F481646

General Info

Members Datasets Scaffolds Average Seq Length
806 280 1612 295

Family's Representative Sequence

Representative Sequence 3300028381|Ga0268264_10503827|Ga0268264_105038271
Length 325
Sequence MVRDPRFWLSLWNTAYFAIFAVPSRIQDRVTFQDLILKLSSYWASHGCLLQQPLDLEVGAGTSHPETLFRVLGPKPWSVAYVQPSRRPDDGRFGQNPNRLFKHHQYQVILKPSPDEVQQLYLESLESCGINPRLHDIRFEEDNWESPTLGAWGIGWQVMLDGMEITQFTYFQQVGGMDLEPISCEITYGLERIAMFLQKVDNVFDLEWGGGVKYRDVRLQEEIEQSKYVFGQVEGMSGADFGARHRELFDRNFELGEKLLASNLILPALEHCLKCSHLFNILDSSGSIGVTERTAYILRVRQLAIRIAKAYAEAEQQEPLKVGED

Samples

Sample ID Description Type Environment
1 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
69 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
70 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
71 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
77 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
156 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
159 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
160 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
161 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
162 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
163 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
164 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
165 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
166 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
167 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
168 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
169 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
170 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
171 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
172 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
173 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
174 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
175 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
176 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
177 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
178 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
179 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
180 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
181 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
182 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
183 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
184 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
185 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
186 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
187 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
188 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
189 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
190 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
191 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
192 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
193 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
194 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
195 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
196 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
197 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
198 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
199 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
200 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
201 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
202 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
203 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
204 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
205 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
206 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
207 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
208 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
209 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
210 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
211 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
212 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
213 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
214 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
215 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
216 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
217 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
218 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
219 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
220 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
221 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
222 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
223 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
224 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
225 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
226 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
227 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
228 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
229 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
230 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
231 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
232 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
233 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
234 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
235 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
236 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
246 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
247 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
248 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
249 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
250 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
251 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
252 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
253 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
254 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
255 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
256 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
257 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
258 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
259 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
260 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
261 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
262 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
263 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
264 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
265 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
266 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
267 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
268 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
269 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
270 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
271 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
272 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
273 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
274 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
275 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
276 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
277 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
278 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
279 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
280 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.88
Metatranscriptomes 0
Isolates 0.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.12
Nodule 0
Rhizoplane 2.11
Rhizosphere 96.4
Stem 0
Stem Tuber 0
Unclassified 0.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0268264_10503827 3300028381 Bacteria 1181
2 JGI24746J21847_1006662 3300001977 Bacteria 1782
3 JGI24751J29686_10003651 3300002459 Bacteria 3101
4 JGI25406J46586_10002723 3300003203 Bacteria 8334
5 JGI25406J46586_10014377 3300003203 Bacteria 3368
6 Ga0065714_10104388 3300005288 Bacteria 1585
7 Ga0065704_10085066 3300005289 Bacteria 3265
8 Ga0065704_10174425 3300005289 Bacteria 1272
9 Ga0065712_10000343 3300005290 Bacteria 17818
10 Ga0065712_10007750 3300005290 Bacteria 2681
11 Ga0065712_10019175 3300005290 Bacteria 2046
12 Ga0065712_10075839 3300005290 Bacteria 3779
13 Ga0065712_10115789 3300005290 Bacteria 1746
14 Ga0065712_10132803 3300005290 Bacteria 1530
15 Ga0065712_10169221 3300005290 Bacteria 1254
16 Ga0065715_10005519 3300005293 Bacteria 5074
17 Ga0065715_10089628 3300005293 Bacteria 9159
18 Ga0065715_10100915 3300005293 Bacteria 3226
