F481494
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 803 | 318 | 1606 | 127 |
Family's Representative Sequence
| Representative Sequence | 3300005456|Ga0070678_101841782|Ga0070678_1018417821 |
| Length | 133 |
| Sequence | MAPQSPRLSKLELRIMDALWTRGSALAIREIQEAFPEKDRPAYTTIQTTVYRMEEKHALRRVRKIGNAHLFEPLVTRDSARGNLIDDILSVFGGRTQPMMAHLVETGRLTMSDVREAEKLLNELEEKKGGSKP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 3 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 47 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 54 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 56 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 57 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 58 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 60 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 61 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 62 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 63 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 64 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 65 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 66 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 67 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 73 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 74 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 75 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 76 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 77 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 78 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 79 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 80 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 82 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 95 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 111 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 112 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 113 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 176 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 180 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 181 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 182 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 183 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 184 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 185 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 186 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 187 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 188 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 189 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 190 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 191 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 192 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 193 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 194 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 195 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 196 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 197 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 198 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 199 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 200 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 201 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 202 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 203 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 204 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 205 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 206 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 207 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 208 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 209 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 210 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 211 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 212 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 213 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 214 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 215 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 216 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 217 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 218 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 219 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 220 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 221 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 222 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 223 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 224 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 225 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 226 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 227 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 228 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 229 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 230 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 263 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 264 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 265 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 266 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 267 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 268 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 269 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 270 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 271 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 272 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 273 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 274 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 298 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 304 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 305 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 307 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 308 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 309 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 310 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 312 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 313 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 314 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 315 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 316 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 317 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 318 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.5 |
