F481554

General Info

Members Datasets Scaffolds Average Seq Length
804 324 1608 163

Family's Representative Sequence

Representative Sequence 3300009176|Ga0105242_10998664|Ga0105242_109986641
Length 193
Sequence VTRSHQLAPVSTAQENGRLGGFVAKEVEMAKAKSAVPEGHHTVTPQLTLDNAAKAIEWYKQALGAEETGRAVGPDGKIMHAELRIGDSRIMMNDAMMGGKGPKALGGSPAALWLYVEDCDSLFNRAVAAGGQIAQGGMGKMQDQFWGDRSGTFTDPHGYTWTIATHKEDLSPEEMKQRQDAFMKQFNAQPTQA

Samples

Sample ID Description Type Environment
1 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300004785 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
8 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
9 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
10 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
11 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
12 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
13 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
14 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
15 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
30 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
38 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
39 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
40 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
41 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
42 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
43 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
44 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
45 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
46 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
47 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
48 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
49 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
50 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
51 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
52 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
53 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
54 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
55 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
56 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
57 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
58 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
59 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
60 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
61 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
62 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
63 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
64 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
65 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
66 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
67 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
68 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
69 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
70 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
71 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
72 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
73 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
74 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
75 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
76 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
77 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
78 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
79 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
80 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
81 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
82 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
83 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
84 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
85 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
86 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
87 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
88 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
89 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
90 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
91 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
92 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
93 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
94 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
95 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
97 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
98 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
99 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
100 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
101 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
102 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
103 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
104 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
105 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
106 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
107 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
108 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
109 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
110 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
111 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
112 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
113 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
114 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
115 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
116 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
117 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
118 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
119 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
120 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
121 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
122 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
123 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
124 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
125 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
126 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
127 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
128 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
129 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
130 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
131 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
132 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
133 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
134 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
135 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
136 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
137 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
138 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
139 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
140 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
141 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
202 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
206 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
207 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
208 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
209 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
210 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
211 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
212 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
213 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
214 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
215 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
216 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
217 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
218 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
219 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
220 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
221 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
222 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
223 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
224 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
225 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
226 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
227 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
228 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
229 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
230 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
231 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
232 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
233 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
234 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
235 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
236 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
237 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
238 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
239 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
240 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
241 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
242 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
243 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
