F481878

General Info

Members Datasets Scaffolds Average Seq Length
812 282 1624 167

Family's Representative Sequence

Representative Sequence 3300006038|Ga0075365_10126708|Ga0075365_101267082
Length 188
Sequence VSNATVQMVDGGTQVPPGSARFALVADFDDLIAANREFAAHFTLGGFDGVAHAGVAIVTCMDSRIDPLGMVGLKPGDAKIFRNPGGRVTPQALEALVLGTHLLGVNRILVVPHTRCAMASNTEEEIRERVSASAGQDASWQTFGVITDQLQALTDDIARIRAHPLIPESTVVGGFVYDVDTGLLEQHL

Samples

Sample ID Description Type Environment
1 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
38 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
39 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
40 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
41 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
42 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
43 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
44 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
106 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
109 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
110 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
111 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
112 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
113 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
114 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
115 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
116 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
117 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
118 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
119 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
120 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
121 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
122 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
123 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
124 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
125 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
126 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
127 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
128 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
129 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
130 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
131 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
132 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
133 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
134 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
135 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
136 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
137 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
138 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
139 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
140 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
141 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
142 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
143 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
144 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
145 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
146 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
147 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
148 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
149 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
150 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
151 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
152 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
153 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
154 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
155 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
156 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
157 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
158 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
159 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
160 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
161 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
162 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
163 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
164 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
165 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
166 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
167 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
168 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
169 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
170 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
171 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
172 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
173 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
174 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
175 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
176 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
177 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
178 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
179 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
180 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
181 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
182 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
183 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
184 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
185 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
186 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
187 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
188 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
189 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
190 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
191 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
192 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
193 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
194 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
195 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
196 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
197 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
198 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
199 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
200 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
201 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
202 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
203 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
219 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
220 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
221 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
222 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
223 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
224 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
225 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
226 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
227 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
228 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
229 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
230 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
231 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
232 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
233 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
234 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
237 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
238 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
239 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
240 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
241 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
242 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
243 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
244 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
245 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
246 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
247 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
248 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
249 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
250 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
251 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
252 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
253 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
254 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
255 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
256 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
257 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
258 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