| Metatranscriptomes | 0.5 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.87 |
| Nodule | 0 |
| Rhizoplane | 2.86 |
| Rhizosphere | 93.52 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 40.35 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070678_101841782 | 3300005456 | Bacteria | 571 |
| 2 | rootH2_10079227 | 3300003320 | Bacteria | 2137 |
| 3 | Ga0065715_10156653 | 3300005293 | Unclassified | 1670 |
| 4 | Ga0065707_10481809 | 3300005295 | Unclassified | 773 |
| 5 | Ga0070658_10415623 | 3300005327 | Bacteria | 1156 |
| 6 | Ga0070683_100028360 | 3300005329 | Bacteria | 5059 |
| 7 | Ga0070683_100058048 | 3300005329 | Bacteria | 3596 |
| 8 | Ga0070683_100089070 | 3300005329 | Bacteria | 2896 |
| 9 | Ga0070683_100157346 | 3300005329 | Unclassified | 2155 |
| 10 | Ga0070683_100826957 | 3300005329 | Unclassified | 888 |
| 11 | Ga0070683_101115417 | 3300005329 | Unclassified | 758 |
| 12 | Ga0070670_100001974 | 3300005331 | Bacteria | 16787 |
| 13 | Ga0070670_100725167 | 3300005331 | Unclassified | 895 |
| 14 | Ga0070677_10341692 | 3300005333 | Unclassified | 773 |
| 15 | Ga0068869_100075132 | 3300005334 | Unclassified | 2510 |
| 16 | Ga0068869_100569997 | 3300005334 | Unclassified | 953 |
| 17 | Ga0070666_10883517 | 3300005335 | Unclassified | 660 |
| 18 | Ga0070680_100052522 | 3300005336 | Bacteria | 3326 |
| 19 | Ga0070680_100283138 | 3300005336 | Bacteria | 1405 |
| 20 | Ga0070680_100657053 | 3300005336 | Unclassified | 901 |
| 21 | Ga0070680_101554329 | 3300005336 | Unclassified | 573 |
| 22 | Ga0070680_102013224 | 3300005336 | Unclassified | 500 |
| 23 | Ga0068868_100047132 | 3300005338 | Unclassified | 3376 |
| 24 | Ga0068868_100472206 | 3300005338 | Unclassified | 1094 |
| 25 | Ga0068868_100485010 | 3300005338 | Bacteria | 1080 |
| 26 | Ga0068868_101896785 | 3300005338 | Bacteria | 564 |
| 27 | Ga0070660_100038380 | 3300005339 | Bacteria | 3636 |
| 28 | Ga0070660_100382882 | 3300005339 | Bacteria | 1161 |
| 29 | Ga0070660_101031095 | 3300005339 | Unclassified | 695 |
| 30 | Ga0070660_101268016 | 3300005339 | Unclassified | 625 |
| 31 | Ga0070660_101423609 | 3300005339 | Unclassified | 589 |
| 32 | Ga0070689_100026720 | 3300005340 | Unclassified | 4347 |
| 33 | Ga0070689_100115965 | 3300005340 | Unclassified | 2135 |
| 34 | Ga0070689_100346858 | 3300005340 | Bacteria | 1244 |
| 35 | Ga0070689_101602557 | 3300005340 | Unclassified | 591 |
| 36 | Ga0070691_10707593 | 3300005341 | Unclassified | 605 |
| 37 | Ga0070687_100039491 | 3300005343 | Bacteria | 2372 |
| 38 | Ga0070661_100052920 | 3300005344 | Bacteria | 2971 |
| 39 | Ga0070661_100062658 | 3300005344 | Bacteria | 2730 |
| 40 | Ga0070661_100298551 | 3300005344 | Bacteria | 1253 |
| 41 | Ga0070661_100849174 | 3300005344 | Unclassified | 751 |
| 42 | Ga0070692_10055513 | 3300005345 | Bacteria | 2071 |
| 43 | Ga0070692_10262243 | 3300005345 | Unclassified | 1039 |
| 44 | Ga0070668_100163560 | 3300005347 | Bacteria | 1807 |
| 45 | Ga0070668_101140493 | 3300005347 | Unclassified | 705 |
| 46 | Ga0070669_100004850 | 3300005353 | Bacteria | 9711 |
| 47 | Ga0070675_100000667 | 3300005354 | Bacteria | 23749 |
| 48 | Ga0070675_100046847 | 3300005354 | Bacteria | 3542 |
| 49 | Ga0070675_100086976 | 3300005354 | Bacteria | 2613 |
| 50 | Ga0070675_100506472 | 3300005354 | Bacteria | 1088 |
| 51 | Ga0070671_100101297 | 3300005355 | Unclassified | 2416 |
| 52 | Ga0070671_100306495 | 3300005355 | Bacteria | 1352 |
| 53 | Ga0070671_101670464 | 3300005355 | Unclassified | 565 |
| 54 | Ga0070673_100028304 | 3300005364 | Unclassified | 4166 |
| 55 | Ga0070688_100156070 | 3300005365 | Unclassified | 1564 |
| 56 | Ga0070659_100014834 | 3300005366 | Bacteria | 5827 |
| 57 | Ga0070659_100176502 | 3300005366 | Bacteria | 1752 |
| 58 | Ga0070659_100266655 | 3300005366 | Bacteria | 1422 |
| 59 | Ga0070667_100256076 | 3300005367 | Unclassified | 1566 |
| 60 | Ga0070709_10018168 | 3300005434 | Bacteria | 4045 |
| 61 | Ga0070709_10369097 | 3300005434 | Bacteria | 1064 |
| 62 | Ga0070709_10407605 | 3300005434 | Bacteria | 1016 |
| 63 | Ga0070714_100019879 | 3300005435 | Bacteria | 5479 |
| 64 | Ga0070714_100042565 | 3300005435 | Unclassified | 3838 |
| 65 | Ga0070714_101181717 | 3300005435 | Bacteria | 746 |
| 66 | Ga0070714_101294305 | 3300005435 | Bacteria | 711 |
| 67 | Ga0070714_101423869 | 3300005435 | Unclassified | 677 |
| 68 | Ga0070714_101938888 | 3300005435 | Unclassified | 575 |
| 69 | Ga0070713_100000111 | 3300005436 | Bacteria | 53417 |
| 70 | Ga0070713_100173925 | 3300005436 | Bacteria | 1930 |
| 71 | Ga0070713_100214709 | 3300005436 | Unclassified | 1743 |
| 72 | Ga0070713_100281795 | 3300005436 | Unclassified | 1525 |
| 73 | Ga0070713_100305751 | 3300005436 | Bacteria | 1465 |
| 74 | Ga0070713_100386872 | 3300005436 | Bacteria | 1304 |
| 75 | Ga0070713_100470924 | 3300005436 | Bacteria | 1182 |
| 76 | Ga0070713_100487472 | 3300005436 | Unclassified | 1162 |