244 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
245 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
246 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
247 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
248 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
249 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
250 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
251 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
252 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
253 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
254 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
255 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
256 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
257 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
258 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
259 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
260 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
261 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
262 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
263 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
264 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
265 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
266 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
267 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
268 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
269 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
270 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
271 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
272 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
273 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
274 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
275 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
276 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
277 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
278 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
279 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
280 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
281 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
282 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
283 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
285 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
286 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
287 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
288 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
289 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
290 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
291 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
292 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
293 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
294 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
295 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
296 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
297 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
298 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
299 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
300 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
301 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
302 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
303 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
304 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
305 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
306 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
307 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
308 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
309 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
310 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
311 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
312 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
313 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
314 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
315 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
316 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
317 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
318 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
319 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
320 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
321 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
322 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
323 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
324 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.03
Metatranscriptomes 5.97
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.24
Nodule 0
Rhizoplane 2.61
Rhizosphere 95.27
Stem 0
Stem Tuber 0
Unclassified 23.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105242_10998664 3300009176 Bacteria 844
2 MBSR1b_contig_10356506 2162886012 Unclassified 892
3 Ga0006759J45824_1038821 3300003163 Unclassified 694
4 Ga0007417J51691_1071657 3300003544 Unclassified 657
5 Ga0007410J51695_1057420 3300003574 Unclassified 682
6 Ga0007429J51699_1036734 3300003579 Bacteria 706
7 Ga0058858_1255844 3300004785 Unclassified 626
8 Ga0058859_11181009 3300004798 Bacteria 645
9 Ga0058859_11504821 3300004798 Unclassified 604
10 Ga0058863_11264835 3300004799 Bacteria 512
11 Ga0058863_11276762 3300004799 Unclassified 678
12 Ga0058863_11927408 3300004799 Bacteria 574
13 Ga0058861_11005037 3300004800 Unclassified 562
14 Ga0058861_11491729 3300004800 Unclassified 687
15 Ga0058861_11995523 3300004800 Bacteria 685
16 Ga0058860_10697049 3300004801 Bacteria 692
17 Ga0058860_11718403 3300004801 Unclassified 701
18 Ga0058860_12129691 3300004801 Bacteria 1020
19 Ga0058860_12158928 3300004801 Bacteria 581
20 Ga0058862_10064583 3300004803 Bacteria 660
21 Ga0058862_12054686 3300004803 Unclassified 669
22 Ga0058862_12169228 3300004803 Unclassified 841
23 Ga0058862_12225975 3300004803 Unclassified 828
24 Ga0058862_12708746 3300004803 Bacteria 1146
25 Ga0058862_12722842 3300004803 Unclassified 527
26 Ga0058862_12820653 3300004803 Bacteria 747
27 Ga0065704_10229588 3300005289 Unclassified 1047
28 Ga0065712_10001802 3300005290 Bacteria 5422
29 Ga0065712_10126717 3300005290 Bacteria 1599
30 Ga0065715_10001231 3300005293 Bacteria 10358
31 Ga0065715_10392888 3300005293 Unclassified 892
32 Ga0065707_10117309 3300005295 Bacteria 2214
33 Ga0065707_10191049 3300005295 Unclassified 1361
34 Ga0065707_10502626 3300005295 Unclassified 756
35 Ga0070658_10136756 3300005327 Bacteria 2045
36 Ga0070676_10036933 3300005328 Bacteria 2815
37 Ga0070676_10196186 3300005328 Bacteria 1321
38 Ga0070676_10659573 3300005328 Unclassified 760
39 Ga0070683_100153324 3300005329 Unclassified 2185
40 Ga0070683_100906927 3300005329 Bacteria 845
41 Ga0070690_100036635 3300005330 Bacteria 3085
42 Ga0070690_100953512 3300005330 Unclassified 674
43 Ga0070670_100001751 3300005331 Bacteria 17679
44 Ga0070670_100003113 3300005331 Bacteria 13725
45 Ga0070670_100094586 3300005331 Bacteria 2570
46 Ga0070670_100335537 3300005331 Unclassified 1326
47 Ga0070677_10391272 3300005333 Bacteria 730
48 Ga0068869_100003870 3300005334 Bacteria 9235
49 Ga0068869_100140454 3300005334 Bacteria 1865
50 Ga0068869_100620290 3300005334 Bacteria 915
51 Ga0068869_100989205 3300005334 Bacteria 732
52 Ga0070666_10043556 3300005335 Bacteria 3006
53 Ga0070666_10120736 3300005335 Bacteria 1817
54 Ga0070666_10272202 3300005335 Unclassified 1202
55 Ga0070666_10279284 3300005335 Bacteria 1187
56 Ga0070680_100025350 3300005336 Bacteria 4739
57 Ga0070680_100115362 3300005336 Bacteria 2238
58 Ga0070680_100686407 3300005336 Unclassified 881
59 Ga0070682_100055120 3300005337 Bacteria 2496
60 Ga0068868_100094821 3300005338 Bacteria 2408
61 Ga0068868_100143782 3300005338 Bacteria 1960
62 Ga0068868_100248991 3300005338 Unclassified 1495
63 Ga0068868_100707854 3300005338 Unclassified 901
64 Ga0068868_100757939 3300005338 Bacteria 873
65 Ga0068868_101035089 3300005338 Unclassified 752
66 Ga0070660_100008870 3300005339 Bacteria 7049
67 Ga0070660_100715676 3300005339 Bacteria 840
68 Ga0070689_100097586 3300005340 Bacteria 2324
69 Ga0070687_100154916 3300005343 Bacteria 1349
70 Ga0070687_100300633 3300005343 Unclassified 1018
71 Ga0070687_100775114 3300005343 Bacteria 677
72 Ga0070661_100111999 3300005344 Bacteria 2039
73 Ga0070661_100258609 3300005344 Bacteria 1345
74 Ga0070661_100558425 3300005344 Unclassified 922
75 Ga0070692_10017281 3300005345 Bacteria 3445
76 Ga0070692_10061982 3300005345 Bacteria 1973
77 Ga0070692_10358815 3300005345 Unclassified 908
78 Ga0070668_100023675 3300005347 Bacteria 4647
79 Ga0070668_100107140 3300005347 Bacteria 2221
80 Ga0070669_100022918 3300005353 Bacteria 4466
81 Ga0070669_100139669 3300005353 Unclassified 1867
82 Ga0070669_100652830 3300005353 Bacteria 885
83 Ga0070675_100010762 3300005354 Bacteria 7156
84 Ga0070675_100048458 3300005354 Bacteria 3484
85 Ga0070675_100051932 3300005354 Bacteria 3369
86 Ga0070675_100245972 3300005354 Bacteria 1564
87 Ga0070675_100340150 3300005354 Bacteria 1329
88 Ga0070675_100355987 3300005354 Bacteria 1299
89 Ga0070671_100002770 3300005355 Bacteria 13618
90 Ga0070671_100306655 3300005355 Bacteria 1352
91 Ga0070674_101292628 3300005356 Unclassified 650
92 Ga0070673_100057698 3300005364 Bacteria 3068