259 2643221561 Nocardioides sp. Root151 Isolate Unclassified
260 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
261 2643221615 Nocardioides sp. Root224 Isolate Unclassified
262 2643221617 Nocardioides sp. Root79 Isolate Unclassified
263 2643221620 Nocardioides sp. Root240 Isolate Unclassified
264 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
265 2643221641 Nocardioides sp. Root122 Isolate Unclassified
266 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
267 2643221696 Nocardioides sp. Root140 Isolate Unclassified
268 2643221711 Terrabacter sp. Root85 Isolate Unclassified
269 2738541305 Nocardioides sp. CF167 Isolate Unclassified
270 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
271 2808606365 Phycicoccus sp. SLBN-51 Isolate Unclassified
272 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
273 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
274 2811994882 Terrabacter sp. SLBN-196 Isolate Unclassified
275 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified
276 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
277 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
278 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
279 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
280 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
281 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
282 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.8
Metatranscriptomes 0.25
Isolates 2.96

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.59
Nodule 0.12
Rhizoplane 13.3
Rhizosphere 72.17
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075365_10126708 3300006038 Bacteria 1765
2 LJQas_1001906 3300000549 Bacteria 3015
3 JGI24740J21852_10023059 3300001979 Bacteria 2132
4 JGI24737J22298_10060630 3300001990 Bacteria 1139
5 Ga0006562J51391_1058933 3300003578 Bacteria 2372
6 Ga0006562J51391_1058934 3300003578 Bacteria 1330
7 Ga0070658_10612282 3300005327 Bacteria 944
8 Ga0070658_10721378 3300005327 Bacteria 866
9 Ga0070683_100001765 3300005329 Bacteria 16830
10 Ga0070683_100020909 3300005329 Bacteria 5834
11 Ga0070683_100171109 3300005329 Bacteria 2062
12 Ga0070677_10472504 3300005333 Bacteria 675
13 Ga0068869_100927096 3300005334 Bacteria 755
14 Ga0070682_100008939 3300005337 Bacteria 5660
15 Ga0070682_100545024 3300005337 Bacteria 907
16 Ga0068868_100124930 3300005338 Bacteria 2101
17 Ga0068868_100141936 3300005338 Bacteria 1972
18 Ga0070660_100023064 3300005339 Bacteria 4608
19 Ga0070660_100084769 3300005339 Bacteria 2491
20 Ga0070687_100168854 3300005343 Bacteria 1300
21 Ga0070692_10009414 3300005345 Bacteria 4405
22 Ga0070659_100050890 3300005366 Bacteria 3256
23 Ga0070700_100702849 3300005441 Bacteria 804
24 Ga0070663_100212526 3300005455 Bacteria 1515
25 Ga0070663_100418087 3300005455 Bacteria 1099
26 Ga0070678_100099536 3300005456 Bacteria 2250
27 Ga0070678_100566374 3300005456 Bacteria 1010
28 Ga0070681_10351086 3300005458 Bacteria 1385
29 Ga0068867_100326639 3300005459 Bacteria 1273
30 Ga0070685_10175742 3300005466 Bacteria 1375
31 Ga0070707_100346059 3300005468 Bacteria 1444
32 Ga0070698_100040552 3300005471 Bacteria 4784
33 Ga0070679_100023558 3300005530 Bacteria 6028
34 Ga0070684_100001108 3300005535 Bacteria 19295
35 Ga0070684_100142262 3300005535 Bacteria 2170
36 Ga0070684_100215444 3300005535 Bacteria 1751
37 Ga0070693_101120504 3300005547 Bacteria 601
38 Ga0070665_100054249 3300005548 Bacteria 4020
39 Ga0068855_100075111 3300005563 Bacteria 3925
40 Ga0070664_100004627 3300005564 Bacteria 11045
41 Ga0070664_100588993 3300005564 Bacteria 1031
42 Ga0068857_100004947 3300005577 Bacteria 11317
43 Ga0068857_100714378 3300005577 Bacteria 953
44 Ga0068856_100242894 3300005614 Bacteria 1816
45 Ga0068856_100505086 3300005614 Bacteria 1230
46 Ga0070702_100130092 3300005615 Bacteria 1588
47 Ga0070702_100368653 3300005615 Bacteria 1017
48 Ga0070702_100770283 3300005615 Bacteria 741
49 Ga0068864_100444581 3300005618 Bacteria 1239
50 Ga0068861_100081020 3300005719 Bacteria 2540
51 Ga0068861_100831107 3300005719 Bacteria 869
52 Ga0068851_10822908 3300005834 Bacteria 578
53 Ga0068860_100003132 3300005843 Bacteria 17086
54 Ga0068860_100079019 3300005843 Bacteria 3128
55 Ga0068860_100336775 3300005843 Bacteria 1483
56 Ga0081455_10447356 3300005937 Bacteria 883
57 Ga0075365_10001053 3300006038 Bacteria 11915
58 Ga0075365_10016862 3300006038 Bacteria 4456
59 Ga0075365_10056730 3300006038 Bacteria 2604
60 Ga0075365_10065247 3300006038 Bacteria 2440
61 Ga0075365_10079886 3300006038 Bacteria 2213
62 Ga0075365_10091451 3300006038 Bacteria 2073
63 Ga0075365_10165334 3300006038 Bacteria 1543
64 Ga0075365_10201393 3300006038 Bacteria 1394
65 Ga0075365_10206597 3300006038 Bacteria 1376
66 Ga0075365_10216294 3300006038 Bacteria 1344
67 Ga0075365_10251861 3300006038 Bacteria 1241
68 Ga0075365_10572135 3300006038 Bacteria 799
69 Ga0075365_10662550 3300006038 Bacteria 737
70 Ga0075368_10000598 3300006042 Bacteria 10877
71 Ga0075368_10065995 3300006042 Bacteria 1454
72 Ga0075363_100001214 3300006048 Bacteria 9520
73 Ga0075363_100018534 3300006048 Bacteria 3470
74 Ga0075363_100031488 3300006048 Bacteria 2750
75 Ga0075363_100069787 3300006048 Bacteria 1907
76 Ga0075363_100114643 3300006048 Bacteria 1500
77 Ga0075363_100430128 3300006048 Bacteria 778
78 Ga0075364_10009909 3300006051 Bacteria 5732
79 Ga0075364_10011285 3300006051 Bacteria 5425
80 Ga0075364_10017735 3300006051 Bacteria 4452
81 Ga0075364_10030569 3300006051 Bacteria 3457
82 Ga0075364_10048072 3300006051 Bacteria 2779
83 Ga0075364_10488843 3300006051 Bacteria 841
84 Ga0075362_10113317 3300006177 Bacteria 1278
85 Ga0075367_10000608 3300006178 Bacteria 13756
86 Ga0075367_10038743 3300006178 Bacteria 2776
87 Ga0075367_10070470 3300006178 Bacteria 2101
88 Ga0075367_10364298 3300006178 Bacteria 913
89 Ga0075369_10026488 3300006186 Bacteria 2417
90 Ga0075370_10011249 3300006353 Bacteria 4697
91 Ga0075370_10014568 3300006353 Bacteria 4197
92 Ga0075370_10045252 3300006353 Bacteria 2489
93 Ga0075370_10176589 3300006353 Bacteria 1256
94 Ga0068871_100387002 3300006358 Bacteria 1243
95 Ga0068871_100663072 3300006358 Bacteria 953
96 Ga0068871_100711155 3300006358 Bacteria 921
97 Ga0075430_100014848 3300006846 Bacteria 6631
98 Ga0075431_100002127 3300006847 Bacteria 18931
99 Ga0075429_100007096 3300006880 Bacteria 9729
100 Ga0068865_100471260 3300006881 Bacteria 1042
101 Ga0105245_10001807 3300009098 Bacteria 19486
102 Ga0105245_10278898 3300009098 Bacteria 1633
103 Ga0105245_10426779 3300009098 Bacteria 1330
104 Ga0105245_10438890 3300009098 Bacteria 1312
105 Ga0105245_10800024 3300009098 Bacteria 981
106 Ga0114129_10001254 3300009147 Bacteria 33860
107 Ga0114129_10596733 3300009147 Bacteria 1431
108 Ga0105243_10029112 3300009148 Bacteria 4246
109 Ga0105243_10154462 3300009148 Bacteria 1972
110 Ga0105241_10571689 3300009174 Bacteria 1017
111 Ga0105242_10511081 3300009176 Bacteria 1144
112 Ga0105248_10081536 3300009177 Bacteria 3636
113 Ga0105248_10596169 3300009177 Bacteria 1247
114 Ga0105237_10069088 3300009545 Bacteria 3527
115 Ga0105237_10198158 3300009545 Bacteria 2007
116 Ga0105237_10620843 3300009545 Bacteria 1088
117 Ga0105238_10268612 3300009551 Bacteria 1686
118 Ga0105238_10552465 3300009551 Bacteria 1156
119 Ga0105238_11876084 3300009551 Bacteria 632
120 Ga0105249_10137020 3300009553 Bacteria 2344
121 Ga0105249_11135266 3300009553 Bacteria 852
122 Ga0105249_12050187 3300009553 Bacteria 645
123 Ga0105249_12304143 3300009553 Bacteria 611
124 Ga0105239_10005630 3300010375 Bacteria 14640
125 Ga0105239_11798927 3300010375 Bacteria 710
126 Ga0105246_10001245 3300011119 Bacteria 14952
127 Ga0105246_10032052 3300011119 Bacteria 3482
128 Ga0105246_10176344 3300011119 Bacteria 1642
129 Ga0105246_10735004 3300011119 Bacteria 869
130 Ga0105246_10973923 3300011119 Bacteria 766
131 Ga0157371_10621654 3300013102 Bacteria 805
132 Ga0157371_10813734 3300013102 Bacteria 705
133 Ga0157370_11111624 3300013104 Bacteria 714
134 Ga0157369_10149788 3300013105 Bacteria 2466
135 Ga0157369_10579548 3300013105 Bacteria 1159
136 Ga0157369_10755343 3300013105 Bacteria 1000
137 Ga0157374_10488862 3300013296 Bacteria 1234
138 Ga0163162_10358405 3300013306 Bacteria 1591
139 Ga0163162_10498029 3300013306 Bacteria 1349
140 Ga0157372_10024501 3300013307 Bacteria 6557
141 Ga0157372_10309128 3300013307 Bacteria 1840
142 Ga0157372_10335789 3300013307 Bacteria 1760
143 Ga0157372_11780309 3300013307 Bacteria 708
144 Ga0157372_12014985 3300013307 Bacteria 663
145 Ga0157375_10013264 3300013308 Bacteria 7329
146 Ga0157375_10065777 3300013308 Bacteria 3615
147 Ga0157375_10256683 3300013308 Bacteria 1909
148 Ga0157375_10325687 3300013308 Bacteria 1701
149 Ga0157375_10433873 3300013308 Bacteria 1480