| 77 | Ga0070713_100523273 | 3300005436 | Bacteria | 1121 |
| 78 | Ga0070713_100568856 | 3300005436 | Unclassified | 1074 |
| 79 | Ga0070713_100714194 | 3300005436 | Bacteria | 957 |
| 80 | Ga0070713_100717714 | 3300005436 | Bacteria | 955 |
| 81 | Ga0070713_100740826 | 3300005436 | Unclassified | 940 |
| 82 | Ga0070710_10160349 | 3300005437 | Bacteria | 1394 |
| 83 | Ga0070710_10186586 | 3300005437 | Bacteria | 1302 |
| 84 | Ga0070710_11534439 | 3300005437 | Unclassified | 501 |
| 85 | Ga0070701_10013748 | 3300005438 | Bacteria | 3691 |
| 86 | Ga0070701_10435271 | 3300005438 | Unclassified | 838 |
| 87 | Ga0070701_11210545 | 3300005438 | Unclassified | 536 |
| 88 | Ga0070711_100004402 | 3300005439 | Bacteria | 8310 |
| 89 | Ga0070711_100007267 | 3300005439 | Bacteria | 6731 |
| 90 | Ga0070711_100025000 | 3300005439 | Bacteria | 3904 |
| 91 | Ga0070711_100034280 | 3300005439 | Bacteria | 3385 |
| 92 | Ga0070711_100041896 | 3300005439 | Unclassified | 3093 |
| 93 | Ga0070711_100227870 | 3300005439 | Unclassified | 1452 |
| 94 | Ga0070711_100267652 | 3300005439 | Unclassified | 1347 |
| 95 | Ga0070711_101310294 | 3300005439 | Unclassified | 629 |
| 96 | Ga0070705_101556637 | 3300005440 | Unclassified | 555 |
| 97 | Ga0070700_100714981 | 3300005441 | Unclassified | 798 |
| 98 | Ga0070694_100181907 | 3300005444 | Bacteria | 1555 |
| 99 | Ga0070694_100472860 | 3300005444 | Bacteria | 993 |
| 100 | Ga0070708_101207493 | 3300005445 | Bacteria | 707 |
| 101 | Ga0070663_100493218 | 3300005455 | Unclassified | 1016 |
| 102 | Ga0070663_101624787 | 3300005455 | Unclassified | 577 |
| 103 | Ga0070678_100162843 | 3300005456 | Bacteria | 1809 |
| 104 | Ga0070678_100169403 | 3300005456 | Unclassified | 1777 |
| 105 | Ga0070678_100716898 | 3300005456 | Unclassified | 902 |
| 106 | Ga0070678_100923028 | 3300005456 | Unclassified | 799 |
| 107 | Ga0070678_101330068 | 3300005456 | Unclassified | 669 |
| 108 | Ga0070662_100263077 | 3300005457 | Bacteria | 1390 |
| 109 | Ga0070662_100295034 | 3300005457 | Bacteria | 1315 |
| 110 | Ga0070662_100375462 | 3300005457 | Bacteria | 1169 |
| 111 | Ga0070662_100452043 | 3300005457 | Unclassified | 1066 |
| 112 | Ga0070681_10000483 | 3300005458 | Bacteria | 32474 |
| 113 | Ga0070681_10163397 | 3300005458 | Unclassified | 2150 |
| 114 | Ga0070681_10377083 | 3300005458 | Bacteria | 1329 |
| 115 | Ga0070681_10520590 | 3300005458 | Unclassified | 1103 |
| 116 | Ga0070685_10687798 | 3300005466 | Unclassified | 745 |
| 117 | Ga0070706_100123271 | 3300005467 | Bacteria | 2416 |
| 118 | Ga0070707_100000757 | 3300005468 | Bacteria | 31825 |
| 119 | Ga0070679_100007031 | 3300005530 | Bacteria | 10496 |
| 120 | Ga0070679_100272001 | 3300005530 | Bacteria | 1648 |
| 121 | Ga0070679_100370097 | 3300005530 | Bacteria | 1380 |
| 122 | Ga0070679_100375819 | 3300005530 | Unclassified | 1368 |
| 123 | Ga0070679_100611259 | 3300005530 | Unclassified | 1033 |
| 124 | Ga0070679_101576964 | 3300005530 | Bacteria | 604 |
| 125 | Ga0070684_100038250 | 3300005535 | Unclassified | 4120 |
| 126 | Ga0070684_100208684 | 3300005535 | Unclassified | 1780 |
| 127 | Ga0070684_100273274 | 3300005535 | Bacteria | 1547 |
| 128 | Ga0070684_101903985 | 3300005535 | Bacteria | 561 |
| 129 | Ga0070697_100020394 | 3300005536 | Bacteria | 5243 |
| 130 | Ga0070697_101557635 | 3300005536 | Bacteria | 591 |
| 131 | Ga0068853_100007353 | 3300005539 | Bacteria | 8811 |
| 132 | Ga0068853_100067924 | 3300005539 | Bacteria | 3098 |
| 133 | Ga0068853_100076099 | 3300005539 | Bacteria | 2930 |
| 134 | Ga0068853_100110101 | 3300005539 | Unclassified | 2446 |
| 135 | Ga0068853_100216613 | 3300005539 | Bacteria | 1747 |
| 136 | Ga0070672_100016071 | 3300005543 | Bacteria | 5351 |
| 137 | Ga0070695_100004444 | 3300005545 | Bacteria | 8236 |
| 138 | Ga0070696_100979156 | 3300005546 | Bacteria | 705 |
| 139 | Ga0070693_100448495 | 3300005547 | Unclassified | 905 |
| 140 | Ga0070693_100480649 | 3300005547 | Unclassified | 877 |
| 141 | Ga0070693_100698011 | 3300005547 | Unclassified | 743 |
| 142 | Ga0070665_100003472 | 3300005548 | Bacteria | 16789 |
| 143 | Ga0070665_100437461 | 3300005548 | Bacteria | 1317 |
| 144 | Ga0070704_100036542 | 3300005549 | Bacteria | 3349 |
| 145 | Ga0068855_100000656 | 3300005563 | Bacteria | 42261 |
| 146 | Ga0068855_100011538 | 3300005563 | Bacteria | 10673 |
| 147 | Ga0068855_100016579 | 3300005563 | Bacteria | 8860 |
| 148 | Ga0068855_100032021 | 3300005563 | Bacteria | 6278 |
| 149 | Ga0068855_100045002 | 3300005563 | Bacteria | 5221 |
| 150 | Ga0068855_100059277 | 3300005563 | Bacteria | 4479 |
| 151 | Ga0068855_100288059 | 3300005563 | Bacteria | 1821 |
| 152 | Ga0068855_100568578 | 3300005563 | Bacteria | 1225 |
| 153 | Ga0068855_100823710 | 3300005563 | Unclassified | 985 |
| 154 | Ga0070664_100020783 | 3300005564 | Bacteria | 5408 |
| 155 | Ga0070664_100029007 | 3300005564 | Bacteria | 4610 |
| 156 | Ga0070664_100047277 | 3300005564 | Unclassified | 3635 |
| 157 | Ga0070664_100059394 | 3300005564 | Bacteria | 3253 |
| 158 | Ga0070664_100070616 | 3300005564 | Unclassified | 2991 |
| 159 | Ga0070664_101604385 | 3300005564 | Unclassified | 616 |
| 160 | Ga0068857_100028696 | 3300005577 | Bacteria | 4909 |
| 161 | Ga0068857_100065622 | 3300005577 | Unclassified | 3229 |
| 162 | Ga0068857_100734884 | 3300005577 | Unclassified | 939 |
| 163 | Ga0068857_100772417 | 3300005577 | Unclassified | 916 |
| 164 | Ga0068854_100931697 | 3300005578 | Unclassified | 765 |
| 165 | Ga0068854_101168299 | 3300005578 | Unclassified | 688 |
| 166 | Ga0068854_101891963 | 3300005578 | Unclassified | 548 |
| 167 | Ga0068856_100001584 | 3300005614 | Bacteria | 23812 |
