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 150 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 151 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 152 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 153 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 154 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 155 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 156 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 157 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 158 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 159 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 160 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 161 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 162 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 163 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 164 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 165 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 166 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 167 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 168 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 184 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 185 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 186 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 187 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 188 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 189 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 190 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 191 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 192 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 193 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 194 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 195 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 196 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 197 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 198 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 199 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 200 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 201 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 202 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 203 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 204 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 205 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 206 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 207 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 208 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 209 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 210 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 211 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 212 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 213 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 214 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 215 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 216 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 217 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 218 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 219 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 220 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 221 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 222 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 223 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 224 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 225 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 226 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 227 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 228 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 229 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 230 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 231 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 232 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 233 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 234 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 235 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 236 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 237 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 238 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 239 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 240 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 241 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 242 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 243 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 244 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 245 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 246 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 247 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 248 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 252 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 253 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 254 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 255 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 256 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 258 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 259 | 2643221561 | Nocardioides sp. Root151 | Isolate | Unclassified |
| 260 | 2643221567 | Phycicoccus sp. Root563 | Isolate | Unclassified |
| 261 | 2643221615 | Nocardioides sp. Root224 | Isolate | Unclassified |
| 262 | 2643221617 | Nocardioides sp. Root79 | Isolate | Unclassified |
| 263 | 2643221620 | Nocardioides sp. Root240 | Isolate | Unclassified |
| 264 | 2643221624 | Phycicoccus sp. Root101 | Isolate | Unclassified |
| 265 | 2643221641 | Nocardioides sp. Root122 | Isolate | Unclassified |
| 266 | 2643221657 | Nocardioides sp. Root1257 | Isolate | Unclassified |
| 267 | 2643221696 | Nocardioides sp. Root140 | Isolate | Unclassified |
| 268 | 2643221711 | Terrabacter sp. Root85 | Isolate | Unclassified |
| 269 | 2738541305 | Nocardioides sp. CF167 | Isolate | Unclassified |
| 270 | 2773857762 | Nocardioides sp. SAI-095 | Isolate | Unclassified |
| 271 | 2808606365 | Phycicoccus sp. SLBN-51 | Isolate | Unclassified |
| 272 | 2808606439 | Nocardioides sp. SLBN-172 | Isolate | Unclassified |
| 273 | 2811994878 | Nocardioides sp. SLBN-169 | Isolate | Unclassified |
| 274 | 2811994882 | Terrabacter sp. SLBN-196 | Isolate | Unclassified |
| 275 | 2818991318 | Humibacillus xanthopallidus SLBN-155 | Isolate | Unclassified |
| 276 | 2818991458 | Terrabacter sp. 3211 | Isolate | Rhizosphere |
| 277 | 2818991462 | Terrabacter sp. 3264 | Isolate | Rhizosphere |
| 278 | 2818991469 | Terrabacter lapilli 3265 | Isolate | Rhizosphere |
| 279 | 2855386786 | Nocardioides ferulae EGI 63112 | Isolate | Unclassified |
| 280 | 2857481737 | Nocardioides sp. R-74106 | Isolate | Unclassified |
| 281 | 2919446982 | Phycicoccus sp. 3266 | Isolate | Rhizosphere |
| 282 | 8054609563 | Nocardioides astragali CGMCC 4.7327 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.8 |
| Metatranscriptomes | 0.25 |
| Isolates | 2.96 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.59 |
| Nodule | 0.12 |
| Rhizoplane | 13.3 |
| Rhizosphere | 72.17 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0075365_10126708 | 3300006038 | Bacteria | 1765 |
| 2 | LJQas_1001906 | 3300000549 | Bacteria | 3015 |
| 3 | JGI24740J21852_10023059 | 3300001979 | Bacteria | 2132 |
| 4 | JGI24737J22298_10060630 | 3300001990 | Bacteria | 1139 |
| 5 | Ga0006562J51391_1058933 | 3300003578 | Bacteria | 2372 |
| 6 | Ga0006562J51391_1058934 | 3300003578 | Bacteria | 1330 |
| 7 | Ga0070658_10612282 | 3300005327 | Bacteria | 944 |
| 8 | Ga0070658_10721378 | 3300005327 | Bacteria | 866 |
| 9 | Ga0070683_100001765 | 3300005329 | Bacteria | 16830 |
| 10 | Ga0070683_100020909 | 3300005329 | Bacteria | 5834 |
| 11 | Ga0070683_100171109 | 3300005329 | Bacteria | 2062 |
| 12 | Ga0070677_10472504 | 3300005333 | Bacteria | 675 |
| 13 | Ga0068869_100927096 | 3300005334 | Bacteria | 755 |
| 14 | Ga0070682_100008939 | 3300005337 | Bacteria | 5660 |
| 15 | Ga0070682_100545024 | 3300005337 | Bacteria | 907 |
| 16 | Ga0068868_100124930 | 3300005338 | Bacteria | 2101 |
| 17 | Ga0068868_100141936 | 3300005338 | Bacteria | 1972 |
| 18 | Ga0070660_100023064 | 3300005339 | Bacteria | 4608 |
| 19 | Ga0070660_100084769 | 3300005339 | Bacteria | 2491 |
| 20 | Ga0070687_100168854 | 3300005343 | Bacteria | 1300 |
| 21 | Ga0070692_10009414 | 3300005345 | Bacteria | 4405 |
| 22 | Ga0070659_100050890 | 3300005366 | Bacteria | 3256 |
| 23 | Ga0070700_100702849 | 3300005441 | Bacteria | 804 |
| 24 | Ga0070663_100212526 | 3300005455 | Bacteria | 1515 |
| 25 | Ga0070663_100418087 | 3300005455 | Bacteria | 1099 |
| 26 | Ga0070678_100099536 | 3300005456 | Bacteria | 2250 |
| 27 | Ga0070678_100566374 | 3300005456 | Bacteria | 1010 |
| 28 | Ga0070681_10351086 | 3300005458 | Bacteria | 1385 |
| 29 | Ga0068867_100326639 | 3300005459 | Bacteria | 1273 |
| 30 | Ga0070685_10175742 | 3300005466 | Bacteria | 1375 |
| 31 | Ga0070707_100346059 | 3300005468 | Bacteria | 1444 |
| 32 | Ga0070698_100040552 | 3300005471 | Bacteria | 4784 |
| 33 | Ga0070679_100023558 | 3300005530 | Bacteria | 6028 |
| 34 | Ga0070684_100001108 | 3300005535 | Bacteria | 19295 |
| 35 | Ga0070684_100142262 | 3300005535 | Bacteria | 2170 |
| 36 | Ga0070684_100215444 | 3300005535 | Bacteria | 1751 |
| 37 | Ga0070693_101120504 | 3300005547 | Bacteria | 601 |
| 38 | Ga0070665_100054249 | 3300005548 | Bacteria | 4020 |
| 39 | Ga0068855_100075111 | 3300005563 | Bacteria | 3925 |
| 40 | Ga0070664_100004627 | 3300005564 | Bacteria | 11045 |
| 41 | Ga0070664_100588993 | 3300005564 | Bacteria | 1031 |
| 42 | Ga0068857_100004947 | 3300005577 | Bacteria | 11317 |
| 43 | Ga0068857_100714378 | 3300005577 | Bacteria | 953 |
| 44 | Ga0068856_100242894 | 3300005614 | Bacteria | 1816 |
| 45 | Ga0068856_100505086 | 3300005614 | Bacteria | 1230 |
| 46 | Ga0070702_100130092 | 3300005615 | Bacteria | 1588 |
| 47 | Ga0070702_100368653 | 3300005615 | Bacteria | 1017 |
| 48 | Ga0070702_100770283 | 3300005615 | Bacteria | 741 |
| 49 | Ga0068864_100444581 | 3300005618 | Bacteria | 1239 |
| 50 | Ga0068861_100081020 | 3300005719 | Bacteria | 2540 |
| 51 | Ga0068861_100831107 | 3300005719 | Bacteria | 869 |
| 52 | Ga0068851_10822908 | 3300005834 | Bacteria | 578 |
| 53 | Ga0068860_100003132 | 3300005843 | Bacteria | 17086 |
| 54 | Ga0068860_100079019 | 3300005843 | Bacteria | 3128 |
| 55 | Ga0068860_100336775 | 3300005843 | Bacteria | 1483 |