150 Ga0157375_10461188 3300013308 Bacteria 1436
151 Ga0157375_11705674 3300013308 Bacteria 746
152 Ga0157375_12210278 3300013308 Bacteria 655
153 Ga0163163_10071259 3300014325 Bacteria 3463
154 Ga0163163_10275738 3300014325 Bacteria 1733
155 Ga0157380_10124787 3300014326 Bacteria 2186
156 Ga0157380_10176902 3300014326 Bacteria 1871
157 Ga0157380_10488504 3300014326 Bacteria 1193
158 Ga0157380_11046190 3300014326 Bacteria 852
159 Ga0157377_10040675 3300014745 Bacteria 2576
160 Ga0157377_10056736 3300014745 Bacteria 2225
161 Ga0157379_10003947 3300014968 Bacteria 12646
162 Ga0157376_10369842 3300014969 Bacteria 1377
163 Ga0163161_10061377 3300017792 Bacteria 2736
164 Ga0163161_10267663 3300017792 Bacteria 1336
165 Ga0207647_10031780 3300025904 Bacteria 3396
166 Ga0207647_10065293 3300025904 Bacteria 2210
167 Ga0207647_10165010 3300025904 Bacteria 1291
168 Ga0207647_10290103 3300025904 Bacteria 933
169 Ga0207705_10036053 3300025909 Bacteria 3540
170 Ga0207705_10498806 3300025909 Bacteria 945
171 Ga0207707_10280986 3300025912 Bacteria 1442
172 Ga0207671_10369553 3300025914 Bacteria 1139
173 Ga0207662_10090826 3300025918 Bacteria 1878
174 Ga0207657_10029498 3300025919 Bacteria 4992
175 Ga0207657_10248773 3300025919 Bacteria 1418
176 Ga0207652_10143256 3300025921 Bacteria 2138
177 Ga0207646_10179992 3300025922 Bacteria 1909
178 Ga0207694_10384002 3300025924 Bacteria 1166
179 Ga0207694_10465906 3300025924 Bacteria 1056
180 Ga0207694_11121655 3300025924 Bacteria 666
181 Ga0207687_10002467 3300025927 Bacteria 12554
182 Ga0207706_10007918 3300025933 Bacteria 9808
183 Ga0207709_10096143 3300025935 Bacteria 1948
184 Ga0207669_10195020 3300025937 Bacteria 1465
185 Ga0207704_10297836 3300025938 Bacteria 1234
186 Ga0207711_10165050 3300025941 Bacteria 2007
187 Ga0207661_10018219 3300025944 Bacteria 5215
188 Ga0207661_10036340 3300025944 Bacteria 3844
189 Ga0207661_10104609 3300025944 Bacteria 2384
190 Ga0207661_10520855 3300025944 Bacteria 1088
191 Ga0207661_10673917 3300025944 Bacteria 951
192 Ga0207679_10037776 3300025945 Bacteria 3436
193 Ga0207667_10326500 3300025949 Bacteria 1567
194 Ga0207712_10216045 3300025961 Bacteria 1530
195 Ga0207640_10750252 3300025981 Bacteria 841
196 Ga0207677_10044648 3300026023 Bacteria 2954
197 Ga0207678_10135084 3300026067 Bacteria 2105
198 Ga0207678_10216118 3300026067 Bacteria 1640
199 Ga0207678_10282138 3300026067 Bacteria 1426
200 Ga0207708_10065834 3300026075 Bacteria 2770
201 Ga0207708_10195101 3300026075 Bacteria 1613
202 Ga0207708_11029894 3300026075 Bacteria 716
203 Ga0207702_10270608 3300026078 Bacteria 1602
204 Ga0207702_10332591 3300026078 Bacteria 1449
205 Ga0207702_11235114 3300026078 Bacteria 741
206 Ga0207641_10958735 3300026088 Bacteria 851
207 Ga0207648_10181699 3300026089 Bacteria 1862
208 Ga0207676_10112084 3300026095 Bacteria 2285
209 Ga0207674_10199363 3300026116 Bacteria 1951
210 Ga0207674_10350159 3300026116 Bacteria 1428
211 Ga0207674_10698227 3300026116 Bacteria 979
212 Ga0207675_100026182 3300026118 Bacteria 5430
213 Ga0207675_100382141 3300026118 Bacteria 1385
214 Ga0207675_100620868 3300026118 Bacteria 1085
215 Ga0207683_10171755 3300026121 Bacteria 1963
216 Ga0207683_10483857 3300026121 Bacteria 1142
217 Ga0207683_11027733 3300026121 Bacteria 765
218 Ga0207683_11369540 3300026121 Bacteria 654
219 Ga0207698_10479094 3300026142 Bacteria 1207
220 Ga0209813_10001356 3300027866 Bacteria 5490
221 Ga0209813_10006987 3300027866 Bacteria 2801
222 Ga0268266_10010593 3300028379 Bacteria 8037
223 Ga0268266_10151014 3300028379 Bacteria 2094
224 Ga0268266_11293917 3300028379 Bacteria 704
225 Ga0268264_10000398 3300028381 Bacteria 62200
226 Ga0268264_10518762 3300028381 Bacteria 1165
227 Ga0268264_10800600 3300028381 Bacteria 941
228 Ga0316181_1251168 3300030744 Bacteria 1098
229 Ga0307408_100320049 3300031548 Bacteria 1306
230 Ga0316575_10105336 3300031665 Bacteria 1148
231 Ga0316579_10014233 3300031691 Bacteria 3435
232 Ga0316576_10130764 3300031727 Bacteria 1888
233 Ga0316576_10357257 3300031727 Bacteria 1086
234 Ga0316578_10105770 3300031728 Bacteria 1688
235 Ga0307405_10113580 3300031731 Bacteria 1839
236 Ga0307405_10548310 3300031731 Bacteria 935
237 Ga0307405_10672305 3300031731 Bacteria 854
238 Ga0307405_11359273 3300031731 Bacteria 620
239 Ga0316577_10016474 3300031733 Bacteria 4074
240 Ga0316577_10024535 3300031733 Bacteria 3353
241 Ga0307413_10093952 3300031824 Bacteria 1962
242 Ga0307413_10263596 3300031824 Bacteria 1286
243 Ga0307413_10430278 3300031824 Bacteria 1042
244 Ga0307413_10883783 3300031824 Bacteria 758
245 Ga0307410_10036603 3300031852 Bacteria 3197
246 Ga0307410_10235762 3300031852 Bacteria 1415
247 Ga0307410_11178267 3300031852 Bacteria 667
248 Ga0307406_10066078 3300031901 Bacteria 2353
249 Ga0307406_10608867 3300031901 Bacteria 902
250 Ga0307407_10012953 3300031903 Bacteria 4029
251 Ga0307407_10068424 3300031903 Bacteria 2103
252 Ga0307407_10101605 3300031903 Bacteria 1786
253 Ga0307412_10064984 3300031911 Bacteria 2467
254 Ga0307409_100043250 3300031995 Bacteria 3380
255 Ga0307409_100062937 3300031995 Bacteria 2907
256 Ga0307409_100148687 3300031995 Bacteria 2030
257 Ga0307409_100158501 3300031995 Bacteria 1976
258 Ga0307409_100184217 3300031995 Bacteria 1851
259 Ga0307409_100275821 3300031995 Bacteria 1551
260 Ga0307409_100283233 3300031995 Bacteria 1533
261 Ga0307409_100360062 3300031995 Bacteria 1376
262 Ga0307409_100504345 3300031995 Bacteria 1179
263 Ga0307409_101241167 3300031995 Bacteria 769
264 Ga0307416_100096579 3300032002 Bacteria 2556
265 Ga0307416_100155082 3300032002 Bacteria 2107
266 Ga0307416_100188290 3300032002 Bacteria 1943
267 Ga0307416_100218906 3300032002 Bacteria 1824
268 Ga0307416_101026068 3300032002 Bacteria 928
269 Ga0307416_101631372 3300032002 Bacteria 750
270 Ga0307416_101712266 3300032002 Bacteria 733
271 Ga0307415_100010168 3300032126 Bacteria 5315
272 Ga0307415_100040277 3300032126 Bacteria 3094
273 Ga0307415_100655723 3300032126 Bacteria 941
274 Ga0307415_100703766 3300032126 Bacteria 912
275 Ga0307415_100717328 3300032126 Bacteria 904
276 Ga0307415_100718213 3300032126 Bacteria 904
277 Ga0307415_100929910 3300032126 Bacteria 803
278 Ga0307415_101085820 3300032126 Bacteria 748
279 Ga0316583_10126828 3300032133 Bacteria 889
280 Ga0316585_10002307 3300032137 Bacteria 5131
281 Ga0316585_10018429 3300032137 Bacteria 2119
282 Ga0316580_10001614 3300032139 Bacteria 5959
283 Ga0316580_10107753 3300032139 Bacteria 853
284 Ga0316580_10152177 3300032139 Bacteria 710
285 Ga0316574_0000685 3300035398 Bacteria 14374
286 Ga0316574_0007039 3300035398 Bacteria 6131
287 Ga0316574_0197884 3300035398 Bacteria 1291
288 Ga0373931_0226085 3300035691 Bacteria 1129
289 Ga0316582_0014902 3300036647 Bacteria 4428
290 Ga0316582_0020349 3300036647 Bacteria 3900
291 Ga0316582_0406495 3300036647 Bacteria 938
292 Ga0316584_0613157 3300036712 Bacteria 753
293 Ga0316584_0751011 3300036712 Bacteria 665
294 Ga0395899_0715894 3300037312 Bacteria 626
295 Ga0395900_0297172 3300037418 Bacteria 1602
296 Ga0395900_0576101 3300037418 Bacteria 1068
297 Ga0395898_0012889 3300037466 Bacteria 8625
298 Ga0395898_0019780 3300037466 Bacteria 6847
299 Ga0395898_0748457 3300037466 Bacteria 919
300 Ga0395905_0040662 3300037471 Bacteria 4362
301 Ga0395905_0108832 3300037471 Bacteria 2602
302 Ga0395905_0163348 3300037471 Bacteria 2093
303 Ga0395901_0005504 3300038443 Bacteria 12828
304 Ga0395901_0045589 3300038443 Bacteria 4551
305 Ga0395901_0072356 3300038443 Bacteria 3594
306 Ga0395901_0189266 3300038443 Bacteria 2158
307 Ga0395901_0769247 3300038443 Bacteria 954
308 Ga0395901_1328514 3300038443 Bacteria 680
309 Ga0242420_008798 3300038996 Bacteria 1646
310 Ga0451789_0111182 3300041443 Bacteria 729
311 Ga0451791_0693704 3300041451 Bacteria 2239
312 Ga0451793_1811604 3300041452 Bacteria 751
313 Ga0451797_0081001 3300041453 Bacteria 796
314 Ga0451797_0645667 3300041453 Bacteria 737
315 Ga0451797_0697299 3300041453 Bacteria 629
316 Ga0451802_1723936 3300041460 Bacteria 665
317 Ga0451837_0953581 3300041494 Bacteria 2074
318 Ga0451841_0766488 3300041498 Bacteria 847
319 Ga0451843_1466042 3300041509 Bacteria 647
320 Ga0451853_0059182 3300041512 Bacteria 1137
321 Ga0451853_0859806 3300041512 Bacteria 1266
322 Ga0451853_1677545 3300041512 Bacteria 555
323 Ga0451853_2103927 3300041512 Bacteria 586
324 Ga0439431_0116775 3300041997 Bacteria 742
325 Ga0439442_075498 3300042002 Bacteria 719
326 Ga0439448_0117894 3300042005 Bacteria 910
327 Ga0439449_0246235 3300042007 Bacteria 672
328 Ga0439455_0066527 3300042012 Bacteria 963
329 Ga0439456_132211 3300042013 Bacteria 576
330 Ga0450907_003864 3300042146 Bacteria 2622
331 Ga0450908_087533 3300042184 Bacteria 563
332 Ga0450909_030318 3300042185 Bacteria 820