| 168 | Ga0068856_100004446 | 3300005614 | Bacteria | 13959 |
| 169 | Ga0068856_100007508 | 3300005614 | Bacteria | 10646 |
| 170 | Ga0068856_100033422 | 3300005614 | Bacteria | 5036 |
| 171 | Ga0068856_100056352 | 3300005614 | Unclassified | 3878 |
| 172 | Ga0068856_100201518 | 3300005614 | Bacteria | 2004 |
| 173 | Ga0068856_100379183 | 3300005614 | Bacteria | 1433 |
| 174 | Ga0068856_100427373 | 3300005614 | Bacteria | 1345 |
| 175 | Ga0068856_100641631 | 3300005614 | Bacteria | 1082 |
| 176 | Ga0070702_100589518 | 3300005615 | Unclassified | 831 |
| 177 | Ga0070702_101644875 | 3300005615 | Unclassified | 532 |
| 178 | Ga0068852_100007795 | 3300005616 | Bacteria | 7841 |
| 179 | Ga0068852_100017100 | 3300005616 | Bacteria | 5681 |
| 180 | Ga0068852_100476979 | 3300005616 | Bacteria | 1239 |
| 181 | Ga0068852_101326881 | 3300005616 | Unclassified | 741 |
| 182 | Ga0068859_100143351 | 3300005617 | Bacteria | 2462 |
| 183 | Ga0068859_100817058 | 3300005617 | Bacteria | 1019 |
| 184 | Ga0068859_101155331 | 3300005617 | Unclassified | 852 |
| 185 | Ga0068859_101233052 | 3300005617 | Unclassified | 824 |
| 186 | Ga0068859_101388673 | 3300005617 | Bacteria | 774 |
| 187 | Ga0068859_101881201 | 3300005617 | Unclassified | 661 |
| 188 | Ga0068864_100095302 | 3300005618 | Bacteria | 2632 |
| 189 | Ga0068864_100202027 | 3300005618 | Bacteria | 1826 |
| 190 | Ga0068864_100225666 | 3300005618 | Bacteria | 1730 |
| 191 | Ga0068864_102023237 | 3300005618 | Unclassified | 582 |
| 192 | Ga0068861_100010665 | 3300005719 | Bacteria | 6382 |
| 193 | Ga0068861_100206536 | 3300005719 | Bacteria | 1652 |
| 194 | Ga0068861_100256018 | 3300005719 | Unclassified | 1496 |
| 195 | Ga0068861_101254800 | 3300005719 | Unclassified | 719 |
| 196 | Ga0068861_101344659 | 3300005719 | Bacteria | 696 |
| 197 | Ga0068861_101381641 | 3300005719 | Bacteria | 687 |
| 198 | Ga0068863_100018504 | 3300005841 | Bacteria | 6668 |
| 199 | Ga0068863_100816882 | 3300005841 | Bacteria | 930 |
| 200 | Ga0068863_101002778 | 3300005841 | Bacteria | 838 |
| 201 | Ga0068858_100011509 | 3300005842 | Bacteria | 8349 |
| 202 | Ga0068858_100195524 | 3300005842 | Unclassified | 1911 |
| 203 | Ga0068858_100407993 | 3300005842 | Bacteria | 1306 |
| 204 | Ga0068858_100617779 | 3300005842 | Unclassified | 1052 |
| 205 | Ga0068860_100046476 | 3300005843 | Unclassified | 4139 |
| 206 | Ga0068860_100165724 | 3300005843 | Bacteria | 2133 |
| 207 | Ga0068860_100325359 | 3300005843 | Unclassified | 1509 |
| 208 | Ga0068860_100443605 | 3300005843 | Unclassified | 1290 |
| 209 | Ga0068862_100060715 | 3300005844 | Bacteria | 3248 |
| 210 | Ga0068862_100175826 | 3300005844 | Unclassified | 1919 |
| 211 | Ga0068862_101867752 | 3300005844 | Unclassified | 610 |
| 212 | Ga0068862_102520710 | 3300005844 | Bacteria | 526 |
| 213 | Ga0068862_102692763 | 3300005844 | Unclassified | 509 |
| 214 | Ga0070717_10091844 | 3300006028 | Bacteria | 2564 |
| 215 | Ga0070717_10110083 | 3300006028 | Bacteria | 2349 |
| 216 | Ga0070717_10483942 | 3300006028 | Bacteria | 1117 |
| 217 | Ga0070717_10557383 | 3300006028 | Unclassified | 1038 |
| 218 | Ga0070717_10592919 | 3300006028 | Unclassified | 1005 |
| 219 | Ga0070717_11553720 | 3300006028 | Unclassified | 600 |
| 220 | Ga0070717_11626357 | 3300006028 | Unclassified | 585 |
| 221 | Ga0070715_10531063 | 3300006163 | Bacteria | 679 |
| 222 | Ga0070716_100004320 | 3300006173 | Bacteria | 6776 |
| 223 | Ga0070716_100072123 | 3300006173 | Bacteria | 2032 |
| 224 | Ga0070716_100214372 | 3300006173 | Bacteria | 1289 |
| 225 | Ga0070716_100347624 | 3300006173 | Unclassified | 1048 |
| 226 | Ga0070716_100687564 | 3300006173 | Unclassified | 780 |
| 227 | Ga0070712_100000453 | 3300006175 | Bacteria | 23518 |
| 228 | Ga0070712_100013375 | 3300006175 | Bacteria | 5243 |
| 229 | Ga0070712_100190098 | 3300006175 | Bacteria | 1606 |
| 230 | Ga0070712_100312058 | 3300006175 | Bacteria | 1276 |
| 231 | Ga0070712_100378210 | 3300006175 | Unclassified | 1165 |
| 232 | Ga0070712_100493642 | 3300006175 | Unclassified | 1025 |
| 233 | Ga0097621_100000631 | 3300006237 | Bacteria | 24844 |
| 234 | Ga0097621_100002425 | 3300006237 | Bacteria | 12770 |
| 235 | Ga0097621_100137367 | 3300006237 | Bacteria | 2086 |
| 236 | Ga0097621_100525132 | 3300006237 | Bacteria | 1075 |
| 237 | Ga0097621_100565251 | 3300006237 | Bacteria | 1036 |
| 238 | Ga0097621_100987139 | 3300006237 | Unclassified | 787 |
| 239 | Ga0097621_102004011 | 3300006237 | Unclassified | 553 |
| 240 | Ga0097621_102323345 | 3300006237 | Unclassified | 513 |
| 241 | Ga0068871_100000220 | 3300006358 | Bacteria | 40091 |
| 242 | Ga0068871_100001703 | 3300006358 | Bacteria | 14775 |
| 243 | Ga0068871_100470409 | 3300006358 | Unclassified | 1129 |
| 244 | Ga0068871_100791223 | 3300006358 | Bacteria | 874 |
| 245 | Ga0068871_101149792 | 3300006358 | Bacteria | 727 |
| 246 | Ga0068871_102321797 | 3300006358 | Unclassified | 511 |
| 247 | Ga0075428_100092852 | 3300006844 | Bacteria | 3290 |
| 248 | Ga0075430_100750758 | 3300006846 | Unclassified | 804 |
| 249 | Ga0075431_100065736 | 3300006847 | Unclassified | 3744 |
| 250 | Ga0075431_100489472 | 3300006847 | Unclassified | 1222 |
| 251 | Ga0075433_10850775 | 3300006852 | Bacteria | 796 |
| 252 | Ga0075434_100427130 | 3300006871 | Bacteria | 1346 |
| 253 | Ga0075434_101052616 | 3300006871 | Unclassified | 827 |
| 254 | Ga0075434_101488549 | 3300006871 | Unclassified | 686 |
| 255 | Ga0075429_100183874 | 3300006880 | Unclassified | 1831 |
| 256 | Ga0068865_100000829 | 3300006881 | Bacteria | 17439 |
| 257 | Ga0068865_100114322 | 3300006881 | Unclassified | 1996 |
| 258 | Ga0068865_100125386 | 3300006881 | Bacteria | 1916 |
| 259 | Ga0068865_101287241 | 3300006881 | Unclassified | 650 |