| 56 | Ga0081455_10447356 | 3300005937 | Bacteria | 883 |
| 57 | Ga0075365_10001053 | 3300006038 | Bacteria | 11915 |
| 58 | Ga0075365_10016862 | 3300006038 | Bacteria | 4456 |
| 59 | Ga0075365_10056730 | 3300006038 | Bacteria | 2604 |
| 60 | Ga0075365_10065247 | 3300006038 | Bacteria | 2440 |
| 61 | Ga0075365_10079886 | 3300006038 | Bacteria | 2213 |
| 62 | Ga0075365_10091451 | 3300006038 | Bacteria | 2073 |
| 63 | Ga0075365_10165334 | 3300006038 | Bacteria | 1543 |
| 64 | Ga0075365_10201393 | 3300006038 | Bacteria | 1394 |
| 65 | Ga0075365_10206597 | 3300006038 | Bacteria | 1376 |
| 66 | Ga0075365_10216294 | 3300006038 | Bacteria | 1344 |
| 67 | Ga0075365_10251861 | 3300006038 | Bacteria | 1241 |
| 68 | Ga0075365_10572135 | 3300006038 | Bacteria | 799 |
| 69 | Ga0075365_10662550 | 3300006038 | Bacteria | 737 |
| 70 | Ga0075368_10000598 | 3300006042 | Bacteria | 10877 |
| 71 | Ga0075368_10065995 | 3300006042 | Bacteria | 1454 |
| 72 | Ga0075363_100001214 | 3300006048 | Bacteria | 9520 |
| 73 | Ga0075363_100018534 | 3300006048 | Bacteria | 3470 |
| 74 | Ga0075363_100031488 | 3300006048 | Bacteria | 2750 |
| 75 | Ga0075363_100069787 | 3300006048 | Bacteria | 1907 |
| 76 | Ga0075363_100114643 | 3300006048 | Bacteria | 1500 |
| 77 | Ga0075363_100430128 | 3300006048 | Bacteria | 778 |
| 78 | Ga0075364_10009909 | 3300006051 | Bacteria | 5732 |
| 79 | Ga0075364_10011285 | 3300006051 | Bacteria | 5425 |
| 80 | Ga0075364_10017735 | 3300006051 | Bacteria | 4452 |
| 81 | Ga0075364_10030569 | 3300006051 | Bacteria | 3457 |
| 82 | Ga0075364_10048072 | 3300006051 | Bacteria | 2779 |
| 83 | Ga0075364_10488843 | 3300006051 | Bacteria | 841 |
| 84 | Ga0075362_10113317 | 3300006177 | Bacteria | 1278 |
| 85 | Ga0075367_10000608 | 3300006178 | Bacteria | 13756 |
| 86 | Ga0075367_10038743 | 3300006178 | Bacteria | 2776 |
| 87 | Ga0075367_10070470 | 3300006178 | Bacteria | 2101 |
| 88 | Ga0075367_10364298 | 3300006178 | Bacteria | 913 |
| 89 | Ga0075369_10026488 | 3300006186 | Bacteria | 2417 |
| 90 | Ga0075370_10011249 | 3300006353 | Bacteria | 4697 |
| 91 | Ga0075370_10014568 | 3300006353 | Bacteria | 4197 |
| 92 | Ga0075370_10045252 | 3300006353 | Bacteria | 2489 |
| 93 | Ga0075370_10176589 | 3300006353 | Bacteria | 1256 |
| 94 | Ga0068871_100387002 | 3300006358 | Bacteria | 1243 |
| 95 | Ga0068871_100663072 | 3300006358 | Bacteria | 953 |
| 96 | Ga0068871_100711155 | 3300006358 | Bacteria | 921 |
| 97 | Ga0075430_100014848 | 3300006846 | Bacteria | 6631 |
| 98 | Ga0075431_100002127 | 3300006847 | Bacteria | 18931 |
| 99 | Ga0075429_100007096 | 3300006880 | Bacteria | 9729 |
| 100 | Ga0068865_100471260 | 3300006881 | Bacteria | 1042 |
| 101 | Ga0105245_10001807 | 3300009098 | Bacteria | 19486 |
| 102 | Ga0105245_10278898 | 3300009098 | Bacteria | 1633 |
| 103 | Ga0105245_10426779 | 3300009098 | Bacteria | 1330 |
| 104 | Ga0105245_10438890 | 3300009098 | Bacteria | 1312 |
| 105 | Ga0105245_10800024 | 3300009098 | Bacteria | 981 |
| 106 | Ga0114129_10001254 | 3300009147 | Bacteria | 33860 |
| 107 | Ga0114129_10596733 | 3300009147 | Bacteria | 1431 |
| 108 | Ga0105243_10029112 | 3300009148 | Bacteria | 4246 |
| 109 | Ga0105243_10154462 | 3300009148 | Bacteria | 1972 |
| 110 | Ga0105241_10571689 | 3300009174 | Bacteria | 1017 |
| 111 | Ga0105242_10511081 | 3300009176 | Bacteria | 1144 |
| 112 | Ga0105248_10081536 | 3300009177 | Bacteria | 3636 |
| 113 | Ga0105248_10596169 | 3300009177 | Bacteria | 1247 |
| 114 | Ga0105237_10069088 | 3300009545 | Bacteria | 3527 |
| 115 | Ga0105237_10198158 | 3300009545 | Bacteria | 2007 |
| 116 | Ga0105237_10620843 | 3300009545 | Bacteria | 1088 |
| 117 | Ga0105238_10268612 | 3300009551 | Bacteria | 1686 |
| 118 | Ga0105238_10552465 | 3300009551 | Bacteria | 1156 |
| 119 | Ga0105238_11876084 | 3300009551 | Bacteria | 632 |
| 120 | Ga0105249_10137020 | 3300009553 | Bacteria | 2344 |
| 121 | Ga0105249_11135266 | 3300009553 | Bacteria | 852 |
| 122 | Ga0105249_12050187 | 3300009553 | Bacteria | 645 |
| 123 | Ga0105249_12304143 | 3300009553 | Bacteria | 611 |
| 124 | Ga0105239_10005630 | 3300010375 | Bacteria | 14640 |
| 125 | Ga0105239_11798927 | 3300010375 | Bacteria | 710 |
| 126 | Ga0105246_10001245 | 3300011119 | Bacteria | 14952 |
| 127 | Ga0105246_10032052 | 3300011119 | Bacteria | 3482 |
| 128 | Ga0105246_10176344 | 3300011119 | Bacteria | 1642 |
| 129 | Ga0105246_10735004 | 3300011119 | Bacteria | 869 |
| 130 | Ga0105246_10973923 | 3300011119 | Bacteria | 766 |
| 131 | Ga0157371_10621654 | 3300013102 | Bacteria | 805 |
| 132 | Ga0157371_10813734 | 3300013102 | Bacteria | 705 |
| 133 | Ga0157370_11111624 | 3300013104 | Bacteria | 714 |
| 134 | Ga0157369_10149788 | 3300013105 | Bacteria | 2466 |
| 135 | Ga0157369_10579548 | 3300013105 | Bacteria | 1159 |
| 136 | Ga0157369_10755343 | 3300013105 | Bacteria | 1000 |
| 137 | Ga0157374_10488862 | 3300013296 | Bacteria | 1234 |
| 138 | Ga0163162_10358405 | 3300013306 | Bacteria | 1591 |
| 139 | Ga0163162_10498029 | 3300013306 | Bacteria | 1349 |
| 140 | Ga0157372_10024501 | 3300013307 | Bacteria | 6557 |
| 141 | Ga0157372_10309128 | 3300013307 | Bacteria | 1840 |
| 142 | Ga0157372_10335789 | 3300013307 | Bacteria | 1760 |
| 143 | Ga0157372_11780309 | 3300013307 | Bacteria | 708 |
| 144 | Ga0157372_12014985 | 3300013307 | Bacteria | 663 |
| 145 | Ga0157375_10013264 | 3300013308 | Bacteria | 7329 |
| 146 | Ga0157375_10065777 | 3300013308 | Bacteria | 3615 |
| 147 | Ga0157375_10256683 | 3300013308 | Bacteria | 1909 |
| 148 | Ga0157375_10325687 | 3300013308 | Bacteria | 1701 |
| 149 | Ga0157375_10433873 | 3300013308 | Bacteria | 1480 |
| 150 | Ga0157375_10461188 | 3300013308 | Bacteria | 1436 |
| 151 | Ga0157375_11705674 | 3300013308 | Bacteria | 746 |
| 152 | Ga0157375_12210278 | 3300013308 | Bacteria | 655 |
| 153 | Ga0163163_10071259 | 3300014325 | Bacteria | 3463 |
| 154 | Ga0163163_10275738 | 3300014325 | Bacteria | 1733 |
| 155 | Ga0157380_10124787 | 3300014326 | Bacteria | 2186 |
| 156 | Ga0157380_10176902 | 3300014326 | Bacteria | 1871 |
| 157 | Ga0157380_10488504 | 3300014326 | Bacteria | 1193 |
| 158 | Ga0157380_11046190 | 3300014326 | Bacteria | 852 |
| 159 | Ga0157377_10040675 | 3300014745 | Bacteria | 2576 |
| 160 | Ga0157377_10056736 | 3300014745 | Bacteria | 2225 |
| 161 | Ga0157379_10003947 | 3300014968 | Bacteria | 12646 |
| 162 | Ga0157376_10369842 | 3300014969 | Bacteria | 1377 |
| 163 | Ga0163161_10061377 | 3300017792 | Bacteria | 2736 |
| 164 | Ga0163161_10267663 | 3300017792 | Bacteria | 1336 |
| 165 | Ga0207647_10031780 | 3300025904 | Bacteria | 3396 |
| 166 | Ga0207647_10065293 | 3300025904 | Bacteria | 2210 |
| 167 | Ga0207647_10165010 | 3300025904 | Bacteria | 1291 |
| 168 | Ga0207647_10290103 | 3300025904 | Bacteria | 933 |
| 169 | Ga0207705_10036053 | 3300025909 | Bacteria | 3540 |
| 170 | Ga0207705_10498806 | 3300025909 | Bacteria | 945 |
| 171 | Ga0207707_10280986 | 3300025912 | Bacteria | 1442 |
| 172 | Ga0207671_10369553 | 3300025914 | Bacteria | 1139 |
| 173 | Ga0207662_10090826 | 3300025918 | Bacteria | 1878 |
| 174 | Ga0207657_10029498 | 3300025919 | Bacteria | 4992 |
| 175 | Ga0207657_10248773 | 3300025919 | Bacteria | 1418 |
| 176 | Ga0207652_10143256 | 3300025921 | Bacteria | 2138 |
| 177 | Ga0207646_10179992 | 3300025922 | Bacteria | 1909 |
| 178 | Ga0207694_10384002 | 3300025924 | Bacteria | 1166 |
| 179 | Ga0207694_10465906 | 3300025924 | Bacteria | 1056 |
| 180 | Ga0207694_11121655 | 3300025924 | Bacteria | 666 |
| 181 | Ga0207687_10002467 | 3300025927 | Bacteria | 12554 |
| 182 | Ga0207706_10007918 | 3300025933 | Bacteria | 9808 |
| 183 | Ga0207709_10096143 | 3300025935 | Bacteria | 1948 |
| 184 | Ga0207669_10195020 | 3300025937 | Bacteria | 1465 |
| 185 | Ga0207704_10297836 | 3300025938 | Bacteria | 1234 |
| 186 | Ga0207711_10165050 | 3300025941 | Bacteria | 2007 |
| 187 | Ga0207661_10018219 | 3300025944 | Bacteria | 5215 |
| 188 | Ga0207661_10036340 | 3300025944 | Bacteria | 3844 |
| 189 | Ga0207661_10104609 | 3300025944 | Bacteria | 2384 |
| 190 | Ga0207661_10520855 | 3300025944 | Bacteria | 1088 |
| 191 | Ga0207661_10673917 | 3300025944 | Bacteria | 951 |
| 192 | Ga0207679_10037776 | 3300025945 | Bacteria | 3436 |
| 193 | Ga0207667_10326500 | 3300025949 | Bacteria | 1567 |
| 194 | Ga0207712_10216045 | 3300025961 | Bacteria | 1530 |
| 195 | Ga0207640_10750252 | 3300025981 | Bacteria | 841 |
| 196 | Ga0207677_10044648 | 3300026023 | Bacteria | 2954 |
| 197 | Ga0207678_10135084 | 3300026067 | Bacteria | 2105 |
| 198 | Ga0207678_10216118 | 3300026067 | Bacteria | 1640 |
| 199 | Ga0207678_10282138 | 3300026067 | Bacteria | 1426 |
| 200 | Ga0207708_10065834 | 3300026075 | Bacteria | 2770 |
| 201 | Ga0207708_10195101 | 3300026075 | Bacteria | 1613 |
| 202 | Ga0207708_11029894 | 3300026075 | Bacteria | 716 |
| 203 | Ga0207702_10270608 | 3300026078 | Bacteria | 1602 |
| 204 | Ga0207702_10332591 | 3300026078 | Bacteria | 1449 |
| 205 | Ga0207702_11235114 | 3300026078 | Bacteria | 741 |
| 206 | Ga0207641_10958735 | 3300026088 | Bacteria | 851 |
| 207 | Ga0207648_10181699 | 3300026089 | Bacteria | 1862 |
| 208 | Ga0207676_10112084 | 3300026095 | Bacteria | 2285 |
| 209 | Ga0207674_10199363 | 3300026116 | Bacteria | 1951 |
| 210 | Ga0207674_10350159 | 3300026116 | Bacteria | 1428 |
| 211 | Ga0207674_10698227 | 3300026116 | Bacteria | 979 |
| 212 | Ga0207675_100026182 | 3300026118 | Bacteria | 5430 |
| 213 | Ga0207675_100382141 | 3300026118 | Bacteria | 1385 |
| 214 | Ga0207675_100620868 | 3300026118 | Bacteria | 1085 |
| 215 | Ga0207683_10171755 | 3300026121 | Bacteria | 1963 |
| 216 | Ga0207683_10483857 | 3300026121 | Bacteria | 1142 |
| 217 | Ga0207683_11027733 | 3300026121 | Bacteria | 765 |
| 218 | Ga0207683_11369540 | 3300026121 | Bacteria | 654 |
| 219 | Ga0207698_10479094 | 3300026142 | Bacteria | 1207 |
| 220 | Ga0209813_10001356 | 3300027866 | Bacteria | 5490 |
| 221 | Ga0209813_10006987 | 3300027866 | Bacteria | 2801 |
| 222 | Ga0268266_10010593 | 3300028379 | Bacteria | 8037 |
| 223 | Ga0268266_10151014 | 3300028379 | Bacteria | 2094 |
| 224 | Ga0268266_11293917 | 3300028379 | Bacteria | 704 |
| 225 | Ga0268264_10000398 | 3300028381 | Bacteria | 62200 |
| 226 | Ga0268264_10518762 | 3300028381 | Bacteria | 1165 |
| 227 | Ga0268264_10800600 | 3300028381 | Bacteria | 941 |
| 228 | Ga0316181_1251168 | 3300030744 | Bacteria | 1098 |
| 229 | Ga0307408_100320049 | 3300031548 | Bacteria | 1306 |
| 230 | Ga0316575_10105336 | 3300031665 | Bacteria | 1148 |
| 231 | Ga0316579_10014233 | 3300031691 | Bacteria | 3435 |
| 232 | Ga0316576_10130764 | 3300031727 | Bacteria | 1888 |