333 Ga0466972_0033078 3300044658 Bacteria 2537
334 Ga0466972_0063815 3300044658 Bacteria 1764
335 Ga0466972_0079898 3300044658 Bacteria 1557
336 Ga0466972_0179501 3300044658 Bacteria 993
337 Ga0466965_0015971 3300044683 Bacteria 3568
338 Ga0466965_0018899 3300044683 Bacteria 3307
339 Ga0466965_0021836 3300044683 Bacteria 3084
340 Ga0466965_0038113 3300044683 Bacteria 2361
341 Ga0466965_0046527 3300044683 Bacteria 2148
342 Ga0466965_0179130 3300044683 Bacteria 1118
343 Ga0466966_0281415 3300044684 Bacteria 1000
344 Ga0466961_0060998 3300044693 Bacteria 2397
345 Ga0466963_0040574 3300044694 Bacteria 3051
346 Ga0466963_0102050 3300044694 Bacteria 1964
347 Ga0466963_0341728 3300044694 Bacteria 1054
348 Ga0466964_0029085 3300044706 Bacteria 2180
349 Ga0466964_0136106 3300044706 Bacteria 1124
350 Ga0466971_0006701 3300044719 Bacteria 5011
351 Ga0466970_0018613 3300044765 Bacteria 3598
352 Ga0466970_0032993 3300044765 Bacteria 2736
353 Ga0466970_0039627 3300044765 Bacteria 2500
354 Ga0466970_0041233 3300044765 Bacteria 2452
355 Ga0466970_0174602 3300044765 Bacteria 1191
356 Ga0466970_0238119 3300044765 Bacteria 1018
357 Ga0466957_0039733 3300044842 Bacteria 2839
358 Ga0466957_0071561 3300044842 Bacteria 2145
359 Ga0466960_0000595 3300044901 Bacteria 12508
360 Ga0466960_0020178 3300044901 Bacteria 2948
361 Ga0466960_0035751 3300044901 Bacteria 2323
362 Ga0466960_0217803 3300044901 Bacteria 1049
363 Ga0466960_0270559 3300044901 Bacteria 949
364 Ga0466960_0548296 3300044901 Bacteria 682
365 Ga0451576_0072659 3300045051 Bacteria 3580
366 Ga0466958_0022574 3300045836 Bacteria 3688
367 Ga0466958_0548176 3300045836 Bacteria 751
368 Ga0466967_0022196 3300045976 Bacteria 5173
369 Ga0466967_0031073 3300045976 Bacteria 4491
370 Ga0466967_0037164 3300045976 Bacteria 4164
371 Ga0466967_0135295 3300045976 Bacteria 2291
372 Ga0466967_0170033 3300045976 Bacteria 2050
373 Ga0466967_0257059 3300045976 Bacteria 1670
374 Ga0466967_0288858 3300045976 Bacteria 1575
375 Ga0466967_0420909 3300045976 Bacteria 1302
376 Ga0466967_0670740 3300045976 Bacteria 1026
377 Ga0466967_0789488 3300045976 Bacteria 943
378 Ga0466967_0865592 3300045976 Bacteria 898
379 Ga0466967_1025463 3300045976 Bacteria 822
380 Ga0495603_0665611 3300046455 Bacteria 596
381 Ga0495641_0019455 3300046461 Bacteria 3472
382 Ga0495641_0106804 3300046461 Bacteria 1249
383 Ga0495641_0146259 3300046461 Bacteria 1056
384 Ga0495582_0048647 3300046473 Bacteria 2335
385 Ga0495582_0096208 3300046473 Bacteria 1655
386 Ga0495582_0138767 3300046473 Bacteria 1377
387 Ga0495662_0197640 3300046476 Bacteria 991
388 Ga0495620_0084920 3300046515 Bacteria 1276
389 Ga0495630_0445153 3300046517 Bacteria 993
390 Ga0495656_0136577 3300046615 Bacteria 1172
391 Ga0495635_0280463 3300046663 Bacteria 1119
392 Ga0495657_0205584 3300046675 Bacteria 1198
393 Ga0495658_0081195 3300046683 Bacteria 1903
394 Ga0495658_0129947 3300046683 Bacteria 1532
395 Ga0495600_0341862 3300046809 Bacteria 938
396 Ga0495581_0133647 3300047315 Bacteria 1446
397 Ga0495674_0263920 3300047319 Bacteria 1414
398 Ga0495680_0215954 3300047322 Bacteria 1371
399 Ga0495614_0174650 3300048089 Bacteria 965
400 Ga0496100_0004983 3300048903 Bacteria 7102
401 Ga0496100_0154288 3300048903 Bacteria 1641
402 Ga0496100_0225290 3300048903 Bacteria 1377
403 Ga0496100_0235700 3300048903 Bacteria 1348
404 Ga0496100_0447546 3300048903 Bacteria 990
405 Ga0496100_0953906 3300048903 Bacteria 674
406 Ga0496101_0001835 3300048904 Bacteria 12807
407 Ga0496101_0017375 3300048904 Bacteria 4881
408 Ga0496101_0021273 3300048904 Bacteria 4456
409 Ga0496101_0029165 3300048904 Bacteria 3859
410 Ga0496101_0183937 3300048904 Bacteria 1610
411 Ga0496101_0347912 3300048904 Bacteria 1165
412 Ga0496101_0681487 3300048904 Bacteria 812
413 Ga0496102_0020751 3300048905 Bacteria 5805
414 Ga0496102_0046777 3300048905 Bacteria 3930
415 Ga0496102_0047814 3300048905 Bacteria 3889
416 Ga0496102_0052728 3300048905 Bacteria 3707
417 Ga0496102_0095121 3300048905 Bacteria 2761
418 Ga0496102_0105315 3300048905 Bacteria 2624
419 Ga0496102_0121320 3300048905 Bacteria 2441
420 Ga0496102_0169525 3300048905 Bacteria 2055
421 Ga0496102_0285888 3300048905 Bacteria 1554
422 Ga0496102_0436692 3300048905 Bacteria 1229
423 Ga0496102_0798411 3300048905 Bacteria 866
424 Ga0496102_1137312 3300048905 Bacteria 700
425 Ga0496103_0029722 3300048906 Bacteria 3322
426 Ga0496103_0048239 3300048906 Bacteria 2631
427 Ga0496103_0142682 3300048906 Bacteria 1532
428 Ga0496103_0148842 3300048906 Bacteria 1499
429 Ga0496103_0444941 3300048906 Bacteria 831
430 Ga0496103_0565318 3300048906 Bacteria 726
431 Ga0496103_0666596 3300048906 Bacteria 660
432 Ga0496104_0008446 3300048907 Bacteria 9156
433 Ga0496104_0091502 3300048907 Bacteria 2908
434 Ga0496104_0115745 3300048907 Bacteria 2572
435 Ga0496104_0225073 3300048907 Bacteria 1788
436 Ga0496104_1194052 3300048907 Bacteria 664
437 Ga0496105_0013182 3300048908 Bacteria 6557
438 Ga0496105_0076286 3300048908 Bacteria 2768
439 Ga0496105_0133728 3300048908 Bacteria 2043
440 Ga0496105_0607383 3300048908 Bacteria 848
441 Ga0496106_0025429 3300048909 Bacteria 4406
442 Ga0496106_0127573 3300048909 Bacteria 1993
443 Ga0496107_0020990 3300048910 Bacteria 4616
444 Ga0496107_0021057 3300048910 Bacteria 4608
445 Ga0496107_0033467 3300048910 Bacteria 3677
446 Ga0496107_0118072 3300048910 Bacteria 1953
447 Ga0496107_0351691 3300048910 Bacteria 1097
448 Ga0496107_0414583 3300048910 Bacteria 1001
449 Ga0496108_0003872 3300048911 Bacteria 12019
450 Ga0496108_0028338 3300048911 Bacteria 4634
451 Ga0496108_0250125 3300048911 Bacteria 1542
452 Ga0496108_0267480 3300048911 Bacteria 1488
453 Ga0496108_0281990 3300048911 Bacteria 1446
454 Ga0496108_0305100 3300048911 Bacteria 1387
455 Ga0496108_0319742 3300048911 Bacteria 1353
456 Ga0496109_0012972 3300048912 Bacteria 7203
457 Ga0496109_0013365 3300048912 Bacteria 7118
458 Ga0496109_0051438 3300048912 Bacteria 3752
459 Ga0496109_0213880 3300048912 Bacteria 1813
460 Ga0496109_0324366 3300048912 Bacteria 1453
461 Ga0496109_0354665 3300048912 Bacteria 1386
462 Ga0496109_0385054 3300048912 Bacteria 1325
463 Ga0496109_0769962 3300048912 Bacteria 900
464 Ga0496109_0851906 3300048912 Bacteria 849
465 Ga0496109_1325990 3300048912 Bacteria 656
466 Ga0496109_1392791 3300048912 Bacteria 637
467 Ga0496110_0011968 3300048913 Bacteria 7125
468 Ga0496110_0065610 3300048913 Bacteria 3210
469 Ga0496110_0198814 3300048913 Bacteria 1821
470 Ga0496110_0286152 3300048913 Bacteria 1501
471 Ga0496110_0289664 3300048913 Bacteria 1491
472 Ga0496110_0787089 3300048913 Bacteria 855
473 Ga0496111_0018902 3300048914 Bacteria 4778
474 Ga0496111_0025918 3300048914 Bacteria 4137
475 Ga0496111_0076582 3300048914 Bacteria 2438
476 Ga0496111_0207792 3300048914 Bacteria 1455
477 Ga0496111_0312555 3300048914 Bacteria 1164
478 Ga0496112_0324735 3300048915 Bacteria 1483
479 Ga0496112_0373813 3300048915 Bacteria 1367
480 Ga0496112_0431974 3300048915 Bacteria 1255
481 Ga0496112_0567503 3300048915 Bacteria 1068
482 Ga0496112_0936896 3300048915 Bacteria 787
483 Ga0496112_1250054 3300048915 Bacteria 659
484 Ga0496113_0044495 3300048916 Bacteria 3289
485 Ga0496113_0063428 3300048916 Bacteria 2792
486 Ga0496113_0252195 3300048916 Bacteria 1409
487 Ga0496113_0415140 3300048916 Bacteria 1081
488 Ga0496113_0548032 3300048916 Bacteria 928
489 Ga0496113_0943820 3300048916 Bacteria 681
490 Ga0496113_1400915 3300048916 Bacteria 541
491 Ga0496114_0007055 3300048917 Bacteria 8866
492 Ga0496114_0016659 3300048917 Bacteria 5927
493 Ga0496114_0017256 3300048917 Bacteria 5824
494 Ga0496114_0026676 3300048917 Bacteria 4731
495 Ga0496114_0042662 3300048917 Bacteria 3760
496 Ga0496114_0108430 3300048917 Bacteria 2377
497 Ga0496114_0118083 3300048917 Bacteria 2279
498 Ga0496114_0127551 3300048917 Bacteria 2194
499 Ga0496115_0029062 3300048918 Bacteria 4338
500 Ga0496115_0165938 3300048918 Bacteria 1826
501 Ga0496118_0196984 3300048921 Bacteria 1198
502 Ga0496119_0069522 3300048922 Bacteria 2069
503 Ga0496124_0177899 3300048927 Bacteria 1640
504 Ga0501291_038342 3300049514 Bacteria 834
505 Ga0501031_0001904 3300049568 Bacteria 13145
506 Ga0501031_0014439 3300049568 Bacteria 5133
507 Ga0501031_0026258 3300049568 Bacteria 3797
508 Ga0501031_0094821 3300049568 Bacteria 1947
509 Ga0501031_0153042 3300049568 Bacteria 1507
510 Ga0501031_0226356 3300049568 Bacteria 1217
511 Ga0501031_0313235 3300049568 Bacteria 1017
512 Ga0501031_0625446 3300049568 Bacteria 692
513 Ga0501032_0023177 3300049569 Bacteria 4295
514 Ga0501032_0031832 3300049569 Bacteria 3616
515 Ga0501032_0095711 3300049569 Bacteria 1968
516 Ga0501032_0126774 3300049569 Bacteria 1686
517 Ga0501032_0142041 3300049569 Bacteria 1581