93 Ga0070673_100058626 3300005364 Bacteria 3045
94 Ga0070673_100211497 3300005364 Unclassified 1675
95 Ga0070673_100486219 3300005364 Bacteria 1115
96 Ga0070688_100005813 3300005365 Bacteria 6528
97 Ga0070688_100202099 3300005365 Bacteria 1391
98 Ga0070688_100723406 3300005365 Unclassified 773
99 Ga0070688_101211734 3300005365 Bacteria 607
100 Ga0070659_100017657 3300005366 Bacteria 5373
101 Ga0070659_101868158 3300005366 Unclassified 538
102 Ga0070667_100014061 3300005367 Bacteria 6614
103 Ga0070667_100170696 3300005367 Bacteria 1920
104 Ga0070709_10009344 3300005434 Bacteria 5405
105 Ga0070714_100049109 3300005435 Unclassified 3591
106 Ga0070714_101415741 3300005435 Unclassified 679
107 Ga0070713_100040145 3300005436 Bacteria 3804
108 Ga0070713_100056436 3300005436 Bacteria 3267
109 Ga0070713_100300640 3300005436 Bacteria 1477
110 Ga0070701_10147393 3300005438 Bacteria 1352
111 Ga0070711_100238032 3300005439 Bacteria 1422
112 Ga0070705_100308180 3300005440 Bacteria 1138
113 Ga0070705_100687167 3300005440 Unclassified 802
114 Ga0070700_100106884 3300005441 Bacteria 1853
115 Ga0070700_100226175 3300005441 Bacteria 1329
116 Ga0070700_100402661 3300005441 Unclassified 1029
117 Ga0070694_100102576 3300005444 Bacteria 2026
118 Ga0070694_101198863 3300005444 Bacteria 636
119 Ga0070708_101264128 3300005445 Bacteria 690
120 Ga0070663_101460907 3300005455 Bacteria 607
121 Ga0070678_100160904 3300005456 Bacteria 1819
122 Ga0070678_100193990 3300005456 Bacteria 1672
123 Ga0070678_100735583 3300005456 Unclassified 891
124 Ga0070662_100029393 3300005457 Bacteria 3835
125 Ga0070662_100066991 3300005457 Bacteria 2636
126 Ga0070662_100302361 3300005457 Bacteria 1300
127 Ga0070681_10017160 3300005458 Bacteria 7239
128 Ga0070681_10064552 3300005458 Bacteria 3631
129 Ga0070681_10135166 3300005458 Bacteria 2397
130 Ga0070681_10234056 3300005458 Bacteria 1751
131 Ga0070681_10240711 3300005458 Bacteria 1723
132 Ga0070681_10556327 3300005458 Bacteria 1061
133 Ga0070681_11245956 3300005458 Unclassified 666
134 Ga0068867_100018150 3300005459 Bacteria 5000
135 Ga0068867_100338957 3300005459 Bacteria 1251
136 Ga0068867_101561195 3300005459 Unclassified 616
137 Ga0070685_10014176 3300005466 Bacteria 4216
138 Ga0070685_10094841 3300005466 Bacteria 1813
139 Ga0070685_10602167 3300005466 Bacteria 791
140 Ga0070706_100036696 3300005467 Unclassified 4528
141 Ga0070706_100734403 3300005467 Bacteria 915
142 Ga0070706_100778928 3300005467 Bacteria 886
143 Ga0070707_100028838 3300005468 Bacteria 5282
144 Ga0070707_100595331 3300005468 Bacteria 1068
145 Ga0070698_100318205 3300005471 Bacteria 1486
146 Ga0070698_101122790 3300005471 Unclassified 735
147 Ga0070699_100004274 3300005518 Bacteria 12627
148 Ga0070699_100075013 3300005518 Bacteria 2943
149 Ga0070699_100123110 3300005518 Bacteria 2281
150 Ga0070699_100173239 3300005518 Bacteria 1913
151 Ga0070679_100019055 3300005530 Bacteria 6666
152 Ga0070679_100029638 3300005530 Bacteria 5399
153 Ga0070679_100254257 3300005530 Bacteria 1713
154 Ga0070679_100535011 3300005530 Bacteria 1115
155 Ga0070684_100030432 3300005535 Bacteria 4586
156 Ga0070684_100037712 3300005535 Bacteria 4148
157 Ga0070684_100306801 3300005535 Bacteria 1457
158 Ga0070697_100172562 3300005536 Bacteria 1831
159 Ga0070697_101100796 3300005536 Unclassified 707
160 Ga0068853_100041973 3300005539 Bacteria 3909
161 Ga0068853_100162889 3300005539 Bacteria 2014
162 Ga0068853_100182109 3300005539 Bacteria 1906
163 Ga0068853_100410229 3300005539 Bacteria 1269
164 Ga0070672_100024144 3300005543 Bacteria 4488
165 Ga0070672_100046952 3300005543 Bacteria 3349
166 Ga0070672_100119957 3300005543 Bacteria 2152
167 Ga0070686_100000585 3300005544 Bacteria 21569
168 Ga0070686_100226499 3300005544 Bacteria 1354
169 Ga0070695_100005045 3300005545 Bacteria 7780
170 Ga0070695_100159441 3300005545 Bacteria 1582
171 Ga0070696_101527277 3300005546 Unclassified 572
172 Ga0070693_100189428 3300005547 Bacteria 1329
173 Ga0070693_100273331 3300005547 Bacteria 1129
174 Ga0070665_100015348 3300005548 Bacteria 7692
175 Ga0070704_100083647 3300005549 Bacteria 2356
176 Ga0070704_100298398 3300005549 Bacteria 1341
177 Ga0068855_100048335 3300005563 Bacteria 5021
178 Ga0068855_100098555 3300005563 Bacteria 3367
179 Ga0068855_100132855 3300005563 Bacteria 2841
180 Ga0068855_100572976 3300005563 Unclassified 1220
181 Ga0068855_101858954 3300005563 Unclassified 611
182 Ga0070664_100087492 3300005564 Unclassified 2694
183 Ga0070664_100098641 3300005564 Bacteria 2538
184 Ga0070664_100111867 3300005564 Bacteria 2384
185 Ga0068857_100164975 3300005577 Bacteria 2011
186 Ga0068854_100014011 3300005578 Bacteria 5276
187 Ga0068854_100512459 3300005578 Unclassified 1012
188 Ga0068854_101541141 3300005578 Unclassified 604
189 Ga0068856_100034186 3300005614 Bacteria 4979
190 Ga0068856_100069503 3300005614 Bacteria 3482
191 Ga0070702_100029161 3300005615 Bacteria 2998
192 Ga0070702_100770244 3300005615 Bacteria 741
193 Ga0070702_100790022 3300005615 Bacteria 733
194 Ga0068852_100122399 3300005616 Bacteria 2385
195 Ga0068852_101896349 3300005616 Bacteria 618
196 Ga0068859_100003436 3300005617 Bacteria 16113
197 Ga0068859_100422910 3300005617 Bacteria 1428
198 Ga0068859_100825288 3300005617 Bacteria 1014
199 Ga0068859_101903620 3300005617 Unclassified 657
200 Ga0068859_102368923 3300005617 Unclassified 585
201 Ga0068864_100034082 3300005618 Bacteria 4329
202 Ga0068864_100047266 3300005618 Bacteria 3695
203 Ga0068864_100233541 3300005618 Bacteria 1702
204 Ga0068864_100359772 3300005618 Unclassified 1375
205 Ga0068864_100519209 3300005618 Bacteria 1148
206 Ga0068866_10384705 3300005718 Unclassified 901
207 Ga0068861_100011861 3300005719 Bacteria 6067
208 Ga0068861_100044938 3300005719 Bacteria 3323
209 Ga0068861_100533180 3300005719 Bacteria 1067
210 Ga0068861_100650330 3300005719 Bacteria 974
211 Ga0068861_100717141 3300005719 Bacteria 931
212 Ga0068861_101107994 3300005719 Unclassified 761
213 Ga0068861_101299782 3300005719 Bacteria 707
214 Ga0068870_10110073 3300005840 Bacteria 1571
215 Ga0068870_10111030 3300005840 Bacteria 1565
216 Ga0068870_10389894 3300005840 Bacteria 904
217 Ga0068863_100017621 3300005841 Bacteria 6842
218 Ga0068863_100303296 3300005841 Bacteria 1549
219 Ga0068863_100978019 3300005841 Unclassified 848
220 Ga0068858_100048003 3300005842 Bacteria 3957
221 Ga0068858_100061433 3300005842 Bacteria 3474
222 Ga0068858_100182698 3300005842 Bacteria 1981
223 Ga0068858_100297515 3300005842 Bacteria 1539
224 Ga0068858_100501011 3300005842 Bacteria 1173
225 Ga0068858_100845930 3300005842 Bacteria 893
226 Ga0068860_100024214 3300005843 Bacteria 5870
227 Ga0068860_100122808 3300005843 Bacteria 2488
228 Ga0068860_100841332 3300005843 Bacteria 932
229 Ga0068860_100966194 3300005843 Unclassified 869
230 Ga0068860_101577473 3300005843 Unclassified 678
231 Ga0068862_100005907 3300005844 Bacteria 10194
232 Ga0068862_100014749 3300005844 Bacteria 6489
233 Ga0068862_100123239 3300005844 Bacteria 2286
234 Ga0068862_100199404 3300005844 Bacteria 1804
235 Ga0068862_100269097 3300005844 Bacteria 1558
236 Ga0068862_100482166 3300005844 Unclassified 1174
237 Ga0068862_100915916 3300005844 Bacteria 863
238 Ga0081455_10137689 3300005937 Bacteria 1900
239 Ga0081455_10282802 3300005937 Bacteria 1198
240 Ga0075368_10132114 3300006042 Bacteria 1038
241 Ga0075363_100079002 3300006048 Bacteria 1797
242 Ga0070715_10302604 3300006163 Bacteria 856
243 Ga0070716_100581245 3300006173 Bacteria 840
244 Ga0070716_100646663 3300006173 Unclassified 801
245 Ga0075362_10004483 3300006177 Bacteria 5027
246 Ga0075366_10003816 3300006195 Bacteria 8019
247 Ga0097621_100050231 3300006237 Bacteria 3391
248 Ga0097621_100202673 3300006237 Bacteria 1723
249 Ga0097621_100248302 3300006237 Bacteria 1557
250 Ga0097621_100441334 3300006237 Unclassified 1171
251 Ga0075370_10071689 3300006353 Bacteria 1982
252 Ga0068871_100192315 3300006358 Unclassified 1758
253 Ga0068871_100330831 3300006358 Bacteria 1343
254 Ga0068871_100635663 3300006358 Bacteria 973
255 Ga0068871_100759055 3300006358 Bacteria 892
256 Ga0075428_100021227 3300006844 Bacteria 7190
257 Ga0075428_100197758 3300006844 Bacteria 2174
258 Ga0075428_100203902 3300006844 Unclassified 2137
259 Ga0075430_100250945 3300006846 Unclassified 1466
260 Ga0075431_100010528 3300006847 Bacteria 9297
261 Ga0075431_100033904 3300006847 Bacteria 5261
262 Ga0075431_100084723 3300006847 Unclassified 3272
263 Ga0075431_100283708 3300006847 Bacteria 1676
264 Ga0075431_101092081 3300006847 Bacteria 763
265 Ga0075433_10011821 3300006852 Bacteria 7031
266 Ga0075433_10021643 3300006852 Bacteria 5394
267 Ga0075433_10053706 3300006852 Bacteria 3513
268 Ga0075433_10054692 3300006852 Bacteria 3482
269 Ga0075433_10085736 3300006852 Bacteria 2780
270 Ga0075433_10207637 3300006852 Bacteria 1741
271 Ga0075433_10804096 3300006852 Bacteria 821
272 Ga0075434_100006157 3300006871 Bacteria 10985
273 Ga0075434_100026633 3300006871 Bacteria 5667
274 Ga0075434_100033027 3300006871 Bacteria 5105
275 Ga0075434_100061722 3300006871 Bacteria 3730
276 Ga0075434_100187346 3300006871 Bacteria 2090
277 Ga0075434_100647013 3300006871 Bacteria 1075
278 Ga0075434_100979397 3300006871 Unclassified 860
279 Ga0075434_101074641 3300006871 Bacteria 818
280 Ga0075429_100347479 3300006880 Bacteria 1298