| 233 | Ga0316576_10357257 | 3300031727 | Bacteria | 1086 |
| 234 | Ga0316578_10105770 | 3300031728 | Bacteria | 1688 |
| 235 | Ga0307405_10113580 | 3300031731 | Bacteria | 1839 |
| 236 | Ga0307405_10548310 | 3300031731 | Bacteria | 935 |
| 237 | Ga0307405_10672305 | 3300031731 | Bacteria | 854 |
| 238 | Ga0307405_11359273 | 3300031731 | Bacteria | 620 |
| 239 | Ga0316577_10016474 | 3300031733 | Bacteria | 4074 |
| 240 | Ga0316577_10024535 | 3300031733 | Bacteria | 3353 |
| 241 | Ga0307413_10093952 | 3300031824 | Bacteria | 1962 |
| 242 | Ga0307413_10263596 | 3300031824 | Bacteria | 1286 |
| 243 | Ga0307413_10430278 | 3300031824 | Bacteria | 1042 |
| 244 | Ga0307413_10883783 | 3300031824 | Bacteria | 758 |
| 245 | Ga0307410_10036603 | 3300031852 | Bacteria | 3197 |
| 246 | Ga0307410_10235762 | 3300031852 | Bacteria | 1415 |
| 247 | Ga0307410_11178267 | 3300031852 | Bacteria | 667 |
| 248 | Ga0307406_10066078 | 3300031901 | Bacteria | 2353 |
| 249 | Ga0307406_10608867 | 3300031901 | Bacteria | 902 |
| 250 | Ga0307407_10012953 | 3300031903 | Bacteria | 4029 |
| 251 | Ga0307407_10068424 | 3300031903 | Bacteria | 2103 |
| 252 | Ga0307407_10101605 | 3300031903 | Bacteria | 1786 |
| 253 | Ga0307412_10064984 | 3300031911 | Bacteria | 2467 |
| 254 | Ga0307409_100043250 | 3300031995 | Bacteria | 3380 |
| 255 | Ga0307409_100062937 | 3300031995 | Bacteria | 2907 |
| 256 | Ga0307409_100148687 | 3300031995 | Bacteria | 2030 |
| 257 | Ga0307409_100158501 | 3300031995 | Bacteria | 1976 |
| 258 | Ga0307409_100184217 | 3300031995 | Bacteria | 1851 |
| 259 | Ga0307409_100275821 | 3300031995 | Bacteria | 1551 |
| 260 | Ga0307409_100283233 | 3300031995 | Bacteria | 1533 |
| 261 | Ga0307409_100360062 | 3300031995 | Bacteria | 1376 |
| 262 | Ga0307409_100504345 | 3300031995 | Bacteria | 1179 |
| 263 | Ga0307409_101241167 | 3300031995 | Bacteria | 769 |
| 264 | Ga0307416_100096579 | 3300032002 | Bacteria | 2556 |
| 265 | Ga0307416_100155082 | 3300032002 | Bacteria | 2107 |
| 266 | Ga0307416_100188290 | 3300032002 | Bacteria | 1943 |
| 267 | Ga0307416_100218906 | 3300032002 | Bacteria | 1824 |
| 268 | Ga0307416_101026068 | 3300032002 | Bacteria | 928 |
| 269 | Ga0307416_101631372 | 3300032002 | Bacteria | 750 |
| 270 | Ga0307416_101712266 | 3300032002 | Bacteria | 733 |
| 271 | Ga0307415_100010168 | 3300032126 | Bacteria | 5315 |
| 272 | Ga0307415_100040277 | 3300032126 | Bacteria | 3094 |
| 273 | Ga0307415_100655723 | 3300032126 | Bacteria | 941 |
| 274 | Ga0307415_100703766 | 3300032126 | Bacteria | 912 |
| 275 | Ga0307415_100717328 | 3300032126 | Bacteria | 904 |
| 276 | Ga0307415_100718213 | 3300032126 | Bacteria | 904 |
| 277 | Ga0307415_100929910 | 3300032126 | Bacteria | 803 |
| 278 | Ga0307415_101085820 | 3300032126 | Bacteria | 748 |
| 279 | Ga0316583_10126828 | 3300032133 | Bacteria | 889 |
| 280 | Ga0316585_10002307 | 3300032137 | Bacteria | 5131 |
| 281 | Ga0316585_10018429 | 3300032137 | Bacteria | 2119 |
| 282 | Ga0316580_10001614 | 3300032139 | Bacteria | 5959 |
| 283 | Ga0316580_10107753 | 3300032139 | Bacteria | 853 |
| 284 | Ga0316580_10152177 | 3300032139 | Bacteria | 710 |
| 285 | Ga0316574_0000685 | 3300035398 | Bacteria | 14374 |
| 286 | Ga0316574_0007039 | 3300035398 | Bacteria | 6131 |
| 287 | Ga0316574_0197884 | 3300035398 | Bacteria | 1291 |
| 288 | Ga0373931_0226085 | 3300035691 | Bacteria | 1129 |
| 289 | Ga0316582_0014902 | 3300036647 | Bacteria | 4428 |
| 290 | Ga0316582_0020349 | 3300036647 | Bacteria | 3900 |
| 291 | Ga0316582_0406495 | 3300036647 | Bacteria | 938 |
| 292 | Ga0316584_0613157 | 3300036712 | Bacteria | 753 |
| 293 | Ga0316584_0751011 | 3300036712 | Bacteria | 665 |
| 294 | Ga0395899_0715894 | 3300037312 | Bacteria | 626 |
| 295 | Ga0395900_0297172 | 3300037418 | Bacteria | 1602 |
| 296 | Ga0395900_0576101 | 3300037418 | Bacteria | 1068 |
| 297 | Ga0395898_0012889 | 3300037466 | Bacteria | 8625 |
| 298 | Ga0395898_0019780 | 3300037466 | Bacteria | 6847 |
| 299 | Ga0395898_0748457 | 3300037466 | Bacteria | 919 |
| 300 | Ga0395905_0040662 | 3300037471 | Bacteria | 4362 |
| 301 | Ga0395905_0108832 | 3300037471 | Bacteria | 2602 |
| 302 | Ga0395905_0163348 | 3300037471 | Bacteria | 2093 |
| 303 | Ga0395901_0005504 | 3300038443 | Bacteria | 12828 |
| 304 | Ga0395901_0045589 | 3300038443 | Bacteria | 4551 |
| 305 | Ga0395901_0072356 | 3300038443 | Bacteria | 3594 |
| 306 | Ga0395901_0189266 | 3300038443 | Bacteria | 2158 |
| 307 | Ga0395901_0769247 | 3300038443 | Bacteria | 954 |
| 308 | Ga0395901_1328514 | 3300038443 | Bacteria | 680 |
| 309 | Ga0242420_008798 | 3300038996 | Bacteria | 1646 |
| 310 | Ga0451789_0111182 | 3300041443 | Bacteria | 729 |
| 311 | Ga0451791_0693704 | 3300041451 | Bacteria | 2239 |
| 312 | Ga0451793_1811604 | 3300041452 | Bacteria | 751 |
| 313 | Ga0451797_0081001 | 3300041453 | Bacteria | 796 |
| 314 | Ga0451797_0645667 | 3300041453 | Bacteria | 737 |
| 315 | Ga0451797_0697299 | 3300041453 | Bacteria | 629 |
| 316 | Ga0451802_1723936 | 3300041460 | Bacteria | 665 |
| 317 | Ga0451837_0953581 | 3300041494 | Bacteria | 2074 |
| 318 | Ga0451841_0766488 | 3300041498 | Bacteria | 847 |
| 319 | Ga0451843_1466042 | 3300041509 | Bacteria | 647 |
| 320 | Ga0451853_0059182 | 3300041512 | Bacteria | 1137 |
| 321 | Ga0451853_0859806 | 3300041512 | Bacteria | 1266 |
| 322 | Ga0451853_1677545 | 3300041512 | Bacteria | 555 |
| 323 | Ga0451853_2103927 | 3300041512 | Bacteria | 586 |
| 324 | Ga0439431_0116775 | 3300041997 | Bacteria | 742 |
| 325 | Ga0439442_075498 | 3300042002 | Bacteria | 719 |
| 326 | Ga0439448_0117894 | 3300042005 | Bacteria | 910 |
| 327 | Ga0439449_0246235 | 3300042007 | Bacteria | 672 |
| 328 | Ga0439455_0066527 | 3300042012 | Bacteria | 963 |
| 329 | Ga0439456_132211 | 3300042013 | Bacteria | 576 |
| 330 | Ga0450907_003864 | 3300042146 | Bacteria | 2622 |
| 331 | Ga0450908_087533 | 3300042184 | Bacteria | 563 |
| 332 | Ga0450909_030318 | 3300042185 | Bacteria | 820 |
| 333 | Ga0466972_0033078 | 3300044658 | Bacteria | 2537 |
| 334 | Ga0466972_0063815 | 3300044658 | Bacteria | 1764 |
| 335 | Ga0466972_0079898 | 3300044658 | Bacteria | 1557 |
| 336 | Ga0466972_0179501 | 3300044658 | Bacteria | 993 |
| 337 | Ga0466965_0015971 | 3300044683 | Bacteria | 3568 |
| 338 | Ga0466965_0018899 | 3300044683 | Bacteria | 3307 |
| 339 | Ga0466965_0021836 | 3300044683 | Bacteria | 3084 |
| 340 | Ga0466965_0038113 | 3300044683 | Bacteria | 2361 |
| 341 | Ga0466965_0046527 | 3300044683 | Bacteria | 2148 |
| 342 | Ga0466965_0179130 | 3300044683 | Bacteria | 1118 |
| 343 | Ga0466966_0281415 | 3300044684 | Bacteria | 1000 |
| 344 | Ga0466961_0060998 | 3300044693 | Bacteria | 2397 |
| 345 | Ga0466963_0040574 | 3300044694 | Bacteria | 3051 |
| 346 | Ga0466963_0102050 | 3300044694 | Bacteria | 1964 |
| 347 | Ga0466963_0341728 | 3300044694 | Bacteria | 1054 |
| 348 | Ga0466964_0029085 | 3300044706 | Bacteria | 2180 |
| 349 | Ga0466964_0136106 | 3300044706 | Bacteria | 1124 |
| 350 | Ga0466971_0006701 | 3300044719 | Bacteria | 5011 |
| 351 | Ga0466970_0018613 | 3300044765 | Bacteria | 3598 |
| 352 | Ga0466970_0032993 | 3300044765 | Bacteria | 2736 |
| 353 | Ga0466970_0039627 | 3300044765 | Bacteria | 2500 |
| 354 | Ga0466970_0041233 | 3300044765 | Bacteria | 2452 |
| 355 | Ga0466970_0174602 | 3300044765 | Bacteria | 1191 |
| 356 | Ga0466970_0238119 | 3300044765 | Bacteria | 1018 |
| 357 | Ga0466957_0039733 | 3300044842 | Bacteria | 2839 |
| 358 | Ga0466957_0071561 | 3300044842 | Bacteria | 2145 |
| 359 | Ga0466960_0000595 | 3300044901 | Bacteria | 12508 |
| 360 | Ga0466960_0020178 | 3300044901 | Bacteria | 2948 |
| 361 | Ga0466960_0035751 | 3300044901 | Bacteria | 2323 |
| 362 | Ga0466960_0217803 | 3300044901 | Bacteria | 1049 |
| 363 | Ga0466960_0270559 | 3300044901 | Bacteria | 949 |
| 364 | Ga0466960_0548296 | 3300044901 | Bacteria | 682 |
| 365 | Ga0451576_0072659 | 3300045051 | Bacteria | 3580 |
| 366 | Ga0466958_0022574 | 3300045836 | Bacteria | 3688 |
| 367 | Ga0466958_0548176 | 3300045836 | Bacteria | 751 |
| 368 | Ga0466967_0022196 | 3300045976 | Bacteria | 5173 |
| 369 | Ga0466967_0031073 | 3300045976 | Bacteria | 4491 |
| 370 | Ga0466967_0037164 | 3300045976 | Bacteria | 4164 |
| 371 | Ga0466967_0135295 | 3300045976 | Bacteria | 2291 |
| 372 | Ga0466967_0170033 | 3300045976 | Bacteria | 2050 |
| 373 | Ga0466967_0257059 | 3300045976 | Bacteria | 1670 |
| 374 | Ga0466967_0288858 | 3300045976 | Bacteria | 1575 |
| 375 | Ga0466967_0420909 | 3300045976 | Bacteria | 1302 |
| 376 | Ga0466967_0670740 | 3300045976 | Bacteria | 1026 |
| 377 | Ga0466967_0789488 | 3300045976 | Bacteria | 943 |
| 378 | Ga0466967_0865592 | 3300045976 | Bacteria | 898 |
| 379 | Ga0466967_1025463 | 3300045976 | Bacteria | 822 |
| 380 | Ga0495603_0665611 | 3300046455 | Bacteria | 596 |
| 381 | Ga0495641_0019455 | 3300046461 | Bacteria | 3472 |
| 382 | Ga0495641_0106804 | 3300046461 | Bacteria | 1249 |
| 383 | Ga0495641_0146259 | 3300046461 | Bacteria | 1056 |
| 384 | Ga0495582_0048647 | 3300046473 | Bacteria | 2335 |
| 385 | Ga0495582_0096208 | 3300046473 | Bacteria | 1655 |
| 386 | Ga0495582_0138767 | 3300046473 | Bacteria | 1377 |
| 387 | Ga0495662_0197640 | 3300046476 | Bacteria | 991 |
| 388 | Ga0495620_0084920 | 3300046515 | Bacteria | 1276 |
| 389 | Ga0495630_0445153 | 3300046517 | Bacteria | 993 |
| 390 | Ga0495656_0136577 | 3300046615 | Bacteria | 1172 |
| 391 | Ga0495635_0280463 | 3300046663 | Bacteria | 1119 |
| 392 | Ga0495657_0205584 | 3300046675 | Bacteria | 1198 |
| 393 | Ga0495658_0081195 | 3300046683 | Bacteria | 1903 |
| 394 | Ga0495658_0129947 | 3300046683 | Bacteria | 1532 |
| 395 | Ga0495600_0341862 | 3300046809 | Bacteria | 938 |
| 396 | Ga0495581_0133647 | 3300047315 | Bacteria | 1446 |
| 397 | Ga0495674_0263920 | 3300047319 | Bacteria | 1414 |
| 398 | Ga0495680_0215954 | 3300047322 | Bacteria | 1371 |
| 399 | Ga0495614_0174650 | 3300048089 | Bacteria | 965 |
| 400 | Ga0496100_0004983 | 3300048903 | Bacteria | 7102 |
| 401 | Ga0496100_0154288 | 3300048903 | Bacteria | 1641 |
| 402 | Ga0496100_0225290 | 3300048903 | Bacteria | 1377 |
| 403 | Ga0496100_0235700 | 3300048903 | Bacteria | 1348 |
| 404 | Ga0496100_0447546 | 3300048903 | Bacteria | 990 |
| 405 | Ga0496100_0953906 | 3300048903 | Bacteria | 674 |
| 406 | Ga0496101_0001835 | 3300048904 | Bacteria | 12807 |
| 407 | Ga0496101_0017375 | 3300048904 | Bacteria | 4881 |
| 408 | Ga0496101_0021273 | 3300048904 | Bacteria | 4456 |
| 409 | Ga0496101_0029165 | 3300048904 | Bacteria | 3859 |
| 410 | Ga0496101_0183937 | 3300048904 | Bacteria | 1610 |
| 411 | Ga0496101_0347912 | 3300048904 | Bacteria | 1165 |