19 Ga0065715_10102333 3300005293 Bacteria 3114
20 Ga0065715_10142981 3300005293 Bacteria 1824
21 Ga0065715_10177973 3300005293 Bacteria 1491
22 Ga0065707_10027346 3300005295 Bacteria 1316
23 Ga0065707_10082514 3300005295 Bacteria 14283
24 Ga0065707_10131221 3300005295 Bacteria 1917
25 Ga0065707_10157710 3300005295 Bacteria 1592
26 Ga0065707_10189343 3300005295 Bacteria 1370
27 Ga0065707_10209722 3300005295 Bacteria 1271
28 Ga0070658_10218851 3300005327 Bacteria 1610
29 Ga0070676_10015392 3300005328 Bacteria 4219
30 Ga0070676_10055592 3300005328 Bacteria 2336
31 Ga0070683_100063720 3300005329 Bacteria 3430
32 Ga0070690_100050232 3300005330 Bacteria 2660
33 Ga0070690_100104583 3300005330 Bacteria 1881
34 Ga0070670_100011394 3300005331 Bacteria 7603
35 Ga0070670_100022677 3300005331 Bacteria 5402
36 Ga0070670_100030519 3300005331 Bacteria 4641
37 Ga0070670_100033887 3300005331 Bacteria 4396
38 Ga0070670_100089855 3300005331 Bacteria 2640
39 Ga0070670_100145287 3300005331 Bacteria 2052
40 Ga0070677_10062991 3300005333 Bacteria 1536
41 Ga0070677_10091029 3300005333 Bacteria 1327
42 Ga0070677_10129381 3300005333 Bacteria 1150
43 Ga0068869_100020480 3300005334 Bacteria 4535
44 Ga0068869_100026717 3300005334 Bacteria 4020
45 Ga0068869_100031728 3300005334 Bacteria 3718
46 Ga0068869_100042033 3300005334 Bacteria 3276
47 Ga0068869_100053372 3300005334 Bacteria 2938
48 Ga0068869_100055834 3300005334 Bacteria 2879
49 Ga0068869_100283562 3300005334 Bacteria 1333
50 Ga0070666_10006600 3300005335 Bacteria 7133
51 Ga0070666_10046463 3300005335 Bacteria 2912
52 Ga0070666_10080053 3300005335 Bacteria 2232
53 Ga0070666_10133256 3300005335 Bacteria 1727
54 Ga0070666_10306975 3300005335 Bacteria 1131
55 Ga0068868_100142698 3300005338 Bacteria 1967
56 Ga0070689_100009676 3300005340 Bacteria 6839
57 Ga0070689_100088422 3300005340 Bacteria 2438
58 Ga0070689_100209799 3300005340 Bacteria 1594
59 Ga0070689_100252429 3300005340 Bacteria 1456
60 Ga0070687_100008849 3300005343 Bacteria 4280
61 Ga0070687_100082648 3300005343 Bacteria 1757
62 Ga0070661_100053071 3300005344 Bacteria 2967
63 Ga0070661_100103990 3300005344 Bacteria 2115
64 Ga0070661_100200154 3300005344 Bacteria 1526
65 Ga0070692_10025578 3300005345 Bacteria 2910
66 Ga0070692_10124881 3300005345 Bacteria 1440
67 Ga0070668_100042506 3300005347 Bacteria 3484
68 Ga0070668_100169853 3300005347 Bacteria 1775
69 Ga0070669_100010651 3300005353 Bacteria 6527
70 Ga0070669_100011748 3300005353 Bacteria 6212
71 Ga0070669_100017349 3300005353 Bacteria 5135
72 Ga0070669_100046157 3300005353 Bacteria 3176
73 Ga0070669_100095967 3300005353 Bacteria 2230
74 Ga0070669_100352711 3300005353 Bacteria 1195
75 Ga0070675_100003635 3300005354 Bacteria 11725
76 Ga0070675_100003891 3300005354 Bacteria 11316
77 Ga0070675_100013044 3300005354 Bacteria 6527
78 Ga0070675_100021606 3300005354 Bacteria 5143
79 Ga0070675_100022900 3300005354 Bacteria 4991
80 Ga0070675_100057116 3300005354 Bacteria 3217
81 Ga0070675_100089789 3300005354 Bacteria 2573
82 Ga0070675_100134123 3300005354 Bacteria 2112
83 Ga0070675_100249939 3300005354 Bacteria 1551
84 Ga0070675_100272778 3300005354 Bacteria 1485
85 Ga0070671_100012703 3300005355 Bacteria 6787
86 Ga0070671_100034350 3300005355 Bacteria 4197
87 Ga0070671_100070342 3300005355 Bacteria 2919
88 Ga0070674_100000528 3300005356 Bacteria 19236
89 Ga0070674_100101463 3300005356 Bacteria 2097
90 Ga0070674_100140594 3300005356 Bacteria 1811
91 Ga0070674_100273692 3300005356 Bacteria 1335
92 Ga0070673_100001696 3300005364 Bacteria 13079
93 Ga0070673_100029421 3300005364 Bacteria 4096
94 Ga0070673_100062555 3300005364 Bacteria 2957
95 Ga0070673_100081593 3300005364 Bacteria 2623
96 Ga0070673_100085657 3300005364 Bacteria 2566
97 Ga0070673_100100471 3300005364 Bacteria 2381
98 Ga0070673_100158085 3300005364 Bacteria 1925
99 Ga0070673_100215945 3300005364 Bacteria 1658
100 Ga0070688_100003572 3300005365 Bacteria 8017
101 Ga0070688_100009518 3300005365 Bacteria 5319
102 Ga0070688_100034420 3300005365 Bacteria 3068
103 Ga0070688_100149040 3300005365 Bacteria 1597
104 Ga0070688_100286549 3300005365 Bacteria 1185
105 Ga0070659_100266650 3300005366 Bacteria 1422
106 Ga0070659_100322460 3300005366 Bacteria 1292
107 Ga0070667_100046980 3300005367 Bacteria 3632
108 Ga0070667_100183358 3300005367 Bacteria 1852
109 Ga0070667_100276634 3300005367 Bacteria 1506
110 Ga0070667_100412991 3300005367 Bacteria 1230
111 Ga0070709_10000072 3300005434 Bacteria 78666
112 Ga0070713_100052546 3300005436 Bacteria 3374
113 Ga0070713_100103726 3300005436 Bacteria 2468
114 Ga0070701_10023804 3300005438 Bacteria 2954
115 Ga0070701_10024467 3300005438 Bacteria 2922
116 Ga0070701_10035394 3300005438 Bacteria 2508
117 Ga0070701_10071185 3300005438 Bacteria 1859
118 Ga0070701_10116955 3300005438 Bacteria 1497
119 Ga0070711_100154805 3300005439 Bacteria 1732
120 Ga0070705_100000125 3300005440 Bacteria 44753
121 Ga0070705_100024908 3300005440 Bacteria 3236
122 Ga0070705_100086306 3300005440 Bacteria 1942
123 Ga0070700_100014264 3300005441 Bacteria 4483
124 Ga0070700_100027466 3300005441 Bacteria 3374
125 Ga0070700_100090317 3300005441 Bacteria 1997
126 Ga0070700_100103542 3300005441 Bacteria 1880
127 Ga0070700_100132233 3300005441 Bacteria 1685
128 Ga0070700_100356145 3300005441 Bacteria 1087
129 Ga0070694_100129755 3300005444 Bacteria 1819
130 Ga0070708_100152229 3300005445 Bacteria 2152
131 Ga0070678_100128678 3300005456 Bacteria 2008
132 Ga0070678_100148984 3300005456 Bacteria 1883
133 Ga0070678_100217112 3300005456 Bacteria 1588
134 Ga0070678_100239113 3300005456 Bacteria 1518
135 Ga0070681_10026624 3300005458 Bacteria 5812
136 Ga0070681_10045231 3300005458 Bacteria 4404
137 Ga0068867_100010125 3300005459 Bacteria 6647
138 Ga0068867_100019721 3300005459 Bacteria 4804
139 Ga0068867_100020264 3300005459 Bacteria 4738
140 Ga0070685_10009745 3300005466 Bacteria 4978
141 Ga0070685_10012631 3300005466 Bacteria 4441
142 Ga0070685_10018882 3300005466 Bacteria 3714
143 Ga0070685_10030049 3300005466 Bacteria 3024
144 Ga0070706_100181072 3300005467 Bacteria 1967
145 Ga0070706_100276606 3300005467 Bacteria 1567
146 Ga0070707_100040009 3300005468 Bacteria 4484
147 Ga0070707_100116970 3300005468 Bacteria 2587
148 Ga0070698_100012700 3300005471 Bacteria 8916
149 Ga0070698_100113807 3300005471 Bacteria 2670
150 Ga0070699_100000778 3300005518 Bacteria 29468
151 Ga0070699_100008069 3300005518 Bacteria 9137
152 Ga0070699_100025635 3300005518 Bacteria 5082
153 Ga0070699_100029719 3300005518 Bacteria 4713
154 Ga0070699_100048725 3300005518 Bacteria 3667
155 Ga0070684_100353819 3300005535 Bacteria 1351
156 Ga0070684_100470195 3300005535 Bacteria 1163
157 Ga0070697_100168509 3300005536 Bacteria 1853
158 Ga0070672_100004804 3300005543 Bacteria 8874
159 Ga0070672_100028382 3300005543 Bacteria 4185
160 Ga0070672_100030981 3300005543 Bacteria 4023
161 Ga0070672_100125895 3300005543 Bacteria 2102
162 Ga0070672_100146207 3300005543 Bacteria 1953
163 Ga0070672_100307292 3300005543 Bacteria 1345
164 Ga0070672_100540794 3300005543 Bacteria 1011
165 Ga0070686_100004058 3300005544 Bacteria 8056
166 Ga0070686_100055353 3300005544 Bacteria 2541
167 Ga0070686_100186229 3300005544 Bacteria 1478
168 Ga0070686_100337369 3300005544 Bacteria 1129
169 Ga0070695_100002089 3300005545 Bacteria 11428
170 Ga0070695_100340439 3300005545 Bacteria 1121
171 Ga0070696_100004080 3300005546 Bacteria 9737
172 Ga0070696_100005766 3300005546 Bacteria 8267
173 Ga0070696_100007023 3300005546 Bacteria 7513
174 Ga0070696_100029870 3300005546 Bacteria 3728
175 Ga0070696_100031320 3300005546 Bacteria 3644
176 Ga0070665_100010816 3300005548 Bacteria 9230
177 Ga0070704_100000070 3300005549 Bacteria 33970
178 Ga0070664_100008372 3300005564 Bacteria 8362
179 Ga0070664_100021300 3300005564 Bacteria 5341
180 Ga0070664_100031218 3300005564 Bacteria 4449
181 Ga0070664_100066061 3300005564 Bacteria 3088
182 Ga0070664_100079702 3300005564 Bacteria 2819
183 Ga0070664_100086715 3300005564 Bacteria 2705
184 Ga0070664_100177487 3300005564 Bacteria 1892
185 Ga0070664_100184333 3300005564 Bacteria 1857
186 Ga0070664_100217280 3300005564 Bacteria 1709
187 Ga0068857_100024166 3300005577 Bacteria 5349
188 Ga0068857_100153967 3300005577 Bacteria 2084
189 Ga0068854_100114485 3300005578 Bacteria 2039
190 Ga0068854_100288779 3300005578 Bacteria 1323
191 Ga0068859_100006189 3300005617 Bacteria 12162
192 Ga0068859_100007617 3300005617 Bacteria 11002
193 Ga0068859_100043204 3300005617 Bacteria 4529
194 Ga0068859_100053245 3300005617 Bacteria 4070