281 Ga0075429_101131370 3300006880 Unclassified 684
282 Ga0068865_100421885 3300006881 Unclassified 1097
283 Ga0075436_100052804 3300006914 Bacteria 2805
284 Ga0075436_100215981 3300006914 Bacteria 1360
285 Ga0075436_100651170 3300006914 Unclassified 778
286 Ga0097620_100003436 3300006931 Bacteria 16113
287 Ga0097620_100422891 3300006931 Bacteria 1428
288 Ga0097620_100825201 3300006931 Bacteria 1014
289 Ga0097620_101903188 3300006931 Unclassified 657
290 Ga0097620_102369560 3300006931 Unclassified 585
291 Ga0075435_100008138 3300007076 Bacteria 7508
292 Ga0075435_100015843 3300007076 Bacteria 5674
293 Ga0075435_100406370 3300007076 Unclassified 1171
294 Ga0075435_100499794 3300007076 Bacteria 1051
295 Ga0075435_100500065 3300007076 Bacteria 1051
296 Ga0075435_100521903 3300007076 Bacteria 1027
297 Ga0075435_100636949 3300007076 Bacteria 925
298 Ga0075435_100645202 3300007076 Bacteria 919
299 Ga0075435_100974832 3300007076 Unclassified 740
300 Ga0105240_10039478 3300009093 Bacteria 6045
301 Ga0105240_10162766 3300009093 Bacteria 2649
302 Ga0105240_10238042 3300009093 Bacteria 2112
303 Ga0111539_10001691 3300009094 Bacteria 29431
304 Ga0111539_10036767 3300009094 Bacteria 5917
305 Ga0111539_10222086 3300009094 Bacteria 2200
306 Ga0111539_10602484 3300009094 Bacteria 1279
307 Ga0111539_11785740 3300009094 Unclassified 713
308 Ga0105245_10002600 3300009098 Bacteria 16264
309 Ga0105245_10078639 3300009098 Bacteria 3010
310 Ga0105245_10111201 3300009098 Bacteria 2547
311 Ga0105245_10230611 3300009098 Bacteria 1791
312 Ga0105245_10383136 3300009098 Bacteria 1401
313 Ga0105245_10638975 3300009098 Unclassified 1094
314 Ga0105245_10874204 3300009098 Bacteria 940
315 Ga0105247_10088558 3300009101 Bacteria 1962
316 Ga0114129_10000493 3300009147 Bacteria 47834
317 Ga0114129_10009447 3300009147 Bacteria 13899
318 Ga0114129_10017128 3300009147 Bacteria 10319
319 Ga0114129_10025230 3300009147 Bacteria 8421
320 Ga0114129_10035265 3300009147 Bacteria 7068
321 Ga0114129_10048849 3300009147 Bacteria 5947
322 Ga0114129_10053521 3300009147 Bacteria 5661
323 Ga0114129_10066051 3300009147 Bacteria 5046
324 Ga0114129_10204371 3300009147 Bacteria 2673
325 Ga0114129_10455527 3300009147 Bacteria 1677
326 Ga0114129_10590619 3300009147 Bacteria 1440
327 Ga0114129_10928534 3300009147 Bacteria 1101
328 Ga0105241_10055437 3300009174 Bacteria 3037
329 Ga0105241_10373792 3300009174 Bacteria 1243
330 Ga0105241_10774669 3300009174 Bacteria 882
331 Ga0105242_10492541 3300009176 Bacteria 1164
332 Ga0105248_10001497 3300009177 Bacteria 26012
333 Ga0105248_10011179 3300009177 Bacteria 9901
334 Ga0105248_10012057 3300009177 Bacteria 9534
335 Ga0105248_10027283 3300009177 Bacteria 6356
336 Ga0105248_10334214 3300009177 Bacteria 1706
337 Ga0105248_11281933 3300009177 Bacteria 829
338 Ga0105248_11954284 3300009177 Unclassified 666
339 Ga0105237_10724751 3300009545 Bacteria 1001
340 Ga0105238_10267627 3300009551 Unclassified 1689
341 Ga0105238_10658656 3300009551 Bacteria 1057
342 Ga0105249_10006650 3300009553 Bacteria 10062
343 Ga0105249_10203001 3300009553 Bacteria 1941
344 Ga0105249_10398073 3300009553 Bacteria 1407
345 Ga0105249_10742394 3300009553 Bacteria 1043
346 Ga0105249_11554253 3300009553 Unclassified 734
347 Ga0105249_12749306 3300009553 Unclassified 564
348 Ga0105239_10137623 3300010375 Bacteria 2719
349 Ga0105239_10166156 3300010375 Bacteria 2467
350 Ga0105239_10453742 3300010375 Unclassified 1454
351 Ga0105246_10187195 3300011119 Bacteria 1599
352 Ga0157371_10167771 3300013102 Bacteria 1568
353 Ga0157369_10103256 3300013105 Unclassified 3037
354 Ga0157374_10053909 3300013296 Bacteria 3750
355 Ga0157374_10437570 3300013296 Bacteria 1308
356 Ga0157378_10018415 3300013297 Bacteria 6132
357 Ga0157378_10366884 3300013297 Bacteria 1411
358 Ga0157378_11094986 3300013297 Bacteria 833
359 Ga0163162_10026672 3300013306 Bacteria 5711
360 Ga0163162_10103200 3300013306 Bacteria 2945
361 Ga0163162_10748484 3300013306 Bacteria 1097
362 Ga0157372_10002255 3300013307 Bacteria 20900
363 Ga0157372_10034076 3300013307 Bacteria 5596
364 Ga0157372_10096543 3300013307 Bacteria 3368
365 Ga0157372_10103378 3300013307 Unclassified 3255
366 Ga0157372_11682688 3300013307 Bacteria 730
367 Ga0157375_10104548 3300013308 Bacteria 2920
368 Ga0157375_10124923 3300013308 Bacteria 2687
369 Ga0157375_10291916 3300013308 Bacteria 1794
370 Ga0157375_10629812 3300013308 Bacteria 1230
371 Ga0157375_10807018 3300013308 Bacteria 1087
372 Ga0163163_10000028 3300014325 Bacteria 176878
373 Ga0163163_11959730 3300014325 Unclassified 646
374 Ga0157380_10033933 3300014326 Bacteria 3933
375 Ga0157380_10085548 3300014326 Bacteria 2588
376 Ga0157380_10590749 3300014326 Unclassified 1097
377 Ga0157380_10936622 3300014326 Unclassified 895
378 Ga0157380_10982162 3300014326 Unclassified 876
379 Ga0182008_10214681 3300014497 Unclassified 983
380 Ga0157377_10007063 3300014745 Bacteria 5394
381 Ga0157377_10011438 3300014745 Bacteria 4430
382 Ga0157379_10029916 3300014968 Unclassified 4844
383 Ga0157379_10044383 3300014968 Bacteria 3968
384 Ga0157379_10128924 3300014968 Bacteria 2276
385 Ga0157379_11696001 3300014968 Unclassified 619
386 Ga0157376_10049342 3300014969 Bacteria 3485
387 Ga0157376_10091958 3300014969 Bacteria 2629
388 Ga0157376_10282344 3300014969 Bacteria 1564
389 Ga0157376_10989466 3300014969 Bacteria 863
390 Ga0157376_11493906 3300014969 Bacteria 708
391 Ga0182007_10188696 3300015262 Bacteria 716
392 Ga0197907_10458588 3300020069 Unclassified 608
393 Ga0197907_10929651 3300020069 Bacteria 592
394 Ga0206356_10541662 3300020070 Unclassified 678
395 Ga0206356_10921023 3300020070 Bacteria 680
396 Ga0206352_10931094 3300020078 Unclassified 609
397 Ga0206352_10972584 3300020078 Unclassified 663
398 Ga0206350_10079179 3300020080 Unclassified 523
399 Ga0206350_10371649 3300020080 Unclassified 629
400 Ga0206350_10772824 3300020080 Bacteria 601
401 Ga0206354_11619177 3300020081 Bacteria 590
402 Ga0154015_1414151 3300020610 Bacteria 593
403 Ga0224712_10319697 3300022467 Unclassified 729
404 Ga0224712_10502310 3300022467 Bacteria 586
405 Ga0207697_10407439 3300025315 Unclassified 604
406 Ga0207642_10046033 3300025899 Bacteria 1941
407 Ga0207710_10149111 3300025900 Unclassified 1133
408 Ga0207680_10075634 3300025903 Bacteria 2100
409 Ga0207680_10163696 3300025903 Bacteria 1494
410 Ga0207699_10030273 3300025906 Bacteria 3027
411 Ga0207699_10293557 3300025906 Unclassified 1133
412 Ga0207699_10335547 3300025906 Bacteria 1064
413 Ga0207645_10288592 3300025907 Bacteria 1091
414 Ga0207643_10116497 3300025908 Bacteria 1578
415 Ga0207643_10542550 3300025908 Unclassified 746
416 Ga0207705_10919441 3300025909 Unclassified 677
417 Ga0207684_10005989 3300025910 Bacteria 11124
418 Ga0207684_10456112 3300025910 Unclassified 1097
419 Ga0207684_10952737 3300025910 Bacteria 720
420 Ga0207654_10357412 3300025911 Bacteria 1007
421 Ga0207707_10012655 3300025912 Bacteria 7332
422 Ga0207707_10023166 3300025912 Bacteria 5433
423 Ga0207707_10124746 3300025912 Bacteria 2252
424 Ga0207707_10139874 3300025912 Bacteria 2117
425 Ga0207707_10376229 3300025912 Bacteria 1221
426 Ga0207707_10383600 3300025912 Unclassified 1208
427 Ga0207707_10787237 3300025912 Unclassified 793
428 Ga0207707_11205117 3300025912 Unclassified 612
429 Ga0207695_10358925 3300025913 Bacteria 1344
430 Ga0207695_10395529 3300025913 Bacteria 1267
431 Ga0207671_10606631 3300025914 Bacteria 872
432 Ga0207663_10513734 3300025916 Unclassified 932
433 Ga0207663_10591145 3300025916 Bacteria 871
434 Ga0207660_10042448 3300025917 Bacteria 3193
435 Ga0207660_10373033 3300025917 Bacteria 1146
436 Ga0207662_10147115 3300025918 Bacteria 1496
437 Ga0207662_10216144 3300025918 Bacteria 1246
438 Ga0207657_10013298 3300025919 Bacteria 8074
439 Ga0207657_10013972 3300025919 Bacteria 7855
440 Ga0207657_10155695 3300025919 Bacteria 1858
441 Ga0207649_10023215 3300025920 Bacteria 3590
442 Ga0207649_10036754 3300025920 Bacteria 2953
443 Ga0207649_10390296 3300025920 Unclassified 1039
444 Ga0207652_10008883 3300025921 Bacteria 8095
445 Ga0207652_10041690 3300025921 Bacteria 3904
446 Ga0207652_10098406 3300025921 Bacteria 2580
447 Ga0207652_10316974 3300025921 Bacteria 1408
448 Ga0207646_10004566 3300025922 Bacteria 14978
449 Ga0207646_10045887 3300025922 Bacteria 3921
450 Ga0207646_10398345 3300025922 Bacteria 1243
451 Ga0207681_10010601 3300025923 Bacteria 5651
452 Ga0207681_10158064 3300025923 Bacteria 1705
453 Ga0207681_10159498 3300025923 Bacteria 1699
454 Ga0207681_10203265 3300025923 Unclassified 1522
455 Ga0207681_10456155 3300025923 Unclassified 1041
456 Ga0207694_11131575 3300025924 Bacteria 662
457 Ga0207650_10014296 3300025925 Bacteria 5515
458 Ga0207650_10146195 3300025925 Bacteria 1862
459 Ga0207659_10000241 3300025926 Bacteria 33277
460 Ga0207659_10037792 3300025926 Bacteria 3354
461 Ga0207659_10119322 3300025926 Bacteria 2019
462 Ga0207659_10198534 3300025926 Bacteria 1600
463 Ga0207659_10277484 3300025926 Bacteria 1369
464 Ga0207659_10785200 3300025926 Bacteria 818
465 Ga0207659_10868535 3300025926 Unclassified 775
466 Ga0207687_10013479 3300025927 Bacteria 5337
467 Ga0207687_10105923 3300025927 Bacteria 2078
468 Ga0207687_10168070 3300025927 Bacteria 1689
469 Ga0207687_10621825 3300025927 Bacteria 912
470 Ga0207700_10187357 3300025928 Bacteria 1737