| 412 | Ga0496101_0681487 | 3300048904 | Bacteria | 812 |
| 413 | Ga0496102_0020751 | 3300048905 | Bacteria | 5805 |
| 414 | Ga0496102_0046777 | 3300048905 | Bacteria | 3930 |
| 415 | Ga0496102_0047814 | 3300048905 | Bacteria | 3889 |
| 416 | Ga0496102_0052728 | 3300048905 | Bacteria | 3707 |
| 417 | Ga0496102_0095121 | 3300048905 | Bacteria | 2761 |
| 418 | Ga0496102_0105315 | 3300048905 | Bacteria | 2624 |
| 419 | Ga0496102_0121320 | 3300048905 | Bacteria | 2441 |
| 420 | Ga0496102_0169525 | 3300048905 | Bacteria | 2055 |
| 421 | Ga0496102_0285888 | 3300048905 | Bacteria | 1554 |
| 422 | Ga0496102_0436692 | 3300048905 | Bacteria | 1229 |
| 423 | Ga0496102_0798411 | 3300048905 | Bacteria | 866 |
| 424 | Ga0496102_1137312 | 3300048905 | Bacteria | 700 |
| 425 | Ga0496103_0029722 | 3300048906 | Bacteria | 3322 |
| 426 | Ga0496103_0048239 | 3300048906 | Bacteria | 2631 |
| 427 | Ga0496103_0142682 | 3300048906 | Bacteria | 1532 |
| 428 | Ga0496103_0148842 | 3300048906 | Bacteria | 1499 |
| 429 | Ga0496103_0444941 | 3300048906 | Bacteria | 831 |
| 430 | Ga0496103_0565318 | 3300048906 | Bacteria | 726 |
| 431 | Ga0496103_0666596 | 3300048906 | Bacteria | 660 |
| 432 | Ga0496104_0008446 | 3300048907 | Bacteria | 9156 |
| 433 | Ga0496104_0091502 | 3300048907 | Bacteria | 2908 |
| 434 | Ga0496104_0115745 | 3300048907 | Bacteria | 2572 |
| 435 | Ga0496104_0225073 | 3300048907 | Bacteria | 1788 |
| 436 | Ga0496104_1194052 | 3300048907 | Bacteria | 664 |
| 437 | Ga0496105_0013182 | 3300048908 | Bacteria | 6557 |
| 438 | Ga0496105_0076286 | 3300048908 | Bacteria | 2768 |
| 439 | Ga0496105_0133728 | 3300048908 | Bacteria | 2043 |
| 440 | Ga0496105_0607383 | 3300048908 | Bacteria | 848 |
| 441 | Ga0496106_0025429 | 3300048909 | Bacteria | 4406 |
| 442 | Ga0496106_0127573 | 3300048909 | Bacteria | 1993 |
| 443 | Ga0496107_0020990 | 3300048910 | Bacteria | 4616 |
| 444 | Ga0496107_0021057 | 3300048910 | Bacteria | 4608 |
| 445 | Ga0496107_0033467 | 3300048910 | Bacteria | 3677 |
| 446 | Ga0496107_0118072 | 3300048910 | Bacteria | 1953 |
| 447 | Ga0496107_0351691 | 3300048910 | Bacteria | 1097 |
| 448 | Ga0496107_0414583 | 3300048910 | Bacteria | 1001 |
| 449 | Ga0496108_0003872 | 3300048911 | Bacteria | 12019 |
| 450 | Ga0496108_0028338 | 3300048911 | Bacteria | 4634 |
| 451 | Ga0496108_0250125 | 3300048911 | Bacteria | 1542 |
| 452 | Ga0496108_0267480 | 3300048911 | Bacteria | 1488 |
| 453 | Ga0496108_0281990 | 3300048911 | Bacteria | 1446 |
| 454 | Ga0496108_0305100 | 3300048911 | Bacteria | 1387 |
| 455 | Ga0496108_0319742 | 3300048911 | Bacteria | 1353 |
| 456 | Ga0496109_0012972 | 3300048912 | Bacteria | 7203 |
| 457 | Ga0496109_0013365 | 3300048912 | Bacteria | 7118 |
| 458 | Ga0496109_0051438 | 3300048912 | Bacteria | 3752 |
| 459 | Ga0496109_0213880 | 3300048912 | Bacteria | 1813 |
| 460 | Ga0496109_0324366 | 3300048912 | Bacteria | 1453 |
| 461 | Ga0496109_0354665 | 3300048912 | Bacteria | 1386 |
| 462 | Ga0496109_0385054 | 3300048912 | Bacteria | 1325 |
| 463 | Ga0496109_0769962 | 3300048912 | Bacteria | 900 |
| 464 | Ga0496109_0851906 | 3300048912 | Bacteria | 849 |
| 465 | Ga0496109_1325990 | 3300048912 | Bacteria | 656 |
| 466 | Ga0496109_1392791 | 3300048912 | Bacteria | 637 |
| 467 | Ga0496110_0011968 | 3300048913 | Bacteria | 7125 |
| 468 | Ga0496110_0065610 | 3300048913 | Bacteria | 3210 |
| 469 | Ga0496110_0198814 | 3300048913 | Bacteria | 1821 |
| 470 | Ga0496110_0286152 | 3300048913 | Bacteria | 1501 |
| 471 | Ga0496110_0289664 | 3300048913 | Bacteria | 1491 |
| 472 | Ga0496110_0787089 | 3300048913 | Bacteria | 855 |
| 473 | Ga0496111_0018902 | 3300048914 | Bacteria | 4778 |
| 474 | Ga0496111_0025918 | 3300048914 | Bacteria | 4137 |
| 475 | Ga0496111_0076582 | 3300048914 | Bacteria | 2438 |
| 476 | Ga0496111_0207792 | 3300048914 | Bacteria | 1455 |
| 477 | Ga0496111_0312555 | 3300048914 | Bacteria | 1164 |
| 478 | Ga0496112_0324735 | 3300048915 | Bacteria | 1483 |
| 479 | Ga0496112_0373813 | 3300048915 | Bacteria | 1367 |
| 480 | Ga0496112_0431974 | 3300048915 | Bacteria | 1255 |
| 481 | Ga0496112_0567503 | 3300048915 | Bacteria | 1068 |
| 482 | Ga0496112_0936896 | 3300048915 | Bacteria | 787 |
| 483 | Ga0496112_1250054 | 3300048915 | Bacteria | 659 |
| 484 | Ga0496113_0044495 | 3300048916 | Bacteria | 3289 |
| 485 | Ga0496113_0063428 | 3300048916 | Bacteria | 2792 |
| 486 | Ga0496113_0252195 | 3300048916 | Bacteria | 1409 |
| 487 | Ga0496113_0415140 | 3300048916 | Bacteria | 1081 |
| 488 | Ga0496113_0548032 | 3300048916 | Bacteria | 928 |
| 489 | Ga0496113_0943820 | 3300048916 | Bacteria | 681 |
| 490 | Ga0496113_1400915 | 3300048916 | Bacteria | 541 |
| 491 | Ga0496114_0007055 | 3300048917 | Bacteria | 8866 |
| 492 | Ga0496114_0016659 | 3300048917 | Bacteria | 5927 |
| 493 | Ga0496114_0017256 | 3300048917 | Bacteria | 5824 |
| 494 | Ga0496114_0026676 | 3300048917 | Bacteria | 4731 |
| 495 | Ga0496114_0042662 | 3300048917 | Bacteria | 3760 |
| 496 | Ga0496114_0108430 | 3300048917 | Bacteria | 2377 |
| 497 | Ga0496114_0118083 | 3300048917 | Bacteria | 2279 |
| 498 | Ga0496114_0127551 | 3300048917 | Bacteria | 2194 |
| 499 | Ga0496115_0029062 | 3300048918 | Bacteria | 4338 |
| 500 | Ga0496115_0165938 | 3300048918 | Bacteria | 1826 |
| 501 | Ga0496118_0196984 | 3300048921 | Bacteria | 1198 |
| 502 | Ga0496119_0069522 | 3300048922 | Bacteria | 2069 |
| 503 | Ga0496124_0177899 | 3300048927 | Bacteria | 1640 |
| 504 | Ga0501291_038342 | 3300049514 | Bacteria | 834 |
| 505 | Ga0501031_0001904 | 3300049568 | Bacteria | 13145 |
| 506 | Ga0501031_0014439 | 3300049568 | Bacteria | 5133 |
| 507 | Ga0501031_0026258 | 3300049568 | Bacteria | 3797 |
| 508 | Ga0501031_0094821 | 3300049568 | Bacteria | 1947 |
| 509 | Ga0501031_0153042 | 3300049568 | Bacteria | 1507 |
| 510 | Ga0501031_0226356 | 3300049568 | Bacteria | 1217 |
| 511 | Ga0501031_0313235 | 3300049568 | Bacteria | 1017 |
| 512 | Ga0501031_0625446 | 3300049568 | Bacteria | 692 |
| 513 | Ga0501032_0023177 | 3300049569 | Bacteria | 4295 |
| 514 | Ga0501032_0031832 | 3300049569 | Bacteria | 3616 |
| 515 | Ga0501032_0095711 | 3300049569 | Bacteria | 1968 |
| 516 | Ga0501032_0126774 | 3300049569 | Bacteria | 1686 |
| 517 | Ga0501032_0142041 | 3300049569 | Bacteria | 1581 |
| 518 | Ga0501032_0207762 | 3300049569 | Bacteria | 1277 |
| 519 | Ga0501032_0260792 | 3300049569 | Bacteria | 1124 |
| 520 | Ga0501033_0113851 | 3300049570 | Bacteria | 1967 |
| 521 | Ga0501033_0237926 | 3300049570 | Bacteria | 1292 |
| 522 | Ga0501033_0332360 | 3300049570 | Bacteria | 1066 |
| 523 | Ga0501034_0005404 | 3300049571 | Bacteria | 13968 |
| 524 | Ga0501034_0040986 | 3300049571 | Bacteria | 4685 |
| 525 | Ga0501034_0105687 | 3300049571 | Bacteria | 2808 |
| 526 | Ga0501034_0179915 | 3300049571 | Bacteria | 2080 |
| 527 | Ga0501034_0227792 | 3300049571 | Bacteria | 1814 |
| 528 | Ga0501034_0380273 | 3300049571 | Bacteria | 1337 |
| 529 | Ga0501034_0759099 | 3300049571 | Bacteria | 865 |
| 530 | Ga0501034_0859779 | 3300049571 | Bacteria | 797 |
| 531 | Ga0501036_0004164 | 3300049572 | Bacteria | 11645 |
| 532 | Ga0501036_0007791 | 3300049572 | Bacteria | 8759 |
| 533 | Ga0501036_0044452 | 3300049572 | Bacteria | 3762 |
| 534 | Ga0501036_0138821 | 3300049572 | Bacteria | 2051 |
| 535 | Ga0501036_0185659 | 3300049572 | Bacteria | 1750 |
| 536 | Ga0501036_0258382 | 3300049572 | Bacteria | 1459 |
| 537 | Ga0501036_0293228 | 3300049572 | Bacteria | 1361 |
| 538 | Ga0501036_0435772 | 3300049572 | Bacteria | 1092 |
| 539 | Ga0501036_0949127 | 3300049572 | Bacteria | 705 |
| 540 | Ga0501037_0007065 | 3300049573 | Bacteria | 8203 |
| 541 | Ga0501037_0023238 | 3300049573 | Bacteria | 4585 |
| 542 | Ga0501037_0056310 | 3300049573 | Bacteria | 2872 |
| 543 | Ga0501037_0193576 | 3300049573 | Bacteria | 1439 |
| 544 | Ga0501037_0313772 | 3300049573 | Bacteria | 1087 |
| 545 | Ga0501037_0419179 | 3300049573 | Bacteria | 916 |
| 546 | Ga0501037_0573612 | 3300049573 | Bacteria | 760 |
| 547 | Ga0501038_0003261 | 3300049574 | Bacteria | 15140 |
| 548 | Ga0501038_0006206 | 3300049574 | Bacteria | 11056 |
| 549 | Ga0501038_0100777 | 3300049574 | Bacteria | 2405 |
| 550 | Ga0501038_0130725 | 3300049574 | Bacteria | 2062 |
| 551 | Ga0501038_0266258 | 3300049574 | Bacteria | 1353 |
| 552 | Ga0501039_0017929 | 3300049575 | Bacteria | 5430 |
| 553 | Ga0501039_0062670 | 3300049575 | Bacteria | 2881 |
| 554 | Ga0501039_0065694 | 3300049575 | Bacteria | 2815 |
| 555 | Ga0501039_0078520 | 3300049575 | Bacteria | 2568 |
| 556 | Ga0501039_0290424 | 3300049575 | Bacteria | 1285 |
| 557 | Ga0501039_0338948 | 3300049575 | Bacteria | 1182 |
| 558 | Ga0501039_0620222 | 3300049575 | Bacteria | 847 |
| 559 | Ga0501039_0711541 | 3300049575 | Bacteria | 785 |
| 560 | Ga0501039_1111428 | 3300049575 | Bacteria | 612 |
| 561 | Ga0501040_0006842 | 3300049576 | Bacteria | 7390 |
| 562 | Ga0501040_0018929 | 3300049576 | Bacteria | 4576 |
| 563 | Ga0501040_0449790 | 3300049576 | Bacteria | 927 |
| 564 | Ga0501040_0653950 | 3300049576 | Bacteria | 760 |
| 565 | Ga0501040_1051930 | 3300049576 | Bacteria | 590 |
| 566 | Ga0501041_0003749 | 3300049577 | Bacteria | 8744 |
| 567 | Ga0501041_0125081 | 3300049577 | Bacteria | 1600 |
| 568 | Ga0501041_0137528 | 3300049577 | Bacteria | 1523 |
| 569 | Ga0501041_0332191 | 3300049577 | Bacteria | 959 |
| 570 | Ga0501041_0461532 | 3300049577 | Bacteria | 807 |
| 571 | Ga0501042_0016345 | 3300049578 | Bacteria | 5092 |
| 572 | Ga0501042_0059908 | 3300049578 | Bacteria | 2719 |
| 573 | Ga0501042_0088299 | 3300049578 | Bacteria | 2224 |
| 574 | Ga0501042_0131373 | 3300049578 | Bacteria | 1805 |
| 575 | Ga0501042_0158519 | 3300049578 | Bacteria | 1633 |
| 576 | Ga0501042_0502106 | 3300049578 | Bacteria | 881 |
| 577 | Ga0501042_0714272 | 3300049578 | Bacteria | 729 |
| 578 | Ga0501043_0024936 | 3300049579 | Bacteria | 4692 |
| 579 | Ga0501043_0067863 | 3300049579 | Bacteria | 2800 |
| 580 | Ga0501043_0128243 | 3300049579 | Bacteria | 1989 |
| 581 | Ga0501043_0191731 | 3300049579 | Bacteria | 1589 |
| 582 | Ga0501043_0590545 | 3300049579 | Bacteria | 821 |
| 583 | Ga0501043_0622689 | 3300049579 | Bacteria | 795 |
| 584 | Ga0501043_0727302 | 3300049579 | Bacteria | 723 |
| 585 | Ga0501046_0006288 | 3300049580 | Bacteria | 10528 |
| 586 | Ga0501046_0012443 | 3300049580 | Bacteria | 7244 |
| 587 | Ga0501046_0164983 | 3300049580 | Bacteria | 1664 |
| 588 | Ga0501046_0200407 | 3300049580 | Bacteria | 1485 |
| 589 | Ga0501047_0015588 | 3300049581 | Bacteria | 7241 |
| 590 | Ga0501047_0023385 | 3300049581 | Bacteria | 5933 |