195 Ga0068859_100078838 3300005617 Bacteria 3334
196 Ga0068859_100134544 3300005617 Bacteria 2544
197 Ga0068859_100139860 3300005617 Bacteria 2494
198 Ga0068859_100142157 3300005617 Bacteria 2473
199 Ga0068859_100346352 3300005617 Bacteria 1580
200 Ga0068859_100753146 3300005617 Bacteria 1063
201 Ga0068864_100041515 3300005618 Bacteria 3934
202 Ga0068864_100054396 3300005618 Bacteria 3454
203 Ga0068864_100110603 3300005618 Bacteria 2447
204 Ga0068864_100161922 3300005618 Bacteria 2034
205 Ga0068861_100014295 3300005719 Bacteria 5568
206 Ga0068861_100020370 3300005719 Bacteria 4751
207 Ga0068861_100076550 3300005719 Bacteria 2608
208 Ga0068861_100198211 3300005719 Bacteria 1683
209 Ga0068861_100260874 3300005719 Bacteria 1483
210 Ga0068861_100583425 3300005719 Bacteria 1023
211 Ga0068870_10001870 3300005840 Bacteria 8666
212 Ga0068870_10004567 3300005840 Bacteria 5967
213 Ga0068870_10064510 3300005840 Bacteria 1978
214 Ga0068870_10145753 3300005840 Bacteria 1390
215 Ga0068863_100006389 3300005841 Bacteria 11559
216 Ga0068863_100109670 3300005841 Bacteria 2628
217 Ga0068863_100114714 3300005841 Bacteria 2566
218 Ga0068863_100361199 3300005841 Bacteria 1416
219 Ga0068858_100051566 3300005842 Bacteria 3806
220 Ga0068858_100060145 3300005842 Bacteria 3511
221 Ga0068858_100077054 3300005842 Bacteria 3097
222 Ga0068858_100138826 3300005842 Bacteria 2282
223 Ga0068858_100160110 3300005842 Bacteria 2119
224 Ga0068858_100259163 3300005842 Bacteria 1653
225 Ga0068860_100014948 3300005843 Bacteria 7588
226 Ga0068860_100082603 3300005843 Bacteria 3055
227 Ga0068860_100397599 3300005843 Bacteria 1363
228 Ga0068860_100660495 3300005843 Bacteria 1054
229 Ga0068862_100002264 3300005844 Bacteria 17230
230 Ga0068862_100002399 3300005844 Bacteria 16666
231 Ga0068862_100241407 3300005844 Bacteria 1643
232 Ga0068862_100377356 3300005844 Bacteria 1322
233 Ga0081455_10123730 3300005937 Bacteria 2034
234 Ga0081455_10161173 3300005937 Bacteria 1719
235 Ga0081539_10000090 3300005985 Bacteria 212006
236 Ga0081539_10000558 3300005985 Bacteria 77001
237 Ga0081539_10005786 3300005985 Bacteria 12317
238 Ga0081539_10059968 3300005985 Bacteria 2091
239 Ga0081539_10119521 3300005985 Bacteria 1311
240 Ga0075368_10012869 3300006042 Bacteria 3064
241 Ga0075364_10021525 3300006051 Bacteria 4065
242 Ga0075364_10158892 3300006051 Bacteria 1525
243 Ga0075366_10075508 3300006195 Bacteria 2011
244 Ga0097621_100051511 3300006237 Bacteria 3351
245 Ga0097621_100107073 3300006237 Bacteria 2359
246 Ga0097621_100116802 3300006237 Bacteria 2260
247 Ga0097621_100119328 3300006237 Bacteria 2235
248 Ga0097621_100162646 3300006237 Bacteria 1920
249 Ga0075370_10040866 3300006353 Bacteria 2617
250 Ga0068871_100023842 3300006358 Bacteria 4740
251 Ga0068871_100164955 3300006358 Bacteria 1896
252 Ga0068871_100211938 3300006358 Bacteria 1676
253 Ga0068871_100293411 3300006358 Bacteria 1425
254 Ga0075428_100000108 3300006844 Bacteria 70319
255 Ga0075428_100002352 3300006844 Bacteria 20530
256 Ga0075428_100007573 3300006844 Bacteria 12031
257 Ga0075428_100017039 3300006844 Bacteria 8028
258 Ga0075428_100020655 3300006844 Bacteria 7292
259 Ga0075428_100083539 3300006844 Bacteria 3484
260 Ga0075428_100089775 3300006844 Bacteria 3352
261 Ga0075428_100334554 3300006844 Bacteria 1626
262 Ga0075430_100002798 3300006846 Bacteria 14590
263 Ga0075430_100130978 3300006846 Bacteria 2090
264 Ga0075430_100175845 3300006846 Bacteria 1781
265 Ga0075430_100181654 3300006846 Bacteria 1750
266 Ga0075430_100199894 3300006846 Bacteria 1660
267 Ga0075430_100242081 3300006846 Bacteria 1495
268 Ga0075431_100001496 3300006847 Bacteria 21633
269 Ga0075431_100070797 3300006847 Bacteria 3598
270 Ga0075431_100100486 3300006847 Bacteria 2984
271 Ga0075431_100309169 3300006847 Bacteria 1596
272 Ga0075431_100461590 3300006847 Bacteria 1264
273 Ga0075433_10002247 3300006852 Bacteria 14659
274 Ga0075433_10019088 3300006852 Bacteria 5703
275 Ga0075433_10021960 3300006852 Bacteria 5355
276 Ga0075433_10024472 3300006852 Bacteria 5097
277 Ga0075433_10285191 3300006852 Bacteria 1463
278 Ga0075434_100003404 3300006871 Bacteria 14237
279 Ga0075434_100007033 3300006871 Bacteria 10380
280 Ga0075434_100016482 3300006871 Bacteria 7104
281 Ga0075434_100027429 3300006871 Bacteria 5591
282 Ga0075434_100045819 3300006871 Bacteria 4339
283 Ga0075434_100151722 3300006871 Bacteria 2337
284 Ga0075434_100154691 3300006871 Bacteria 2313
285 Ga0075434_100242972 3300006871 Bacteria 1820
286 Ga0075429_100001841 3300006880 Bacteria 17560
287 Ga0075429_100027949 3300006880 Bacteria 4896
288 Ga0075429_100036106 3300006880 Bacteria 4298
289 Ga0075429_100045119 3300006880 Bacteria 3835
290 Ga0075429_100046445 3300006880 Bacteria 3778
291 Ga0075429_100064192 3300006880 Bacteria 3199
292 Ga0075429_100186913 3300006880 Bacteria 1815
293 Ga0068865_100014328 3300006881 Bacteria 5037
294 Ga0068865_100046218 3300006881 Bacteria 2986
295 Ga0068865_100077328 3300006881 Bacteria 2378
296 Ga0068865_100194268 3300006881 Bacteria 1572
297 Ga0068865_100204005 3300006881 Bacteria 1536
298 Ga0068865_100234000 3300006881 Bacteria 1443
299 Ga0075436_100057179 3300006914 Bacteria 2694
300 Ga0097620_100006189 3300006931 Bacteria 12162
301 Ga0097620_100007617 3300006931 Bacteria 11002
302 Ga0097620_100043204 3300006931 Bacteria 4529
303 Ga0097620_100053245 3300006931 Bacteria 4070
304 Ga0097620_100078840 3300006931 Bacteria 3334
305 Ga0097620_100134556 3300006931 Bacteria 2544
306 Ga0097620_100142158 3300006931 Bacteria 2473
307 Ga0097620_100346347 3300006931 Bacteria 1580
308 Ga0097620_100753214 3300006931 Bacteria 1063
309 Ga0075435_100005141 3300007076 Bacteria 9096
310 Ga0075435_100110218 3300007076 Bacteria 2289
311 Ga0075435_100205394 3300007076 Bacteria 1670
312 Ga0075435_100316780 3300007076 Bacteria 1335
313 Ga0111539_10000001 3300009094 Bacteria 1035431
314 Ga0111539_10002783 3300009094 Bacteria 23220
315 Ga0111539_10002991 3300009094 Bacteria 22418
316 Ga0111539_10004416 3300009094 Bacteria 18385
317 Ga0111539_10008503 3300009094 Bacteria 13045
318 Ga0111539_10013363 3300009094 Bacteria 10261
319 Ga0111539_10072684 3300009094 Bacteria 4056
320 Ga0111539_10084394 3300009094 Bacteria 3734
321 Ga0111539_10244286 3300009094 Bacteria 2090
322 Ga0111539_10410094 3300009094 Bacteria 1578
323 Ga0111539_10560219 3300009094 Bacteria 1331
324 Ga0105245_10153300 3300009098 Bacteria 2181
325 Ga0105245_10405107 3300009098 Bacteria 1364
326 Ga0105245_10758818 3300009098 Bacteria 1006
327 Ga0114129_10001825 3300009147 Bacteria 28997
328 Ga0114129_10013989 3300009147 Bacteria 11431
329 Ga0114129_10015967 3300009147 Bacteria 10678
330 Ga0114129_10018881 3300009147 Bacteria 9821
331 Ga0114129_10025803 3300009147 Bacteria 8323
332 Ga0114129_10030659 3300009147 Bacteria 7608
333 Ga0114129_10050539 3300009147 Bacteria 5839
334 Ga0114129_10104650 3300009147 Bacteria 3912
335 Ga0114129_10177979 3300009147 Bacteria 2896
336 Ga0114129_10256807 3300009147 Bacteria 2344
337 Ga0114129_10266142 3300009147 Bacteria 2295
338 Ga0114129_10270791 3300009147 Bacteria 2272
339 Ga0114129_10776692 3300009147 Bacteria 1224
340 Ga0105243_10017462 3300009148 Bacteria 5424
341 Ga0105243_10278607 3300009148 Bacteria 1505
342 Ga0105243_10280564 3300009148 Bacteria 1500
343 Ga0105241_10263559 3300009174 Bacteria 1465
344 Ga0105242_10074043 3300009176 Bacteria 2833
345 Ga0105242_10129079 3300009176 Bacteria 2179
346 Ga0105242_10376539 3300009176 Bacteria 1318
347 Ga0105248_10022608 3300009177 Bacteria 6978
348 Ga0105248_10033010 3300009177 Bacteria 5782
349 Ga0105248_10110153 3300009177 Bacteria 3104
350 Ga0105248_10165201 3300009177 Bacteria 2496
351 Ga0105248_10238687 3300009177 Bacteria 2046
352 Ga0105248_10311542 3300009177 Bacteria 1773
353 Ga0105238_10018424 3300009551 Bacteria 7107
354 Ga0105249_10003747 3300009553 Bacteria 13119
355 Ga0105249_10199004 3300009553 Bacteria 1960
356 Ga0105249_10533188 3300009553 Bacteria 1223
357 Ga0105239_10407824 3300010375 Bacteria 1538
358 Ga0105246_10057099 3300011119 Bacteria 2700
359 Ga0157371_10078836 3300013102 Bacteria 2333
360 Ga0157374_10020500 3300013296 Bacteria 5866
361 Ga0157374_10081796 3300013296 Bacteria 3065
362 Ga0157374_10158157 3300013296 Bacteria 2206
363 Ga0157374_10767659 3300013296 Bacteria 979
364 Ga0157378_10422582 3300013297 Bacteria 1317
365 Ga0163162_10020168 3300013306 Bacteria 6546
366 Ga0163162_10175599 3300013306 Bacteria 2268
367 Ga0163162_10213708 3300013306 Bacteria 2059
368 Ga0157375_10031481 3300013308 Bacteria 5015
369 Ga0157375_10037587 3300013308 Bacteria 4640
370 Ga0157375_10077277 3300013308 Bacteria 3358