| 260 | Ga0097620_100143355 | 3300006931 | Bacteria | 2462 |
| 261 | Ga0097620_100816971 | 3300006931 | Bacteria | 1019 |
| 262 | Ga0097620_101155678 | 3300006931 | Unclassified | 852 |
| 263 | Ga0097620_101233077 | 3300006931 | Unclassified | 824 |
| 264 | Ga0097620_101388750 | 3300006931 | Bacteria | 774 |
| 265 | Ga0097620_101880929 | 3300006931 | Unclassified | 661 |
| 266 | Ga0099794_10460654 | 3300007265 | Unclassified | 667 |
| 267 | Ga0105240_10013042 | 3300009093 | Bacteria | 11439 |
| 268 | Ga0105240_10031145 | 3300009093 | Bacteria | 6921 |
| 269 | Ga0105240_10049604 | 3300009093 | Bacteria | 5297 |
| 270 | Ga0105240_10116458 | 3300009093 | Bacteria | 3224 |
| 271 | Ga0105240_10215641 | 3300009093 | Bacteria | 2240 |
| 272 | Ga0105240_10286716 | 3300009093 | Unclassified | 1889 |
| 273 | Ga0105240_10290097 | 3300009093 | Unclassified | 1876 |
| 274 | Ga0105240_10494428 | 3300009093 | Bacteria | 1361 |
| 275 | Ga0105240_10621394 | 3300009093 | Bacteria | 1187 |
| 276 | Ga0105240_10893629 | 3300009093 | Bacteria | 956 |
| 277 | Ga0105240_11309943 | 3300009093 | Bacteria | 764 |
| 278 | Ga0111539_10055492 | 3300009094 | Bacteria | 4709 |
| 279 | Ga0111539_12457837 | 3300009094 | Unclassified | 604 |
| 280 | Ga0105245_10196162 | 3300009098 | Unclassified | 1937 |
| 281 | Ga0105245_11401497 | 3300009098 | Bacteria | 749 |
| 282 | Ga0105245_11493141 | 3300009098 | Unclassified | 727 |
| 283 | Ga0105247_10255149 | 3300009101 | Unclassified | 1200 |
| 284 | Ga0114129_10345236 | 3300009147 | Bacteria | 1973 |
| 285 | Ga0105243_10259847 | 3300009148 | Bacteria | 1554 |
| 286 | Ga0105243_10707904 | 3300009148 | Bacteria | 982 |
| 287 | Ga0105243_12143092 | 3300009148 | Unclassified | 595 |
| 288 | Ga0105241_10169457 | 3300009174 | Bacteria | 1802 |
| 289 | Ga0105241_10224910 | 3300009174 | Unclassified | 1579 |
| 290 | Ga0105241_10572860 | 3300009174 | Bacteria | 1017 |
| 291 | Ga0105241_11943464 | 3300009174 | Bacteria | 578 |
| 292 | Ga0105241_12465492 | 3300009174 | Unclassified | 520 |
| 293 | Ga0105242_10024190 | 3300009176 | Bacteria | 4794 |
| 294 | Ga0105242_10173426 | 3300009176 | Bacteria | 1897 |
| 295 | Ga0105242_10251577 | 3300009176 | Archaea | 1593 |
| 296 | Ga0105248_10003212 | 3300009177 | Bacteria | 18120 |
| 297 | Ga0105248_10762375 | 3300009177 | Archaea | 1092 |
| 298 | Ga0105248_11551704 | 3300009177 | Bacteria | 750 |
| 299 | Ga0105237_10323442 | 3300009545 | Bacteria | 1546 |
| 300 | Ga0105237_10694527 | 3300009545 | Bacteria | 1024 |
| 301 | Ga0105237_10854338 | 3300009545 | Bacteria | 917 |
| 302 | Ga0105237_11544029 | 3300009545 | Unclassified | 671 |
| 303 | Ga0105238_10152608 | 3300009551 | Bacteria | 2285 |
| 304 | Ga0105238_10179126 | 3300009551 | Bacteria | 2096 |
| 305 | Ga0105238_10333625 | 3300009551 | Bacteria | 1504 |
| 306 | Ga0105238_10857718 | 3300009551 | Bacteria | 925 |
| 307 | Ga0105238_11945453 | 3300009551 | Unclassified | 621 |
| 308 | Ga0105238_12192428 | 3300009551 | Unclassified | 587 |
| 309 | Ga0105249_10287716 | 3300009553 | Bacteria | 1644 |
| 310 | Ga0105249_10357055 | 3300009553 | Bacteria | 1482 |
| 311 | Ga0105249_10666084 | 3300009553 | Bacteria | 1099 |
| 312 | Ga0105249_10835591 | 3300009553 | Bacteria | 986 |
| 313 | Ga0105249_12187079 | 3300009553 | Unclassified | 626 |
| 314 | Ga0099796_10398516 | 3300010159 | Unclassified | 603 |
| 315 | Ga0105239_10178344 | 3300010375 | Bacteria | 2376 |
| 316 | Ga0105239_10231719 | 3300010375 | Bacteria | 2072 |
| 317 | Ga0105239_10422045 | 3300010375 | Bacteria | 1511 |
| 318 | Ga0105239_11214300 | 3300010375 | Unclassified | 869 |
| 319 | Ga0105246_11488955 | 3300011119 | Bacteria | 635 |
| 320 | Ga0105246_11825769 | 3300011119 | Unclassified | 581 |
| 321 | Ga0157371_10328358 | 3300013102 | Bacteria | 1111 |
| 322 | Ga0157371_11104433 | 3300013102 | Bacteria | 608 |
| 323 | Ga0157370_10022542 | 3300013104 | Bacteria | 6266 |
| 324 | Ga0157370_10348062 | 3300013104 | Bacteria | 1366 |
| 325 | Ga0157369_10023142 | 3300013105 | Bacteria | 6922 |
| 326 | Ga0157369_10048525 | 3300013105 | Bacteria | 4607 |
| 327 | Ga0157369_10155062 | 3300013105 | Unclassified | 2419 |
| 328 | Ga0157369_10155085 | 3300013105 | Unclassified | 2419 |
| 329 | Ga0157369_10380551 | 3300013105 | Bacteria | 1465 |
| 330 | Ga0157369_10549642 | 3300013105 | Bacteria | 1193 |
| 331 | Ga0157369_10681901 | 3300013105 | Bacteria | 1059 |
| 332 | Ga0157369_11930182 | 3300013105 | Unclassified | 599 |
| 333 | Ga0157374_10000164 | 3300013296 | Bacteria | 61685 |
| 334 | Ga0157374_10052083 | 3300013296 | Bacteria | 3811 |
| 335 | Ga0157374_10926477 | 3300013296 | Unclassified | 889 |
| 336 | Ga0157374_11390471 | 3300013296 | Bacteria | 724 |
| 337 | Ga0157374_11663999 | 3300013296 | Unclassified | 663 |
| 338 | Ga0157378_10000204 | 3300013297 | Bacteria | 57882 |
| 339 | Ga0157372_10001933 | 3300013307 | Bacteria | 22482 |
| 340 | Ga0157372_10174613 | 3300013307 | Unclassified | 2487 |
| 341 | Ga0157372_10185665 | 3300013307 | Bacteria | 2408 |
| 342 | Ga0157372_10190871 | 3300013307 | Bacteria | 2373 |
| 343 | Ga0157372_10205931 | 3300013307 | Bacteria | 2279 |
| 344 | Ga0157372_10239030 | 3300013307 | Unclassified | 2107 |
| 345 | Ga0157372_10270929 | 3300013307 | Bacteria | 1973 |
| 346 | Ga0157375_10383973 | 3300013308 | Unclassified | 1571 |
| 347 | Ga0163163_10024431 | 3300014325 | Bacteria | 5751 |
| 348 | Ga0163163_10617745 | 3300014325 | Bacteria | 1147 |
| 349 | Ga0163163_10826310 | 3300014325 | Bacteria | 990 |
| 350 | Ga0157380_10079027 | 3300014326 | Bacteria | 2685 |
| 351 | Ga0157380_10267308 | 3300014326 | Archaea | 1557 |
| 352 | Ga0157380_13411529 | 3300014326 | Unclassified | 508 |