| 591 | Ga0501047_0125216 | 3300049581 | Bacteria | 2450 |
| 592 | Ga0501047_0744334 | 3300049581 | Bacteria | 796 |
| 593 | Ga0501047_0843753 | 3300049581 | Bacteria | 730 |
| 594 | Ga0501048_0004142 | 3300049582 | Bacteria | 11054 |
| 595 | Ga0501048_0004795 | 3300049582 | Bacteria | 10306 |
| 596 | Ga0501048_0005842 | 3300049582 | Bacteria | 9362 |
| 597 | Ga0501048_0055092 | 3300049582 | Bacteria | 2824 |
| 598 | Ga0501048_0229782 | 3300049582 | Bacteria | 1316 |
| 599 | Ga0501048_0237416 | 3300049582 | Bacteria | 1293 |
| 600 | Ga0501048_0294935 | 3300049582 | Bacteria | 1153 |
| 601 | Ga0501048_0492925 | 3300049582 | Bacteria | 878 |
| 602 | Ga0501067_0000658 | 3300049583 | Bacteria | 18523 |
| 603 | Ga0501067_0008791 | 3300049583 | Bacteria | 5597 |
| 604 | Ga0501067_0044364 | 3300049583 | Bacteria | 2470 |
| 605 | Ga0501067_0084598 | 3300049583 | Bacteria | 1759 |
| 606 | Ga0501067_0099818 | 3300049583 | Bacteria | 1612 |
| 607 | Ga0501068_0003031 | 3300049584 | Bacteria | 8966 |
| 608 | Ga0501068_0007715 | 3300049584 | Bacteria | 5953 |
| 609 | Ga0501068_0039773 | 3300049584 | Bacteria | 2821 |
| 610 | Ga0501068_0135045 | 3300049584 | Bacteria | 1544 |
| 611 | Ga0501068_0388813 | 3300049584 | Bacteria | 899 |
| 612 | Ga0501068_0405806 | 3300049584 | Bacteria | 879 |
| 613 | Ga0501068_0449690 | 3300049584 | Bacteria | 833 |
| 614 | Ga0501068_0631238 | 3300049584 | Bacteria | 699 |
| 615 | Ga0501069_0015893 | 3300049585 | Bacteria | 4035 |
| 616 | Ga0501069_0017400 | 3300049585 | Bacteria | 3867 |
| 617 | Ga0501069_0032903 | 3300049585 | Bacteria | 2854 |
| 618 | Ga0501069_0084888 | 3300049585 | Bacteria | 1786 |
| 619 | Ga0501069_0175206 | 3300049585 | Bacteria | 1239 |
| 620 | Ga0501069_0294824 | 3300049585 | Bacteria | 950 |
| 621 | Ga0501070_0002949 | 3300049586 | Bacteria | 14813 |
| 622 | Ga0501070_0024136 | 3300049586 | Bacteria | 5099 |
| 623 | Ga0501070_0024860 | 3300049586 | Bacteria | 5022 |
| 624 | Ga0501070_0184660 | 3300049586 | Bacteria | 1715 |
| 625 | Ga0501070_0278625 | 3300049586 | Bacteria | 1365 |
| 626 | Ga0501070_0399136 | 3300049586 | Bacteria | 1112 |
| 627 | Ga0501070_0419803 | 3300049586 | Bacteria | 1080 |
| 628 | Ga0501071_0007851 | 3300049587 | Bacteria | 7037 |
| 629 | Ga0501071_0019218 | 3300049587 | Bacteria | 4740 |
| 630 | Ga0501071_0062635 | 3300049587 | Bacteria | 2695 |
| 631 | Ga0501071_0156691 | 3300049587 | Bacteria | 1701 |
| 632 | Ga0501071_0199647 | 3300049587 | Bacteria | 1502 |
| 633 | Ga0501071_0215569 | 3300049587 | Bacteria | 1444 |
| 634 | Ga0501071_0253314 | 3300049587 | Bacteria | 1329 |
| 635 | Ga0501071_0341021 | 3300049587 | Bacteria | 1139 |
| 636 | Ga0501071_0779223 | 3300049587 | Bacteria | 737 |
| 637 | Ga0501071_1055365 | 3300049587 | Bacteria | 628 |
| 638 | Ga0501072_0009499 | 3300049588 | Bacteria | 7395 |
| 639 | Ga0501072_0011419 | 3300049588 | Bacteria | 6790 |
| 640 | Ga0501072_0022421 | 3300049588 | Bacteria | 4899 |
| 641 | Ga0501072_0035711 | 3300049588 | Bacteria | 3895 |
| 642 | Ga0501072_0051538 | 3300049588 | Bacteria | 3240 |
| 643 | Ga0501072_0127568 | 3300049588 | Bacteria | 2027 |
| 644 | Ga0501072_0265495 | 3300049588 | Bacteria | 1366 |
| 645 | Ga0501072_0804692 | 3300049588 | Bacteria | 736 |
| 646 | Ga0501073_0028602 | 3300049589 | Bacteria | 3983 |
| 647 | Ga0501073_0087153 | 3300049589 | Bacteria | 2171 |
| 648 | Ga0501073_0159078 | 3300049589 | Bacteria | 1565 |
| 649 | Ga0501073_0212879 | 3300049589 | Bacteria | 1335 |
| 650 | Ga0501074_0003560 | 3300049590 | Bacteria | 11042 |
| 651 | Ga0501074_0004188 | 3300049590 | Bacteria | 10306 |
| 652 | Ga0501074_0031905 | 3300049590 | Bacteria | 3818 |
| 653 | Ga0501074_0061415 | 3300049590 | Bacteria | 2707 |
| 654 | Ga0501074_0091504 | 3300049590 | Bacteria | 2179 |
| 655 | Ga0501074_0179515 | 3300049590 | Bacteria | 1510 |
| 656 | Ga0501074_0358146 | 3300049590 | Bacteria | 1035 |
| 657 | Ga0501074_1001762 | 3300049590 | Bacteria | 587 |
| 658 | Ga0501075_0010552 | 3300049591 | Bacteria | 6493 |
| 659 | Ga0501075_0156256 | 3300049591 | Bacteria | 1739 |
| 660 | Ga0501075_0442113 | 3300049591 | Bacteria | 992 |
| 661 | Ga0501075_0476132 | 3300049591 | Bacteria | 952 |
| 662 | Ga0501075_1135259 | 3300049591 | Bacteria | 593 |
| 663 | Ga0501076_0003377 | 3300049592 | Bacteria | 11208 |
| 664 | Ga0501076_0035561 | 3300049592 | Bacteria | 3897 |
| 665 | Ga0501076_0204067 | 3300049592 | Bacteria | 1615 |
| 666 | Ga0501076_0267054 | 3300049592 | Bacteria | 1401 |
| 667 | Ga0501076_0330008 | 3300049592 | Bacteria | 1251 |
| 668 | Ga0501076_0330101 | 3300049592 | Bacteria | 1251 |
| 669 | Ga0501076_0354606 | 3300049592 | Bacteria | 1205 |
| 670 | Ga0501076_1396219 | 3300049592 | Bacteria | 575 |
| 671 | Ga0501077_0002635 | 3300049593 | Bacteria | 10745 |
| 672 | Ga0501077_0007377 | 3300049593 | Bacteria | 6778 |
| 673 | Ga0501077_0014735 | 3300049593 | Bacteria | 4911 |
| 674 | Ga0501253_076096 | 3300049683 | Bacteria | 750 |
| 675 | Ga0501079_0002786 | 3300049741 | Bacteria | 12749 |
| 676 | Ga0501079_0072307 | 3300049741 | Bacteria | 2665 |
| 677 | Ga0501079_0104652 | 3300049741 | Bacteria | 2196 |
| 678 | Ga0501079_0304726 | 3300049741 | Bacteria | 1246 |
| 679 | Ga0501079_0371622 | 3300049741 | Bacteria | 1121 |
| 680 | Ga0501079_0598862 | 3300049741 | Bacteria | 867 |
| 681 | Ga0501080_0003619 | 3300049742 | Bacteria | 13616 |
| 682 | Ga0501080_0017507 | 3300049742 | Bacteria | 6626 |
| 683 | Ga0501080_0026316 | 3300049742 | Bacteria | 5406 |
| 684 | Ga0501080_0140976 | 3300049742 | Bacteria | 2229 |
| 685 | Ga0501080_0159826 | 3300049742 | Bacteria | 2081 |
| 686 | Ga0501080_0244598 | 3300049742 | Bacteria | 1637 |
| 687 | Ga0501080_0429664 | 3300049742 | Bacteria | 1186 |
| 688 | Ga0501080_0621982 | 3300049742 | Bacteria | 957 |
| 689 | Ga0501081_0001282 | 3300049743 | Bacteria | 15279 |
| 690 | Ga0501081_0164791 | 3300049743 | Bacteria | 1598 |
| 691 | Ga0501081_0396591 | 3300049743 | Bacteria | 1021 |
| 692 | Ga0501081_0820899 | 3300049743 | Bacteria | 700 |
| 693 | Ga0501083_0010051 | 3300049744 | Bacteria | 6675 |
| 694 | Ga0501083_0011451 | 3300049744 | Bacteria | 6221 |
| 695 | Ga0501083_0077047 | 3300049744 | Bacteria | 2213 |
| 696 | Ga0501083_0078750 | 3300049744 | Bacteria | 2186 |
| 697 | Ga0501035_0001864 | 3300049822 | Bacteria | 21244 |
| 698 | Ga0501035_0030544 | 3300049822 | Bacteria | 4910 |
| 699 | Ga0501035_0093661 | 3300049822 | Bacteria | 2643 |
| 700 | Ga0501035_0118725 | 3300049822 | Bacteria | 2313 |
| 701 | Ga0501035_0126067 | 3300049822 | Bacteria | 2235 |
| 702 | Ga0501044_0015928 | 3300049823 | Bacteria | 8090 |
| 703 | Ga0501044_0044025 | 3300049823 | Bacteria | 4635 |
| 704 | Ga0501044_0111975 | 3300049823 | Bacteria | 2736 |
| 705 | Ga0501044_0205756 | 3300049823 | Bacteria | 1925 |
| 706 | Ga0501044_0828702 | 3300049823 | Bacteria | 803 |
| 707 | Ga0501045_0006430 | 3300049824 | Bacteria | 8138 |
| 708 | Ga0501045_0017260 | 3300049824 | Bacteria | 5123 |
| 709 | Ga0501045_0021062 | 3300049824 | Bacteria | 4661 |
| 710 | Ga0501045_0024085 | 3300049824 | Bacteria | 4369 |
| 711 | Ga0501045_0164254 | 3300049824 | Bacteria | 1653 |
| 712 | Ga0501045_0207695 | 3300049824 | Bacteria | 1459 |
| 713 | Ga0501045_0363965 | 3300049824 | Bacteria | 1076 |
| 714 | Ga0501045_0517659 | 3300049824 | Bacteria | 886 |
| 715 | Ga0501045_0619608 | 3300049824 | Bacteria | 801 |
| 716 | nmdc:mga03683_306024_c1 | 3300050489 | Bacteria | 746 |
| 717 | nmdc:mga03683_479787_c1 | 3300050489 | Bacteria | 600 |
| 718 | nmdc:mga03683_71640_c1 | 3300050489 | Bacteria | 1483 |
| 719 | nmdc:mga03n38_101737_c1 | 3300050490 | Bacteria | 1386 |
| 720 | nmdc:mga03n38_203549_c1 | 3300050490 | Bacteria | 1026 |
| 721 | nmdc:mga03n38_41461_c1 | 3300050490 | Bacteria | 2007 |
| 722 | nmdc:mga03n38_4664_c1 | 3300050490 | Bacteria | 4572 |
| 723 | nmdc:mga03n38_77331_c1 | 3300050490 | Bacteria | 1555 |
| 724 | nmdc:mga00v17_136068_c2 | 3300050491 | Bacteria | 1121 |
| 725 | nmdc:mga00v17_161054_c1 | 3300050491 | Bacteria | 1445 |
| 726 | nmdc:mga00v17_17561_c1 | 3300050491 | Bacteria | 4052 |
| 727 | nmdc:mga00v17_240215_c1 | 3300050491 | Bacteria | 1174 |
| 728 | nmdc:mga00v17_31651_c1 | 3300050491 | Bacteria | 3121 |
| 729 | nmdc:mga00v17_368842_c1 | 3300050491 | Bacteria | 933 |
| 730 | nmdc:mga00v17_37251_c1 | 3300050491 | Bacteria | 2903 |
| 731 | nmdc:mga00v17_40869_c1 | 3300050491 | Bacteria | 2783 |
| 732 | nmdc:mga00v17_754927_c1 | 3300050491 | Bacteria | 622 |
| 733 | nmdc:mga0yw44_130473_c1 | 3300050492 | Bacteria | 1627 |
| 734 | nmdc:mga0yw44_130571_c1 | 3300050492 | Bacteria | 1626 |
| 735 | nmdc:mga0yw44_134603_c1 | 3300050492 | Bacteria | 1602 |
| 736 | nmdc:mga0yw44_205243_c1 | 3300050492 | Bacteria | 1302 |
| 737 | nmdc:mga0yw44_205679_c1 | 3300050492 | Bacteria | 1301 |
| 738 | nmdc:mga0yw44_212756_c2 | 3300050492 | Bacteria | 818 |
| 739 | nmdc:mga0yw44_28583_c1 | 3300050492 | Bacteria | 3209 |
| 740 | nmdc:mga0yw44_30519_c1 | 3300050492 | Bacteria | 3125 |
| 741 | nmdc:mga0yw44_371574_c1 | 3300050492 | Bacteria | 965 |
| 742 | nmdc:mga0yw44_407292_c1 | 3300050492 | Bacteria | 920 |
| 743 | nmdc:mga0yw44_422755_c1 | 3300050492 | Bacteria | 902 |
| 744 | nmdc:mga0yw44_42585_c1 | 3300050492 | Bacteria | 2708 |
| 745 | nmdc:mga0yw44_5038_c1 | 3300050492 | Bacteria | 6174 |
| 746 | nmdc:mga0yw44_54010_c1 | 3300050492 | Bacteria | 2440 |
| 747 | nmdc:mga0yw44_63670_c1 | 3300050492 | Bacteria | 2268 |
| 748 | nmdc:mga06z11_127368_c1 | 3300050494 | Bacteria | 1426 |
| 749 | nmdc:mga06z11_4075_c1 | 3300050494 | Bacteria | 5713 |
| 750 | nmdc:mga04h51_123576_c1 | 3300050495 | Bacteria | 967 |
| 751 | nmdc:mga07m45_170035_c1 | 3300050496 | Bacteria | 1267 |
| 752 | nmdc:mga07m45_196673_c1 | 3300050496 | Bacteria | 1172 |
| 753 | nmdc:mga07m45_20080_c1 | 3300050496 | Bacteria | 3626 |
| 754 | nmdc:mga07m45_58325_c1 | 3300050496 | Bacteria | 2184 |
| 755 | nmdc:mga07m45_709_c2 | 3300050496 | Bacteria | 11165 |
| 756 | nmdc:mga05p37_1111677_c1 | 3300050507 | Bacteria | 826 |
| 757 | nmdc:mga05p37_12254_c1 | 3300050507 | Bacteria | 10239 |
| 758 | nmdc:mga09592_51704_c1 | 3300050508 | Bacteria | 3467 |
| 759 | nmdc:mga06r32_40804_c1 | 3300050510 | Bacteria | 4408 |
| 760 | nmdc:mga0sz30_22491_c1 | 3300050516 | Bacteria | 2559 |
| 761 | Ga0495655_0025788 | 3300053083 | Bacteria | 1379 |
| 762 | Ga0495595_0100233 | 3300053084 | Bacteria | 1397 |
| 763 | Ga0495595_0587129 | 3300053084 | Bacteria | 569 |
| 764 | Ga0495619_0075897 | 3300053085 | Bacteria | 2256 |
| 765 | Ga0495619_0112396 | 3300053085 | Bacteria | 1862 |
| 766 | Ga0495619_0519972 | 3300053085 | Bacteria | 818 |