371 Ga0157375_10175820 3300013308 Bacteria 2290
372 Ga0157375_10293598 3300013308 Bacteria 1789
373 Ga0157375_10897266 3300013308 Bacteria 1031
374 Ga0163163_10204538 3300014325 Bacteria 2023
375 Ga0163163_10402607 3300014325 Bacteria 1427
376 Ga0163163_10502010 3300014325 Bacteria 1275
377 Ga0157380_10006699 3300014326 Bacteria 8137
378 Ga0157380_10013386 3300014326 Bacteria 5979
379 Ga0157380_10042145 3300014326 Bacteria 3567
380 Ga0157380_10108784 3300014326 Bacteria 2324
381 Ga0157380_10137487 3300014326 Bacteria 2094
382 Ga0157380_10189866 3300014326 Bacteria 1813
383 Ga0157380_10247190 3300014326 Bacteria 1612
384 Ga0157380_10352395 3300014326 Bacteria 1378
385 Ga0157377_10009983 3300014745 Bacteria 4684
386 Ga0157377_10020630 3300014745 Bacteria 3455
387 Ga0157377_10359065 3300014745 Bacteria 980
388 Ga0157379_10037626 3300014968 Bacteria 4316
389 Ga0157379_10098687 3300014968 Bacteria 2622
390 Ga0157376_10020374 3300014969 Bacteria 5128
391 Ga0157376_10065121 3300014969 Bacteria 3076
392 Ga0157376_10072739 3300014969 Bacteria 2926
393 Ga0157376_10102363 3300014969 Bacteria 2505
394 Ga0157376_10382583 3300014969 Bacteria 1356
395 Ga0163161_10035038 3300017792 Bacteria 3591
396 Ga0163161_10104452 3300017792 Bacteria 2112
397 Ga0163161_10119441 3300017792 Bacteria 1979
398 Ga0163161_10125578 3300017792 Bacteria 1932
399 Ga0207697_10000814 3300025315 Bacteria 17672
400 Ga0207697_10016469 3300025315 Bacteria 3044
401 Ga0207697_10063163 3300025315 Bacteria 1543
402 Ga0207682_10002591 3300025893 Bacteria 8071
403 Ga0207682_10004166 3300025893 Bacteria 6113
404 Ga0207682_10009894 3300025893 Bacteria 3748
405 Ga0207682_10081170 3300025893 Bacteria 1390
406 Ga0207642_10015075 3300025899 Bacteria 2869
407 Ga0207688_10000771 3300025901 Bacteria 15946
408 Ga0207688_10026003 3300025901 Bacteria 3216
409 Ga0207688_10308615 3300025901 Bacteria 968
410 Ga0207680_10005030 3300025903 Bacteria 6301
411 Ga0207680_10025433 3300025903 Bacteria 3265
412 Ga0207680_10069606 3300025903 Bacteria 2175
413 Ga0207680_10079099 3300025903 Bacteria 2061
414 Ga0207680_10384166 3300025903 Bacteria 990
415 Ga0207647_10023304 3300025904 Bacteria 4095
416 Ga0207645_10000922 3300025907 Bacteria 24408
417 Ga0207643_10006474 3300025908 Bacteria 6271
418 Ga0207643_10041111 3300025908 Bacteria 2604
419 Ga0207643_10112148 3300025908 Bacteria 1607
420 Ga0207705_10162254 3300025909 Bacteria 1679
421 Ga0207705_10372134 3300025909 Bacteria 1103
422 Ga0207684_10111794 3300025910 Bacteria 2338
423 Ga0207707_10117814 3300025912 Bacteria 2321
424 Ga0207662_10001958 3300025918 Bacteria 10156
425 Ga0207662_10016897 3300025918 Bacteria 4122
426 Ga0207662_10162018 3300025918 Bacteria 1429
427 Ga0207662_10329737 3300025918 Bacteria 1021
428 Ga0207657_10237091 3300025919 Bacteria 1457
429 Ga0207649_10341543 3300025920 Bacteria 1106
430 Ga0207646_10027517 3300025922 Bacteria 5186
431 Ga0207681_10008727 3300025923 Bacteria 6192
432 Ga0207681_10026529 3300025923 Bacteria 3737
433 Ga0207681_10059954 3300025923 Bacteria 2610
434 Ga0207681_10098112 3300025923 Bacteria 2107
435 Ga0207681_10122594 3300025923 Bacteria 1909
436 Ga0207681_10203513 3300025923 Bacteria 1521
437 Ga0207694_10007617 3300025924 Bacteria 8210
438 Ga0207650_10007775 3300025925 Bacteria 7308
439 Ga0207650_10014015 3300025925 Bacteria 5565
440 Ga0207650_10052527 3300025925 Bacteria 3019
441 Ga0207650_10069368 3300025925 Bacteria 2649
442 Ga0207650_10100265 3300025925 Bacteria 2228
443 Ga0207659_10000227 3300025926 Bacteria 34213
444 Ga0207659_10002132 3300025926 Bacteria 11733
445 Ga0207659_10011124 3300025926 Bacteria 5677
446 Ga0207659_10012656 3300025926 Bacteria 5378
447 Ga0207659_10026295 3300025926 Bacteria 3925
448 Ga0207659_10044675 3300025926 Bacteria 3118
449 Ga0207659_10270741 3300025926 Bacteria 1385
450 Ga0207659_10281094 3300025926 Bacteria 1361
451 Ga0207659_10284099 3300025926 Bacteria 1354
452 Ga0207700_10433079 3300025928 Bacteria 1157
453 Ga0207644_10015145 3300025931 Bacteria 5173
454 Ga0207644_10032837 3300025931 Bacteria 3624
455 Ga0207644_10114999 3300025931 Bacteria 2040
456 Ga0207690_10028930 3300025932 Bacteria 3517
457 Ga0207690_10212520 3300025932 Bacteria 1476
458 Ga0207706_10001352 3300025933 Bacteria 24484
459 Ga0207706_10059422 3300025933 Bacteria 3367
460 Ga0207706_10121063 3300025933 Bacteria 2301
461 Ga0207686_10002750 3300025934 Bacteria 9533
462 Ga0207686_10185673 3300025934 Bacteria 1478
463 Ga0207709_10014402 3300025935 Bacteria 4367
464 Ga0207670_10004011 3300025936 Bacteria 7865
465 Ga0207670_10004853 3300025936 Bacteria 7305
466 Ga0207670_10009491 3300025936 Bacteria 5555
467 Ga0207670_10153568 3300025936 Bacteria 1711
468 Ga0207670_10163960 3300025936 Bacteria 1661
469 Ga0207670_10366118 3300025936 Bacteria 1145
470 Ga0207669_10000305 3300025937 Bacteria 22533
471 Ga0207669_10025852 3300025937 Bacteria 3182
472 Ga0207704_10019982 3300025938 Bacteria 3532
473 Ga0207704_10042933 3300025938 Bacteria 2666
474 Ga0207691_10003439 3300025940 Bacteria 15403
475 Ga0207691_10017036 3300025940 Bacteria 6896
476 Ga0207691_10022980 3300025940 Bacteria 5874
477 Ga0207691_10026155 3300025940 Bacteria 5476
478 Ga0207691_10029793 3300025940 Bacteria 5104
479 Ga0207691_10056735 3300025940 Bacteria 3567
480 Ga0207691_10167696 3300025940 Bacteria 1924
481 Ga0207691_10267610 3300025940 Bacteria 1472
482 Ga0207691_10290783 3300025940 Bacteria 1405
483 Ga0207711_10364805 3300025941 Bacteria 1339
484 Ga0207711_10376813 3300025941 Bacteria 1316
485 Ga0207689_10002899 3300025942 Bacteria 15823
486 Ga0207689_10043051 3300025942 Bacteria 3733
487 Ga0207689_10048867 3300025942 Bacteria 3490
488 Ga0207689_10091320 3300025942 Bacteria 2502
489 Ga0207661_10050601 3300025944 Bacteria 3311
490 Ga0207679_10115018 3300025945 Bacteria 2131
491 Ga0207679_10153059 3300025945 Bacteria 1880
492 Ga0207679_10170247 3300025945 Bacteria 1792
493 Ga0207651_10013584 3300025960 Bacteria 4666
494 Ga0207651_10031825 3300025960 Bacteria 3379
495 Ga0207651_10034654 3300025960 Bacteria 3272
496 Ga0207651_10049375 3300025960 Bacteria 2850
497 Ga0207651_10076135 3300025960 Bacteria 2397
498 Ga0207712_10140875 3300025961 Bacteria 1850
499 Ga0207712_10165003 3300025961 Bacteria 1725
500 Ga0207658_10191812 3300025986 Bacteria 1699
501 Ga0207677_10044475 3300026023 Bacteria 2959
502 Ga0207677_10120653 3300026023 Bacteria 1972
503 Ga0207677_10297091 3300026023 Bacteria 1333
504 Ga0207703_10006471 3300026035 Bacteria 9354
505 Ga0207703_10029103 3300026035 Bacteria 4358
506 Ga0207703_10056054 3300026035 Bacteria 3208
507 Ga0207703_10124027 3300026035 Bacteria 2221
508 Ga0207678_10307510 3300026067 Bacteria 1363
509 Ga0207708_10007742 3300026075 Bacteria 7956
510 Ga0207708_10010464 3300026075 Bacteria 6886
511 Ga0207708_10031325 3300026075 Bacteria 4036
512 Ga0207708_10114462 3300026075 Bacteria 2096
513 Ga0207641_10078772 3300026088 Bacteria 2855
514 Ga0207641_10117190 3300026088 Bacteria 2371
515 Ga0207641_10310301 3300026088 Bacteria 1493
516 Ga0207648_10004002 3300026089 Bacteria 15295
517 Ga0207648_10005451 3300026089 Bacteria 12816
518 Ga0207648_10032556 3300026089 Bacteria 4602
519 Ga0207648_10219497 3300026089 Bacteria 1689
520 Ga0207676_10023027 3300026095 Bacteria 4588
521 Ga0207676_10028415 3300026095 Bacteria 4177
522 Ga0207676_10040584 3300026095 Bacteria 3567
523 Ga0207676_10057671 3300026095 Bacteria 3060
524 Ga0207676_10072151 3300026095 Bacteria 2774
525 Ga0207676_10077786 3300026095 Bacteria 2685
526 Ga0207676_10079976 3300026095 Bacteria 2652
527 Ga0207676_10444598 3300026095 Bacteria 1221
528 Ga0207674_10019212 3300026116 Bacteria 7409
529 Ga0207674_10341258 3300026116 Bacteria 1448
530 Ga0207675_100039300 3300026118 Bacteria 4416
531 Ga0207675_100052533 3300026118 Bacteria 3802
532 Ga0207675_100057772 3300026118 Bacteria 3620
533 Ga0207675_100115763 3300026118 Bacteria 2533
534 Ga0207675_100162466 3300026118 Bacteria 2131
535 Ga0207675_100477101 3300026118 Bacteria 1239
536 Ga0207683_10023925 3300026121 Bacteria 5256
537 Ga0207683_10037451 3300026121 Bacteria 4224
538 Ga0207683_10045363 3300026121 Bacteria 3844
539 Ga0207683_10093988 3300026121 Bacteria 2672
540 Ga0207683_10097199 3300026121 Bacteria 2626
541 Ga0207683_10196185 3300026121 Bacteria 1834
542 Ga0207683_10412111 3300026121 Bacteria 1244
543 Ga0207698_10055498 3300026142 Bacteria 3054
544 Ga0209974_10076370 3300027876 Bacteria 1147
545 Ga0207428_10000002 3300027907 Bacteria 854851
546 Ga0207428_10000186 3300027907 Bacteria 86221
547 Ga0207428_10001288 3300027907 Bacteria 26753