518 Ga0501032_0207762 3300049569 Bacteria 1277
519 Ga0501032_0260792 3300049569 Bacteria 1124
520 Ga0501033_0113851 3300049570 Bacteria 1967
521 Ga0501033_0237926 3300049570 Bacteria 1292
522 Ga0501033_0332360 3300049570 Bacteria 1066
523 Ga0501034_0005404 3300049571 Bacteria 13968
524 Ga0501034_0040986 3300049571 Bacteria 4685
525 Ga0501034_0105687 3300049571 Bacteria 2808
526 Ga0501034_0179915 3300049571 Bacteria 2080
527 Ga0501034_0227792 3300049571 Bacteria 1814
528 Ga0501034_0380273 3300049571 Bacteria 1337
529 Ga0501034_0759099 3300049571 Bacteria 865
530 Ga0501034_0859779 3300049571 Bacteria 797
531 Ga0501036_0004164 3300049572 Bacteria 11645
532 Ga0501036_0007791 3300049572 Bacteria 8759
533 Ga0501036_0044452 3300049572 Bacteria 3762
534 Ga0501036_0138821 3300049572 Bacteria 2051
535 Ga0501036_0185659 3300049572 Bacteria 1750
536 Ga0501036_0258382 3300049572 Bacteria 1459
537 Ga0501036_0293228 3300049572 Bacteria 1361
538 Ga0501036_0435772 3300049572 Bacteria 1092
539 Ga0501036_0949127 3300049572 Bacteria 705
540 Ga0501037_0007065 3300049573 Bacteria 8203
541 Ga0501037_0023238 3300049573 Bacteria 4585
542 Ga0501037_0056310 3300049573 Bacteria 2872
543 Ga0501037_0193576 3300049573 Bacteria 1439
544 Ga0501037_0313772 3300049573 Bacteria 1087
545 Ga0501037_0419179 3300049573 Bacteria 916
546 Ga0501037_0573612 3300049573 Bacteria 760
547 Ga0501038_0003261 3300049574 Bacteria 15140
548 Ga0501038_0006206 3300049574 Bacteria 11056
549 Ga0501038_0100777 3300049574 Bacteria 2405
550 Ga0501038_0130725 3300049574 Bacteria 2062
551 Ga0501038_0266258 3300049574 Bacteria 1353
552 Ga0501039_0017929 3300049575 Bacteria 5430
553 Ga0501039_0062670 3300049575 Bacteria 2881
554 Ga0501039_0065694 3300049575 Bacteria 2815
555 Ga0501039_0078520 3300049575 Bacteria 2568
556 Ga0501039_0290424 3300049575 Bacteria 1285
557 Ga0501039_0338948 3300049575 Bacteria 1182
558 Ga0501039_0620222 3300049575 Bacteria 847
559 Ga0501039_0711541 3300049575 Bacteria 785
560 Ga0501039_1111428 3300049575 Bacteria 612
561 Ga0501040_0006842 3300049576 Bacteria 7390
562 Ga0501040_0018929 3300049576 Bacteria 4576
563 Ga0501040_0449790 3300049576 Bacteria 927
564 Ga0501040_0653950 3300049576 Bacteria 760
565 Ga0501040_1051930 3300049576 Bacteria 590
566 Ga0501041_0003749 3300049577 Bacteria 8744
567 Ga0501041_0125081 3300049577 Bacteria 1600
568 Ga0501041_0137528 3300049577 Bacteria 1523
569 Ga0501041_0332191 3300049577 Bacteria 959
570 Ga0501041_0461532 3300049577 Bacteria 807
571 Ga0501042_0016345 3300049578 Bacteria 5092
572 Ga0501042_0059908 3300049578 Bacteria 2719
573 Ga0501042_0088299 3300049578 Bacteria 2224
574 Ga0501042_0131373 3300049578 Bacteria 1805
575 Ga0501042_0158519 3300049578 Bacteria 1633
576 Ga0501042_0502106 3300049578 Bacteria 881
577 Ga0501042_0714272 3300049578 Bacteria 729
578 Ga0501043_0024936 3300049579 Bacteria 4692
579 Ga0501043_0067863 3300049579 Bacteria 2800
580 Ga0501043_0128243 3300049579 Bacteria 1989
581 Ga0501043_0191731 3300049579 Bacteria 1589
582 Ga0501043_0590545 3300049579 Bacteria 821
583 Ga0501043_0622689 3300049579 Bacteria 795
584 Ga0501043_0727302 3300049579 Bacteria 723
585 Ga0501046_0006288 3300049580 Bacteria 10528
586 Ga0501046_0012443 3300049580 Bacteria 7244
587 Ga0501046_0164983 3300049580 Bacteria 1664
588 Ga0501046_0200407 3300049580 Bacteria 1485
589 Ga0501047_0015588 3300049581 Bacteria 7241
590 Ga0501047_0023385 3300049581 Bacteria 5933
591 Ga0501047_0125216 3300049581 Bacteria 2450
592 Ga0501047_0744334 3300049581 Bacteria 796
593 Ga0501047_0843753 3300049581 Bacteria 730
594 Ga0501048_0004142 3300049582 Bacteria 11054
595 Ga0501048_0004795 3300049582 Bacteria 10306
596 Ga0501048_0005842 3300049582 Bacteria 9362
597 Ga0501048_0055092 3300049582 Bacteria 2824
598 Ga0501048_0229782 3300049582 Bacteria 1316
599 Ga0501048_0237416 3300049582 Bacteria 1293
600 Ga0501048_0294935 3300049582 Bacteria 1153
601 Ga0501048_0492925 3300049582 Bacteria 878
602 Ga0501067_0000658 3300049583 Bacteria 18523
603 Ga0501067_0008791 3300049583 Bacteria 5597
604 Ga0501067_0044364 3300049583 Bacteria 2470
605 Ga0501067_0084598 3300049583 Bacteria 1759
606 Ga0501067_0099818 3300049583 Bacteria 1612
607 Ga0501068_0003031 3300049584 Bacteria 8966
608 Ga0501068_0007715 3300049584 Bacteria 5953
609 Ga0501068_0039773 3300049584 Bacteria 2821
610 Ga0501068_0135045 3300049584 Bacteria 1544
611 Ga0501068_0388813 3300049584 Bacteria 899
612 Ga0501068_0405806 3300049584 Bacteria 879
613 Ga0501068_0449690 3300049584 Bacteria 833
614 Ga0501068_0631238 3300049584 Bacteria 699
615 Ga0501069_0015893 3300049585 Bacteria 4035
616 Ga0501069_0017400 3300049585 Bacteria 3867
617 Ga0501069_0032903 3300049585 Bacteria 2854
618 Ga0501069_0084888 3300049585 Bacteria 1786
619 Ga0501069_0175206 3300049585 Bacteria 1239
620 Ga0501069_0294824 3300049585 Bacteria 950
621 Ga0501070_0002949 3300049586 Bacteria 14813
622 Ga0501070_0024136 3300049586 Bacteria 5099
623 Ga0501070_0024860 3300049586 Bacteria 5022
624 Ga0501070_0184660 3300049586 Bacteria 1715
625 Ga0501070_0278625 3300049586 Bacteria 1365
626 Ga0501070_0399136 3300049586 Bacteria 1112
627 Ga0501070_0419803 3300049586 Bacteria 1080
628 Ga0501071_0007851 3300049587 Bacteria 7037
629 Ga0501071_0019218 3300049587 Bacteria 4740
630 Ga0501071_0062635 3300049587 Bacteria 2695
631 Ga0501071_0156691 3300049587 Bacteria 1701
632 Ga0501071_0199647 3300049587 Bacteria 1502
633 Ga0501071_0215569 3300049587 Bacteria 1444
634 Ga0501071_0253314 3300049587 Bacteria 1329
635 Ga0501071_0341021 3300049587 Bacteria 1139
636 Ga0501071_0779223 3300049587 Bacteria 737
637 Ga0501071_1055365 3300049587 Bacteria 628
638 Ga0501072_0009499 3300049588 Bacteria 7395
639 Ga0501072_0011419 3300049588 Bacteria 6790
640 Ga0501072_0022421 3300049588 Bacteria 4899
641 Ga0501072_0035711 3300049588 Bacteria 3895
642 Ga0501072_0051538 3300049588 Bacteria 3240
643 Ga0501072_0127568 3300049588 Bacteria 2027
644 Ga0501072_0265495 3300049588 Bacteria 1366
645 Ga0501072_0804692 3300049588 Bacteria 736
646 Ga0501073_0028602 3300049589 Bacteria 3983
647 Ga0501073_0087153 3300049589 Bacteria 2171
648 Ga0501073_0159078 3300049589 Bacteria 1565
649 Ga0501073_0212879 3300049589 Bacteria 1335
650 Ga0501074_0003560 3300049590 Bacteria 11042
651 Ga0501074_0004188 3300049590 Bacteria 10306
652 Ga0501074_0031905 3300049590 Bacteria 3818
653 Ga0501074_0061415 3300049590 Bacteria 2707
654 Ga0501074_0091504 3300049590 Bacteria 2179
655 Ga0501074_0179515 3300049590 Bacteria 1510
656 Ga0501074_0358146 3300049590 Bacteria 1035
657 Ga0501074_1001762 3300049590 Bacteria 587
658 Ga0501075_0010552 3300049591 Bacteria 6493
659 Ga0501075_0156256 3300049591 Bacteria 1739
660 Ga0501075_0442113 3300049591 Bacteria 992
661 Ga0501075_0476132 3300049591 Bacteria 952
662 Ga0501075_1135259 3300049591 Bacteria 593
663 Ga0501076_0003377 3300049592 Bacteria 11208
664 Ga0501076_0035561 3300049592 Bacteria 3897
665 Ga0501076_0204067 3300049592 Bacteria 1615
666 Ga0501076_0267054 3300049592 Bacteria 1401
667 Ga0501076_0330008 3300049592 Bacteria 1251
668 Ga0501076_0330101 3300049592 Bacteria 1251
669 Ga0501076_0354606 3300049592 Bacteria 1205
670 Ga0501076_1396219 3300049592 Bacteria 575
671 Ga0501077_0002635 3300049593 Bacteria 10745
672 Ga0501077_0007377 3300049593 Bacteria 6778
673 Ga0501077_0014735 3300049593 Bacteria 4911
674 Ga0501253_076096 3300049683 Bacteria 750
675 Ga0501079_0002786 3300049741 Bacteria 12749
676 Ga0501079_0072307 3300049741 Bacteria 2665
677 Ga0501079_0104652 3300049741 Bacteria 2196
678 Ga0501079_0304726 3300049741 Bacteria 1246
679 Ga0501079_0371622 3300049741 Bacteria 1121
680 Ga0501079_0598862 3300049741 Bacteria 867
681 Ga0501080_0003619 3300049742 Bacteria 13616
682 Ga0501080_0017507 3300049742 Bacteria 6626
683 Ga0501080_0026316 3300049742 Bacteria 5406
684 Ga0501080_0140976 3300049742 Bacteria 2229
685 Ga0501080_0159826 3300049742 Bacteria 2081
686 Ga0501080_0244598 3300049742 Bacteria 1637
687 Ga0501080_0429664 3300049742 Bacteria 1186
688 Ga0501080_0621982 3300049742 Bacteria 957
689 Ga0501081_0001282 3300049743 Bacteria 15279
690 Ga0501081_0164791 3300049743 Bacteria 1598
691 Ga0501081_0396591 3300049743 Bacteria 1021
692 Ga0501081_0820899 3300049743 Bacteria 700
693 Ga0501083_0010051 3300049744 Bacteria 6675
694 Ga0501083_0011451 3300049744 Bacteria 6221
695 Ga0501083_0077047 3300049744 Bacteria 2213
696 Ga0501083_0078750 3300049744 Bacteria 2186
697 Ga0501035_0001864 3300049822 Bacteria 21244
698 Ga0501035_0030544 3300049822 Bacteria 4910
699 Ga0501035_0093661 3300049822 Bacteria 2643
700 Ga0501035_0118725 3300049822 Bacteria 2313
701 Ga0501035_0126067 3300049822 Bacteria 2235
702 Ga0501044_0015928 3300049823 Bacteria 8090
703 Ga0501044_0044025 3300049823 Bacteria 4635