| 767 | Ga0500644_0000014 | 3300053088 | Bacteria | 109650 |
| 768 | Ga0500644_0034331 | 3300053088 | Bacteria | 1636 |
| 769 | Ga0500556_0006408 | 3300053104 | Bacteria | 3341 |
| 770 | Ga0500593_000395 | 3300053117 | Bacteria | 17370 |
| 771 | Ga0500573_0006114 | 3300053140 | Bacteria | 6486 |
| 772 | Ga0501084_0008673 | 3300054114 | Bacteria | 8404 |
| 773 | Ga0501084_0188294 | 3300054114 | Bacteria | 1741 |
| 774 | Ga0501084_0533698 | 3300054114 | Bacteria | 992 |
| 775 | Ga0501082_0005074 | 3300060353 | Bacteria | 11478 |
| 776 | Ga0501082_0023144 | 3300060353 | Bacteria | 5358 |
| 777 | Ga0501082_0035057 | 3300060353 | Bacteria | 4325 |
| 778 | Ga0501082_0131242 | 3300060353 | Bacteria | 2174 |
| 779 | Ga0501082_0293877 | 3300060353 | Bacteria | 1415 |
| 780 | Ga0501082_0331634 | 3300060353 | Bacteria | 1326 |
| 781 | Ga0501082_0373122 | 3300060353 | Bacteria | 1244 |
| 782 | Ga0501082_0774161 | 3300060353 | Bacteria | 840 |
| 783 | Ga0501082_0848315 | 3300060353 | Bacteria | 799 |
| 784 | Ga0466962_0010241 | 3300061719 | Bacteria | 4502 |
| 785 | Ga0530510_0064970 | 3300061734 | Bacteria | 2643 |
| 786 | Ga0530510_0098065 | 3300061734 | Bacteria | 2143 |
| 787 | Ga0530510_0292292 | 3300061734 | Bacteria | 1218 |
| 788 | Ga0530510_0692023 | 3300061734 | Bacteria | 777 |
| 789 | 2643825680 | 2643221561 | Bacteria | 4984412 |
| 790 | 2643851140 | 2643221567 | Bacteria | 4163945 |
| 791 | 2644089461 | 2643221615 | Bacteria | 5487866 |
| 792 | 2644102005 | 2643221617 | Bacteria | 5139111 |
| 793 | 2644115228 | 2643221620 | Bacteria | 5134593 |
| 794 | 2644134926 | 2643221624 | Bacteria | 4384879 |
| 795 | 2644230278 | 2643221641 | Bacteria | 4490190 |
| 796 | 2644319306 | 2643221657 | Bacteria | 5490246 |
| 797 | 2644531674 | 2643221696 | Bacteria | 5431823 |
| 798 | 2644607469 | 2643221711 | Bacteria | 4865335 |
| 799 | 2738870202 | 2738541305 | Bacteria | 4910150 |
| 800 | 2774393293 | 2773857762 | Bacteria | 5971770 |
| 801 | 2808873023 | 2808606365 | Bacteria | 4301966 |
| 802 | 2809197134 | 2808606439 | Bacteria | 5952208 |
| 803 | 2812350721 | 2811994878 | Bacteria | 5992952 |
| 804 | 2812373755 | 2811994882 | Bacteria | 4688362 |
| 805 | 2819426372 | 2818991318 | Bacteria | 5266538 |
| 806 | 2819665413 | 2818991458 | Bacteria | 4794049 |
| 807 | 2819691383 | 2818991462 | Bacteria | 4320267 |
| 808 | 2819727580 | 2818991469 | Bacteria | 4644110 |
| 809 | 2855387903 | 2855386786 | Bacteria | 4752232 |
| 810 | 2857485953 | 2857481737 | Bacteria | 4761446 |
| 811 | 2919449364 | 2919446982 | Bacteria | 3994487 |
| 812 | 8054611121 | 8054609563 | Bacteria | 5170090 |
| 813 | Ga0075365_10126708 | |||
| 814 | LJQas_1001906 | |||
| 815 | JGI24740J21852_10023059 | |||
| 816 | JGI24737J22298_10060630 | |||
| 817 | Ga0006562J51391_1058933 | |||
| 818 | Ga0006562J51391_1058934 | |||
| 819 | Ga0070658_10612282 | |||
| 820 | Ga0070658_10721378 | |||
| 821 | Ga0070683_100001765 | |||
| 822 | Ga0070683_100020909 | |||
| 823 | Ga0070683_100171109 | |||
| 824 | Ga0070677_10472504 | |||
| 825 | Ga0068869_100927096 | |||
| 826 | Ga0070682_100008939 | |||
| 827 | Ga0070682_100545024 | |||
| 828 | Ga0068868_100124930 | |||
| 829 | Ga0068868_100141936 | |||
| 830 | Ga0070660_100023064 | |||
| 831 | Ga0070660_100084769 | |||
| 832 | Ga0070687_100168854 | |||
| 833 | Ga0070692_10009414 | |||
| 834 | Ga0070659_100050890 | |||
| 835 | Ga0070700_100702849 | |||
| 836 | Ga0070663_100212526 | |||
| 837 | Ga0070663_100418087 | |||
| 838 | Ga0070678_100099536 | |||
| 839 | Ga0070678_100566374 | |||
| 840 | Ga0070681_10351086 | |||
| 841 | Ga0068867_100326639 | |||
| 842 | Ga0070685_10175742 | |||
| 843 | Ga0070707_100346059 | |||
| 844 | Ga0070698_100040552 | |||
| 845 | Ga0070679_100023558 | |||
| 846 | Ga0070684_100001108 | |||
| 847 | Ga0070684_100142262 | |||
| 848 | Ga0070684_100215444 | |||
| 849 | Ga0070693_101120504 | |||
| 850 | Ga0070665_100054249 | |||
| 851 | Ga0068855_100075111 | |||
| 852 | Ga0070664_100004627 | |||
| 853 | Ga0070664_100588993 | |||
| 854 | Ga0068857_100004947 | |||
| 855 | Ga0068857_100714378 | |||
| 856 | Ga0068856_100242894 | |||
| 857 | Ga0068856_100505086 | |||
| 858 | Ga0070702_100130092 | |||
| 859 | Ga0070702_100368653 | |||
| 860 | Ga0070702_100770283 | |||
| 861 | Ga0068864_100444581 | |||
| 862 | Ga0068861_100081020 | |||
| 863 | Ga0068861_100831107 | |||
| 864 | Ga0068851_10822908 | |||
| 865 | Ga0068860_100003132 | |||
| 866 | Ga0068860_100079019 | |||
| 867 | Ga0068860_100336775 | |||
| 868 | Ga0081455_10447356 | |||
| 869 | Ga0075365_10001053 | |||
| 870 | Ga0075365_10016862 | |||
| 871 | Ga0075365_10056730 | |||
| 872 | Ga0075365_10065247 | |||
| 873 | Ga0075365_10079886 | |||
| 874 | Ga0075365_10091451 | |||
| 875 | Ga0075365_10165334 | |||
| 876 | Ga0075365_10201393 | |||
| 877 | Ga0075365_10206597 | |||
| 878 | Ga0075365_10216294 | |||
| 879 | Ga0075365_10251861 | |||
| 880 | Ga0075365_10572135 | |||
| 881 | Ga0075365_10662550 | |||
| 882 | Ga0075368_10000598 | |||
| 883 | Ga0075368_10065995 | |||
| 884 | Ga0075363_100001214 | |||
| 885 | Ga0075363_100018534 | |||
| 886 | Ga0075363_100031488 | |||
| 887 | Ga0075363_100069787 | |||
| 888 | Ga0075363_100114643 | |||
| 889 | Ga0075363_100430128 | |||
| 890 | Ga0075364_10009909 | |||
| 891 | Ga0075364_10011285 | |||
| 892 | Ga0075364_10017735 | |||
| 893 | Ga0075364_10030569 | |||
| 894 | Ga0075364_10048072 | |||
| 895 | Ga0075364_10488843 | |||
| 896 | Ga0075362_10113317 | |||
| 897 | Ga0075367_10000608 | |||
| 898 | Ga0075367_10038743 | |||
| 899 | Ga0075367_10070470 | |||
| 900 | Ga0075367_10364298 | |||
| 901 | Ga0075369_10026488 | |||
| 902 | Ga0075370_10011249 | |||
| 903 | Ga0075370_10014568 | |||
| 904 | Ga0075370_10045252 | |||
| 905 | Ga0075370_10176589 | |||
| 906 | Ga0068871_100387002 | |||
| 907 | Ga0068871_100663072 | |||
| 908 | Ga0068871_100711155 | |||
| 909 | Ga0075430_100014848 | |||
| 910 | Ga0075431_100002127 | |||
| 911 | Ga0075429_100007096 | |||
| 912 | Ga0068865_100471260 | |||
| 913 | Ga0105245_10001807 | |||
| 914 | Ga0105245_10278898 | |||
| 915 | Ga0105245_10426779 | |||
| 916 | Ga0105245_10438890 | |||
| 917 | Ga0105245_10800024 | |||
| 918 | Ga0114129_10001254 | |||
| 919 | Ga0114129_10596733 | |||
| 920 | Ga0105243_10029112 | |||
| 921 | Ga0105243_10154462 | |||
| 922 | Ga0105241_10571689 | |||
| 923 | Ga0105242_10511081 | |||
| 924 | Ga0105248_10081536 | |||
| 925 | Ga0105248_10596169 | |||
| 926 | Ga0105237_10069088 | |||
| 927 | Ga0105237_10198158 | |||
| 928 | Ga0105237_10620843 | |||
| 929 | Ga0105238_10268612 | |||
| 930 | Ga0105238_10552465 | |||
| 931 | Ga0105238_11876084 | |||
| 932 | Ga0105249_10137020 | |||
| 933 | Ga0105249_11135266 | |||
| 934 | Ga0105249_12050187 | |||
| 935 | Ga0105249_12304143 | |||
| 936 | Ga0105239_10005630 | |||
| 937 | Ga0105239_11798927 | |||
| 938 | Ga0105246_10001245 | |||
| 939 | Ga0105246_10032052 | |||
| 940 | Ga0105246_10176344 | |||
| 941 | Ga0105246_10735004 | |||
| 942 | Ga0105246_10973923 | |||
| 943 | Ga0157371_10621654 | |||
| 944 | Ga0157371_10813734 | |||
| 945 | Ga0157370_11111624 | |||
| 946 | Ga0157369_10149788 | |||
| 947 | Ga0157369_10579548 | |||
| 948 | Ga0157369_10755343 | |||
| 949 | Ga0157374_10488862 | |||
| 950 | Ga0163162_10358405 | |||
| 951 | Ga0163162_10498029 | |||
| 952 | Ga0157372_10024501 | |||
| 953 | Ga0157372_10309128 | |||
| 954 | Ga0157372_10335789 | |||
| 955 | Ga0157372_11780309 | |||
| 956 | Ga0157372_12014985 | |||
| 957 | Ga0157375_10013264 | |||
| 958 | Ga0157375_10065777 | |||
| 959 | Ga0157375_10256683 | |||
| 960 | Ga0157375_10325687 | |||
| 961 | Ga0157375_10433873 | |||
| 962 | Ga0157375_10461188 | |||
| 963 | Ga0157375_11705674 | |||
| 964 | Ga0157375_12210278 | |||
| 965 | Ga0163163_10071259 | |||
| 966 | Ga0163163_10275738 | |||
| 967 | Ga0157380_10124787 | |||
| 968 | Ga0157380_10176902 | |||
| 969 | Ga0157380_10488504 | |||
| 970 | Ga0157380_11046190 | |||
| 971 | Ga0157377_10040675 | |||
| 972 | Ga0157377_10056736 | |||
| 973 | Ga0157379_10003947 | |||
| 974 | Ga0157376_10369842 | |||
| 975 | Ga0163161_10061377 | |||
| 976 | Ga0163161_10267663 | |||
| 977 | Ga0207647_10031780 | |||
| 978 | Ga0207647_10065293 | |||
| 979 | Ga0207647_10165010 | |||
| 980 | Ga0207647_10290103 | |||
| 981 | Ga0207705_10036053 | |||
| 982 | Ga0207705_10498806 | |||
| 983 | Ga0207707_10280986 | |||
| 984 | Ga0207671_10369553 | |||
| 985 | Ga0207662_10090826 | |||
| 986 | Ga0207657_10029498 | |||
| 987 | Ga0207657_10248773 | |||
| 988 | Ga0207652_10143256 | |||
| 989 | Ga0207646_10179992 | |||
| 990 | Ga0207694_10384002 | |||
| 991 | Ga0207694_10465906 | |||
| 992 | Ga0207694_11121655 | |||
| 993 | Ga0207687_10002467 | |||
| 994 | Ga0207706_10007918 | |||
| 995 | Ga0207709_10096143 | |||
| 996 | Ga0207669_10195020 | |||
| 997 | Ga0207704_10297836 | |||
| 998 | Ga0207711_10165050 | |||
| 999 | Ga0207661_10018219 | |||
| 1000 | Ga0207661_10036340 | |||
| 1001 | Ga0207661_10104609 | |||
| 1002 | Ga0207661_10520855 | |||
| 1003 | Ga0207661_10673917 | |||
| 1004 | Ga0207679_10037776 | |||
| 1005 | Ga0207667_10326500 | |||
| 1006 | Ga0207712_10216045 | |||
| 1007 | Ga0207640_10750252 | |||
| 1008 | Ga0207677_10044648 | |||
| 1009 | Ga0207678_10135084 | |||
| 1010 | Ga0207678_10216118 | |||
| 1011 | Ga0207678_10282138 | |||
| 1012 | Ga0207708_10065834 | |||
| 1013 | Ga0207708_10195101 | |||
| 1014 | Ga0207708_11029894 | |||
| 1015 | Ga0207702_10270608 | |||
| 1016 | Ga0207702_10332591 | |||
| 1017 | Ga0207702_11235114 | |||
| 1018 | Ga0207641_10958735 | |||
| 1019 | Ga0207648_10181699 | |||
| 1020 | Ga0207676_10112084 | |||
| 1021 | Ga0207674_10199363 | |||
| 1022 | Ga0207674_10350159 | |||
| 1023 | Ga0207674_10698227 | |||
| 1024 | Ga0207675_100026182 | |||
| 1025 | Ga0207675_100382141 | |||
| 1026 | Ga0207675_100620868 | |||
| 1027 | Ga0207683_10171755 | |||
| 1028 | Ga0207683_10483857 | |||
| 1029 | Ga0207683_11027733 | |||
| 1030 | Ga0207683_11369540 | |||
| 1031 | Ga0207698_10479094 | |||
| 1032 | Ga0209813_10001356 | |||
| 1033 | Ga0209813_10006987 | |||
| 1034 | Ga0268266_10010593 | |||
| 1035 | Ga0268266_10151014 | |||
| 1036 | Ga0268266_11293917 | |||
| 1037 | Ga0268264_10000398 | |||
| 1038 | Ga0268264_10518762 | |||
| 1039 | Ga0268264_10800600 | |||
| 1040 | Ga0316181_1251168 | |||
| 1041 | Ga0307408_100320049 | |||
| 1042 | Ga0316575_10105336 | |||
| 1043 | Ga0316579_10014233 | |||
| 1044 | Ga0316576_10130764 | |||
| 1045 | Ga0316576_10357257 | |||
| 1046 | Ga0316578_10105770 | |||
| 1047 | Ga0307405_10113580 | |||
| 1048 | Ga0307405_10548310 | |||