548 Ga0207428_10003458 3300027907 Bacteria 15332
549 Ga0207428_10003797 3300027907 Bacteria 14491
550 Ga0207428_10021175 3300027907 Bacteria 5507
551 Ga0207428_10086976 3300027907 Bacteria 2432
552 Ga0268266_10061150 3300028379 Bacteria 3248
553 Ga0268266_10254632 3300028379 Bacteria 1625
554 Ga0268265_10013929 3300028380 Bacteria 5475
555 Ga0268265_10020206 3300028380 Bacteria 4646
556 Ga0268265_10103164 3300028380 Bacteria 2309
557 Ga0268265_10303349 3300028380 Bacteria 1439
558 Ga0268264_10003634 3300028381 Bacteria 13263
559 Ga0268264_10115916 3300028381 Bacteria 2354
560 Ga0268264_10119150 3300028381 Bacteria 2324
561 Ga0307408_100017365 3300031548 Bacteria 4814
562 Ga0307408_100052737 3300031548 Bacteria 2935
563 Ga0307405_10002131 3300031731 Bacteria 8622
564 Ga0307405_10009105 3300031731 Bacteria 5076
565 Ga0307405_10210769 3300031731 Bacteria 1418
566 Ga0307413_10017496 3300031824 Bacteria 3734
567 Ga0307413_10044884 3300031824 Bacteria 2615
568 Ga0307413_10057112 3300031824 Bacteria 2385
569 Ga0307413_10107377 3300031824 Bacteria 1860
570 Ga0307413_10557911 3300031824 Bacteria 930
571 Ga0307410_10018735 3300031852 Bacteria 4190
572 Ga0307410_10052281 3300031852 Bacteria 2758
573 Ga0307410_10098529 3300031852 Bacteria 2091
574 Ga0307410_10400114 3300031852 Bacteria 1109
575 Ga0307406_10065565 3300031901 Bacteria 2360
576 Ga0307407_10000293 3300031903 Bacteria 14741
577 Ga0307407_10001941 3300031903 Bacteria 7839
578 Ga0307407_10309598 3300031903 Bacteria 1104
579 Ga0307412_10000776 3300031911 Bacteria 18435
580 Ga0307412_10018696 3300031911 Bacteria 4177
581 Ga0307412_10275145 3300031911 Bacteria 1319
582 Ga0307409_100006789 3300031995 Bacteria 6771
583 Ga0307409_100016682 3300031995 Bacteria 4869
584 Ga0307409_100077929 3300031995 Bacteria 2664
585 Ga0307409_100306263 3300031995 Bacteria 1480
586 Ga0307409_100322753 3300031995 Bacteria 1446
587 Ga0307416_100003188 3300032002 Bacteria 9606
588 Ga0307416_100017458 3300032002 Bacteria 5024
589 Ga0307416_100032303 3300032002 Bacteria 3953
590 Ga0307416_100065063 3300032002 Bacteria 2994
591 Ga0307416_100217532 3300032002 Bacteria 1829
592 Ga0307416_100254069 3300032002 Bacteria 1713
593 Ga0307414_10018852 3300032004 Bacteria 4261
594 Ga0307414_10168034 3300032004 Bacteria 1750
595 Ga0307411_10009851 3300032005 Bacteria 5055
596 Ga0307411_10031692 3300032005 Bacteria 3257
597 Ga0307411_10037695 3300032005 Bacteria 3042
598 Ga0307411_10048772 3300032005 Bacteria 2747
599 Ga0307411_10153967 3300032005 Bacteria 1712
600 Ga0307415_100045439 3300032126 Bacteria 2944
601 Ga0307415_100051479 3300032126 Bacteria 2795
602 Ga0373940_0040107 3300035088 Bacteria 1284
603 Ga0373949_0043526 3300035090 Bacteria 1111
604 Ga0373923_0153386 3300035111 Bacteria 1047
605 Ga0373960_0031204 3300035121 Bacteria 1489
606 Ga0373937_0317562 3300036401 Bacteria 1474
607 Ga0373937_0340951 3300036401 Bacteria 1419
608 Ga0373937_0594388 3300036401 Bacteria 1051
609 Ga0373925_0259497 3300037068 Bacteria 1396
610 Ga0373925_0513790 3300037068 Bacteria 984
611 Ga0395900_0195648 3300037418 Bacteria 2049
612 Ga0439439_0025788 3300041406 Bacteria 1480
613 Ga0439453_0011186 3300041408 Bacteria 1493
614 Ga0451837_1074641 3300041494 Bacteria 1035
615 Ga0451849_0562773 3300041505 Bacteria 978
616 Ga0439450_006032 3300042008 Bacteria 2163
617 Ga0450894_002055 3300042131 Bacteria 2767
618 Ga0450907_022472 3300042146 Bacteria 1063
619 Ga0439435_0003134 3300042436 Bacteria 3397
620 Ga0439464_0037507 3300042439 Bacteria 1375
621 Ga0439460_0012981 3300042461 Bacteria 2172
622 Ga0450916_000574 3300042530 Bacteria 3272
623 Ga0451577_0057575 3300042876 Bacteria 3464
624 Ga0451577_0232943 3300042876 Bacteria 1666
625 Ga0451577_0351013 3300042876 Bacteria 1338
626 Ga0453683_0043602 3300044673 Bacteria 2815
627 Ga0466963_0034476 3300044694 Bacteria 3293
628 Ga0453684_0152004 3300044712 Bacteria 2749
629 Ga0451576_0024448 3300045051 Bacteria 6525
630 Ga0451576_0047052 3300045051 Bacteria 4537
631 Ga0451576_0056252 3300045051 Bacteria 4115
632 Ga0451576_0111842 3300045051 Bacteria 2842
633 Ga0451576_0491259 3300045051 Bacteria 1289
634 Ga0451576_0533917 3300045051 Bacteria 1232
635 Ga0495592_0116525 3300046454 Bacteria 1885
636 Ga0495592_0265782 3300046454 Bacteria 1128
637 Ga0495603_0004533 3300046455 Bacteria 8292
638 Ga0495629_0004294 3300046459 Bacteria 10683
639 Ga0495639_0202239 3300046475 Bacteria 973
640 Ga0495584_0044701 3300046491 Bacteria 2234
641 Ga0495594_0143021 3300046499 Bacteria 1357
642 Ga0495608_0077458 3300046511 Bacteria 2164
643 Ga0495628_0266011 3300046516 Bacteria 1277
644 Ga0495630_0005754 3300046517 Bacteria 8762
645 Ga0495643_0007296 3300046522 Bacteria 7145
646 Ga0495644_0047565 3300046523 Bacteria 1611
647 Ga0495642_0010795 3300046528 Bacteria 3499
648 Ga0495586_0163298 3300046535 Bacteria 1257
649 Ga0495598_0008413 3300046537 Bacteria 2403
650 Ga0495598_0014364 3300046537 Bacteria 1980
651 Ga0495621_0017287 3300046539 Bacteria 2329
652 Ga0495621_0030792 3300046539 Bacteria 1837
653 Ga0495621_0042236 3300046539 Bacteria 1604
654 Ga0495621_0050714 3300046539 Bacteria 1483
655 Ga0495645_0145564 3300046543 Bacteria 1650
656 Ga0495667_0037477 3300046559 Bacteria 3231
657 Ga0495656_0025637 3300046615 Bacteria 2340
658 Ga0495659_0017131 3300046664 Bacteria 2397
659 Ga0495588_0010576 3300046674 Bacteria 4297
660 Ga0495657_0124711 3300046675 Bacteria 1619
661 Ga0495647_0045074 3300046681 Bacteria 1693
662 Ga0495658_0071410 3300046683 Bacteria 2017
663 Ga0495658_0209882 3300046683 Bacteria 1216
664 Ga0495669_0014415 3300046684 Bacteria 3378
665 Ga0495613_0002633 3300046689 Bacteria 13495
666 Ga0495670_0111469 3300046691 Bacteria 1416
667 Ga0495604_0051505 3300047317 Bacteria 3191
668 Ga0495676_0111495 3300047321 Bacteria 2006
669 Ga0495675_0100775 3300047444 Bacteria 1808
670 Ga0495685_001874 3300047447 Bacteria 6494
671 Ga0495684_0000550 3300047471 Bacteria 30400
672 Ga0496101_0102868 3300048904 Bacteria 2140
673 Ga0496102_0076364 3300048905 Bacteria 3082
674 Ga0496104_0021833 3300048907 Bacteria 5879
675 Ga0496106_0307924 3300048909 Bacteria 1271
676 Ga0496108_0020479 3300048911 Bacteria 5438
677 Ga0496108_0193296 3300048911 Bacteria 1764
678 Ga0496108_0223216 3300048911 Bacteria 1637
679 Ga0496109_0583842 3300048912 Bacteria 1053
680 Ga0496110_0212379 3300048913 Bacteria 1759
681 Ga0496110_0416656 3300048913 Bacteria 1224
682 Ga0496111_0170912 3300048914 Bacteria 1615
683 Ga0496112_0001667 3300048915 Bacteria 17262
684 Ga0496112_0521545 3300048915 Bacteria 1123
685 Ga0496113_0025772 3300048916 Bacteria 4196
686 Ga0496114_0001016 3300048917 Bacteria 21060
687 Ga0496114_0160948 3300048917 Bacteria 1952
688 Ga0496114_0332781 3300048917 Bacteria 1342
689 Ga0501299_015258 3300049522 Bacteria 1348
690 Ga0501033_0017870 3300049570 Bacteria 5354
691 Ga0501036_0122401 3300049572 Bacteria 2197
692 Ga0501039_0295610 3300049575 Bacteria 1273
693 Ga0501040_0102504 3300049576 Bacteria 1997
694 Ga0501040_0235203 3300049576 Bacteria 1305
695 Ga0501041_0015179 3300049577 Bacteria 4574
696 Ga0501042_0027279 3300049578 Bacteria 4015
697 Ga0501043_0077327 3300049579 Unclassified 2615
698 Ga0501046_0025809 3300049580 Bacteria 4804
699 Ga0501048_0015954 3300049582 Bacteria 5542
700 Ga0501048_0036048 3300049582 Bacteria 3557
701 Ga0501067_0170483 3300049583 Bacteria 1212
702 Ga0501068_0122554 3300049584 Bacteria 1622
703 Ga0501071_0021187 3300049587 Bacteria 4527
704 Ga0501072_0006518 3300049588 Bacteria 8891
705 Ga0501072_0015436 3300049588 Bacteria 5856
706 Ga0501072_0235661 3300049588 Bacteria 1458
707 Ga0501073_0002222 3300049589 Bacteria 14511
708 Ga0501073_0133334 3300049589 Bacteria 1722
709 Ga0501074_0037631 3300049590 Bacteria 3507
710 Ga0501075_0007091 3300049591 Bacteria 7750
711 Ga0501075_0008664 3300049591 Bacteria 7090
712 Ga0501075_0040952 3300049591 Bacteria 3471
713 Ga0501075_0095644 3300049591 Bacteria 2254
714 Ga0501076_0059528 3300049592 Bacteria 3038
715 Ga0501079_0029618 3300049741 Bacteria 4204
716 Ga0501079_0053334 3300049741 Bacteria 3119
717 Ga0501079_0109548 3300049741 Bacteria 2145
718 Ga0501079_0200014 3300049741 Bacteria 1561
719 Ga0501080_0066073 3300049742 Bacteria 3364
720 Ga0501081_0122418 3300049743 Bacteria 1854
721 Ga0501283_002034 3300049779 Bacteria 2624
722 Ga0501045_0013842 3300049824 Bacteria 5705
723 Ga0501045_0230035 3300049824 Bacteria 1380
724 nmdc:mga0yw44_279372_c1 3300050492 Bacteria 1116
725 nmdc:mga0k408_176814_c1 3300050493 Bacteria 1273
726 nmdc:mga0k408_66375_c1 3300050493 Bacteria 2102
727 nmdc:mga07m45_10813_c1 3300050496 Bacteria 4780