704 Ga0501044_0111975 3300049823 Bacteria 2736
705 Ga0501044_0205756 3300049823 Bacteria 1925
706 Ga0501044_0828702 3300049823 Bacteria 803
707 Ga0501045_0006430 3300049824 Bacteria 8138
708 Ga0501045_0017260 3300049824 Bacteria 5123
709 Ga0501045_0021062 3300049824 Bacteria 4661
710 Ga0501045_0024085 3300049824 Bacteria 4369
711 Ga0501045_0164254 3300049824 Bacteria 1653
712 Ga0501045_0207695 3300049824 Bacteria 1459
713 Ga0501045_0363965 3300049824 Bacteria 1076
714 Ga0501045_0517659 3300049824 Bacteria 886
715 Ga0501045_0619608 3300049824 Bacteria 801
716 nmdc:mga03683_306024_c1 3300050489 Bacteria 746
717 nmdc:mga03683_479787_c1 3300050489 Bacteria 600
718 nmdc:mga03683_71640_c1 3300050489 Bacteria 1483
719 nmdc:mga03n38_101737_c1 3300050490 Bacteria 1386
720 nmdc:mga03n38_203549_c1 3300050490 Bacteria 1026
721 nmdc:mga03n38_41461_c1 3300050490 Bacteria 2007
722 nmdc:mga03n38_4664_c1 3300050490 Bacteria 4572
723 nmdc:mga03n38_77331_c1 3300050490 Bacteria 1555
724 nmdc:mga00v17_136068_c2 3300050491 Bacteria 1121
725 nmdc:mga00v17_161054_c1 3300050491 Bacteria 1445
726 nmdc:mga00v17_17561_c1 3300050491 Bacteria 4052
727 nmdc:mga00v17_240215_c1 3300050491 Bacteria 1174
728 nmdc:mga00v17_31651_c1 3300050491 Bacteria 3121
729 nmdc:mga00v17_368842_c1 3300050491 Bacteria 933
730 nmdc:mga00v17_37251_c1 3300050491 Bacteria 2903
731 nmdc:mga00v17_40869_c1 3300050491 Bacteria 2783
732 nmdc:mga00v17_754927_c1 3300050491 Bacteria 622
733 nmdc:mga0yw44_130473_c1 3300050492 Bacteria 1627
734 nmdc:mga0yw44_130571_c1 3300050492 Bacteria 1626
735 nmdc:mga0yw44_134603_c1 3300050492 Bacteria 1602
736 nmdc:mga0yw44_205243_c1 3300050492 Bacteria 1302
737 nmdc:mga0yw44_205679_c1 3300050492 Bacteria 1301
738 nmdc:mga0yw44_212756_c2 3300050492 Bacteria 818
739 nmdc:mga0yw44_28583_c1 3300050492 Bacteria 3209
740 nmdc:mga0yw44_30519_c1 3300050492 Bacteria 3125
741 nmdc:mga0yw44_371574_c1 3300050492 Bacteria 965
742 nmdc:mga0yw44_407292_c1 3300050492 Bacteria 920
743 nmdc:mga0yw44_422755_c1 3300050492 Bacteria 902
744 nmdc:mga0yw44_42585_c1 3300050492 Bacteria 2708
745 nmdc:mga0yw44_5038_c1 3300050492 Bacteria 6174
746 nmdc:mga0yw44_54010_c1 3300050492 Bacteria 2440
747 nmdc:mga0yw44_63670_c1 3300050492 Bacteria 2268
748 nmdc:mga06z11_127368_c1 3300050494 Bacteria 1426
749 nmdc:mga06z11_4075_c1 3300050494 Bacteria 5713
750 nmdc:mga04h51_123576_c1 3300050495 Bacteria 967
751 nmdc:mga07m45_170035_c1 3300050496 Bacteria 1267
752 nmdc:mga07m45_196673_c1 3300050496 Bacteria 1172
753 nmdc:mga07m45_20080_c1 3300050496 Bacteria 3626
754 nmdc:mga07m45_58325_c1 3300050496 Bacteria 2184
755 nmdc:mga07m45_709_c2 3300050496 Bacteria 11165
756 nmdc:mga05p37_1111677_c1 3300050507 Bacteria 826
757 nmdc:mga05p37_12254_c1 3300050507 Bacteria 10239
758 nmdc:mga09592_51704_c1 3300050508 Bacteria 3467
759 nmdc:mga06r32_40804_c1 3300050510 Bacteria 4408
760 nmdc:mga0sz30_22491_c1 3300050516 Bacteria 2559
761 Ga0495655_0025788 3300053083 Bacteria 1379
762 Ga0495595_0100233 3300053084 Bacteria 1397
763 Ga0495595_0587129 3300053084 Bacteria 569
764 Ga0495619_0075897 3300053085 Bacteria 2256
765 Ga0495619_0112396 3300053085 Bacteria 1862
766 Ga0495619_0519972 3300053085 Bacteria 818
767 Ga0500644_0000014 3300053088 Bacteria 109650
768 Ga0500644_0034331 3300053088 Bacteria 1636
769 Ga0500556_0006408 3300053104 Bacteria 3341
770 Ga0500593_000395 3300053117 Bacteria 17370
771 Ga0500573_0006114 3300053140 Bacteria 6486
772 Ga0501084_0008673 3300054114 Bacteria 8404
773 Ga0501084_0188294 3300054114 Bacteria 1741
774 Ga0501084_0533698 3300054114 Bacteria 992
775 Ga0501082_0005074 3300060353 Bacteria 11478
776 Ga0501082_0023144 3300060353 Bacteria 5358
777 Ga0501082_0035057 3300060353 Bacteria 4325
778 Ga0501082_0131242 3300060353 Bacteria 2174
779 Ga0501082_0293877 3300060353 Bacteria 1415
780 Ga0501082_0331634 3300060353 Bacteria 1326
781 Ga0501082_0373122 3300060353 Bacteria 1244
782 Ga0501082_0774161 3300060353 Bacteria 840
783 Ga0501082_0848315 3300060353 Bacteria 799
784 Ga0466962_0010241 3300061719 Bacteria 4502
785 Ga0530510_0064970 3300061734 Bacteria 2643
786 Ga0530510_0098065 3300061734 Bacteria 2143
787 Ga0530510_0292292 3300061734 Bacteria 1218
788 Ga0530510_0692023 3300061734 Bacteria 777
789 2643825680 2643221561 Bacteria 4984412
790 2643851140 2643221567 Bacteria 4163945
791 2644089461 2643221615 Bacteria 5487866
792 2644102005 2643221617 Bacteria 5139111
793 2644115228 2643221620 Bacteria 5134593
794 2644134926 2643221624 Bacteria 4384879
795 2644230278 2643221641 Bacteria 4490190
796 2644319306 2643221657 Bacteria 5490246
797 2644531674 2643221696 Bacteria 5431823
798 2644607469 2643221711 Bacteria 4865335
799 2738870202 2738541305 Bacteria 4910150
800 2774393293 2773857762 Bacteria 5971770
801 2808873023 2808606365 Bacteria 4301966
802 2809197134 2808606439 Bacteria 5952208
803 2812350721 2811994878 Bacteria 5992952
804 2812373755 2811994882 Bacteria 4688362
805 2819426372 2818991318 Bacteria 5266538
806 2819665413 2818991458 Bacteria 4794049
807 2819691383 2818991462 Bacteria 4320267
808 2819727580 2818991469 Bacteria 4644110
809 2855387903 2855386786 Bacteria 4752232
810 2857485953 2857481737 Bacteria 4761446
811 2919449364 2919446982 Bacteria 3994487
812 8054611121 8054609563 Bacteria 5170090
813 Ga0075365_10126708
814 LJQas_1001906
815 JGI24740J21852_10023059
816 JGI24737J22298_10060630
817 Ga0006562J51391_1058933
818 Ga0006562J51391_1058934
819 Ga0070658_10612282
820 Ga0070658_10721378
821 Ga0070683_100001765
822 Ga0070683_100020909
823 Ga0070683_100171109
824 Ga0070677_10472504
825 Ga0068869_100927096
826 Ga0070682_100008939
827 Ga0070682_100545024
828 Ga0068868_100124930
829 Ga0068868_100141936
830 Ga0070660_100023064
831 Ga0070660_100084769
832 Ga0070687_100168854
833 Ga0070692_10009414
834 Ga0070659_100050890
835 Ga0070700_100702849
836 Ga0070663_100212526
837 Ga0070663_100418087
838 Ga0070678_100099536
839 Ga0070678_100566374
840 Ga0070681_10351086
841 Ga0068867_100326639
842 Ga0070685_10175742
843 Ga0070707_100346059
844 Ga0070698_100040552
845 Ga0070679_100023558
846 Ga0070684_100001108
847 Ga0070684_100142262
848 Ga0070684_100215444
849 Ga0070693_101120504
850 Ga0070665_100054249
851 Ga0068855_100075111
852 Ga0070664_100004627
853 Ga0070664_100588993
854 Ga0068857_100004947
855 Ga0068857_100714378
856 Ga0068856_100242894
857 Ga0068856_100505086
858 Ga0070702_100130092
859 Ga0070702_100368653
860 Ga0070702_100770283
861 Ga0068864_100444581
862 Ga0068861_100081020
863 Ga0068861_100831107
864 Ga0068851_10822908
865 Ga0068860_100003132
866 Ga0068860_100079019
867 Ga0068860_100336775
868 Ga0081455_10447356
869 Ga0075365_10001053
870 Ga0075365_10016862
871 Ga0075365_10056730
872 Ga0075365_10065247
873 Ga0075365_10079886
874 Ga0075365_10091451
875 Ga0075365_10165334
876 Ga0075365_10201393
877 Ga0075365_10206597
878 Ga0075365_10216294
879 Ga0075365_10251861
880 Ga0075365_10572135
881 Ga0075365_10662550
882 Ga0075368_10000598
883 Ga0075368_10065995
884 Ga0075363_100001214
885 Ga0075363_100018534
886 Ga0075363_100031488
887 Ga0075363_100069787
888 Ga0075363_100114643
889 Ga0075363_100430128
890 Ga0075364_10009909
891 Ga0075364_10011285
892 Ga0075364_10017735
893 Ga0075364_10030569
894 Ga0075364_10048072
895 Ga0075364_10488843
896 Ga0075362_10113317
897 Ga0075367_10000608
898 Ga0075367_10038743
899 Ga0075367_10070470
900 Ga0075367_10364298
901 Ga0075369_10026488
902 Ga0075370_10011249
903 Ga0075370_10014568
904 Ga0075370_10045252
905 Ga0075370_10176589
906 Ga0068871_100387002
907 Ga0068871_100663072
908 Ga0068871_100711155
909 Ga0075430_100014848
910 Ga0075431_100002127
911 Ga0075429_100007096
912 Ga0068865_100471260
913 Ga0105245_10001807
914 Ga0105245_10278898
915 Ga0105245_10426779
916 Ga0105245_10438890
917 Ga0105245_10800024
918 Ga0114129_10001254
919 Ga0114129_10596733
920 Ga0105243_10029112
921 Ga0105243_10154462
922 Ga0105241_10571689
923 Ga0105242_10511081
924 Ga0105248_10081536
925 Ga0105248_10596169
926 Ga0105237_10069088
927 Ga0105237_10198158
928 Ga0105237_10620843
929 Ga0105238_10268612
930 Ga0105238_10552465
931 Ga0105238_11876084
932 Ga0105249_10137020
933 Ga0105249_11135266
934 Ga0105249_12050187
935 Ga0105249_12304143
936 Ga0105239_10005630
937 Ga0105239_11798927
938 Ga0105246_10001245
939 Ga0105246_10032052
940 Ga0105246_10176344
941 Ga0105246_10735004
942 Ga0105246_10973923
943 Ga0157371_10621654
944 Ga0157371_10813734
945 Ga0157370_11111624
946 Ga0157369_10149788
947 Ga0157369_10579548
948 Ga0157369_10755343
949 Ga0157374_10488862
950 Ga0163162_10358405
951 Ga0163162_10498029
952 Ga0157372_10024501
953 Ga0157372_10309128
954 Ga0157372_10335789
955 Ga0157372_11780309
956 Ga0157372_12014985
957 Ga0157375_10013264
958 Ga0157375_10065777