| 1049 | Ga0307405_10672305 | |||
| 1050 | Ga0307405_11359273 | |||
| 1051 | Ga0316577_10016474 | |||
| 1052 | Ga0316577_10024535 | |||
| 1053 | Ga0307413_10093952 | |||
| 1054 | Ga0307413_10263596 | |||
| 1055 | Ga0307413_10430278 | |||
| 1056 | Ga0307413_10883783 | |||
| 1057 | Ga0307410_10036603 | |||
| 1058 | Ga0307410_10235762 | |||
| 1059 | Ga0307410_11178267 | |||
| 1060 | Ga0307406_10066078 | |||
| 1061 | Ga0307406_10608867 | |||
| 1062 | Ga0307407_10012953 | |||
| 1063 | Ga0307407_10068424 | |||
| 1064 | Ga0307407_10101605 | |||
| 1065 | Ga0307412_10064984 | |||
| 1066 | Ga0307409_100043250 | |||
| 1067 | Ga0307409_100062937 | |||
| 1068 | Ga0307409_100148687 | |||
| 1069 | Ga0307409_100158501 | |||
| 1070 | Ga0307409_100184217 | |||
| 1071 | Ga0307409_100275821 | |||
| 1072 | Ga0307409_100283233 | |||
| 1073 | Ga0307409_100360062 | |||
| 1074 | Ga0307409_100504345 | |||
| 1075 | Ga0307409_101241167 | |||
| 1076 | Ga0307416_100096579 | |||
| 1077 | Ga0307416_100155082 | |||
| 1078 | Ga0307416_100188290 | |||
| 1079 | Ga0307416_100218906 | |||
| 1080 | Ga0307416_101026068 | |||
| 1081 | Ga0307416_101631372 | |||
| 1082 | Ga0307416_101712266 | |||
| 1083 | Ga0307415_100010168 | |||
| 1084 | Ga0307415_100040277 | |||
| 1085 | Ga0307415_100655723 | |||
| 1086 | Ga0307415_100703766 | |||
| 1087 | Ga0307415_100717328 | |||
| 1088 | Ga0307415_100718213 | |||
| 1089 | Ga0307415_100929910 | |||
| 1090 | Ga0307415_101085820 | |||
| 1091 | Ga0316583_10126828 | |||
| 1092 | Ga0316585_10002307 | |||
| 1093 | Ga0316585_10018429 | |||
| 1094 | Ga0316580_10001614 | |||
| 1095 | Ga0316580_10107753 | |||
| 1096 | Ga0316580_10152177 | |||
| 1097 | Ga0316574_0000685 | |||
| 1098 | Ga0316574_0007039 | |||
| 1099 | Ga0316574_0197884 | |||
| 1100 | Ga0373931_0226085 | |||
| 1101 | Ga0316582_0014902 | |||
| 1102 | Ga0316582_0020349 | |||
| 1103 | Ga0316582_0406495 | |||
| 1104 | Ga0316584_0613157 | |||
| 1105 | Ga0316584_0751011 | |||
| 1106 | Ga0395899_0715894 | |||
| 1107 | Ga0395900_0297172 | |||
| 1108 | Ga0395900_0576101 | |||
| 1109 | Ga0395898_0012889 | |||
| 1110 | Ga0395898_0019780 | |||
| 1111 | Ga0395898_0748457 | |||
| 1112 | Ga0395905_0040662 | |||
| 1113 | Ga0395905_0108832 | |||
| 1114 | Ga0395905_0163348 | |||
| 1115 | Ga0395901_0005504 | |||
| 1116 | Ga0395901_0045589 | |||
| 1117 | Ga0395901_0072356 | |||
| 1118 | Ga0395901_0189266 | |||
| 1119 | Ga0395901_0769247 | |||
| 1120 | Ga0395901_1328514 | |||
| 1121 | Ga0242420_008798 | |||
| 1122 | Ga0451789_0111182 | |||
| 1123 | Ga0451791_0693704 | |||
| 1124 | Ga0451793_1811604 | |||
| 1125 | Ga0451797_0081001 | |||
| 1126 | Ga0451797_0645667 | |||
| 1127 | Ga0451797_0697299 | |||
| 1128 | Ga0451802_1723936 | |||
| 1129 | Ga0451837_0953581 | |||
| 1130 | Ga0451841_0766488 | |||
| 1131 | Ga0451843_1466042 | |||
| 1132 | Ga0451853_0059182 | |||
| 1133 | Ga0451853_0859806 | |||
| 1134 | Ga0451853_1677545 | |||
| 1135 | Ga0451853_2103927 | |||
| 1136 | Ga0439431_0116775 | |||
| 1137 | Ga0439442_075498 | |||
| 1138 | Ga0439448_0117894 | |||
| 1139 | Ga0439449_0246235 | |||
| 1140 | Ga0439455_0066527 | |||
| 1141 | Ga0439456_132211 | |||
| 1142 | Ga0450907_003864 | |||
| 1143 | Ga0450908_087533 | |||
| 1144 | Ga0450909_030318 | |||
| 1145 | Ga0466972_0033078 | |||
| 1146 | Ga0466972_0063815 | |||
| 1147 | Ga0466972_0079898 | |||
| 1148 | Ga0466972_0179501 | |||
| 1149 | Ga0466965_0015971 | |||
| 1150 | Ga0466965_0018899 | |||
| 1151 | Ga0466965_0021836 | |||
| 1152 | Ga0466965_0038113 | |||
| 1153 | Ga0466965_0046527 | |||
| 1154 | Ga0466965_0179130 | |||
| 1155 | Ga0466966_0281415 | |||
| 1156 | Ga0466961_0060998 | |||
| 1157 | Ga0466963_0040574 | |||
| 1158 | Ga0466963_0102050 | |||
| 1159 | Ga0466963_0341728 | |||
| 1160 | Ga0466964_0029085 | |||
| 1161 | Ga0466964_0136106 | |||
| 1162 | Ga0466971_0006701 | |||
| 1163 | Ga0466970_0018613 | |||
| 1164 | Ga0466970_0032993 | |||
| 1165 | Ga0466970_0039627 | |||
| 1166 | Ga0466970_0041233 | |||
| 1167 | Ga0466970_0174602 | |||
| 1168 | Ga0466970_0238119 | |||
| 1169 | Ga0466957_0039733 | |||
| 1170 | Ga0466957_0071561 | |||
| 1171 | Ga0466960_0000595 | |||
| 1172 | Ga0466960_0020178 | |||
| 1173 | Ga0466960_0035751 | |||
| 1174 | Ga0466960_0217803 | |||
| 1175 | Ga0466960_0270559 | |||
| 1176 | Ga0466960_0548296 | |||
| 1177 | Ga0451576_0072659 | |||
| 1178 | Ga0466958_0022574 | |||
| 1179 | Ga0466958_0548176 | |||
| 1180 | Ga0466967_0022196 | |||
| 1181 | Ga0466967_0031073 | |||
| 1182 | Ga0466967_0037164 | |||
| 1183 | Ga0466967_0135295 | |||
| 1184 | Ga0466967_0170033 | |||
| 1185 | Ga0466967_0257059 | |||
| 1186 | Ga0466967_0288858 | |||
| 1187 | Ga0466967_0420909 | |||
| 1188 | Ga0466967_0670740 | |||
| 1189 | Ga0466967_0789488 | |||
| 1190 | Ga0466967_0865592 | |||
| 1191 | Ga0466967_1025463 | |||
| 1192 | Ga0495603_0665611 | |||
| 1193 | Ga0495641_0019455 | |||
| 1194 | Ga0495641_0106804 | |||
| 1195 | Ga0495641_0146259 | |||
| 1196 | Ga0495582_0048647 | |||
| 1197 | Ga0495582_0096208 | |||
| 1198 | Ga0495582_0138767 | |||
| 1199 | Ga0495662_0197640 | |||
| 1200 | Ga0495620_0084920 | |||
| 1201 | Ga0495630_0445153 | |||
| 1202 | Ga0495656_0136577 | |||
| 1203 | Ga0495635_0280463 | |||
| 1204 | Ga0495657_0205584 | |||
| 1205 | Ga0495658_0081195 | |||
| 1206 | Ga0495658_0129947 | |||
| 1207 | Ga0495600_0341862 | |||
| 1208 | Ga0495581_0133647 | |||
| 1209 | Ga0495674_0263920 | |||
| 1210 | Ga0495680_0215954 | |||
| 1211 | Ga0495614_0174650 | |||
| 1212 | Ga0496100_0004983 | |||
| 1213 | Ga0496100_0154288 | |||
| 1214 | Ga0496100_0225290 | |||
| 1215 | Ga0496100_0235700 | |||
| 1216 | Ga0496100_0447546 | |||
| 1217 | Ga0496100_0953906 | |||
| 1218 | Ga0496101_0001835 | |||
| 1219 | Ga0496101_0017375 | |||
| 1220 | Ga0496101_0021273 | |||
| 1221 | Ga0496101_0029165 | |||
| 1222 | Ga0496101_0183937 | |||
| 1223 | Ga0496101_0347912 | |||
| 1224 | Ga0496101_0681487 | |||
| 1225 | Ga0496102_0020751 | |||
| 1226 | Ga0496102_0046777 | |||
| 1227 | Ga0496102_0047814 | |||
| 1228 | Ga0496102_0052728 | |||
| 1229 | Ga0496102_0095121 | |||
| 1230 | Ga0496102_0105315 | |||
| 1231 | Ga0496102_0121320 | |||
| 1232 | Ga0496102_0169525 | |||
| 1233 | Ga0496102_0285888 | |||
| 1234 | Ga0496102_0436692 | |||
| 1235 | Ga0496102_0798411 | |||
| 1236 | Ga0496102_1137312 | |||
| 1237 | Ga0496103_0029722 | |||
| 1238 | Ga0496103_0048239 | |||
| 1239 | Ga0496103_0142682 | |||
| 1240 | Ga0496103_0148842 | |||
| 1241 | Ga0496103_0444941 | |||
| 1242 | Ga0496103_0565318 | |||
| 1243 | Ga0496103_0666596 | |||
| 1244 | Ga0496104_0008446 | |||
| 1245 | Ga0496104_0091502 | |||
| 1246 | Ga0496104_0115745 | |||
| 1247 | Ga0496104_0225073 | |||
| 1248 | Ga0496104_1194052 | |||
| 1249 | Ga0496105_0013182 | |||
| 1250 | Ga0496105_0076286 | |||
| 1251 | Ga0496105_0133728 | |||
| 1252 | Ga0496105_0607383 | |||
| 1253 | Ga0496106_0025429 | |||
| 1254 | Ga0496106_0127573 | |||
| 1255 | Ga0496107_0020990 | |||
| 1256 | Ga0496107_0021057 | |||
| 1257 | Ga0496107_0033467 | |||
| 1258 | Ga0496107_0118072 | |||
| 1259 | Ga0496107_0351691 | |||
| 1260 | Ga0496107_0414583 | |||
| 1261 | Ga0496108_0003872 | |||
| 1262 | Ga0496108_0028338 | |||
| 1263 | Ga0496108_0250125 | |||
| 1264 | Ga0496108_0267480 | |||
| 1265 | Ga0496108_0281990 | |||
| 1266 | Ga0496108_0305100 | |||
| 1267 | Ga0496108_0319742 | |||
| 1268 | Ga0496109_0012972 | |||
| 1269 | Ga0496109_0013365 | |||
| 1270 | Ga0496109_0051438 | |||
| 1271 | Ga0496109_0213880 | |||
| 1272 | Ga0496109_0324366 | |||
| 1273 | Ga0496109_0354665 | |||
| 1274 | Ga0496109_0385054 | |||
| 1275 | Ga0496109_0769962 | |||
| 1276 | Ga0496109_0851906 | |||
| 1277 | Ga0496109_1325990 | |||
| 1278 | Ga0496109_1392791 | |||
| 1279 | Ga0496110_0011968 | |||
| 1280 | Ga0496110_0065610 | |||
| 1281 | Ga0496110_0198814 | |||
| 1282 | Ga0496110_0286152 | |||
| 1283 | Ga0496110_0289664 | |||
| 1284 | Ga0496110_0787089 | |||
| 1285 | Ga0496111_0018902 | |||
| 1286 | Ga0496111_0025918 | |||
| 1287 | Ga0496111_0076582 | |||
| 1288 | Ga0496111_0207792 | |||
| 1289 | Ga0496111_0312555 | |||
| 1290 | Ga0496112_0324735 | |||
| 1291 | Ga0496112_0373813 | |||
| 1292 | Ga0496112_0431974 | |||
| 1293 | Ga0496112_0567503 | |||
| 1294 | Ga0496112_0936896 | |||
| 1295 | Ga0496112_1250054 | |||
| 1296 | Ga0496113_0044495 | |||
| 1297 | Ga0496113_0063428 | |||
| 1298 | Ga0496113_0252195 | |||
| 1299 | Ga0496113_0415140 | |||
| 1300 | Ga0496113_0548032 | |||
| 1301 | Ga0496113_0943820 | |||
| 1302 | Ga0496113_1400915 | |||
| 1303 | Ga0496114_0007055 | |||
| 1304 | Ga0496114_0016659 | |||
| 1305 | Ga0496114_0017256 | |||
| 1306 | Ga0496114_0026676 | |||
| 1307 | Ga0496114_0042662 | |||
| 1308 | Ga0496114_0108430 | |||
| 1309 | Ga0496114_0118083 | |||
| 1310 | Ga0496114_0127551 | |||
| 1311 | Ga0496115_0029062 | |||
| 1312 | Ga0496115_0165938 | |||
| 1313 | Ga0496118_0196984 | |||
| 1314 | Ga0496119_0069522 | |||
| 1315 | Ga0496124_0177899 | |||
| 1316 | Ga0501291_038342 | |||
| 1317 | Ga0501031_0001904 | |||
| 1318 | Ga0501031_0014439 | |||
| 1319 | Ga0501031_0026258 | |||
| 1320 | Ga0501031_0094821 | |||
| 1321 | Ga0501031_0153042 | |||
| 1322 | Ga0501031_0226356 | |||
| 1323 | Ga0501031_0313235 | |||
| 1324 | Ga0501031_0625446 | |||
| 1325 | Ga0501032_0023177 | |||
| 1326 | Ga0501032_0031832 | |||
| 1327 | Ga0501032_0095711 | |||
| 1328 | Ga0501032_0126774 | |||
| 1329 | Ga0501032_0142041 | |||
| 1330 | Ga0501032_0207762 | |||
| 1331 | Ga0501032_0260792 | |||
| 1332 | Ga0501033_0113851 | |||
| 1333 | Ga0501033_0237926 | |||
| 1334 | Ga0501033_0332360 | |||
| 1335 | Ga0501034_0005404 | |||
| 1336 | Ga0501034_0040986 | |||
| 1337 | Ga0501034_0105687 | |||
| 1338 | Ga0501034_0179915 | |||
| 1339 | Ga0501034_0227792 | |||
| 1340 | Ga0501034_0380273 | |||
| 1341 | Ga0501034_0759099 | |||
| 1342 | Ga0501034_0859779 | |||
| 1343 | Ga0501036_0004164 | |||
| 1344 | Ga0501036_0007791 | |||
| 1345 | Ga0501036_0044452 | |||
| 1346 | Ga0501036_0138821 | |||
| 1347 | Ga0501036_0185659 | |||
| 1348 | Ga0501036_0258382 | |||
| 1349 | Ga0501036_0293228 | |||
| 1350 | Ga0501036_0435772 | |||
| 1351 | Ga0501036_0949127 | |||
| 1352 | Ga0501037_0007065 | |||
| 1353 | Ga0501037_0023238 | |||
| 1354 | Ga0501037_0056310 | |||
| 1355 | Ga0501037_0193576 | |||
| 1356 | Ga0501037_0313772 | |||
| 1357 | Ga0501037_0419179 | |||
| 1358 | Ga0501037_0573612 | |||
| 1359 | Ga0501038_0003261 | |||
| 1360 | Ga0501038_0006206 | |||
| 1361 | Ga0501038_0100777 | |||
| 1362 | Ga0501038_0130725 | |||
| 1363 | Ga0501038_0266258 | |||
| 1364 | Ga0501039_0017929 | |||
| 1365 | Ga0501039_0062670 | |||
| 1366 | Ga0501039_0065694 | |||
| 1367 | Ga0501039_0078520 | |||