728 nmdc:mga05p37_10587_c1 3300050507 Bacteria 10938
729 nmdc:mga05p37_11851_c1 3300050507 Bacteria 10392
730 nmdc:mga05p37_131364_c1 3300050507 Bacteria 3072
731 nmdc:mga05p37_144088_c1 3300050507 Bacteria 2918
732 nmdc:mga05p37_2339_c1 3300050507 Bacteria 22050
733 nmdc:mga05p37_34634_c1 3300050507 Bacteria 6186
734 nmdc:mga05p37_351029_c1 3300050507 Bacteria 1737
735 nmdc:mga05p37_45284_c1 3300050507 Bacteria 5412
736 nmdc:mga05p37_52863_c1 3300050507 Bacteria 4995
737 nmdc:mga09592_124791_c1 3300050508 Bacteria 2213
738 nmdc:mga09592_183827_c1 3300050508 Bacteria 1808
739 nmdc:mga09592_213749_c1 3300050508 Bacteria 1671
740 nmdc:mga09592_213863_c1 3300050508 Bacteria 1670
741 nmdc:mga09592_39211_c1 3300050508 Bacteria 3978
742 nmdc:mga09592_58849_c1 3300050508 Bacteria 3249
743 nmdc:mga0qj67_142803_c1 3300050509 Bacteria 1941
744 nmdc:mga0qj67_16813_c1 3300050509 Bacteria 5554
745 nmdc:mga0qj67_209450_c1 3300050509 Bacteria 1584
746 nmdc:mga0qj67_44070_c1 3300050509 Bacteria 3515
747 nmdc:mga0qj67_64800_c1 3300050509 Bacteria 2908
748 nmdc:mga06r32_244573_c1 3300050510 Bacteria 1781
749 nmdc:mga06r32_291025_c1 3300050510 Bacteria 1620
750 nmdc:mga06r32_32077_c1 3300050510 Bacteria 4939
751 nmdc:mga06r32_6756_c1 3300050510 Bacteria 10312
752 nmdc:mga08y16_118047_c1 3300050511 Bacteria 2761
753 nmdc:mga08y16_13670_c1 3300050511 Bacteria 8547
754 nmdc:mga08y16_1369_c1 3300050511 Bacteria 24366
755 nmdc:mga08y16_2097_c1 3300050511 Bacteria 20436
756 nmdc:mga08y16_347793_c1 3300050511 Bacteria 1523
757 nmdc:mga08y16_3_c1 3300050511 Bacteria 936907
758 nmdc:mga08y16_41421_c1 3300050511 Bacteria 4824
759 nmdc:mga08y16_472984_c1 3300050511 Bacteria 1276
760 nmdc:mga08y16_524_c1 3300050511 Bacteria 35438
761 nmdc:mga08y16_54341_c1 3300050511 Bacteria 4185
762 nmdc:mga08y16_557784_c1 3300050511 Bacteria 1159
763 nmdc:mga08y16_7734_c1 3300050511 Bacteria 11259
764 nmdc:mga08y16_92064_c1 3300050511 Bacteria 3159
765 nmdc:mga0n895_1771_c1 3300050512 Bacteria 16368
766 nmdc:mga0n895_196139_c1 3300050512 Bacteria 2050
767 nmdc:mga0n895_288432_c1 3300050512 Bacteria 1664
768 nmdc:mga0n895_46480_c1 3300050512 Bacteria 4241
769 nmdc:mga0n895_5410_c1 3300050512 Bacteria 10665
770 nmdc:mga0n895_67_c1 3300050512 Bacteria 61603
771 nmdc:mga0n895_7580_c1 3300050512 Bacteria 9330
772 nmdc:mga0n895_8931_c1 3300050512 Bacteria 8734
773 nmdc:mga0n895_9524_c1 3300050512 Bacteria 8504
774 nmdc:mga0rr50_103361_c1 3300050513 Bacteria 2242
775 nmdc:mga0rr50_34696_c1 3300050513 Bacteria 3615
776 nmdc:mga0rr50_52202_c1 3300050513 Bacteria 3037
777 nmdc:mga08x19_155945_c1 3300050514 Bacteria 1548
778 nmdc:mga08x19_5150_c1 3300050514 Bacteria 7731
779 nmdc:mga0a205_114795_c1 3300050515 Bacteria 2591
780 nmdc:mga0a205_132153_c1 3300050515 Bacteria 2397
781 nmdc:mga0a205_13650_c1 3300050515 Bacteria 7569
782 nmdc:mga0a205_24077_c1 3300050515 Bacteria 5782
783 nmdc:mga0a205_29065_c1 3300050515 Bacteria 1187
784 nmdc:mga0a205_324_c1 3300050515 Bacteria 35790
785 nmdc:mga0a205_8014_c1 3300050515 Bacteria 9601
786 Ga0495601_0002794 3300053077 Bacteria 9913
787 Ga0495601_0020465 3300053077 Bacteria 4043
788 Ga0495601_0102718 3300053077 Bacteria 1847
789 Ga0495595_0016758 3300053084 Bacteria 3141
790 Ga0495595_0087045 3300053084 Bacteria 1495
791 Ga0495619_0009836 3300053085 Bacteria 6028
792 Ga0495619_0019897 3300053085 Bacteria 4273
793 Ga0501084_0029006 3300054114 Bacteria 4627
794 Ga0501084_0038827 3300054114 Bacteria 3981
795 Ga0590071_000698 3300059421 Bacteria 9522
796 Ga0590071_016080 3300059421 Bacteria 1754
797 Ga0590074_003927 3300059423 Bacteria 2459
798 Ga0590075_000718 3300059424 Bacteria 8781
799 Ga0590077_000224 3300059426 Bacteria 16320
800 Ga0590077_003985 3300059426 Bacteria 3043
801 Ga0590077_008996 3300059426 Bacteria 2044
802 Ga0501082_0333012 3300060353 Bacteria 1323
803 Ga0501082_0542769 3300060353 Bacteria 1017
804 Ga0501082_0674661 3300060353 Bacteria 905
805 Ga0530510_0217001 3300061734 Bacteria 1421
806 2857581179 2857576091 Bacteria 5465855
807 Ga0268264_10503827
808 JGI24746J21847_1006662
809 JGI24751J29686_10003651
810 JGI25406J46586_10002723
811 JGI25406J46586_10014377
812 Ga0065714_10104388
813 Ga0065704_10085066
814 Ga0065704_10174425
815 Ga0065712_10000343
816 Ga0065712_10007750
817 Ga0065712_10019175
818 Ga0065712_10075839
819 Ga0065712_10115789
820 Ga0065712_10132803
821 Ga0065712_10169221
822 Ga0065715_10005519
823 Ga0065715_10089628
824 Ga0065715_10100915
825 Ga0065715_10102333
826 Ga0065715_10142981
827 Ga0065715_10177973
828 Ga0065707_10027346
829 Ga0065707_10082514
830 Ga0065707_10131221
831 Ga0065707_10157710
832 Ga0065707_10189343
833 Ga0065707_10209722
834 Ga0070658_10218851
835 Ga0070676_10015392
836 Ga0070676_10055592
837 Ga0070683_100063720
838 Ga0070690_100050232
839 Ga0070690_100104583
840 Ga0070670_100011394
841 Ga0070670_100022677
842 Ga0070670_100030519
843 Ga0070670_100033887
844 Ga0070670_100089855
845 Ga0070670_100145287
846 Ga0070677_10062991
847 Ga0070677_10091029
848 Ga0070677_10129381
849 Ga0068869_100020480
850 Ga0068869_100026717
851 Ga0068869_100031728
852 Ga0068869_100042033
853 Ga0068869_100053372
854 Ga0068869_100055834
855 Ga0068869_100283562
856 Ga0070666_10006600
857 Ga0070666_10046463
858 Ga0070666_10080053
859 Ga0070666_10133256
860 Ga0070666_10306975
861 Ga0068868_100142698
862 Ga0070689_100009676
863 Ga0070689_100088422
864 Ga0070689_100209799
865 Ga0070689_100252429
866 Ga0070687_100008849
867 Ga0070687_100082648
868 Ga0070661_100053071
869 Ga0070661_100103990
870 Ga0070661_100200154
871 Ga0070692_10025578
872 Ga0070692_10124881
873 Ga0070668_100042506
874 Ga0070668_100169853
875 Ga0070669_100010651
876 Ga0070669_100011748
877 Ga0070669_100017349
878 Ga0070669_100046157
879 Ga0070669_100095967
880 Ga0070669_100352711
881 Ga0070675_100003635
882 Ga0070675_100003891
883 Ga0070675_100013044
884 Ga0070675_100021606
885 Ga0070675_100022900
886 Ga0070675_100057116
887 Ga0070675_100089789
888 Ga0070675_100134123
889 Ga0070675_100249939
890 Ga0070675_100272778
891 Ga0070671_100012703
892 Ga0070671_100034350
893 Ga0070671_100070342
894 Ga0070674_100000528
895 Ga0070674_100101463
896 Ga0070674_100140594
897 Ga0070674_100273692
898 Ga0070673_100001696
899 Ga0070673_100029421
900 Ga0070673_100062555
901 Ga0070673_100081593
902 Ga0070673_100085657
903 Ga0070673_100100471
904 Ga0070673_100158085
905 Ga0070673_100215945
906 Ga0070688_100003572
907 Ga0070688_100009518
908 Ga0070688_100034420
909 Ga0070688_100149040
910 Ga0070688_100286549
911 Ga0070659_100266650
912 Ga0070659_100322460
913 Ga0070667_100046980
914 Ga0070667_100183358
915 Ga0070667_100276634
916 Ga0070667_100412991
917 Ga0070709_10000072
918 Ga0070713_100052546
919 Ga0070713_100103726
920 Ga0070701_10023804
921 Ga0070701_10024467
922 Ga0070701_10035394
923 Ga0070701_10071185
924 Ga0070701_10116955
925 Ga0070711_100154805
926 Ga0070705_100000125
927 Ga0070705_100024908
928 Ga0070705_100086306
929 Ga0070700_100014264
930 Ga0070700_100027466
931 Ga0070700_100090317
932 Ga0070700_100103542
933 Ga0070700_100132233
934 Ga0070700_100356145
935 Ga0070694_100129755
936 Ga0070708_100152229
937 Ga0070678_100128678
938 Ga0070678_100148984
939 Ga0070678_100217112
940 Ga0070678_100239113
941 Ga0070681_10026624
942 Ga0070681_10045231
943 Ga0068867_100010125
944 Ga0068867_100019721
945 Ga0068867_100020264
946 Ga0070685_10009745
947 Ga0070685_10012631
948 Ga0070685_10018882
949 Ga0070685_10030049
950 Ga0070706_100181072
951 Ga0070706_100276606
952 Ga0070707_100040009
953 Ga0070707_100116970
954 Ga0070698_100012700
955 Ga0070698_100113807
956 Ga0070699_100000778
957 Ga0070699_100008069
958 Ga0070699_100025635
959 Ga0070699_100029719
960 Ga0070699_100048725
961 Ga0070684_100353819
962 Ga0070684_100470195
963 Ga0070697_100168509
964 Ga0070672_100004804
965 Ga0070672_100028382
966 Ga0070672_100030981
967 Ga0070672_100125895
968 Ga0070672_100146207
969 Ga0070672_100307292
970 Ga0070672_100540794
971 Ga0070686_100004058
972 Ga0070686_100055353
973 Ga0070686_100186229
974 Ga0070686_100337369
975 Ga0070695_100002089
976 Ga0070695_100340439
977 Ga0070696_100004080
978 Ga0070696_100005766
979 Ga0070696_100007023
980 Ga0070696_100029870
981 Ga0070696_100031320
982 Ga0070665_100010816
983 Ga0070704_100000070
984 Ga0070664_100008372
985 Ga0070664_100021300
986 Ga0070664_100031218
987 Ga0070664_100066061
988 Ga0070664_100079702
989 Ga0070664_100086715
990 Ga0070664_100177487
991 Ga0070664_100184333
992 Ga0070664_100217280
993 Ga0068857_100024166
994 Ga0068857_100153967
995 Ga0068854_100114485
996 Ga0068854_100288779
997 Ga0068859_100006189