471 Ga0207664_10297863 3300025929 Bacteria 1418
472 Ga0207644_10018083 3300025931 Bacteria 4766
473 Ga0207690_10061708 3300025932 Bacteria 2549
474 Ga0207690_10238442 3300025932 Bacteria 1400
475 Ga0207706_10039720 3300025933 Bacteria 4173
476 Ga0207706_10058566 3300025933 Bacteria 3393
477 Ga0207706_10070825 3300025933 Bacteria 3067
478 Ga0207706_10236373 3300025933 Bacteria 1598
479 Ga0207706_10349651 3300025933 Bacteria 1285
480 Ga0207706_10505258 3300025933 Bacteria 1043
481 Ga0207706_10681761 3300025933 Bacteria 879
482 Ga0207686_10347400 3300025934 Bacteria 1116
483 Ga0207686_10568887 3300025934 Unclassified 888
484 Ga0207686_11321392 3300025934 Unclassified 592
485 Ga0207670_10071524 3300025936 Bacteria 2399
486 Ga0207670_10212000 3300025936 Bacteria 1478
487 Ga0207670_10429279 3300025936 Unclassified 1062
488 Ga0207669_10178464 3300025937 Bacteria 1520
489 Ga0207669_10442884 3300025937 Unclassified 1028
490 Ga0207669_10914027 3300025937 Unclassified 734
491 Ga0207665_10550860 3300025939 Unclassified 896
492 Ga0207691_10009081 3300025940 Bacteria 9542
493 Ga0207691_10049074 3300025940 Bacteria 3868
494 Ga0207691_10167927 3300025940 Unclassified 1922
495 Ga0207711_10036335 3300025941 Bacteria 4180
496 Ga0207711_10063489 3300025941 Bacteria 3188
497 Ga0207711_10088436 3300025941 Bacteria 2720
498 Ga0207711_10301695 3300025941 Bacteria 1477
499 Ga0207711_10508220 3300025941 Bacteria 1123
500 Ga0207689_10001921 3300025942 Bacteria 19651
501 Ga0207689_10045415 3300025942 Bacteria 3632
502 Ga0207661_10048243 3300025944 Bacteria 3383
503 Ga0207679_10008433 3300025945 Bacteria 6566
504 Ga0207667_10040844 3300025949 Bacteria 4937
505 Ga0207667_10057122 3300025949 Bacteria 4097
506 Ga0207667_10143521 3300025949 Bacteria 2458
507 Ga0207651_10031379 3300025960 Bacteria 3396
508 Ga0207651_10033664 3300025960 Bacteria 3308
509 Ga0207651_10047080 3300025960 Bacteria 2905
510 Ga0207651_10165906 3300025960 Unclassified 1736
511 Ga0207651_10483388 3300025960 Unclassified 1068
512 Ga0207712_10148823 3300025961 Bacteria 1806
513 Ga0207712_10350664 3300025961 Bacteria 1227
514 Ga0207668_10307126 3300025972 Bacteria 1311
515 Ga0207668_11353037 3300025972 Unclassified 641
516 Ga0207640_10033140 3300025981 Bacteria 3211
517 Ga0207640_10080166 3300025981 Bacteria 2227
518 Ga0207640_10111697 3300025981 Bacteria 1939
519 Ga0207640_10511638 3300025981 Bacteria 1002
520 Ga0207640_11856214 3300025981 Bacteria 545
521 Ga0207658_10002738 3300025986 Bacteria 12730
522 Ga0207658_10231367 3300025986 Bacteria 1561
523 Ga0207658_10781912 3300025986 Bacteria 866
524 Ga0207677_10185786 3300026023 Bacteria 1639
525 Ga0207677_10336964 3300026023 Unclassified 1259
526 Ga0207677_10760608 3300026023 Bacteria 864
527 Ga0207703_10012673 3300026035 Bacteria 6574
528 Ga0207703_10085474 3300026035 Bacteria 2640
529 Ga0207703_10301747 3300026035 Bacteria 1461
530 Ga0207703_10312971 3300026035 Bacteria 1436
531 Ga0207703_10452333 3300026035 Bacteria 1200
532 Ga0207639_10126039 3300026041 Bacteria 2112
533 Ga0207639_10183463 3300026041 Bacteria 1782
534 Ga0207639_10540129 3300026041 Bacteria 1069
535 Ga0207678_10085076 3300026067 Bacteria 2704
536 Ga0207708_10066173 3300026075 Bacteria 2763
537 Ga0207708_10392951 3300026075 Unclassified 1145
538 Ga0207708_10829923 3300026075 Bacteria 797
539 Ga0207702_10091159 3300026078 Unclassified 2668
540 Ga0207641_10013763 3300026088 Bacteria 6634
541 Ga0207641_10115140 3300026088 Bacteria 2390
542 Ga0207641_10181409 3300026088 Bacteria 1928
543 Ga0207641_11705658 3300026088 Bacteria 632
544 Ga0207648_10022232 3300026089 Bacteria 5698
545 Ga0207648_10193942 3300026089 Bacteria 1801
546 Ga0207648_10431867 3300026089 Bacteria 1197
547 Ga0207676_10016690 3300026095 Bacteria 5318
548 Ga0207676_10029407 3300026095 Bacteria 4113
549 Ga0207676_10806104 3300026095 Unclassified 916
550 Ga0207676_11737983 3300026095 Bacteria 622
551 Ga0207674_10002852 3300026116 Bacteria 21476
552 Ga0207674_10404867 3300026116 Bacteria 1318
553 Ga0207674_10994080 3300026116 Unclassified 808
554 Ga0207675_100093988 3300026118 Bacteria 2820
555 Ga0207675_100196611 3300026118 Bacteria 1935
556 Ga0207675_100317009 3300026118 Bacteria 1522
557 Ga0207675_100327073 3300026118 Bacteria 1498
558 Ga0207675_100742849 3300026118 Unclassified 992
559 Ga0207675_101040272 3300026118 Bacteria 838
560 Ga0207683_10041807 3300026121 Bacteria 4003
561 Ga0207683_10167775 3300026121 Bacteria 1987
562 Ga0207683_10571275 3300026121 Bacteria 1046
563 Ga0207698_11734276 3300026142 Bacteria 640
564 Ga0209983_1030391 3300027665 Bacteria 1150
565 Ga0209998_10079924 3300027717 Unclassified 791
566 Ga0207428_10000171 3300027907 Bacteria 90460
567 Ga0207428_10087998 3300027907 Bacteria 2416
568 Ga0207428_10276822 3300027907 Bacteria 1246
569 Ga0268266_10977105 3300028379 Bacteria 819
570 Ga0268265_10049961 3300028380 Bacteria 3149
571 Ga0268265_10078707 3300028380 Bacteria 2593
572 Ga0268265_10132450 3300028380 Bacteria 2074
573 Ga0268265_10198292 3300028380 Bacteria 1739
574 Ga0268265_10242156 3300028380 Bacteria 1592
575 Ga0268265_10313612 3300028380 Bacteria 1417
576 Ga0268265_10556772 3300028380 Unclassified 1089
577 Ga0268265_11363133 3300028380 Unclassified 711
578 Ga0268265_11691898 3300028380 Unclassified 638
579 Ga0268264_10022127 3300028381 Bacteria 5189
580 Ga0268264_10051071 3300028381 Unclassified 3445
581 Ga0268264_10099732 3300028381 Bacteria 2521
582 Ga0268264_10114227 3300028381 Bacteria 2370
583 Ga0268264_10583488 3300028381 Bacteria 1100
584 Ga0268264_10797532 3300028381 Unclassified 943
585 Ga0268264_10890333 3300028381 Unclassified 893
586 Ga0307408_100269138 3300031548 Bacteria 1414
587 Ga0307405_10069272 3300031731 Unclassified 2261
588 Ga0307405_10501481 3300031731 Unclassified 973
589 Ga0307410_10498772 3300031852 Bacteria 1001
590 Ga0307410_11583920 3300031852 Unclassified 578
591 Ga0307406_10110420 3300031901 Bacteria 1892
592 Ga0307407_10047451 3300031903 Unclassified 2438
593 Ga0307416_100069548 3300032002 Bacteria 2914
594 Ga0307416_100077977 3300032002 Bacteria 2785
595 Ga0307411_10364458 3300032005 Unclassified 1183
596 Ga0373934_0000084 3300035086 Bacteria 32879
597 Ga0373949_0058199 3300035090 Bacteria 989
598 Ga0373923_0003038 3300035111 Bacteria 5305
599 Ga0373932_0047407 3300035112 Bacteria 1263
600 Ga0373936_0029767 3300035113 Bacteria 2151
601 Ga0373939_0037964 3300035114 Bacteria 1434
602 Ga0373941_0021432 3300035115 Bacteria 1824
603 Ga0373956_0005200 3300035119 Bacteria 5209
604 Ga0373957_0120354 3300035120 Unclassified 1062
605 Ga0373943_0025498 3300035170 Bacteria 2763
606 Ga0373955_0000681 3300035172 Bacteria 14527
607 Ga0373955_0059986 3300035172 Bacteria 2097
608 Ga0373955_0215162 3300035172 Unclassified 1146
609 Ga0373961_0006860 3300035241 Bacteria 2740
610 Ga0373961_0100530 3300035241 Bacteria 936
611 Ga0373924_0031877 3300035410 Unclassified 2121
612 Ga0373924_0425643 3300035410 Unclassified 594
613 Ga0373924_0468199 3300035410 Bacteria 565
614 Ga0373935_0392483 3300035692 Bacteria 995
615 Ga0373933_0004021 3300035724 Bacteria 8105
616 Ga0373933_0080134 3300035724 Bacteria 2001
617 Ga0373933_0169370 3300035724 Unclassified 1389
618 Ga0373947_0155650 3300035725 Bacteria 1475
619 Ga0373947_0226456 3300035725 Unclassified 1230
620 Ga0373947_0847035 3300035725 Unclassified 624
621 Ga0373937_0002980 3300036401 Bacteria 14177
622 Ga0373937_0020345 3300036401 Bacteria 5951
623 Ga0373937_0660158 3300036401 Unclassified 991
624 Ga0373937_1593156 3300036401 Unclassified 600
625 Ga0373925_0030854 3300037068 Bacteria 3936
626 Ga0373925_1085497 3300037068 Unclassified 659
627 Ga0450922_017774 3300042124 Unclassified 719
628 Ga0439435_0158457 3300042436 Bacteria 730
629 Ga0439464_0292677 3300042439 Unclassified 531
630 Ga0451577_0253815 3300042876 Bacteria 1592
631 Ga0451577_0590990 3300042876 Bacteria 1007
632 Ga0451577_1412943 3300042876 Unclassified 617
633 Ga0451576_0023353 3300045051 Bacteria 6696
634 Ga0451576_0090872 3300045051 Bacteria 3176
635 Ga0451576_0489801 3300045051 Bacteria 1292
636 Ga0495592_0001671 3300046454 Bacteria 15546
637 Ga0495629_0162014 3300046459 Unclassified 1554
638 Ga0495629_0618505 3300046459 Unclassified 723
639 Ga0495629_0963614 3300046459 Unclassified 557
640 Ga0495651_0000407 3300046462 Bacteria 33309
641 Ga0495653_0000166 3300046463 Bacteria 54559
642 Ga0495653_0097295 3300046463 Bacteria 2139
643 Ga0495580_0223023 3300046472 Unclassified 1295
644 Ga0495582_0173147 3300046473 Bacteria 1229
645 Ga0495639_0112335 3300046475 Unclassified 1294
646 Ga0495639_0146081 3300046475 Bacteria 1139
647 Ga0495662_0279477 3300046476 Unclassified 822
648 Ga0495664_0099110 3300046477 Unclassified 1755
649 Ga0495608_0009132 3300046511 Bacteria 6931
650 Ga0495608_0024244 3300046511 Bacteria 4151
651 Ga0495608_0278329 3300046511 Bacteria 1039
652 Ga0495628_0003253 3300046516 Bacteria 14544
653 Ga0495628_0100535 3300046516 Bacteria 2232
654 Ga0495628_0185540 3300046516 Bacteria 1572
655 Ga0495630_0000981 3300046517 Bacteria 19836
656 Ga0495630_0060937 3300046517 Bacteria 2833
657 Ga0495630_0340873 3300046517 Bacteria 1147
658 Ga0495652_0001195 3300046529 Bacteria 29128
659 Ga0495586_0060302 3300046535 Bacteria 2063
660 Ga0495587_0000636 3300046536 Bacteria 23625
661 Ga0495621_0040681 3300046539 Bacteria 1630
662 Ga0495645_0001150 3300046543 Bacteria 17954