959 Ga0157375_10256683
960 Ga0157375_10325687
961 Ga0157375_10433873
962 Ga0157375_10461188
963 Ga0157375_11705674
964 Ga0157375_12210278
965 Ga0163163_10071259
966 Ga0163163_10275738
967 Ga0157380_10124787
968 Ga0157380_10176902
969 Ga0157380_10488504
970 Ga0157380_11046190
971 Ga0157377_10040675
972 Ga0157377_10056736
973 Ga0157379_10003947
974 Ga0157376_10369842
975 Ga0163161_10061377
976 Ga0163161_10267663
977 Ga0207647_10031780
978 Ga0207647_10065293
979 Ga0207647_10165010
980 Ga0207647_10290103
981 Ga0207705_10036053
982 Ga0207705_10498806
983 Ga0207707_10280986
984 Ga0207671_10369553
985 Ga0207662_10090826
986 Ga0207657_10029498
987 Ga0207657_10248773
988 Ga0207652_10143256
989 Ga0207646_10179992
990 Ga0207694_10384002
991 Ga0207694_10465906
992 Ga0207694_11121655
993 Ga0207687_10002467
994 Ga0207706_10007918
995 Ga0207709_10096143
996 Ga0207669_10195020
997 Ga0207704_10297836
998 Ga0207711_10165050
999 Ga0207661_10018219
1000 Ga0207661_10036340
1001 Ga0207661_10104609
1002 Ga0207661_10520855
1003 Ga0207661_10673917
1004 Ga0207679_10037776
1005 Ga0207667_10326500
1006 Ga0207712_10216045
1007 Ga0207640_10750252
1008 Ga0207677_10044648
1009 Ga0207678_10135084
1010 Ga0207678_10216118
1011 Ga0207678_10282138
1012 Ga0207708_10065834
1013 Ga0207708_10195101
1014 Ga0207708_11029894
1015 Ga0207702_10270608
1016 Ga0207702_10332591
1017 Ga0207702_11235114
1018 Ga0207641_10958735
1019 Ga0207648_10181699
1020 Ga0207676_10112084
1021 Ga0207674_10199363
1022 Ga0207674_10350159
1023 Ga0207674_10698227
1024 Ga0207675_100026182
1025 Ga0207675_100382141
1026 Ga0207675_100620868
1027 Ga0207683_10171755
1028 Ga0207683_10483857
1029 Ga0207683_11027733
1030 Ga0207683_11369540
1031 Ga0207698_10479094
1032 Ga0209813_10001356
1033 Ga0209813_10006987
1034 Ga0268266_10010593
1035 Ga0268266_10151014
1036 Ga0268266_11293917
1037 Ga0268264_10000398
1038 Ga0268264_10518762
1039 Ga0268264_10800600
1040 Ga0316181_1251168
1041 Ga0307408_100320049
1042 Ga0316575_10105336
1043 Ga0316579_10014233
1044 Ga0316576_10130764
1045 Ga0316576_10357257
1046 Ga0316578_10105770
1047 Ga0307405_10113580
1048 Ga0307405_10548310
1049 Ga0307405_10672305
1050 Ga0307405_11359273
1051 Ga0316577_10016474
1052 Ga0316577_10024535
1053 Ga0307413_10093952
1054 Ga0307413_10263596
1055 Ga0307413_10430278
1056 Ga0307413_10883783
1057 Ga0307410_10036603
1058 Ga0307410_10235762
1059 Ga0307410_11178267
1060 Ga0307406_10066078
1061 Ga0307406_10608867
1062 Ga0307407_10012953
1063 Ga0307407_10068424
1064 Ga0307407_10101605
1065 Ga0307412_10064984
1066 Ga0307409_100043250
1067 Ga0307409_100062937
1068 Ga0307409_100148687
1069 Ga0307409_100158501
1070 Ga0307409_100184217
1071 Ga0307409_100275821
1072 Ga0307409_100283233
1073 Ga0307409_100360062
1074 Ga0307409_100504345
1075 Ga0307409_101241167
1076 Ga0307416_100096579
1077 Ga0307416_100155082
1078 Ga0307416_100188290
1079 Ga0307416_100218906
1080 Ga0307416_101026068
1081 Ga0307416_101631372
1082 Ga0307416_101712266
1083 Ga0307415_100010168
1084 Ga0307415_100040277
1085 Ga0307415_100655723
1086 Ga0307415_100703766
1087 Ga0307415_100717328
1088 Ga0307415_100718213
1089 Ga0307415_100929910
1090 Ga0307415_101085820
1091 Ga0316583_10126828
1092 Ga0316585_10002307
1093 Ga0316585_10018429
1094 Ga0316580_10001614
1095 Ga0316580_10107753
1096 Ga0316580_10152177
1097 Ga0316574_0000685
1098 Ga0316574_0007039
1099 Ga0316574_0197884
1100 Ga0373931_0226085
1101 Ga0316582_0014902
1102 Ga0316582_0020349
1103 Ga0316582_0406495
1104 Ga0316584_0613157
1105 Ga0316584_0751011
1106 Ga0395899_0715894
1107 Ga0395900_0297172
1108 Ga0395900_0576101
1109 Ga0395898_0012889
1110 Ga0395898_0019780
1111 Ga0395898_0748457
1112 Ga0395905_0040662
1113 Ga0395905_0108832
1114 Ga0395905_0163348
1115 Ga0395901_0005504
1116 Ga0395901_0045589
1117 Ga0395901_0072356
1118 Ga0395901_0189266
1119 Ga0395901_0769247
1120 Ga0395901_1328514
1121 Ga0242420_008798
1122 Ga0451789_0111182
1123 Ga0451791_0693704
1124 Ga0451793_1811604
1125 Ga0451797_0081001
1126 Ga0451797_0645667
1127 Ga0451797_0697299
1128 Ga0451802_1723936
1129 Ga0451837_0953581
1130 Ga0451841_0766488
1131 Ga0451843_1466042
1132 Ga0451853_0059182
1133 Ga0451853_0859806
1134 Ga0451853_1677545
1135 Ga0451853_2103927
1136 Ga0439431_0116775
1137 Ga0439442_075498
1138 Ga0439448_0117894
1139 Ga0439449_0246235
1140 Ga0439455_0066527
1141 Ga0439456_132211
1142 Ga0450907_003864
1143 Ga0450908_087533
1144 Ga0450909_030318
1145 Ga0466972_0033078
1146 Ga0466972_0063815
1147 Ga0466972_0079898
1148 Ga0466972_0179501
1149 Ga0466965_0015971
1150 Ga0466965_0018899
1151 Ga0466965_0021836
1152 Ga0466965_0038113
1153 Ga0466965_0046527
1154 Ga0466965_0179130
1155 Ga0466966_0281415
1156 Ga0466961_0060998
1157 Ga0466963_0040574
1158 Ga0466963_0102050
1159 Ga0466963_0341728
1160 Ga0466964_0029085
1161 Ga0466964_0136106
1162 Ga0466971_0006701
1163 Ga0466970_0018613
1164 Ga0466970_0032993
1165 Ga0466970_0039627
1166 Ga0466970_0041233
1167 Ga0466970_0174602
1168 Ga0466970_0238119
1169 Ga0466957_0039733
1170 Ga0466957_0071561
1171 Ga0466960_0000595
1172 Ga0466960_0020178
1173 Ga0466960_0035751
1174 Ga0466960_0217803
1175 Ga0466960_0270559
1176 Ga0466960_0548296
1177 Ga0451576_0072659
1178 Ga0466958_0022574
1179 Ga0466958_0548176
1180 Ga0466967_0022196
1181 Ga0466967_0031073
1182 Ga0466967_0037164
1183 Ga0466967_0135295
1184 Ga0466967_0170033
1185 Ga0466967_0257059
1186 Ga0466967_0288858
1187 Ga0466967_0420909
1188 Ga0466967_0670740
1189 Ga0466967_0789488
1190 Ga0466967_0865592
1191 Ga0466967_1025463
1192 Ga0495603_0665611
1193 Ga0495641_0019455
1194 Ga0495641_0106804
1195 Ga0495641_0146259
1196 Ga0495582_0048647
1197 Ga0495582_0096208
1198 Ga0495582_0138767
1199 Ga0495662_0197640
1200 Ga0495620_0084920
1201 Ga0495630_0445153
1202 Ga0495656_0136577
1203 Ga0495635_0280463
1204 Ga0495657_0205584
1205 Ga0495658_0081195
1206 Ga0495658_0129947
1207 Ga0495600_0341862
1208 Ga0495581_0133647
1209 Ga0495674_0263920
1210 Ga0495680_0215954
1211 Ga0495614_0174650
1212 Ga0496100_0004983
1213 Ga0496100_0154288
1214 Ga0496100_0225290
1215 Ga0496100_0235700
1216 Ga0496100_0447546
1217 Ga0496100_0953906
1218 Ga0496101_0001835
1219 Ga0496101_0017375
1220 Ga0496101_0021273
1221 Ga0496101_0029165
1222 Ga0496101_0183937
1223 Ga0496101_0347912
1224 Ga0496101_0681487
1225 Ga0496102_0020751
1226 Ga0496102_0046777
1227 Ga0496102_0047814
1228 Ga0496102_0052728
1229 Ga0496102_0095121
1230 Ga0496102_0105315
1231 Ga0496102_0121320
1232 Ga0496102_0169525
1233 Ga0496102_0285888
1234 Ga0496102_0436692
1235 Ga0496102_0798411
1236 Ga0496102_1137312
1237 Ga0496103_0029722
1238 Ga0496103_0048239
1239 Ga0496103_0142682
1240 Ga0496103_0148842
1241 Ga0496103_0444941
1242 Ga0496103_0565318
1243 Ga0496103_0666596
1244 Ga0496104_0008446
1245 Ga0496104_0091502
1246 Ga0496104_0115745
1247 Ga0496104_0225073
1248 Ga0496104_1194052
1249 Ga0496105_0013182
1250 Ga0496105_0076286
1251 Ga0496105_0133728
1252 Ga0496105_0607383
1253 Ga0496106_0025429
1254 Ga0496106_0127573
1255 Ga0496107_0020990
1256 Ga0496107_0021057
1257 Ga0496107_0033467
1258 Ga0496107_0118072
1259 Ga0496107_0351691
1260 Ga0496107_0414583
1261 Ga0496108_0003872
1262 Ga0496108_0028338
1263 Ga0496108_0250125
1264 Ga0496108_0267480
1265 Ga0496108_0281990
1266 Ga0496108_0305100
1267 Ga0496108_0319742
1268 Ga0496109_0012972
1269 Ga0496109_0013365
1270 Ga0496109_0051438
1271 Ga0496109_0213880
1272 Ga0496109_0324366
1273 Ga0496109_0354665
1274 Ga0496109_0385054
1275 Ga0496109_0769962
1276 Ga0496109_0851906
1277 Ga0496109_1325990
1278 Ga0496109_1392791
1279 Ga0496110_0011968
1280 Ga0496110_0065610
1281 Ga0496110_0198814
1282 Ga0496110_0286152
1283 Ga0496110_0289664
1284 Ga0496110_0787089
1285 Ga0496111_0018902
1286 Ga0496111_0025918
1287 Ga0496111_0076582
1288 Ga0496111_0207792
1289 Ga0496111_0312555
1290 Ga0496112_0324735
1291 Ga0496112_0373813
1292 Ga0496112_0431974
1293 Ga0496112_0567503
1294 Ga0496112_0936896
1295 Ga0496112_1250054
1296 Ga0496113_0044495
1297 Ga0496113_0063428
1298 Ga0496113_0252195
1299 Ga0496113_0415140
1300 Ga0496113_0548032
1301 Ga0496113_0943820
1302 Ga0496113_1400915
1303 Ga0496114_0007055
1304 Ga0496114_0016659
1305 Ga0496114_0017256
1306 Ga0496114_0026676
1307 Ga0496114_0042662
1308 Ga0496114_0108430
1309 Ga0496114_0118083
1310 Ga0496114_0127551
1311 Ga0496115_0029062
1312 Ga0496115_0165938
1313 Ga0496118_0196984
1314 Ga0496119_0069522
1315 Ga0496124_0177899
1316 Ga0501291_038342
1317 Ga0501031_0001904
1318 Ga0501031_0014439
1319 Ga0501031_0026258
1320 Ga0501031_0094821
1321 Ga0501031_0153042
1322 Ga0501031_0226356
1323 Ga0501031_0313235
1324 Ga0501031_0625446
1325 Ga0501032_0023177
1326 Ga0501032_0031832
1327 Ga0501032_0095711
1328 Ga0501032_0126774
1329 Ga0501032_0142041
1330 Ga0501032_0207762
1331 Ga0501032_0260792