| 1368 | Ga0501039_0290424 | |||
| 1369 | Ga0501039_0338948 | |||
| 1370 | Ga0501039_0620222 | |||
| 1371 | Ga0501039_0711541 | |||
| 1372 | Ga0501039_1111428 | |||
| 1373 | Ga0501040_0006842 | |||
| 1374 | Ga0501040_0018929 | |||
| 1375 | Ga0501040_0449790 | |||
| 1376 | Ga0501040_0653950 | |||
| 1377 | Ga0501040_1051930 | |||
| 1378 | Ga0501041_0003749 | |||
| 1379 | Ga0501041_0125081 | |||
| 1380 | Ga0501041_0137528 | |||
| 1381 | Ga0501041_0332191 | |||
| 1382 | Ga0501041_0461532 | |||
| 1383 | Ga0501042_0016345 | |||
| 1384 | Ga0501042_0059908 | |||
| 1385 | Ga0501042_0088299 | |||
| 1386 | Ga0501042_0131373 | |||
| 1387 | Ga0501042_0158519 | |||
| 1388 | Ga0501042_0502106 | |||
| 1389 | Ga0501042_0714272 | |||
| 1390 | Ga0501043_0024936 | |||
| 1391 | Ga0501043_0067863 | |||
| 1392 | Ga0501043_0128243 | |||
| 1393 | Ga0501043_0191731 | |||
| 1394 | Ga0501043_0590545 | |||
| 1395 | Ga0501043_0622689 | |||
| 1396 | Ga0501043_0727302 | |||
| 1397 | Ga0501046_0006288 | |||
| 1398 | Ga0501046_0012443 | |||
| 1399 | Ga0501046_0164983 | |||
| 1400 | Ga0501046_0200407 | |||
| 1401 | Ga0501047_0015588 | |||
| 1402 | Ga0501047_0023385 | |||
| 1403 | Ga0501047_0125216 | |||
| 1404 | Ga0501047_0744334 | |||
| 1405 | Ga0501047_0843753 | |||
| 1406 | Ga0501048_0004142 | |||
| 1407 | Ga0501048_0004795 | |||
| 1408 | Ga0501048_0005842 | |||
| 1409 | Ga0501048_0055092 | |||
| 1410 | Ga0501048_0229782 | |||
| 1411 | Ga0501048_0237416 | |||
| 1412 | Ga0501048_0294935 | |||
| 1413 | Ga0501048_0492925 | |||
| 1414 | Ga0501067_0000658 | |||
| 1415 | Ga0501067_0008791 | |||
| 1416 | Ga0501067_0044364 | |||
| 1417 | Ga0501067_0084598 | |||
| 1418 | Ga0501067_0099818 | |||
| 1419 | Ga0501068_0003031 | |||
| 1420 | Ga0501068_0007715 | |||
| 1421 | Ga0501068_0039773 | |||
| 1422 | Ga0501068_0135045 | |||
| 1423 | Ga0501068_0388813 | |||
| 1424 | Ga0501068_0405806 | |||
| 1425 | Ga0501068_0449690 | |||
| 1426 | Ga0501068_0631238 | |||
| 1427 | Ga0501069_0015893 | |||
| 1428 | Ga0501069_0017400 | |||
| 1429 | Ga0501069_0032903 | |||
| 1430 | Ga0501069_0084888 | |||
| 1431 | Ga0501069_0175206 | |||
| 1432 | Ga0501069_0294824 | |||
| 1433 | Ga0501070_0002949 | |||
| 1434 | Ga0501070_0024136 | |||
| 1435 | Ga0501070_0024860 | |||
| 1436 | Ga0501070_0184660 | |||
| 1437 | Ga0501070_0278625 | |||
| 1438 | Ga0501070_0399136 | |||
| 1439 | Ga0501070_0419803 | |||
| 1440 | Ga0501071_0007851 | |||
| 1441 | Ga0501071_0019218 | |||
| 1442 | Ga0501071_0062635 | |||
| 1443 | Ga0501071_0156691 | |||
| 1444 | Ga0501071_0199647 | |||
| 1445 | Ga0501071_0215569 | |||
| 1446 | Ga0501071_0253314 | |||
| 1447 | Ga0501071_0341021 | |||
| 1448 | Ga0501071_0779223 | |||
| 1449 | Ga0501071_1055365 | |||
| 1450 | Ga0501072_0009499 | |||
| 1451 | Ga0501072_0011419 | |||
| 1452 | Ga0501072_0022421 | |||
| 1453 | Ga0501072_0035711 | |||
| 1454 | Ga0501072_0051538 | |||
| 1455 | Ga0501072_0127568 | |||
| 1456 | Ga0501072_0265495 | |||
| 1457 | Ga0501072_0804692 | |||
| 1458 | Ga0501073_0028602 | |||
| 1459 | Ga0501073_0087153 | |||
| 1460 | Ga0501073_0159078 | |||
| 1461 | Ga0501073_0212879 | |||
| 1462 | Ga0501074_0003560 | |||
| 1463 | Ga0501074_0004188 | |||
| 1464 | Ga0501074_0031905 | |||
| 1465 | Ga0501074_0061415 | |||
| 1466 | Ga0501074_0091504 | |||
| 1467 | Ga0501074_0179515 | |||
| 1468 | Ga0501074_0358146 | |||
| 1469 | Ga0501074_1001762 | |||
| 1470 | Ga0501075_0010552 | |||
| 1471 | Ga0501075_0156256 | |||
| 1472 | Ga0501075_0442113 | |||
| 1473 | Ga0501075_0476132 | |||
| 1474 | Ga0501075_1135259 | |||
| 1475 | Ga0501076_0003377 | |||
| 1476 | Ga0501076_0035561 | |||
| 1477 | Ga0501076_0204067 | |||
| 1478 | Ga0501076_0267054 | |||
| 1479 | Ga0501076_0330008 | |||
| 1480 | Ga0501076_0330101 | |||
| 1481 | Ga0501076_0354606 | |||
| 1482 | Ga0501076_1396219 | |||
| 1483 | Ga0501077_0002635 | |||
| 1484 | Ga0501077_0007377 | |||
| 1485 | Ga0501077_0014735 | |||
| 1486 | Ga0501253_076096 | |||
| 1487 | Ga0501079_0002786 | |||
| 1488 | Ga0501079_0072307 | |||
| 1489 | Ga0501079_0104652 | |||
| 1490 | Ga0501079_0304726 | |||
| 1491 | Ga0501079_0371622 | |||
| 1492 | Ga0501079_0598862 | |||
| 1493 | Ga0501080_0003619 | |||
| 1494 | Ga0501080_0017507 | |||
| 1495 | Ga0501080_0026316 | |||
| 1496 | Ga0501080_0140976 | |||
| 1497 | Ga0501080_0159826 | |||
| 1498 | Ga0501080_0244598 | |||
| 1499 | Ga0501080_0429664 | |||
| 1500 | Ga0501080_0621982 | |||
| 1501 | Ga0501081_0001282 | |||
| 1502 | Ga0501081_0164791 | |||
| 1503 | Ga0501081_0396591 | |||
| 1504 | Ga0501081_0820899 | |||
| 1505 | Ga0501083_0010051 | |||
| 1506 | Ga0501083_0011451 | |||
| 1507 | Ga0501083_0077047 | |||
| 1508 | Ga0501083_0078750 | |||
| 1509 | Ga0501035_0001864 | |||
| 1510 | Ga0501035_0030544 | |||
| 1511 | Ga0501035_0093661 | |||
| 1512 | Ga0501035_0118725 | |||
| 1513 | Ga0501035_0126067 | |||
| 1514 | Ga0501044_0015928 | |||
| 1515 | Ga0501044_0044025 | |||
| 1516 | Ga0501044_0111975 | |||
| 1517 | Ga0501044_0205756 | |||
| 1518 | Ga0501044_0828702 | |||
| 1519 | Ga0501045_0006430 | |||
| 1520 | Ga0501045_0017260 | |||
| 1521 | Ga0501045_0021062 | |||
| 1522 | Ga0501045_0024085 | |||
| 1523 | Ga0501045_0164254 | |||
| 1524 | Ga0501045_0207695 | |||
| 1525 | Ga0501045_0363965 | |||
| 1526 | Ga0501045_0517659 | |||
| 1527 | Ga0501045_0619608 | |||
| 1528 | nmdc:mga03683_306024_c1 | |||
| 1529 | nmdc:mga03683_479787_c1 | |||
| 1530 | nmdc:mga03683_71640_c1 | |||
| 1531 | nmdc:mga03n38_101737_c1 | |||
| 1532 | nmdc:mga03n38_203549_c1 | |||
| 1533 | nmdc:mga03n38_41461_c1 | |||
| 1534 | nmdc:mga03n38_4664_c1 | |||
| 1535 | nmdc:mga03n38_77331_c1 | |||
| 1536 | nmdc:mga00v17_136068_c2 | |||
| 1537 | nmdc:mga00v17_161054_c1 | |||
| 1538 | nmdc:mga00v17_17561_c1 | |||
| 1539 | nmdc:mga00v17_240215_c1 | |||
| 1540 | nmdc:mga00v17_31651_c1 | |||
| 1541 | nmdc:mga00v17_368842_c1 | |||
| 1542 | nmdc:mga00v17_37251_c1 | |||
| 1543 | nmdc:mga00v17_40869_c1 | |||
| 1544 | nmdc:mga00v17_754927_c1 | |||
| 1545 | nmdc:mga0yw44_130473_c1 | |||
| 1546 | nmdc:mga0yw44_130571_c1 | |||
| 1547 | nmdc:mga0yw44_134603_c1 | |||
| 1548 | nmdc:mga0yw44_205243_c1 | |||
| 1549 | nmdc:mga0yw44_205679_c1 | |||
| 1550 | nmdc:mga0yw44_212756_c2 | |||
| 1551 | nmdc:mga0yw44_28583_c1 | |||
| 1552 | nmdc:mga0yw44_30519_c1 | |||
| 1553 | nmdc:mga0yw44_371574_c1 | |||
| 1554 | nmdc:mga0yw44_407292_c1 | |||
| 1555 | nmdc:mga0yw44_422755_c1 | |||
| 1556 | nmdc:mga0yw44_42585_c1 | |||
| 1557 | nmdc:mga0yw44_5038_c1 | |||
| 1558 | nmdc:mga0yw44_54010_c1 | |||
| 1559 | nmdc:mga0yw44_63670_c1 | |||
| 1560 | nmdc:mga06z11_127368_c1 | |||
| 1561 | nmdc:mga06z11_4075_c1 | |||
| 1562 | nmdc:mga04h51_123576_c1 | |||
| 1563 | nmdc:mga07m45_170035_c1 | |||
| 1564 | nmdc:mga07m45_196673_c1 | |||
| 1565 | nmdc:mga07m45_20080_c1 | |||
| 1566 | nmdc:mga07m45_58325_c1 | |||
| 1567 | nmdc:mga07m45_709_c2 | |||
| 1568 | nmdc:mga05p37_1111677_c1 | |||
| 1569 | nmdc:mga05p37_12254_c1 | |||
| 1570 | nmdc:mga09592_51704_c1 | |||
| 1571 | nmdc:mga06r32_40804_c1 | |||
| 1572 | nmdc:mga0sz30_22491_c1 | |||
| 1573 | Ga0495655_0025788 | |||
| 1574 | Ga0495595_0100233 | |||
| 1575 | Ga0495595_0587129 | |||
| 1576 | Ga0495619_0075897 | |||
| 1577 | Ga0495619_0112396 | |||
| 1578 | Ga0495619_0519972 | |||
| 1579 | Ga0500644_0000014 | |||
| 1580 | Ga0500644_0034331 | |||
| 1581 | Ga0500556_0006408 | |||
| 1582 | Ga0500593_000395 | |||
| 1583 | Ga0500573_0006114 | |||
| 1584 | Ga0501084_0008673 | |||
| 1585 | Ga0501084_0188294 | |||
| 1586 | Ga0501084_0533698 | |||
| 1587 | Ga0501082_0005074 | |||
| 1588 | Ga0501082_0023144 | |||
| 1589 | Ga0501082_0035057 | |||
| 1590 | Ga0501082_0131242 | |||
| 1591 | Ga0501082_0293877 | |||
| 1592 | Ga0501082_0331634 | |||
| 1593 | Ga0501082_0373122 | |||
| 1594 | Ga0501082_0774161 | |||
| 1595 | Ga0501082_0848315 | |||
| 1596 | Ga0466962_0010241 | |||
| 1597 | Ga0530510_0064970 | |||
| 1598 | Ga0530510_0098065 | |||
| 1599 | Ga0530510_0292292 | |||
| 1600 | Ga0530510_0692023 | |||
| 1601 | 2643825680 | |||
| 1602 | 2643851140 | |||
| 1603 | 2644089461 | |||
| 1604 | 2644102005 | |||
| 1605 | 2644115228 | |||
| 1606 | 2644134926 | |||
| 1607 | 2644230278 | |||
| 1608 | 2644319306 | |||
| 1609 | 2644531674 | |||
| 1610 | 2644607469 | |||
| 1611 | 2738870202 | |||
| 1612 | 2774393293 | |||
| 1613 | 2808873023 | |||
| 1614 | 2809197134 | |||
| 1615 | 2812350721 | |||
| 1616 | 2812373755 | |||
| 1617 | 2819426372 | |||
| 1618 | 2819665413 | |||
| 1619 | 2819691383 | |||
| 1620 | 2819727580 | |||
| 1621 | 2855387903 | |||
| 1622 | 2857485953 | |||
| 1623 | 2919449364 | |||
| 1624 | 8054611121 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6jqd-assembly1.cif.gz_B | the structural basis of the beta-carbonic anhydrase cafc (l25g and l78g mutant) of the filamentous fungus aspergillus fumigatus | 0.8516 | 1 | 163 |
| 6jqc-assembly1.cif.gz_B | the structural basis of the beta-carbonic anhydrase cafc (wild type) of the filamentous fungus aspergillus fumigatus | 0.8497 | 1 | 163 |
| 3las-assembly1.cif.gz_B | crystal structure of carbonic anhydrase from streptococcus mutans to 1.4 angstrom resolution | 0.8468 | 1 | 161 |
| 6jqd-assembly1.cif.gz_B | the structural basis of the beta-carbonic anhydrase cafc (l25g and l78g mutant) of the filamentous fungus aspergillus fumigatus | 0.8376 | 1 | 163 |
| 6jqc-assembly1.cif.gz_B | the structural basis of the beta-carbonic anhydrase cafc (wild type) of the filamentous fungus aspergillus fumigatus | 0.8358 | 1 | 163 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3lasB00 | Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase | 0.8468 | 1 | 161 | 3.40.1050.10 |
| af_Q5A207_1_162_3.40.1050.10 | Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase | 0.8388 | 5 | 161 | 3.40.1050.10 |
| 3lasB00 | Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase | 0.8329 | 1 | 161 | 3.40.1050.10 |
| 1ylkA00 | Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase | 0.8213 | 3 | 163 | 3.40.1050.10 |
| af_Q5A207_1_162_3.40.1050.10 | Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase | 0.8061 | 5 | 161 | 3.40.1050.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0S9QBD2-F1-model_v4 | Carbonic anhydrase | 0.9814 | 9 | 163 |
GO:0004089
GO:0008270 |
| AF-A0A7V9F6I8-F1-model_v4 | Carbonic anhydrase | 0.9742 | 1 | 163 |
GO:0004089
GO:0008270 |
| AF-A0A838KN49-F1-model_v4 | Carbonic anhydrase | 0.9699 | 1 | 163 |
GO:0004089
GO:0008270 |
| AF-A0A7V9F6I8-F1-model_v4 | Carbonic anhydrase | 0.9683 | 1 | 163 |
GO:0004089
GO:0008270 |
| AF-A0A4P8RDD1-F1-model_v4 | Carbonic anhydrase | 0.9666 | 3 | 161 |
GO:0004089
GO:0008270 |