663 Ga0495645_0002473 3300046543 Bacteria 12551
664 Ga0495645_0020605 3300046543 Bacteria 4761
665 Ga0495645_0175593 3300046543 Unclassified 1471
666 Ga0495667_0014330 3300046559 Bacteria 5355
667 Ga0495667_0080678 3300046559 Bacteria 2115
668 Ga0495656_0615398 3300046615 Bacteria 582
669 Ga0495634_0130442 3300046642 Unclassified 1603
670 Ga0495634_0171336 3300046642 Unclassified 1364
671 Ga0495634_0333575 3300046642 Unclassified 911
672 Ga0495635_0009664 3300046663 Bacteria 6744
673 Ga0495659_0070340 3300046664 Bacteria 1310
674 Ga0495657_0015324 3300046675 Bacteria 5613
675 Ga0495599_0002603 3300046678 Bacteria 10523
676 Ga0495623_0007730 3300046679 Bacteria 6987
677 Ga0495646_0017871 3300046680 Bacteria 4493
678 Ga0495613_0001685 3300046689 Bacteria 16826
679 Ga0495613_0053932 3300046689 Unclassified 2956
680 Ga0495613_0112770 3300046689 Bacteria 1958
681 Ga0495613_0417542 3300046689 Unclassified 913
682 Ga0495670_0353567 3300046691 Bacteria 791
683 Ga0495600_0000211 3300046809 Bacteria 33185
684 Ga0495600_0039864 3300046809 Bacteria 3059
685 Ga0495581_0041484 3300047315 Bacteria 2663
686 Ga0495581_0057282 3300047315 Unclassified 2249
687 Ga0495604_0008250 3300047317 Bacteria 8240
688 Ga0495674_0016798 3300047319 Bacteria 6826
689 Ga0495674_0032754 3300047319 Bacteria 4711
690 Ga0495680_0062548 3300047322 Unclassified 2861
691 Ga0495680_0218137 3300047322 Bacteria 1363
692 Ga0495675_0011793 3300047444 Bacteria 5491
693 Ga0495684_0000093 3300047471 Bacteria 63048
694 Ga0495684_0005975 3300047471 Bacteria 9456
695 Ga0495602_0026118 3300048088 Bacteria 5639
696 Ga0496101_0318165 3300048904 Unclassified 1221
697 Ga0496101_0776799 3300048904 Bacteria 756
698 Ga0496104_0029063 3300048907 Bacteria 5126
699 Ga0496105_1194264 3300048908 Bacteria 560
700 Ga0496106_0053437 3300048909 Bacteria 3051
701 Ga0496106_1133645 3300048909 Unclassified 612
702 Ga0496107_0313451 3300048910 Unclassified 1168
703 Ga0496108_0016082 3300048911 Bacteria 6099
704 Ga0496108_0840652 3300048911 Unclassified 790
705 Ga0496109_0059510 3300048912 Bacteria 3490
706 Ga0496109_0216937 3300048912 Bacteria 1799
707 Ga0496111_0315054 3300048914 Bacteria 1159
708 Ga0496112_0034523 3300048915 Bacteria 4923
709 Ga0496112_0045851 3300048915 Bacteria 4285
710 Ga0496112_0125799 3300048915 Bacteria 2534
711 Ga0496112_0343871 3300048915 Bacteria 1435
712 Ga0496113_0046001 3300048916 Bacteria 3239
713 Ga0496113_0219702 3300048916 Bacteria 1514
714 Ga0496114_0074687 3300048917 Bacteria 2854
715 Ga0496114_0299354 3300048917 Bacteria 1420
716 Ga0496115_0879878 3300048918 Unclassified 692
717 Ga0501034_0002966 3300049571 Bacteria 19668
718 Ga0501067_0153800 3300049583 Bacteria 1281
719 Ga0501069_0461549 3300049585 Bacteria 755
720 Ga0501070_1302230 3300049586 Unclassified 555
721 Ga0501071_0637511 3300049587 Unclassified 820
722 Ga0501073_0657251 3300049589 Bacteria 723
723 Ga0501074_0582734 3300049590 Unclassified 791
724 Ga0501209_153713 3300049656 Unclassified 694
725 Ga0501045_0190941 3300049824 Unclassified 1527
726 nmdc:mga03683_19055_c1 3300050489 Bacteria 2616
727 nmdc:mga00v17_79920_c1 3300050491 Bacteria 2040
728 nmdc:mga06z11_145035_c1 3300050494 Bacteria 1345
729 nmdc:mga07m45_286121_c1 3300050496 Bacteria 959
730 nmdc:mga05p37_109838_c1 3300050507 Unclassified 3392
731 nmdc:mga05p37_11811_c1 3300050507 Bacteria 10409
732 nmdc:mga05p37_12558_c1 3300050507 Bacteria 10113
733 nmdc:mga05p37_135813_c1 3300050507 Bacteria 3016
734 nmdc:mga05p37_25961_c1 3300050507 Bacteria 6819
735 nmdc:mga05p37_36167_c1 3300050507 Bacteria 6059
736 nmdc:mga05p37_44987_c1 3300050507 Bacteria 5431
737 nmdc:mga05p37_714722_c1 3300050507 Unclassified 1111
738 nmdc:mga05p37_81625_c1 3300050507 Bacteria 3983
739 nmdc:mga05p37_89426_c1 3300050507 Bacteria 3795
740 nmdc:mga09592_175220_c1 3300050508 Bacteria 1855
741 nmdc:mga09592_302434_c1 3300050508 Bacteria 1387
742 nmdc:mga09592_648902_c1 3300050508 Bacteria 901
743 nmdc:mga0qj67_388000_c1 3300050509 Bacteria 1127
744 nmdc:mga06r32_15183_c1 3300050510 Bacteria 6995
745 nmdc:mga06r32_157463_c1 3300050510 Bacteria 2253
746 nmdc:mga06r32_224235_c1 3300050510 Bacteria 1868
747 nmdc:mga06r32_364555_c1 3300050510 Bacteria 1428
748 nmdc:mga06r32_542609_c1 3300050510 Bacteria 1137
749 nmdc:mga06r32_58888_c1 3300050510 Bacteria 3692
750 nmdc:mga08y16_1248421_c1 3300050511 Unclassified 712
751 nmdc:mga08y16_438275_c1 3300050511 Bacteria 1334
752 nmdc:mga08y16_61152_c1 3300050511 Bacteria 3933
753 nmdc:mga08y16_695_c1 3300050511 Bacteria 31921
754 nmdc:mga0n895_1079015_c1 3300050512 Bacteria 781
755 nmdc:mga0n895_11567_c1 3300050512 Bacteria 7883
756 nmdc:mga0n895_124518_c1 3300050512 Unclassified 2601
757 nmdc:mga0n895_13030_c1 3300050512 Bacteria 7481
758 nmdc:mga0n895_14561_c1 3300050512 Bacteria 7147
759 nmdc:mga0n895_157390_c1 3300050512 Bacteria 2303
760 nmdc:mga0n895_1877674_c1 3300050512 Bacteria 558
761 nmdc:mga0n895_199302_c1 3300050512 Bacteria 2033
762 nmdc:mga0n895_489746_c1 3300050512 Bacteria 1239
763 nmdc:mga0rr50_262288_c1 3300050513 Bacteria 1438
764 nmdc:mga0rr50_291600_c1 3300050513 Bacteria 1363
765 nmdc:mga0rr50_442795_c1 3300050513 Bacteria 1101
766 nmdc:mga0rr50_679943_c1 3300050513 Unclassified 878
767 nmdc:mga0rr50_713485_c1 3300050513 Unclassified 856
768 nmdc:mga0rr50_973_c1 3300050513 Bacteria 15562
769 nmdc:mga08x19_34977_c1 3300050514 Bacteria 3178
770 nmdc:mga08x19_546080_c1 3300050514 Unclassified 820
771 nmdc:mga0a205_107668_c1 3300050515 Bacteria 2686
772 nmdc:mga0a205_216331_c1 3300050515 Bacteria 1803
773 nmdc:mga0a205_31588_c1 3300050515 Bacteria 5074
774 nmdc:mga0a205_34431_c1 3300050515 Bacteria 4859
775 nmdc:mga0a205_34468_c1 3300050515 Bacteria 4855
776 nmdc:mga0a205_41436_c1 3300050515 Bacteria 4434
777 nmdc:mga0a205_456773_c1 3300050515 Bacteria 1137
778 nmdc:mga0a205_94975_c1 3300050515 Unclassified 2881
779 Ga0495601_0020947 3300053077 Bacteria 3998
780 Ga0495601_0290699 3300053077 Bacteria 1065
781 Ga0495612_0008792 3300053078 Bacteria 4094
782 Ga0495595_0055562 3300053084 Unclassified 1843
783 Ga0495595_0076174 3300053084 Unclassified 1592
784 Ga0495619_0003239 3300053085 Bacteria 10542
785 Ga0495619_0004058 3300053085 Bacteria 9382
786 Ga0495619_0207402 3300053085 Unclassified 1357
787 Ga0495619_0359790 3300053085 Unclassified 1006
788 Ga0500628_085616 3300053129 Bacteria 814
789 Ga0590071_000124 3300059421 Bacteria 21535
790 Ga0590074_002314 3300059423 Bacteria 3125
791 Ga0590075_000578 3300059424 Bacteria 9903
792 Ga0590077_002882 3300059426 Bacteria 3611
793 Ga0590077_034989 3300059426 Bacteria 1105
794 Ga0587073_0054568 3300059492 Unclassified 917
795 Ga0587086_030118 3300059507 Bacteria 793
796 Ga0587091_050899 3300059511 Bacteria 850
797 Ga0587094_062497 3300059513 Bacteria 654
798 Ga0587106_054524 3300059605 Bacteria 718
799 Ga0587115_032684 3300059626 Unclassified 781
800 Ga0587067_088885 3300059640 Bacteria 696
801 Ga0587075_050847 3300059644 Bacteria 723
802 Ga0587078_023000 3300059646 Bacteria 799
803 Ga0587079_039248 3300059647 Bacteria 949
804 Ga0587071_060337 3300060344 Bacteria 805
805 Ga0105242_10998664
806 MBSR1b_contig_10356506
807 Ga0006759J45824_1038821
808 Ga0007417J51691_1071657
809 Ga0007410J51695_1057420
810 Ga0007429J51699_1036734
811 Ga0058858_1255844
812 Ga0058859_11181009
813 Ga0058859_11504821
814 Ga0058863_11264835
815 Ga0058863_11276762
816 Ga0058863_11927408
817 Ga0058861_11005037
818 Ga0058861_11491729
819 Ga0058861_11995523
820 Ga0058860_10697049
821 Ga0058860_11718403
822 Ga0058860_12129691
823 Ga0058860_12158928
824 Ga0058862_10064583
825 Ga0058862_12054686
826 Ga0058862_12169228
827 Ga0058862_12225975
828 Ga0058862_12708746
829 Ga0058862_12722842
830 Ga0058862_12820653
831 Ga0065704_10229588
832 Ga0065712_10001802
833 Ga0065712_10126717
834 Ga0065715_10001231
835 Ga0065715_10392888
836 Ga0065707_10117309
837 Ga0065707_10191049
838 Ga0065707_10502626
839 Ga0070658_10136756
840 Ga0070676_10036933
841 Ga0070676_10196186
842 Ga0070676_10659573
843 Ga0070683_100153324
844 Ga0070683_100906927
845 Ga0070690_100036635
846 Ga0070690_100953512
847 Ga0070670_100001751
848 Ga0070670_100003113
849 Ga0070670_100094586
850 Ga0070670_100335537
851 Ga0070677_10391272
852 Ga0068869_100003870
853 Ga0068869_100140454
854 Ga0068869_100620290
855 Ga0068869_100989205
856 Ga0070666_10043556
857 Ga0070666_10120736
858 Ga0070666_10272202
859 Ga0070666_10279284
860 Ga0070680_100025350
861 Ga0070680_100115362
862 Ga0070680_100686407
863 Ga0070682_100055120
864 Ga0068868_100094821
865 Ga0068868_100143782
866 Ga0068868_100248991
867 Ga0068868_100707854
868 Ga0068868_100757939
869 Ga0068868_101035089
870 Ga0070660_100008870
871 Ga0070660_100715676
872 Ga0070689_100097586
873 Ga0070687_100154916
874 Ga0070687_100300633
875 Ga0070687_100775114
876 Ga0070661_100111999
877 Ga0070661_100258609
878 Ga0070661_100558425
879 Ga0070692_10017281
880 Ga0070692_10061982
881 Ga0070692_10358815
882 Ga0070668_100023675
883 Ga0070668_100107140
884 Ga0070669_100022918
885 Ga0070669_100139669
886 Ga0070669_100652830
887 Ga0070675_100010762
888 Ga0070675_100048458
889 Ga0070675_100051932
890 Ga0070675_100245972
891 Ga0070675_100340150
892 Ga0070675_100355987
893 Ga0070671_100002770
894 Ga0070671_100306655
895 Ga0070674_101292628
896 Ga0070673_100057698
897 Ga0070673_100058626