1332 Ga0501033_0113851
1333 Ga0501033_0237926
1334 Ga0501033_0332360
1335 Ga0501034_0005404
1336 Ga0501034_0040986
1337 Ga0501034_0105687
1338 Ga0501034_0179915
1339 Ga0501034_0227792
1340 Ga0501034_0380273
1341 Ga0501034_0759099
1342 Ga0501034_0859779
1343 Ga0501036_0004164
1344 Ga0501036_0007791
1345 Ga0501036_0044452
1346 Ga0501036_0138821
1347 Ga0501036_0185659
1348 Ga0501036_0258382
1349 Ga0501036_0293228
1350 Ga0501036_0435772
1351 Ga0501036_0949127
1352 Ga0501037_0007065
1353 Ga0501037_0023238
1354 Ga0501037_0056310
1355 Ga0501037_0193576
1356 Ga0501037_0313772
1357 Ga0501037_0419179
1358 Ga0501037_0573612
1359 Ga0501038_0003261
1360 Ga0501038_0006206
1361 Ga0501038_0100777
1362 Ga0501038_0130725
1363 Ga0501038_0266258
1364 Ga0501039_0017929
1365 Ga0501039_0062670
1366 Ga0501039_0065694
1367 Ga0501039_0078520
1368 Ga0501039_0290424
1369 Ga0501039_0338948
1370 Ga0501039_0620222
1371 Ga0501039_0711541
1372 Ga0501039_1111428
1373 Ga0501040_0006842
1374 Ga0501040_0018929
1375 Ga0501040_0449790
1376 Ga0501040_0653950
1377 Ga0501040_1051930
1378 Ga0501041_0003749
1379 Ga0501041_0125081
1380 Ga0501041_0137528
1381 Ga0501041_0332191
1382 Ga0501041_0461532
1383 Ga0501042_0016345
1384 Ga0501042_0059908
1385 Ga0501042_0088299
1386 Ga0501042_0131373
1387 Ga0501042_0158519
1388 Ga0501042_0502106
1389 Ga0501042_0714272
1390 Ga0501043_0024936
1391 Ga0501043_0067863
1392 Ga0501043_0128243
1393 Ga0501043_0191731
1394 Ga0501043_0590545
1395 Ga0501043_0622689
1396 Ga0501043_0727302
1397 Ga0501046_0006288
1398 Ga0501046_0012443
1399 Ga0501046_0164983
1400 Ga0501046_0200407
1401 Ga0501047_0015588
1402 Ga0501047_0023385
1403 Ga0501047_0125216
1404 Ga0501047_0744334
1405 Ga0501047_0843753
1406 Ga0501048_0004142
1407 Ga0501048_0004795
1408 Ga0501048_0005842
1409 Ga0501048_0055092
1410 Ga0501048_0229782
1411 Ga0501048_0237416
1412 Ga0501048_0294935
1413 Ga0501048_0492925
1414 Ga0501067_0000658
1415 Ga0501067_0008791
1416 Ga0501067_0044364
1417 Ga0501067_0084598
1418 Ga0501067_0099818
1419 Ga0501068_0003031
1420 Ga0501068_0007715
1421 Ga0501068_0039773
1422 Ga0501068_0135045
1423 Ga0501068_0388813
1424 Ga0501068_0405806
1425 Ga0501068_0449690
1426 Ga0501068_0631238
1427 Ga0501069_0015893
1428 Ga0501069_0017400
1429 Ga0501069_0032903
1430 Ga0501069_0084888
1431 Ga0501069_0175206
1432 Ga0501069_0294824
1433 Ga0501070_0002949
1434 Ga0501070_0024136
1435 Ga0501070_0024860
1436 Ga0501070_0184660
1437 Ga0501070_0278625
1438 Ga0501070_0399136
1439 Ga0501070_0419803
1440 Ga0501071_0007851
1441 Ga0501071_0019218
1442 Ga0501071_0062635
1443 Ga0501071_0156691
1444 Ga0501071_0199647
1445 Ga0501071_0215569
1446 Ga0501071_0253314
1447 Ga0501071_0341021
1448 Ga0501071_0779223
1449 Ga0501071_1055365
1450 Ga0501072_0009499
1451 Ga0501072_0011419
1452 Ga0501072_0022421
1453 Ga0501072_0035711
1454 Ga0501072_0051538
1455 Ga0501072_0127568
1456 Ga0501072_0265495
1457 Ga0501072_0804692
1458 Ga0501073_0028602
1459 Ga0501073_0087153
1460 Ga0501073_0159078
1461 Ga0501073_0212879
1462 Ga0501074_0003560
1463 Ga0501074_0004188
1464 Ga0501074_0031905
1465 Ga0501074_0061415
1466 Ga0501074_0091504
1467 Ga0501074_0179515
1468 Ga0501074_0358146
1469 Ga0501074_1001762
1470 Ga0501075_0010552
1471 Ga0501075_0156256
1472 Ga0501075_0442113
1473 Ga0501075_0476132
1474 Ga0501075_1135259
1475 Ga0501076_0003377
1476 Ga0501076_0035561
1477 Ga0501076_0204067
1478 Ga0501076_0267054
1479 Ga0501076_0330008
1480 Ga0501076_0330101
1481 Ga0501076_0354606
1482 Ga0501076_1396219
1483 Ga0501077_0002635
1484 Ga0501077_0007377
1485 Ga0501077_0014735
1486 Ga0501253_076096
1487 Ga0501079_0002786
1488 Ga0501079_0072307
1489 Ga0501079_0104652
1490 Ga0501079_0304726
1491 Ga0501079_0371622
1492 Ga0501079_0598862
1493 Ga0501080_0003619
1494 Ga0501080_0017507
1495 Ga0501080_0026316
1496 Ga0501080_0140976
1497 Ga0501080_0159826
1498 Ga0501080_0244598
1499 Ga0501080_0429664
1500 Ga0501080_0621982
1501 Ga0501081_0001282
1502 Ga0501081_0164791
1503 Ga0501081_0396591
1504 Ga0501081_0820899
1505 Ga0501083_0010051
1506 Ga0501083_0011451
1507 Ga0501083_0077047
1508 Ga0501083_0078750
1509 Ga0501035_0001864
1510 Ga0501035_0030544
1511 Ga0501035_0093661
1512 Ga0501035_0118725
1513 Ga0501035_0126067
1514 Ga0501044_0015928
1515 Ga0501044_0044025
1516 Ga0501044_0111975
1517 Ga0501044_0205756
1518 Ga0501044_0828702
1519 Ga0501045_0006430
1520 Ga0501045_0017260
1521 Ga0501045_0021062
1522 Ga0501045_0024085
1523 Ga0501045_0164254
1524 Ga0501045_0207695
1525 Ga0501045_0363965
1526 Ga0501045_0517659
1527 Ga0501045_0619608
1528 nmdc:mga03683_306024_c1
1529 nmdc:mga03683_479787_c1
1530 nmdc:mga03683_71640_c1
1531 nmdc:mga03n38_101737_c1
1532 nmdc:mga03n38_203549_c1
1533 nmdc:mga03n38_41461_c1
1534 nmdc:mga03n38_4664_c1
1535 nmdc:mga03n38_77331_c1
1536 nmdc:mga00v17_136068_c2
1537 nmdc:mga00v17_161054_c1
1538 nmdc:mga00v17_17561_c1
1539 nmdc:mga00v17_240215_c1
1540 nmdc:mga00v17_31651_c1
1541 nmdc:mga00v17_368842_c1
1542 nmdc:mga00v17_37251_c1
1543 nmdc:mga00v17_40869_c1
1544 nmdc:mga00v17_754927_c1
1545 nmdc:mga0yw44_130473_c1
1546 nmdc:mga0yw44_130571_c1
1547 nmdc:mga0yw44_134603_c1
1548 nmdc:mga0yw44_205243_c1
1549 nmdc:mga0yw44_205679_c1
1550 nmdc:mga0yw44_212756_c2
1551 nmdc:mga0yw44_28583_c1
1552 nmdc:mga0yw44_30519_c1
1553 nmdc:mga0yw44_371574_c1
1554 nmdc:mga0yw44_407292_c1
1555 nmdc:mga0yw44_422755_c1
1556 nmdc:mga0yw44_42585_c1
1557 nmdc:mga0yw44_5038_c1
1558 nmdc:mga0yw44_54010_c1
1559 nmdc:mga0yw44_63670_c1
1560 nmdc:mga06z11_127368_c1
1561 nmdc:mga06z11_4075_c1
1562 nmdc:mga04h51_123576_c1
1563 nmdc:mga07m45_170035_c1
1564 nmdc:mga07m45_196673_c1
1565 nmdc:mga07m45_20080_c1
1566 nmdc:mga07m45_58325_c1
1567 nmdc:mga07m45_709_c2
1568 nmdc:mga05p37_1111677_c1
1569 nmdc:mga05p37_12254_c1
1570 nmdc:mga09592_51704_c1
1571 nmdc:mga06r32_40804_c1
1572 nmdc:mga0sz30_22491_c1
1573 Ga0495655_0025788
1574 Ga0495595_0100233
1575 Ga0495595_0587129
1576 Ga0495619_0075897
1577 Ga0495619_0112396
1578 Ga0495619_0519972
1579 Ga0500644_0000014
1580 Ga0500644_0034331
1581 Ga0500556_0006408
1582 Ga0500593_000395
1583 Ga0500573_0006114
1584 Ga0501084_0008673
1585 Ga0501084_0188294
1586 Ga0501084_0533698
1587 Ga0501082_0005074
1588 Ga0501082_0023144
1589 Ga0501082_0035057
1590 Ga0501082_0131242
1591 Ga0501082_0293877
1592 Ga0501082_0331634
1593 Ga0501082_0373122
1594 Ga0501082_0774161
1595 Ga0501082_0848315
1596 Ga0466962_0010241
1597 Ga0530510_0064970
1598 Ga0530510_0098065
1599 Ga0530510_0292292
1600 Ga0530510_0692023
1601 2643825680
1602 2643851140
1603 2644089461
1604 2644102005
1605 2644115228
1606 2644134926
1607 2644230278
1608 2644319306
1609 2644531674
1610 2644607469
1611 2738870202
1612 2774393293
1613 2808873023
1614 2809197134
1615 2812350721
1616 2812373755
1617 2819426372
1618 2819665413
1619 2819691383
1620 2819727580
1621 2855387903
1622 2857485953
1623 2919449364
1624 8054611121

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00484

Pro_CA

Carbonic anhydrase

55

184

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
6jqd-assembly1.cif.gz_B the structural basis of the beta-carbonic anhydrase cafc (l25g and l78g mutant) of the filamentous fungus aspergillus fumigatus 0.8516 1 163
6jqc-assembly1.cif.gz_B the structural basis of the beta-carbonic anhydrase cafc (wild type) of the filamentous fungus aspergillus fumigatus 0.8497 1 163
3las-assembly1.cif.gz_B crystal structure of carbonic anhydrase from streptococcus mutans to 1.4 angstrom resolution 0.8468 1 161
6jqd-assembly1.cif.gz_B the structural basis of the beta-carbonic anhydrase cafc (l25g and l78g mutant) of the filamentous fungus aspergillus fumigatus 0.8376 1 163
6jqc-assembly1.cif.gz_B the structural basis of the beta-carbonic anhydrase cafc (wild type) of the filamentous fungus aspergillus fumigatus 0.8358 1 163
ID Description Score Start End Superfamily
3lasB00 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.8468 1 161 3.40.1050.10
af_Q5A207_1_162_3.40.1050.10 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.8388 5 161 3.40.1050.10
3lasB00 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.8329 1 161 3.40.1050.10
1ylkA00 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.8213 3 163 3.40.1050.10
af_Q5A207_1_162_3.40.1050.10 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.8061 5 161 3.40.1050.10
ID Description Score Start End GO Terms
AF-A0A0S9QBD2-F1-model_v4 Carbonic anhydrase 0.9814 9 163 GO:0004089
GO:0008270
AF-A0A7V9F6I8-F1-model_v4 Carbonic anhydrase 0.9742 1 163 GO:0004089
GO:0008270
AF-A0A838KN49-F1-model_v4 Carbonic anhydrase 0.9699 1 163 GO:0004089
GO:0008270
AF-A0A7V9F6I8-F1-model_v4 Carbonic anhydrase 0.9683 1 163 GO:0004089
GO:0008270
AF-A0A4P8RDD1-F1-model_v4 Carbonic anhydrase 0.9666 3 161 GO:0004089
GO:0008270

Map