| 353 | Ga0157377_10136715 | 3300014745 | Bacteria | 1502 |
| 354 | Ga0157377_10704276 | 3300014745 | Unclassified | 734 |
| 355 | Ga0157379_11046881 | 3300014968 | Unclassified | 780 |
| 356 | Ga0157376_10012147 | 3300014969 | Bacteria | 6380 |
| 357 | Ga0157376_10016016 | 3300014969 | Bacteria | 5681 |
| 358 | Ga0157376_10098749 | 3300014969 | Bacteria | 2546 |
| 359 | Ga0157376_11399259 | 3300014969 | Bacteria | 731 |
| 360 | Ga0163161_10994179 | 3300017792 | Unclassified | 716 |
| 361 | Ga0213874_10212965 | 3300021377 | Unclassified | 699 |
| 362 | Ga0213874_10267724 | 3300021377 | Bacteria | 634 |
| 363 | Ga0213876_10541261 | 3300021384 | Unclassified | 620 |
| 364 | Ga0213875_10039476 | 3300021388 | Bacteria | 2224 |
| 365 | Ga0213875_10221263 | 3300021388 | Unclassified | 892 |
| 366 | Ga0213875_10472288 | 3300021388 | Unclassified | 601 |
| 367 | Ga0207697_10055968 | 3300025315 | Bacteria | 1636 |
| 368 | Ga0207682_10324794 | 3300025893 | Bacteria | 723 |
| 369 | Ga0207692_10584763 | 3300025898 | Bacteria | 716 |
| 370 | Ga0207710_10026941 | 3300025900 | Unclassified | 2486 |
| 371 | Ga0207710_10506949 | 3300025900 | Unclassified | 626 |
| 372 | Ga0207688_10278842 | 3300025901 | Unclassified | 1018 |
| 373 | Ga0207647_10290039 | 3300025904 | Unclassified | 933 |
| 374 | Ga0207647_10537927 | 3300025904 | Unclassified | 649 |
| 375 | Ga0207643_11039460 | 3300025908 | Bacteria | 529 |
| 376 | Ga0207684_10185483 | 3300025910 | Unclassified | 1794 |
| 377 | Ga0207684_10428512 | 3300025910 | Bacteria | 1136 |
| 378 | Ga0207654_10277751 | 3300025911 | Unclassified | 1132 |
| 379 | Ga0207707_10009160 | 3300025912 | Bacteria | 8599 |
| 380 | Ga0207707_10131297 | 3300025912 | Unclassified | 2191 |
| 381 | Ga0207707_10414934 | 3300025912 | Unclassified | 1155 |
| 382 | Ga0207695_10041165 | 3300025913 | Bacteria | 4946 |
| 383 | Ga0207695_10043394 | 3300025913 | Bacteria | 4793 |
| 384 | Ga0207695_10047068 | 3300025913 | Bacteria | 4567 |
| 385 | Ga0207695_10099409 | 3300025913 | Unclassified | 2907 |
| 386 | Ga0207695_10123594 | 3300025913 | Bacteria | 2553 |
| 387 | Ga0207695_10158530 | 3300025913 | Bacteria | 2196 |
| 388 | Ga0207695_10484571 | 3300025913 | Bacteria | 1119 |
| 389 | Ga0207671_10189501 | 3300025914 | Bacteria | 1603 |
| 390 | Ga0207671_10342153 | 3300025914 | Bacteria | 1185 |
| 391 | Ga0207693_10000066 | 3300025915 | Bacteria | 91088 |
| 392 | Ga0207693_10009445 | 3300025915 | Bacteria | 7949 |
| 393 | Ga0207693_10024268 | 3300025915 | Bacteria | 4813 |
| 394 | Ga0207693_10494419 | 3300025915 | Unclassified | 955 |
| 395 | Ga0207693_10559018 | 3300025915 | Bacteria | 892 |
| 396 | Ga0207693_11086554 | 3300025915 | Unclassified | 608 |
| 397 | Ga0207663_10001476 | 3300025916 | Bacteria | 10954 |
| 398 | Ga0207663_10010788 | 3300025916 | Bacteria | 4878 |
| 399 | Ga0207663_10216141 | 3300025916 | Unclassified | 1392 |
| 400 | Ga0207663_10827901 | 3300025916 | Bacteria | 738 |
| 401 | Ga0207660_10047171 | 3300025917 | Bacteria | 3044 |
| 402 | Ga0207660_10213766 | 3300025917 | Bacteria | 1511 |
| 403 | Ga0207660_10586230 | 3300025917 | Unclassified | 908 |
| 404 | Ga0207662_10108963 | 3300025918 | Unclassified | 1725 |
| 405 | Ga0207657_10038749 | 3300025919 | Unclassified | 4239 |
| 406 | Ga0207657_10046059 | 3300025919 | Bacteria | 3821 |
| 407 | Ga0207649_10012342 | 3300025920 | Bacteria | 4737 |
| 408 | Ga0207649_10054464 | 3300025920 | Bacteria | 2490 |
| 409 | Ga0207649_10108585 | 3300025920 | Unclassified | 1850 |
| 410 | Ga0207652_10024267 | 3300025921 | Bacteria | 5030 |
| 411 | Ga0207652_10050603 | 3300025921 | Unclassified | 3560 |
| 412 | Ga0207652_10305213 | 3300025921 | Bacteria | 1437 |
| 413 | Ga0207652_10371446 | 3300025921 | Bacteria | 1291 |
| 414 | Ga0207652_10550602 | 3300025921 | Unclassified | 1037 |
| 415 | Ga0207652_10695388 | 3300025921 | Unclassified | 907 |
| 416 | Ga0207652_11070505 | 3300025921 | Unclassified | 706 |
| 417 | Ga0207646_10000478 | 3300025922 | Bacteria | 53489 |
| 418 | Ga0207681_10013605 | 3300025923 | Bacteria | 5038 |
| 419 | Ga0207694_10001705 | 3300025924 | Bacteria | 18380 |
| 420 | Ga0207694_10200187 | 3300025924 | Bacteria | 1625 |
| 421 | Ga0207694_11128229 | 3300025924 | Unclassified | 664 |
| 422 | Ga0207694_11228384 | 3300025924 | Unclassified | 634 |
| 423 | Ga0207650_10043165 | 3300025925 | Bacteria | 3309 |
| 424 | Ga0207650_10683656 | 3300025925 | Unclassified | 866 |
| 425 | Ga0207659_10000222 | 3300025926 | Bacteria | 34395 |
| 426 | Ga0207659_10391101 | 3300025926 | Unclassified | 1161 |
| 427 | Ga0207659_10466974 | 3300025926 | Bacteria | 1065 |
| 428 | Ga0207659_10536155 | 3300025926 | Unclassified | 994 |
| 429 | Ga0207687_10345374 | 3300025927 | Bacteria | 1211 |
| 430 | Ga0207687_10577708 | 3300025927 | Bacteria | 945 |
| 431 | Ga0207687_11035049 | 3300025927 | Unclassified | 704 |
| 432 | Ga0207700_10000328 | 3300025928 | Bacteria | 27960 |
| 433 | Ga0207700_10207889 | 3300025928 | Unclassified | 1653 |
| 434 | Ga0207700_10223768 | 3300025928 | Unclassified | 1597 |
| 435 | Ga0207700_10434206 | 3300025928 | Bacteria | 1155 |
| 436 | Ga0207700_11585662 | 3300025928 | Unclassified | 579 |
| 437 | Ga0207664_10001074 | 3300025929 | Bacteria | 18222 |
| 438 | Ga0207664_10210841 | 3300025929 | Bacteria | 1681 |
| 439 | Ga0207644_10234891 | 3300025931 | Bacteria | 1458 |
| 440 | Ga0207644_10244618 | 3300025931 | Bacteria | 1429 |
| 441 | Ga0207644_10845353 | 3300025931 | Unclassified | 766 |
| 442 | Ga0207690_10010126 | 3300025932 | Bacteria | 5599 |
| 443 | Ga0207706_10295546 | 3300025933 | Bacteria | 1412 |
| 444 | Ga0207706_10385347 | 3300025933 | Bacteria | 1216 |