898 Ga0070673_100211497
899 Ga0070673_100486219
900 Ga0070688_100005813
901 Ga0070688_100202099
902 Ga0070688_100723406
903 Ga0070688_101211734
904 Ga0070659_100017657
905 Ga0070659_101868158
906 Ga0070667_100014061
907 Ga0070667_100170696
908 Ga0070709_10009344
909 Ga0070714_100049109
910 Ga0070714_101415741
911 Ga0070713_100040145
912 Ga0070713_100056436
913 Ga0070713_100300640
914 Ga0070701_10147393
915 Ga0070711_100238032
916 Ga0070705_100308180
917 Ga0070705_100687167
918 Ga0070700_100106884
919 Ga0070700_100226175
920 Ga0070700_100402661
921 Ga0070694_100102576
922 Ga0070694_101198863
923 Ga0070708_101264128
924 Ga0070663_101460907
925 Ga0070678_100160904
926 Ga0070678_100193990
927 Ga0070678_100735583
928 Ga0070662_100029393
929 Ga0070662_100066991
930 Ga0070662_100302361
931 Ga0070681_10017160
932 Ga0070681_10064552
933 Ga0070681_10135166
934 Ga0070681_10234056
935 Ga0070681_10240711
936 Ga0070681_10556327
937 Ga0070681_11245956
938 Ga0068867_100018150
939 Ga0068867_100338957
940 Ga0068867_101561195
941 Ga0070685_10014176
942 Ga0070685_10094841
943 Ga0070685_10602167
944 Ga0070706_100036696
945 Ga0070706_100734403
946 Ga0070706_100778928
947 Ga0070707_100028838
948 Ga0070707_100595331
949 Ga0070698_100318205
950 Ga0070698_101122790
951 Ga0070699_100004274
952 Ga0070699_100075013
953 Ga0070699_100123110
954 Ga0070699_100173239
955 Ga0070679_100019055
956 Ga0070679_100029638
957 Ga0070679_100254257
958 Ga0070679_100535011
959 Ga0070684_100030432
960 Ga0070684_100037712
961 Ga0070684_100306801
962 Ga0070697_100172562
963 Ga0070697_101100796
964 Ga0068853_100041973
965 Ga0068853_100162889
966 Ga0068853_100182109
967 Ga0068853_100410229
968 Ga0070672_100024144
969 Ga0070672_100046952
970 Ga0070672_100119957
971 Ga0070686_100000585
972 Ga0070686_100226499
973 Ga0070695_100005045
974 Ga0070695_100159441
975 Ga0070696_101527277
976 Ga0070693_100189428
977 Ga0070693_100273331
978 Ga0070665_100015348
979 Ga0070704_100083647
980 Ga0070704_100298398
981 Ga0068855_100048335
982 Ga0068855_100098555
983 Ga0068855_100132855
984 Ga0068855_100572976
985 Ga0068855_101858954
986 Ga0070664_100087492
987 Ga0070664_100098641
988 Ga0070664_100111867
989 Ga0068857_100164975
990 Ga0068854_100014011
991 Ga0068854_100512459
992 Ga0068854_101541141
993 Ga0068856_100034186
994 Ga0068856_100069503
995 Ga0070702_100029161
996 Ga0070702_100770244
997 Ga0070702_100790022
998 Ga0068852_100122399
999 Ga0068852_101896349
1000 Ga0068859_100003436
1001 Ga0068859_100422910
1002 Ga0068859_100825288
1003 Ga0068859_101903620
1004 Ga0068859_102368923
1005 Ga0068864_100034082
1006 Ga0068864_100047266
1007 Ga0068864_100233541
1008 Ga0068864_100359772
1009 Ga0068864_100519209
1010 Ga0068866_10384705
1011 Ga0068861_100011861
1012 Ga0068861_100044938
1013 Ga0068861_100533180
1014 Ga0068861_100650330
1015 Ga0068861_100717141
1016 Ga0068861_101107994
1017 Ga0068861_101299782
1018 Ga0068870_10110073
1019 Ga0068870_10111030
1020 Ga0068870_10389894
1021 Ga0068863_100017621
1022 Ga0068863_100303296
1023 Ga0068863_100978019
1024 Ga0068858_100048003
1025 Ga0068858_100061433
1026 Ga0068858_100182698
1027 Ga0068858_100297515
1028 Ga0068858_100501011
1029 Ga0068858_100845930
1030 Ga0068860_100024214
1031 Ga0068860_100122808
1032 Ga0068860_100841332
1033 Ga0068860_100966194
1034 Ga0068860_101577473
1035 Ga0068862_100005907
1036 Ga0068862_100014749
1037 Ga0068862_100123239
1038 Ga0068862_100199404
1039 Ga0068862_100269097
1040 Ga0068862_100482166
1041 Ga0068862_100915916
1042 Ga0081455_10137689
1043 Ga0081455_10282802
1044 Ga0075368_10132114
1045 Ga0075363_100079002
1046 Ga0070715_10302604
1047 Ga0070716_100581245
1048 Ga0070716_100646663
1049 Ga0075362_10004483
1050 Ga0075366_10003816
1051 Ga0097621_100050231
1052 Ga0097621_100202673
1053 Ga0097621_100248302
1054 Ga0097621_100441334
1055 Ga0075370_10071689
1056 Ga0068871_100192315
1057 Ga0068871_100330831
1058 Ga0068871_100635663
1059 Ga0068871_100759055
1060 Ga0075428_100021227
1061 Ga0075428_100197758
1062 Ga0075428_100203902
1063 Ga0075430_100250945
1064 Ga0075431_100010528
1065 Ga0075431_100033904
1066 Ga0075431_100084723
1067 Ga0075431_100283708
1068 Ga0075431_101092081
1069 Ga0075433_10011821
1070 Ga0075433_10021643
1071 Ga0075433_10053706
1072 Ga0075433_10054692
1073 Ga0075433_10085736
1074 Ga0075433_10207637
1075 Ga0075433_10804096
1076 Ga0075434_100006157
1077 Ga0075434_100026633
1078 Ga0075434_100033027
1079 Ga0075434_100061722
1080 Ga0075434_100187346
1081 Ga0075434_100647013
1082 Ga0075434_100979397
1083 Ga0075434_101074641
1084 Ga0075429_100347479
1085 Ga0075429_101131370
1086 Ga0068865_100421885
1087 Ga0075436_100052804
1088 Ga0075436_100215981
1089 Ga0075436_100651170
1090 Ga0097620_100003436
1091 Ga0097620_100422891
1092 Ga0097620_100825201
1093 Ga0097620_101903188
1094 Ga0097620_102369560
1095 Ga0075435_100008138
1096 Ga0075435_100015843
1097 Ga0075435_100406370
1098 Ga0075435_100499794
1099 Ga0075435_100500065
1100 Ga0075435_100521903
1101 Ga0075435_100636949
1102 Ga0075435_100645202
1103 Ga0075435_100974832
1104 Ga0105240_10039478
1105 Ga0105240_10162766
1106 Ga0105240_10238042
1107 Ga0111539_10001691
1108 Ga0111539_10036767
1109 Ga0111539_10222086
1110 Ga0111539_10602484
1111 Ga0111539_11785740
1112 Ga0105245_10002600
1113 Ga0105245_10078639
1114 Ga0105245_10111201
1115 Ga0105245_10230611
1116 Ga0105245_10383136
1117 Ga0105245_10638975
1118 Ga0105245_10874204
1119 Ga0105247_10088558
1120 Ga0114129_10000493
1121 Ga0114129_10009447
1122 Ga0114129_10017128
1123 Ga0114129_10025230
1124 Ga0114129_10035265
1125 Ga0114129_10048849
1126 Ga0114129_10053521
1127 Ga0114129_10066051
1128 Ga0114129_10204371
1129 Ga0114129_10455527
1130 Ga0114129_10590619
1131 Ga0114129_10928534
1132 Ga0105241_10055437
1133 Ga0105241_10373792
1134 Ga0105241_10774669
1135 Ga0105242_10492541
1136 Ga0105248_10001497
1137 Ga0105248_10011179
1138 Ga0105248_10012057
1139 Ga0105248_10027283
1140 Ga0105248_10334214
1141 Ga0105248_11281933
1142 Ga0105248_11954284
1143 Ga0105237_10724751
1144 Ga0105238_10267627
1145 Ga0105238_10658656
1146 Ga0105249_10006650
1147 Ga0105249_10203001
1148 Ga0105249_10398073
1149 Ga0105249_10742394
1150 Ga0105249_11554253
1151 Ga0105249_12749306
1152 Ga0105239_10137623
1153 Ga0105239_10166156
1154 Ga0105239_10453742
1155 Ga0105246_10187195
1156 Ga0157371_10167771
1157 Ga0157369_10103256
1158 Ga0157374_10053909
1159 Ga0157374_10437570
1160 Ga0157378_10018415
1161 Ga0157378_10366884
1162 Ga0157378_11094986
1163 Ga0163162_10026672
1164 Ga0163162_10103200
1165 Ga0163162_10748484
1166 Ga0157372_10002255
1167 Ga0157372_10034076
1168 Ga0157372_10096543
1169 Ga0157372_10103378
1170 Ga0157372_11682688
1171 Ga0157375_10104548
1172 Ga0157375_10124923
1173 Ga0157375_10291916
1174 Ga0157375_10629812
1175 Ga0157375_10807018
1176 Ga0163163_10000028
1177 Ga0163163_11959730
1178 Ga0157380_10033933
1179 Ga0157380_10085548
1180 Ga0157380_10590749
1181 Ga0157380_10936622
1182 Ga0157380_10982162
1183 Ga0182008_10214681
1184 Ga0157377_10007063
1185 Ga0157377_10011438
1186 Ga0157379_10029916
1187 Ga0157379_10044383
1188 Ga0157379_10128924
1189 Ga0157379_11696001
1190 Ga0157376_10049342
1191 Ga0157376_10091958
1192 Ga0157376_10282344
1193 Ga0157376_10989466
1194 Ga0157376_11493906
1195 Ga0182007_10188696
1196 Ga0197907_10458588
1197 Ga0197907_10929651
1198 Ga0206356_10541662
1199 Ga0206356_10921023
1200 Ga0206352_10931094
1201 Ga0206352_10972584
1202 Ga0206350_10079179
1203 Ga0206350_10371649
1204 Ga0206350_10772824
1205 Ga0206354_11619177
1206 Ga0154015_1414151
1207 Ga0224712_10319697
1208 Ga0224712_10502310
1209 Ga0207697_10407439
1210 Ga0207642_10046033
1211 Ga0207710_10149111
1212 Ga0207680_10075634
1213 Ga0207680_10163696
1214 Ga0207699_10030273
1215 Ga0207699_10293557
1216 Ga0207699_10335547
1217 Ga0207645_10288592
1218 Ga0207643_10116497
1219 Ga0207643_10542550
1220 Ga0207705_10919441
1221 Ga0207684_10005989
1222 Ga0207684_10456112
1223 Ga0207684_10952737
1224 Ga0207654_10357412
1225 Ga0207707_10012655
1226 Ga0207707_10023166
1227 Ga0207707_10124746
1228 Ga0207707_10139874
1229 Ga0207707_10376229
1230 Ga0207707_10383600
1231 Ga0207707_10787237
1232 Ga0207707_11205117
1233 Ga0207695_10358925
1234 Ga0207695_10395529
1235 Ga0207671_10606631
1236 Ga0207663_10513734
1237 Ga0207663_10591145
1238 Ga0207660_10042448
1239 Ga0207660_10373033
1240 Ga0207662_10147115
1241 Ga0207662_10216144
1242 Ga0207657_10013298
1243 Ga0207657_10013972
1244 Ga0207657_10155695
1245 Ga0207649_10023215
1246 Ga0207649_10036754
1247 Ga0207649_10390296
1248 Ga0207652_10008883
1249 Ga0207652_10041690
1250 Ga0207652_10098406
1251 Ga0207652_10316974
1252 Ga0207646_10004566
1253 Ga0207646_10045887
1254 Ga0207646_10398345
1255 Ga0207681_10010601
1256 Ga0207681_10158064
1257 Ga0207681_10159498
1258 Ga0207681_10203265
1259 Ga0207681_10456155
1260 Ga0207694_11131575
1261 Ga0207650_10014296
1262 Ga0207650_10146195
1263 Ga0207659_10000241
1264 Ga0207659_10037792
1265 Ga0207659_10119322
1266 Ga0207659_10198534
1267 Ga0207659_10277484
1268 Ga0207659_10785200
1269 Ga0207659_10868535
1270 Ga0207687_10013479
1271 Ga0207687_10105923
1272 Ga0207687_10168070
1273 Ga0207687_10621825
1274 Ga0207700_10187357
1275 Ga0207664_10297863
1276 Ga0207644_10018083
1277 Ga0207690_10061708
1278 Ga0207690_10238442
1279 Ga0207706_10039720
1280 Ga0207706_10058566
1281 Ga0207706_10070825