998 Ga0068859_100007617
999 Ga0068859_100043204
1000 Ga0068859_100053245
1001 Ga0068859_100078838
1002 Ga0068859_100134544
1003 Ga0068859_100139860
1004 Ga0068859_100142157
1005 Ga0068859_100346352
1006 Ga0068859_100753146
1007 Ga0068864_100041515
1008 Ga0068864_100054396
1009 Ga0068864_100110603
1010 Ga0068864_100161922
1011 Ga0068861_100014295
1012 Ga0068861_100020370
1013 Ga0068861_100076550
1014 Ga0068861_100198211
1015 Ga0068861_100260874
1016 Ga0068861_100583425
1017 Ga0068870_10001870
1018 Ga0068870_10004567
1019 Ga0068870_10064510
1020 Ga0068870_10145753
1021 Ga0068863_100006389
1022 Ga0068863_100109670
1023 Ga0068863_100114714
1024 Ga0068863_100361199
1025 Ga0068858_100051566
1026 Ga0068858_100060145
1027 Ga0068858_100077054
1028 Ga0068858_100138826
1029 Ga0068858_100160110
1030 Ga0068858_100259163
1031 Ga0068860_100014948
1032 Ga0068860_100082603
1033 Ga0068860_100397599
1034 Ga0068860_100660495
1035 Ga0068862_100002264
1036 Ga0068862_100002399
1037 Ga0068862_100241407
1038 Ga0068862_100377356
1039 Ga0081455_10123730
1040 Ga0081455_10161173
1041 Ga0081539_10000090
1042 Ga0081539_10000558
1043 Ga0081539_10005786
1044 Ga0081539_10059968
1045 Ga0081539_10119521
1046 Ga0075368_10012869
1047 Ga0075364_10021525
1048 Ga0075364_10158892
1049 Ga0075366_10075508
1050 Ga0097621_100051511
1051 Ga0097621_100107073
1052 Ga0097621_100116802
1053 Ga0097621_100119328
1054 Ga0097621_100162646
1055 Ga0075370_10040866
1056 Ga0068871_100023842
1057 Ga0068871_100164955
1058 Ga0068871_100211938
1059 Ga0068871_100293411
1060 Ga0075428_100000108
1061 Ga0075428_100002352
1062 Ga0075428_100007573
1063 Ga0075428_100017039
1064 Ga0075428_100020655
1065 Ga0075428_100083539
1066 Ga0075428_100089775
1067 Ga0075428_100334554
1068 Ga0075430_100002798
1069 Ga0075430_100130978
1070 Ga0075430_100175845
1071 Ga0075430_100181654
1072 Ga0075430_100199894
1073 Ga0075430_100242081
1074 Ga0075431_100001496
1075 Ga0075431_100070797
1076 Ga0075431_100100486
1077 Ga0075431_100309169
1078 Ga0075431_100461590
1079 Ga0075433_10002247
1080 Ga0075433_10019088
1081 Ga0075433_10021960
1082 Ga0075433_10024472
1083 Ga0075433_10285191
1084 Ga0075434_100003404
1085 Ga0075434_100007033
1086 Ga0075434_100016482
1087 Ga0075434_100027429
1088 Ga0075434_100045819
1089 Ga0075434_100151722
1090 Ga0075434_100154691
1091 Ga0075434_100242972
1092 Ga0075429_100001841
1093 Ga0075429_100027949
1094 Ga0075429_100036106
1095 Ga0075429_100045119
1096 Ga0075429_100046445
1097 Ga0075429_100064192
1098 Ga0075429_100186913
1099 Ga0068865_100014328
1100 Ga0068865_100046218
1101 Ga0068865_100077328
1102 Ga0068865_100194268
1103 Ga0068865_100204005
1104 Ga0068865_100234000
1105 Ga0075436_100057179
1106 Ga0097620_100006189
1107 Ga0097620_100007617
1108 Ga0097620_100043204
1109 Ga0097620_100053245
1110 Ga0097620_100078840
1111 Ga0097620_100134556
1112 Ga0097620_100142158
1113 Ga0097620_100346347
1114 Ga0097620_100753214
1115 Ga0075435_100005141
1116 Ga0075435_100110218
1117 Ga0075435_100205394
1118 Ga0075435_100316780
1119 Ga0111539_10000001
1120 Ga0111539_10002783
1121 Ga0111539_10002991
1122 Ga0111539_10004416
1123 Ga0111539_10008503
1124 Ga0111539_10013363
1125 Ga0111539_10072684
1126 Ga0111539_10084394
1127 Ga0111539_10244286
1128 Ga0111539_10410094
1129 Ga0111539_10560219
1130 Ga0105245_10153300
1131 Ga0105245_10405107
1132 Ga0105245_10758818
1133 Ga0114129_10001825
1134 Ga0114129_10013989
1135 Ga0114129_10015967
1136 Ga0114129_10018881
1137 Ga0114129_10025803
1138 Ga0114129_10030659
1139 Ga0114129_10050539
1140 Ga0114129_10104650
1141 Ga0114129_10177979
1142 Ga0114129_10256807
1143 Ga0114129_10266142
1144 Ga0114129_10270791
1145 Ga0114129_10776692
1146 Ga0105243_10017462
1147 Ga0105243_10278607
1148 Ga0105243_10280564
1149 Ga0105241_10263559
1150 Ga0105242_10074043
1151 Ga0105242_10129079
1152 Ga0105242_10376539
1153 Ga0105248_10022608
1154 Ga0105248_10033010
1155 Ga0105248_10110153
1156 Ga0105248_10165201
1157 Ga0105248_10238687
1158 Ga0105248_10311542
1159 Ga0105238_10018424
1160 Ga0105249_10003747
1161 Ga0105249_10199004
1162 Ga0105249_10533188
1163 Ga0105239_10407824
1164 Ga0105246_10057099
1165 Ga0157371_10078836
1166 Ga0157374_10020500
1167 Ga0157374_10081796
1168 Ga0157374_10158157
1169 Ga0157374_10767659
1170 Ga0157378_10422582
1171 Ga0163162_10020168
1172 Ga0163162_10175599
1173 Ga0163162_10213708
1174 Ga0157375_10031481
1175 Ga0157375_10037587
1176 Ga0157375_10077277
1177 Ga0157375_10175820
1178 Ga0157375_10293598
1179 Ga0157375_10897266
1180 Ga0163163_10204538
1181 Ga0163163_10402607
1182 Ga0163163_10502010
1183 Ga0157380_10006699
1184 Ga0157380_10013386
1185 Ga0157380_10042145
1186 Ga0157380_10108784
1187 Ga0157380_10137487
1188 Ga0157380_10189866
1189 Ga0157380_10247190
1190 Ga0157380_10352395
1191 Ga0157377_10009983
1192 Ga0157377_10020630
1193 Ga0157377_10359065
1194 Ga0157379_10037626
1195 Ga0157379_10098687
1196 Ga0157376_10020374
1197 Ga0157376_10065121
1198 Ga0157376_10072739
1199 Ga0157376_10102363
1200 Ga0157376_10382583
1201 Ga0163161_10035038
1202 Ga0163161_10104452
1203 Ga0163161_10119441
1204 Ga0163161_10125578
1205 Ga0207697_10000814
1206 Ga0207697_10016469
1207 Ga0207697_10063163
1208 Ga0207682_10002591
1209 Ga0207682_10004166
1210 Ga0207682_10009894
1211 Ga0207682_10081170
1212 Ga0207642_10015075
1213 Ga0207688_10000771
1214 Ga0207688_10026003
1215 Ga0207688_10308615
1216 Ga0207680_10005030
1217 Ga0207680_10025433
1218 Ga0207680_10069606
1219 Ga0207680_10079099
1220 Ga0207680_10384166
1221 Ga0207647_10023304
1222 Ga0207645_10000922
1223 Ga0207643_10006474
1224 Ga0207643_10041111
1225 Ga0207643_10112148
1226 Ga0207705_10162254
1227 Ga0207705_10372134
1228 Ga0207684_10111794
1229 Ga0207707_10117814
1230 Ga0207662_10001958
1231 Ga0207662_10016897
1232 Ga0207662_10162018
1233 Ga0207662_10329737
1234 Ga0207657_10237091
1235 Ga0207649_10341543
1236 Ga0207646_10027517
1237 Ga0207681_10008727
1238 Ga0207681_10026529
1239 Ga0207681_10059954
1240 Ga0207681_10098112
1241 Ga0207681_10122594
1242 Ga0207681_10203513
1243 Ga0207694_10007617
1244 Ga0207650_10007775
1245 Ga0207650_10014015
1246 Ga0207650_10052527
1247 Ga0207650_10069368
1248 Ga0207650_10100265
1249 Ga0207659_10000227
1250 Ga0207659_10002132
1251 Ga0207659_10011124
1252 Ga0207659_10012656
1253 Ga0207659_10026295
1254 Ga0207659_10044675
1255 Ga0207659_10270741
1256 Ga0207659_10281094
1257 Ga0207659_10284099
1258 Ga0207700_10433079
1259 Ga0207644_10015145
1260 Ga0207644_10032837
1261 Ga0207644_10114999
1262 Ga0207690_10028930
1263 Ga0207690_10212520
1264 Ga0207706_10001352
1265 Ga0207706_10059422
1266 Ga0207706_10121063
1267 Ga0207686_10002750
1268 Ga0207686_10185673
1269 Ga0207709_10014402
1270 Ga0207670_10004011
1271 Ga0207670_10004853
1272 Ga0207670_10009491
1273 Ga0207670_10153568
1274 Ga0207670_10163960
1275 Ga0207670_10366118
1276 Ga0207669_10000305
1277 Ga0207669_10025852
1278 Ga0207704_10019982
1279 Ga0207704_10042933
1280 Ga0207691_10003439
1281 Ga0207691_10017036
1282 Ga0207691_10022980
1283 Ga0207691_10026155
1284 Ga0207691_10029793
1285 Ga0207691_10056735
1286 Ga0207691_10167696
1287 Ga0207691_10267610
1288 Ga0207691_10290783
1289 Ga0207711_10364805
1290 Ga0207711_10376813
1291 Ga0207689_10002899
1292 Ga0207689_10043051
1293 Ga0207689_10048867
1294 Ga0207689_10091320
1295 Ga0207661_10050601
1296 Ga0207679_10115018
1297 Ga0207679_10153059
1298 Ga0207679_10170247
1299 Ga0207651_10013584
1300 Ga0207651_10031825
1301 Ga0207651_10034654
1302 Ga0207651_10049375
1303 Ga0207651_10076135
1304 Ga0207712_10140875
1305 Ga0207712_10165003
1306 Ga0207658_10191812
1307 Ga0207677_10044475
1308 Ga0207677_10120653
1309 Ga0207677_10297091
1310 Ga0207703_10006471
1311 Ga0207703_10029103
1312 Ga0207703_10056054
1313 Ga0207703_10124027
1314 Ga0207678_10307510
1315 Ga0207708_10007742
1316 Ga0207708_10010464
1317 Ga0207708_10031325
1318 Ga0207708_10114462
1319 Ga0207641_10078772
1320 Ga0207641_10117190
1321 Ga0207641_10310301
1322 Ga0207648_10004002
1323 Ga0207648_10005451
1324 Ga0207648_10032556
1325 Ga0207648_10219497
1326 Ga0207676_10023027
1327 Ga0207676_10028415
1328 Ga0207676_10040584
1329 Ga0207676_10057671
1330 Ga0207676_10072151
1331 Ga0207676_10077786
1332 Ga0207676_10079976
1333 Ga0207676_10444598
1334 Ga0207674_10019212
1335 Ga0207674_10341258
1336 Ga0207675_100039300
1337 Ga0207675_100052533
1338 Ga0207675_100057772
1339 Ga0207675_100115763
1340 Ga0207675_100162466
1341 Ga0207675_100477101
1342 Ga0207683_10023925
1343 Ga0207683_10037451
1344 Ga0207683_10045363
1345 Ga0207683_10093988
1346 Ga0207683_10097199
1347 Ga0207683_10196185
1348 Ga0207683_10412111
1349 Ga0207698_10055498