| 445 | Ga0207706_10466981 | 3300025933 | Unclassified | 1091 |
| 446 | Ga0207706_10986458 | 3300025933 | Unclassified | 708 |
| 447 | Ga0207686_10262760 | 3300025934 | Bacteria | 1266 |
| 448 | Ga0207686_10490619 | 3300025934 | Bacteria | 951 |
| 449 | Ga0207686_11672372 | 3300025934 | Unclassified | 526 |
| 450 | Ga0207709_10612246 | 3300025935 | Bacteria | 863 |
| 451 | Ga0207709_10951146 | 3300025935 | Bacteria | 700 |
| 452 | Ga0207670_10149053 | 3300025936 | Unclassified | 1734 |
| 453 | Ga0207670_10170589 | 3300025936 | Unclassified | 1631 |
| 454 | Ga0207670_10189116 | 3300025936 | Bacteria | 1557 |
| 455 | Ga0207669_10288353 | 3300025937 | Unclassified | 1242 |
| 456 | Ga0207704_11394945 | 3300025938 | Bacteria | 600 |
| 457 | Ga0207665_10062770 | 3300025939 | Bacteria | 2521 |
| 458 | Ga0207665_10067110 | 3300025939 | Unclassified | 2442 |
| 459 | Ga0207665_10170238 | 3300025939 | Unclassified | 1572 |
| 460 | Ga0207665_10414943 | 3300025939 | Bacteria | 1027 |
| 461 | Ga0207665_10610423 | 3300025939 | Unclassified | 852 |
| 462 | Ga0207665_10808044 | 3300025939 | Unclassified | 741 |
| 463 | Ga0207691_10259413 | 3300025940 | Unclassified | 1498 |
| 464 | Ga0207711_10080710 | 3300025941 | Bacteria | 2842 |
| 465 | Ga0207711_10215978 | 3300025941 | Bacteria | 1753 |
| 466 | Ga0207711_11220050 | 3300025941 | Unclassified | 694 |
| 467 | Ga0207711_11270918 | 3300025941 | Unclassified | 678 |
| 468 | Ga0207689_10522598 | 3300025942 | Unclassified | 995 |
| 469 | Ga0207661_10025003 | 3300025944 | Unclassified | 4534 |
| 470 | Ga0207661_10055880 | 3300025944 | Bacteria | 3168 |
| 471 | Ga0207661_10161574 | 3300025944 | Bacteria | 1944 |
| 472 | Ga0207661_10802221 | 3300025944 | Unclassified | 867 |
| 473 | Ga0207661_10973998 | 3300025944 | Unclassified | 781 |
| 474 | Ga0207661_11586648 | 3300025944 | Bacteria | 599 |
| 475 | Ga0207679_10086849 | 3300025945 | Bacteria | 2407 |
| 476 | Ga0207679_10217000 | 3300025945 | Bacteria | 1607 |
| 477 | Ga0207679_10370859 | 3300025945 | Bacteria | 1253 |
| 478 | Ga0207679_10378048 | 3300025945 | Bacteria | 1241 |
| 479 | Ga0207679_10478554 | 3300025945 | Bacteria | 1108 |
| 480 | Ga0207679_10818139 | 3300025945 | Unclassified | 850 |
| 481 | Ga0207667_10002423 | 3300025949 | Bacteria | 23377 |
| 482 | Ga0207667_10009378 | 3300025949 | Bacteria | 11533 |
| 483 | Ga0207667_10022637 | 3300025949 | Bacteria | 6934 |
| 484 | Ga0207667_10028547 | 3300025949 | Bacteria | 6059 |
| 485 | Ga0207667_10094788 | 3300025949 | Bacteria | 3081 |
| 486 | Ga0207667_10250918 | 3300025949 | Bacteria | 1810 |
| 487 | Ga0207667_10738292 | 3300025949 | Unclassified | 985 |
| 488 | Ga0207651_10106096 | 3300025960 | Unclassified | 2097 |
| 489 | Ga0207651_10773259 | 3300025960 | Unclassified | 850 |
| 490 | Ga0207651_10793587 | 3300025960 | Unclassified | 839 |
| 491 | Ga0207712_10208356 | 3300025961 | Bacteria | 1555 |
| 492 | Ga0207712_10481125 | 3300025961 | Bacteria | 1058 |
| 493 | Ga0207712_10838960 | 3300025961 | Unclassified | 809 |
| 494 | Ga0207668_10463076 | 3300025972 | Bacteria | 1084 |
| 495 | Ga0207668_10816670 | 3300025972 | Unclassified | 826 |
| 496 | Ga0207640_10068176 | 3300025981 | Bacteria | 2383 |
| 497 | Ga0207640_10188272 | 3300025981 | Unclassified | 1553 |
| 498 | Ga0207640_11137997 | 3300025981 | Unclassified | 692 |
| 499 | Ga0207658_11930007 | 3300025986 | Bacteria | 538 |
| 500 | Ga0207677_10441825 | 3300026023 | Bacteria | 1113 |
| 501 | Ga0207677_10531266 | 3300026023 | Unclassified | 1022 |
| 502 | Ga0207677_10734755 | 3300026023 | Unclassified | 878 |
| 503 | Ga0207677_11749965 | 3300026023 | Bacteria | 577 |
| 504 | Ga0207703_10010958 | 3300026035 | Bacteria | 7066 |
| 505 | Ga0207703_10142045 | 3300026035 | Unclassified | 2084 |
| 506 | Ga0207703_10378432 | 3300026035 | Bacteria | 1309 |
| 507 | Ga0207703_10572747 | 3300026035 | Unclassified | 1066 |
| 508 | Ga0207703_10850367 | 3300026035 | Bacteria | 872 |
| 509 | Ga0207703_12418160 | 3300026035 | Unclassified | 501 |
| 510 | Ga0207639_10058244 | 3300026041 | Bacteria | 2971 |
| 511 | Ga0207639_10075664 | 3300026041 | Bacteria | 2648 |
| 512 | Ga0207639_10077603 | 3300026041 | Bacteria | 2619 |
| 513 | Ga0207639_10376842 | 3300026041 | Bacteria | 1273 |
| 514 | Ga0207639_11660621 | 3300026041 | Unclassified | 599 |
| 515 | Ga0207678_10676333 | 3300026067 | Unclassified | 908 |
| 516 | Ga0207678_10825350 | 3300026067 | Bacteria | 819 |
| 517 | Ga0207708_10396248 | 3300026075 | Bacteria | 1141 |
| 518 | Ga0207702_10001476 | 3300026078 | Bacteria | 23337 |
| 519 | Ga0207702_10004134 | 3300026078 | Bacteria | 13009 |
| 520 | Ga0207702_10024301 | 3300026078 | Bacteria | 5027 |
| 521 | Ga0207702_10052310 | 3300026078 | Bacteria | 3455 |
| 522 | Ga0207702_10065951 | 3300026078 | Bacteria | 3102 |
| 523 | Ga0207702_10086737 | 3300026078 | Bacteria | 2730 |
| 524 | Ga0207702_10112418 | 3300026078 | Bacteria | 2424 |
| 525 | Ga0207702_10197887 | 3300026078 | Bacteria | 1861 |
| 526 | Ga0207641_10020600 | 3300026088 | Bacteria | 5418 |
| 527 | Ga0207648_10487218 | 3300026089 | Unclassified | 1127 |
| 528 | Ga0207648_11337522 | 3300026089 | Bacteria | 673 |
| 529 | Ga0207676_10011800 | 3300026095 | Bacteria | 6251 |
| 530 | Ga0207676_10083942 | 3300026095 | Bacteria | 2595 |
| 531 | Ga0207676_10208010 | 3300026095 | Bacteria | 1734 |
| 532 | Ga0207676_10781542 | 3300026095 | Bacteria | 930 |
| 533 | Ga0207676_11977683 | 3300026095 | Unclassified | 582 |
| 534 | Ga0207674_10028475 | 3300026116 | Bacteria | 5897 |
| 535 | Ga0207674_10144149 | 3300026116 | Bacteria | 2341 |
| 536 | Ga0207674_10160478 | 3300026116 | Unclassified | 2203 |
| 537 | Ga0207674_10265981 | 3300026116 | Bacteria | 1662 |