1282 Ga0207706_10236373
1283 Ga0207706_10349651
1284 Ga0207706_10505258
1285 Ga0207706_10681761
1286 Ga0207686_10347400
1287 Ga0207686_10568887
1288 Ga0207686_11321392
1289 Ga0207670_10071524
1290 Ga0207670_10212000
1291 Ga0207670_10429279
1292 Ga0207669_10178464
1293 Ga0207669_10442884
1294 Ga0207669_10914027
1295 Ga0207665_10550860
1296 Ga0207691_10009081
1297 Ga0207691_10049074
1298 Ga0207691_10167927
1299 Ga0207711_10036335
1300 Ga0207711_10063489
1301 Ga0207711_10088436
1302 Ga0207711_10301695
1303 Ga0207711_10508220
1304 Ga0207689_10001921
1305 Ga0207689_10045415
1306 Ga0207661_10048243
1307 Ga0207679_10008433
1308 Ga0207667_10040844
1309 Ga0207667_10057122
1310 Ga0207667_10143521
1311 Ga0207651_10031379
1312 Ga0207651_10033664
1313 Ga0207651_10047080
1314 Ga0207651_10165906
1315 Ga0207651_10483388
1316 Ga0207712_10148823
1317 Ga0207712_10350664
1318 Ga0207668_10307126
1319 Ga0207668_11353037
1320 Ga0207640_10033140
1321 Ga0207640_10080166
1322 Ga0207640_10111697
1323 Ga0207640_10511638
1324 Ga0207640_11856214
1325 Ga0207658_10002738
1326 Ga0207658_10231367
1327 Ga0207658_10781912
1328 Ga0207677_10185786
1329 Ga0207677_10336964
1330 Ga0207677_10760608
1331 Ga0207703_10012673
1332 Ga0207703_10085474
1333 Ga0207703_10301747
1334 Ga0207703_10312971
1335 Ga0207703_10452333
1336 Ga0207639_10126039
1337 Ga0207639_10183463
1338 Ga0207639_10540129
1339 Ga0207678_10085076
1340 Ga0207708_10066173
1341 Ga0207708_10392951
1342 Ga0207708_10829923
1343 Ga0207702_10091159
1344 Ga0207641_10013763
1345 Ga0207641_10115140
1346 Ga0207641_10181409
1347 Ga0207641_11705658
1348 Ga0207648_10022232
1349 Ga0207648_10193942
1350 Ga0207648_10431867
1351 Ga0207676_10016690
1352 Ga0207676_10029407
1353 Ga0207676_10806104
1354 Ga0207676_11737983
1355 Ga0207674_10002852
1356 Ga0207674_10404867
1357 Ga0207674_10994080
1358 Ga0207675_100093988
1359 Ga0207675_100196611
1360 Ga0207675_100317009
1361 Ga0207675_100327073
1362 Ga0207675_100742849
1363 Ga0207675_101040272
1364 Ga0207683_10041807
1365 Ga0207683_10167775
1366 Ga0207683_10571275
1367 Ga0207698_11734276
1368 Ga0209983_1030391
1369 Ga0209998_10079924
1370 Ga0207428_10000171
1371 Ga0207428_10087998
1372 Ga0207428_10276822
1373 Ga0268266_10977105
1374 Ga0268265_10049961
1375 Ga0268265_10078707
1376 Ga0268265_10132450
1377 Ga0268265_10198292
1378 Ga0268265_10242156
1379 Ga0268265_10313612
1380 Ga0268265_10556772
1381 Ga0268265_11363133
1382 Ga0268265_11691898
1383 Ga0268264_10022127
1384 Ga0268264_10051071
1385 Ga0268264_10099732
1386 Ga0268264_10114227
1387 Ga0268264_10583488
1388 Ga0268264_10797532
1389 Ga0268264_10890333
1390 Ga0307408_100269138
1391 Ga0307405_10069272
1392 Ga0307405_10501481
1393 Ga0307410_10498772
1394 Ga0307410_11583920
1395 Ga0307406_10110420
1396 Ga0307407_10047451
1397 Ga0307416_100069548
1398 Ga0307416_100077977
1399 Ga0307411_10364458
1400 Ga0373934_0000084
1401 Ga0373949_0058199
1402 Ga0373923_0003038
1403 Ga0373932_0047407
1404 Ga0373936_0029767
1405 Ga0373939_0037964
1406 Ga0373941_0021432
1407 Ga0373956_0005200
1408 Ga0373957_0120354
1409 Ga0373943_0025498
1410 Ga0373955_0000681
1411 Ga0373955_0059986
1412 Ga0373955_0215162
1413 Ga0373961_0006860
1414 Ga0373961_0100530
1415 Ga0373924_0031877
1416 Ga0373924_0425643
1417 Ga0373924_0468199
1418 Ga0373935_0392483
1419 Ga0373933_0004021
1420 Ga0373933_0080134
1421 Ga0373933_0169370
1422 Ga0373947_0155650
1423 Ga0373947_0226456
1424 Ga0373947_0847035
1425 Ga0373937_0002980
1426 Ga0373937_0020345
1427 Ga0373937_0660158
1428 Ga0373937_1593156
1429 Ga0373925_0030854
1430 Ga0373925_1085497
1431 Ga0450922_017774
1432 Ga0439435_0158457
1433 Ga0439464_0292677
1434 Ga0451577_0253815
1435 Ga0451577_0590990
1436 Ga0451577_1412943
1437 Ga0451576_0023353
1438 Ga0451576_0090872
1439 Ga0451576_0489801
1440 Ga0495592_0001671
1441 Ga0495629_0162014
1442 Ga0495629_0618505
1443 Ga0495629_0963614
1444 Ga0495651_0000407
1445 Ga0495653_0000166
1446 Ga0495653_0097295
1447 Ga0495580_0223023
1448 Ga0495582_0173147
1449 Ga0495639_0112335
1450 Ga0495639_0146081
1451 Ga0495662_0279477
1452 Ga0495664_0099110
1453 Ga0495608_0009132
1454 Ga0495608_0024244
1455 Ga0495608_0278329
1456 Ga0495628_0003253
1457 Ga0495628_0100535
1458 Ga0495628_0185540
1459 Ga0495630_0000981
1460 Ga0495630_0060937
1461 Ga0495630_0340873
1462 Ga0495652_0001195
1463 Ga0495586_0060302
1464 Ga0495587_0000636
1465 Ga0495621_0040681
1466 Ga0495645_0001150
1467 Ga0495645_0002473
1468 Ga0495645_0020605
1469 Ga0495645_0175593
1470 Ga0495667_0014330
1471 Ga0495667_0080678
1472 Ga0495656_0615398
1473 Ga0495634_0130442
1474 Ga0495634_0171336
1475 Ga0495634_0333575
1476 Ga0495635_0009664
1477 Ga0495659_0070340
1478 Ga0495657_0015324
1479 Ga0495599_0002603
1480 Ga0495623_0007730
1481 Ga0495646_0017871
1482 Ga0495613_0001685
1483 Ga0495613_0053932
1484 Ga0495613_0112770
1485 Ga0495613_0417542
1486 Ga0495670_0353567
1487 Ga0495600_0000211
1488 Ga0495600_0039864
1489 Ga0495581_0041484
1490 Ga0495581_0057282
1491 Ga0495604_0008250
1492 Ga0495674_0016798
1493 Ga0495674_0032754
1494 Ga0495680_0062548
1495 Ga0495680_0218137
1496 Ga0495675_0011793
1497 Ga0495684_0000093
1498 Ga0495684_0005975
1499 Ga0495602_0026118
1500 Ga0496101_0318165
1501 Ga0496101_0776799
1502 Ga0496104_0029063
1503 Ga0496105_1194264
1504 Ga0496106_0053437
1505 Ga0496106_1133645
1506 Ga0496107_0313451
1507 Ga0496108_0016082
1508 Ga0496108_0840652
1509 Ga0496109_0059510
1510 Ga0496109_0216937
1511 Ga0496111_0315054
1512 Ga0496112_0034523
1513 Ga0496112_0045851
1514 Ga0496112_0125799
1515 Ga0496112_0343871
1516 Ga0496113_0046001
1517 Ga0496113_0219702
1518 Ga0496114_0074687
1519 Ga0496114_0299354
1520 Ga0496115_0879878
1521 Ga0501034_0002966
1522 Ga0501067_0153800
1523 Ga0501069_0461549
1524 Ga0501070_1302230
1525 Ga0501071_0637511
1526 Ga0501073_0657251
1527 Ga0501074_0582734
1528 Ga0501209_153713
1529 Ga0501045_0190941
1530 nmdc:mga03683_19055_c1
1531 nmdc:mga00v17_79920_c1
1532 nmdc:mga06z11_145035_c1
1533 nmdc:mga07m45_286121_c1
1534 nmdc:mga05p37_109838_c1
1535 nmdc:mga05p37_11811_c1
1536 nmdc:mga05p37_12558_c1
1537 nmdc:mga05p37_135813_c1
1538 nmdc:mga05p37_25961_c1
1539 nmdc:mga05p37_36167_c1
1540 nmdc:mga05p37_44987_c1
1541 nmdc:mga05p37_714722_c1
1542 nmdc:mga05p37_81625_c1
1543 nmdc:mga05p37_89426_c1
1544 nmdc:mga09592_175220_c1
1545 nmdc:mga09592_302434_c1
1546 nmdc:mga09592_648902_c1
1547 nmdc:mga0qj67_388000_c1
1548 nmdc:mga06r32_15183_c1
1549 nmdc:mga06r32_157463_c1
1550 nmdc:mga06r32_224235_c1
1551 nmdc:mga06r32_364555_c1
1552 nmdc:mga06r32_542609_c1
1553 nmdc:mga06r32_58888_c1
1554 nmdc:mga08y16_1248421_c1
1555 nmdc:mga08y16_438275_c1
1556 nmdc:mga08y16_61152_c1
1557 nmdc:mga08y16_695_c1
1558 nmdc:mga0n895_1079015_c1
1559 nmdc:mga0n895_11567_c1
1560 nmdc:mga0n895_124518_c1
1561 nmdc:mga0n895_13030_c1
1562 nmdc:mga0n895_14561_c1
1563 nmdc:mga0n895_157390_c1
1564 nmdc:mga0n895_1877674_c1
1565 nmdc:mga0n895_199302_c1
1566 nmdc:mga0n895_489746_c1
1567 nmdc:mga0rr50_262288_c1
1568 nmdc:mga0rr50_291600_c1
1569 nmdc:mga0rr50_442795_c1
1570 nmdc:mga0rr50_679943_c1
1571 nmdc:mga0rr50_713485_c1
1572 nmdc:mga0rr50_973_c1
1573 nmdc:mga08x19_34977_c1
1574 nmdc:mga08x19_546080_c1
1575 nmdc:mga0a205_107668_c1
1576 nmdc:mga0a205_216331_c1
1577 nmdc:mga0a205_31588_c1
1578 nmdc:mga0a205_34431_c1
1579 nmdc:mga0a205_34468_c1
1580 nmdc:mga0a205_41436_c1
1581 nmdc:mga0a205_456773_c1
1582 nmdc:mga0a205_94975_c1
1583 Ga0495601_0020947
1584 Ga0495601_0290699
1585 Ga0495612_0008792
1586 Ga0495595_0055562
1587 Ga0495595_0076174
1588 Ga0495619_0003239
1589 Ga0495619_0004058
1590 Ga0495619_0207402
1591 Ga0495619_0359790
1592 Ga0500628_085616
1593 Ga0590071_000124
1594 Ga0590074_002314
1595 Ga0590075_000578
1596 Ga0590077_002882
1597 Ga0590077_034989
1598 Ga0587073_0054568
1599 Ga0587086_030118
1600 Ga0587091_050899
1601 Ga0587094_062497
1602 Ga0587106_054524
1603 Ga0587115_032684
1604 Ga0587067_088885
1605 Ga0587075_050847
1606 Ga0587078_023000
1607 Ga0587079_039248
1608 Ga0587071_060337

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

38

163

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
4pav-assembly4.cif.gz_D structure of hypothetical protein sa1046 from s. aureus. 0.803 12 137
3itw-assembly1.cif.gz_A-2 crystal structure of tiox from micromonospora sp. ml1 0.7893 12 138
1fa5-assembly1.cif.gz_B crystal structure of the zn(ii)-bound glyoxalase i of escherichia coli 0.7864 12 137
4mtr-assembly1.cif.gz_B zn-bound gloa2 0.7815 12 137
1lqo-assembly1.cif.gz_B crystal strutcure of the fosfomycin resistance protein a (fosa) containing bound thallium cations 0.7814 12 137
ID Description Score Start End Superfamily
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9404 81 149 3.30.720.110
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8882 81 149 3.30.720.110
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8483 83 138 3.30.720.110
af_Q5VMX8_15_124_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8193 18 138 3.10.180.10
3itwB01 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8126 13 73 3.30.720.120
ID Description Score Start End GO Terms
AF-A0A7Y5U062-F1-model_v4 VOC family protein 0.9744 1 162
AF-A0A7Y5U062-F1-model_v4 VOC family protein 0.9627 1 162
AF-A0A7Y9LC95-F1-model_v4 PhnB protein 0.9622 11 162
AF-A0A523KTB3-F1-model_v4 deleted 0.9601 6 143
AF-A0A2E9T231-F1-model_v4 Glyoxalase 0.9537 72 160

Map