1350 Ga0209974_10076370
1351 Ga0207428_10000002
1352 Ga0207428_10000186
1353 Ga0207428_10001288
1354 Ga0207428_10003458
1355 Ga0207428_10003797
1356 Ga0207428_10021175
1357 Ga0207428_10086976
1358 Ga0268266_10061150
1359 Ga0268266_10254632
1360 Ga0268265_10013929
1361 Ga0268265_10020206
1362 Ga0268265_10103164
1363 Ga0268265_10303349
1364 Ga0268264_10003634
1365 Ga0268264_10115916
1366 Ga0268264_10119150
1367 Ga0307408_100017365
1368 Ga0307408_100052737
1369 Ga0307405_10002131
1370 Ga0307405_10009105
1371 Ga0307405_10210769
1372 Ga0307413_10017496
1373 Ga0307413_10044884
1374 Ga0307413_10057112
1375 Ga0307413_10107377
1376 Ga0307413_10557911
1377 Ga0307410_10018735
1378 Ga0307410_10052281
1379 Ga0307410_10098529
1380 Ga0307410_10400114
1381 Ga0307406_10065565
1382 Ga0307407_10000293
1383 Ga0307407_10001941
1384 Ga0307407_10309598
1385 Ga0307412_10000776
1386 Ga0307412_10018696
1387 Ga0307412_10275145
1388 Ga0307409_100006789
1389 Ga0307409_100016682
1390 Ga0307409_100077929
1391 Ga0307409_100306263
1392 Ga0307409_100322753
1393 Ga0307416_100003188
1394 Ga0307416_100017458
1395 Ga0307416_100032303
1396 Ga0307416_100065063
1397 Ga0307416_100217532
1398 Ga0307416_100254069
1399 Ga0307414_10018852
1400 Ga0307414_10168034
1401 Ga0307411_10009851
1402 Ga0307411_10031692
1403 Ga0307411_10037695
1404 Ga0307411_10048772
1405 Ga0307411_10153967
1406 Ga0307415_100045439
1407 Ga0307415_100051479
1408 Ga0373940_0040107
1409 Ga0373949_0043526
1410 Ga0373923_0153386
1411 Ga0373960_0031204
1412 Ga0373937_0317562
1413 Ga0373937_0340951
1414 Ga0373937_0594388
1415 Ga0373925_0259497
1416 Ga0373925_0513790
1417 Ga0395900_0195648
1418 Ga0439439_0025788
1419 Ga0439453_0011186
1420 Ga0451837_1074641
1421 Ga0451849_0562773
1422 Ga0439450_006032
1423 Ga0450894_002055
1424 Ga0450907_022472
1425 Ga0439435_0003134
1426 Ga0439464_0037507
1427 Ga0439460_0012981
1428 Ga0450916_000574
1429 Ga0451577_0057575
1430 Ga0451577_0232943
1431 Ga0451577_0351013
1432 Ga0453683_0043602
1433 Ga0466963_0034476
1434 Ga0453684_0152004
1435 Ga0451576_0024448
1436 Ga0451576_0047052
1437 Ga0451576_0056252
1438 Ga0451576_0111842
1439 Ga0451576_0491259
1440 Ga0451576_0533917
1441 Ga0495592_0116525
1442 Ga0495592_0265782
1443 Ga0495603_0004533
1444 Ga0495629_0004294
1445 Ga0495639_0202239
1446 Ga0495584_0044701
1447 Ga0495594_0143021
1448 Ga0495608_0077458
1449 Ga0495628_0266011
1450 Ga0495630_0005754
1451 Ga0495643_0007296
1452 Ga0495644_0047565
1453 Ga0495642_0010795
1454 Ga0495586_0163298
1455 Ga0495598_0008413
1456 Ga0495598_0014364
1457 Ga0495621_0017287
1458 Ga0495621_0030792
1459 Ga0495621_0042236
1460 Ga0495621_0050714
1461 Ga0495645_0145564
1462 Ga0495667_0037477
1463 Ga0495656_0025637
1464 Ga0495659_0017131
1465 Ga0495588_0010576
1466 Ga0495657_0124711
1467 Ga0495647_0045074
1468 Ga0495658_0071410
1469 Ga0495658_0209882
1470 Ga0495669_0014415
1471 Ga0495613_0002633
1472 Ga0495670_0111469
1473 Ga0495604_0051505
1474 Ga0495676_0111495
1475 Ga0495675_0100775
1476 Ga0495685_001874
1477 Ga0495684_0000550
1478 Ga0496101_0102868
1479 Ga0496102_0076364
1480 Ga0496104_0021833
1481 Ga0496106_0307924
1482 Ga0496108_0020479
1483 Ga0496108_0193296
1484 Ga0496108_0223216
1485 Ga0496109_0583842
1486 Ga0496110_0212379
1487 Ga0496110_0416656
1488 Ga0496111_0170912
1489 Ga0496112_0001667
1490 Ga0496112_0521545
1491 Ga0496113_0025772
1492 Ga0496114_0001016
1493 Ga0496114_0160948
1494 Ga0496114_0332781
1495 Ga0501299_015258
1496 Ga0501033_0017870
1497 Ga0501036_0122401
1498 Ga0501039_0295610
1499 Ga0501040_0102504
1500 Ga0501040_0235203
1501 Ga0501041_0015179
1502 Ga0501042_0027279
1503 Ga0501043_0077327
1504 Ga0501046_0025809
1505 Ga0501048_0015954
1506 Ga0501048_0036048
1507 Ga0501067_0170483
1508 Ga0501068_0122554
1509 Ga0501071_0021187
1510 Ga0501072_0006518
1511 Ga0501072_0015436
1512 Ga0501072_0235661
1513 Ga0501073_0002222
1514 Ga0501073_0133334
1515 Ga0501074_0037631
1516 Ga0501075_0007091
1517 Ga0501075_0008664
1518 Ga0501075_0040952
1519 Ga0501075_0095644
1520 Ga0501076_0059528
1521 Ga0501079_0029618
1522 Ga0501079_0053334
1523 Ga0501079_0109548
1524 Ga0501079_0200014
1525 Ga0501080_0066073
1526 Ga0501081_0122418
1527 Ga0501283_002034
1528 Ga0501045_0013842
1529 Ga0501045_0230035
1530 nmdc:mga0yw44_279372_c1
1531 nmdc:mga0k408_176814_c1
1532 nmdc:mga0k408_66375_c1
1533 nmdc:mga07m45_10813_c1
1534 nmdc:mga05p37_10587_c1
1535 nmdc:mga05p37_11851_c1
1536 nmdc:mga05p37_131364_c1
1537 nmdc:mga05p37_144088_c1
1538 nmdc:mga05p37_2339_c1
1539 nmdc:mga05p37_34634_c1
1540 nmdc:mga05p37_351029_c1
1541 nmdc:mga05p37_45284_c1
1542 nmdc:mga05p37_52863_c1
1543 nmdc:mga09592_124791_c1
1544 nmdc:mga09592_183827_c1
1545 nmdc:mga09592_213749_c1
1546 nmdc:mga09592_213863_c1
1547 nmdc:mga09592_39211_c1
1548 nmdc:mga09592_58849_c1
1549 nmdc:mga0qj67_142803_c1
1550 nmdc:mga0qj67_16813_c1
1551 nmdc:mga0qj67_209450_c1
1552 nmdc:mga0qj67_44070_c1
1553 nmdc:mga0qj67_64800_c1
1554 nmdc:mga06r32_244573_c1
1555 nmdc:mga06r32_291025_c1
1556 nmdc:mga06r32_32077_c1
1557 nmdc:mga06r32_6756_c1
1558 nmdc:mga08y16_118047_c1
1559 nmdc:mga08y16_13670_c1
1560 nmdc:mga08y16_1369_c1
1561 nmdc:mga08y16_2097_c1
1562 nmdc:mga08y16_347793_c1
1563 nmdc:mga08y16_3_c1
1564 nmdc:mga08y16_41421_c1
1565 nmdc:mga08y16_472984_c1
1566 nmdc:mga08y16_524_c1
1567 nmdc:mga08y16_54341_c1
1568 nmdc:mga08y16_557784_c1
1569 nmdc:mga08y16_7734_c1
1570 nmdc:mga08y16_92064_c1
1571 nmdc:mga0n895_1771_c1
1572 nmdc:mga0n895_196139_c1
1573 nmdc:mga0n895_288432_c1
1574 nmdc:mga0n895_46480_c1
1575 nmdc:mga0n895_5410_c1
1576 nmdc:mga0n895_67_c1
1577 nmdc:mga0n895_7580_c1
1578 nmdc:mga0n895_8931_c1
1579 nmdc:mga0n895_9524_c1
1580 nmdc:mga0rr50_103361_c1
1581 nmdc:mga0rr50_34696_c1
1582 nmdc:mga0rr50_52202_c1
1583 nmdc:mga08x19_155945_c1
1584 nmdc:mga08x19_5150_c1
1585 nmdc:mga0a205_114795_c1
1586 nmdc:mga0a205_132153_c1
1587 nmdc:mga0a205_13650_c1
1588 nmdc:mga0a205_24077_c1
1589 nmdc:mga0a205_29065_c1
1590 nmdc:mga0a205_324_c1
1591 nmdc:mga0a205_8014_c1
1592 Ga0495601_0002794
1593 Ga0495601_0020465
1594 Ga0495601_0102718
1595 Ga0495595_0016758
1596 Ga0495595_0087045
1597 Ga0495619_0009836
1598 Ga0495619_0019897
1599 Ga0501084_0029006
1600 Ga0501084_0038827
1601 Ga0590071_000698
1602 Ga0590071_016080
1603 Ga0590074_003927
1604 Ga0590075_000718
1605 Ga0590077_000224
1606 Ga0590077_003985
1607 Ga0590077_008996
1608 Ga0501082_0333012
1609 Ga0501082_0542769
1610 Ga0501082_0674661
1611 Ga0530510_0217001
1612 2857581179

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02091

tRNA-synt_2e

Glycyl-tRNA synthetase alpha subunit

32

316

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5f5w-assembly1.cif.gz_A crystal structure of the alpha subunit of glycyl trna synthetase (glyrs) from aquifex aeolicus in complex with an analog of glycyl adenylate (gly-sa) 0.9619 1 281
1j5w-assembly1.cif.gz_A crystal structure of glycyl-trna synthetase alpha chain (tm0216) from thermotoga maritima at 1.95 a resolution 0.9584 1 285
1j5w-assembly1.cif.gz_B crystal structure of glycyl-trna synthetase alpha chain (tm0216) from thermotoga maritima at 1.95 a resolution 0.9539 1 285
7lu4-assembly1.cif.gz_B crystal structure of bacterial glycyl trna synthetase in complex with glycine 0.9526 1 287
7xof-assembly1.cif.gz_B crystal structure of oryza sativa plastid glycyl-trna synthetase 0.9513 1 286
ID Description Score Start End Superfamily
5f5wA02 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Class II aaRS and biotin synthetases; domain 2 0.9911 213 280 1.20.58.180
3ufgA02 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Class II aaRS and biotin synthetases; domain 2 0.9719 213 280 1.20.58.180
af_P00960_1_214_3.30.930.10 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.9499 2 204 3.30.930.10
af_A0A368UIE1_307_387_1.20.58.180 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Class II aaRS and biotin synthetases; domain 2 0.9341 212 286 1.20.58.180
af_A0A1D6NXM7_66_257_3.30.930.10 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.9286 25 190 3.30.930.10
ID Description Score Start End GO Terms
AF-A0A5C7FUC4-F1-model_v4 deleted 0.9988 100 188
AF-A0A534WLM3-F1-model_v4 glycine--tRNA ligase (EC 6.1.1.14) 0.9985 212 280 GO:0004820
GO:0005524
GO:0005829
GO:0006426
AF-B0L8W9-F1-model_v4 glycine--tRNA ligase (EC 6.1.1.14) 0.9979 74 181 GO:0004820
GO:0005524
GO:0005829
GO:0006426
AF-C6HZZ9-F1-model_v4 glycine--tRNA ligase (EC 6.1.1.14) 0.9919 212 280 GO:0004820
GO:0005524
GO:0005829
GO:0006426
AF-A0A6I3UA74-F1-model_v4 glycine--tRNA ligase (EC 6.1.1.14) 0.9914 103 184 GO:0004820
GO:0005524
GO:0005829
GO:0006426
GO:0016740

Map