| 538 | Ga0207674_10279334 | 3300026116 | Unclassified | 1618 |
| 539 | Ga0207674_10851452 | 3300026116 | Bacteria | 879 |
| 540 | Ga0207674_11678244 | 3300026116 | Bacteria | 604 |
| 541 | Ga0207675_100017206 | 3300026118 | Bacteria | 6752 |
| 542 | Ga0207675_100189527 | 3300026118 | Bacteria | 1972 |
| 543 | Ga0207675_100835211 | 3300026118 | Bacteria | 936 |
| 544 | Ga0207675_100879820 | 3300026118 | Unclassified | 911 |
| 545 | Ga0207675_101265618 | 3300026118 | Unclassified | 758 |
| 546 | Ga0207675_101639312 | 3300026118 | Bacteria | 663 |
| 547 | Ga0207683_10528972 | 3300026121 | Unclassified | 1090 |
| 548 | Ga0207683_10531237 | 3300026121 | Bacteria | 1087 |
| 549 | Ga0207683_10561193 | 3300026121 | Bacteria | 1056 |
| 550 | Ga0207683_11139670 | 3300026121 | Unclassified | 723 |
| 551 | Ga0207683_11457909 | 3300026121 | Bacteria | 632 |
| 552 | Ga0207698_10204743 | 3300026142 | Bacteria | 1770 |
| 553 | Ga0207698_10413105 | 3300026142 | Bacteria | 1293 |
| 554 | Ga0207698_10416000 | 3300026142 | Unclassified | 1289 |
| 555 | Ga0207698_11043156 | 3300026142 | Bacteria | 829 |
| 556 | Ga0207698_11721841 | 3300026142 | Bacteria | 642 |
| 557 | Ga0207698_11986445 | 3300026142 | Unclassified | 596 |
| 558 | Ga0209995_1057959 | 3300027471 | Unclassified | 659 |
| 559 | Ga0209974_10093591 | 3300027876 | Bacteria | 1044 |
| 560 | Ga0207428_10009430 | 3300027907 | Bacteria | 8748 |
| 561 | Ga0207428_10209245 | 3300027907 | Unclassified | 1466 |
| 562 | Ga0268266_10127652 | 3300028379 | Bacteria | 2271 |
| 563 | Ga0268265_10255766 | 3300028380 | Unclassified | 1554 |
| 564 | Ga0268265_11676605 | 3300028380 | Bacteria | 641 |
| 565 | Ga0268264_10085251 | 3300028381 | Unclassified | 2711 |
| 566 | Ga0268264_10380106 | 3300028381 | Unclassified | 1352 |
| 567 | Ga0268264_11337493 | 3300028381 | Bacteria | 727 |
| 568 | Ga0265338_10189180 | 3300028800 | Bacteria | 1562 |
| 569 | Ga0265338_10240264 | 3300028800 | Unclassified | 1342 |
| 570 | Ga0265762_1013858 | 3300030760 | Bacteria | 1451 |
| 571 | Ga0265760_10010213 | 3300031090 | Bacteria | 2677 |
| 572 | Ga0265760_10057562 | 3300031090 | Unclassified | 1177 |
| 573 | Ga0265760_10233094 | 3300031090 | Unclassified | 632 |
| 574 | Ga0265327_10007562 | 3300031251 | Bacteria | 8351 |
| 575 | Ga0265327_10243940 | 3300031251 | Bacteria | 802 |
| 576 | Ga0307408_100213778 | 3300031548 | Unclassified | 1569 |
| 577 | Ga0265314_10001418 | 3300031711 | Bacteria | 26869 |
| 578 | Ga0265314_10027696 | 3300031711 | Bacteria | 4241 |
| 579 | Ga0307405_10047481 | 3300031731 | Bacteria | 2644 |
| 580 | Ga0307405_10132992 | 3300031731 | Bacteria | 1722 |
| 581 | Ga0307413_11267812 | 3300031824 | Unclassified | 643 |
| 582 | Ga0307413_11731234 | 3300031824 | Bacteria | 558 |
| 583 | Ga0307406_10551256 | 3300031901 | Bacteria | 943 |
| 584 | Ga0307407_10098268 | 3300031903 | Bacteria | 1811 |
| 585 | Ga0307407_10143820 | 3300031903 | Bacteria | 1542 |
| 586 | Ga0307412_10280475 | 3300031911 | Bacteria | 1308 |
| 587 | Ga0307409_100076733 | 3300031995 | Bacteria | 2681 |
| 588 | Ga0307409_100312942 | 3300031995 | Bacteria | 1466 |
| 589 | Ga0307409_100387529 | 3300031995 | Bacteria | 1331 |
| 590 | Ga0307416_100026773 | 3300032002 | Bacteria | 4256 |
| 591 | Ga0307416_101777929 | 3300032002 | Unclassified | 720 |
| 592 | Ga0307416_101869938 | 3300032002 | Unclassified | 704 |
| 593 | Ga0307414_10871945 | 3300032004 | Bacteria | 824 |
| 594 | Ga0307411_10120911 | 3300032005 | Bacteria | 1894 |
| 595 | Ga0307411_10305231 | 3300032005 | Unclassified | 1278 |
| 596 | Ga0307411_10623402 | 3300032005 | Unclassified | 930 |
| 597 | Ga0307415_100065126 | 3300032126 | Unclassified | 2538 |
| 598 | Ga0307415_101554251 | 3300032126 | Unclassified | 634 |
| 599 | Ga0373926_0005084 | 3300035083 | Unclassified | 4317 |
| 600 | Ga0373934_0029918 | 3300035086 | Bacteria | 2129 |
| 601 | Ga0373923_0038378 | 3300035111 | Bacteria | 1963 |
| 602 | Ga0373936_0221976 | 3300035113 | Bacteria | 838 |
| 603 | Ga0373936_0327226 | 3300035113 | Unclassified | 695 |
| 604 | Ga0373945_0000350 | 3300035116 | Bacteria | 13201 |
| 605 | Ga0373945_0198767 | 3300035116 | Bacteria | 831 |
| 606 | Ga0373954_0049731 | 3300035118 | Bacteria | 1966 |
| 607 | Ga0373956_0030667 | 3300035119 | Unclassified | 2352 |
| 608 | Ga0373956_0380379 | 3300035119 | Unclassified | 673 |
| 609 | Ga0373957_0039156 | 3300035120 | Bacteria | 1777 |
| 610 | Ga0373957_0091312 | 3300035120 | Bacteria | 1211 |
| 611 | Ga0373943_0005619 | 3300035170 | Bacteria | 5626 |
| 612 | Ga0373943_0006192 | 3300035170 | Bacteria | 5371 |
| 613 | Ga0373946_0177790 | 3300035171 | Unclassified | 1008 |
| 614 | Ga0373946_0208673 | 3300035171 | Bacteria | 938 |
| 615 | Ga0373955_0086044 | 3300035172 | Bacteria | 1785 |
| 616 | Ga0373955_0204391 | 3300035172 | Bacteria | 1176 |
| 617 | Ga0373955_0560060 | 3300035172 | Bacteria | 699 |
| 618 | Ga0373961_0124236 | 3300035241 | Bacteria | 858 |
| 619 | Ga0373924_0000782 | 3300035410 | Bacteria | 9892 |
| 620 | Ga0373924_0022822 | 3300035410 | Unclassified | 2449 |
| 621 | Ga0373924_0055791 | 3300035410 | Unclassified | 1644 |
| 622 | Ga0373931_0077679 | 3300035691 | Bacteria | 1825 |
| 623 | Ga0373931_1101121 | 3300035691 | Unclassified | 541 |
| 624 | Ga0373935_0000453 | 3300035692 | Bacteria | 21241 |
| 625 | Ga0373935_0138620 | 3300035692 | Unclassified | 1641 |
| 626 | Ga0373927_0000102 | 3300035695 | Bacteria | 64428 |
| 627 | Ga0373927_0000304 | 3300035695 | Bacteria | 38764 |
| 628 | Ga0373927_0027094 | 3300035695 | Bacteria | 3744 |
| 629 | Ga0373933_0028484 | 3300035724 | Bacteria | 3223 |
| 630 | Ga0373933_0218023 | 3300035724 | Bacteria | 1224 |
| 631 | Ga0373933_0243653 | 3300035724 | Bacteria | 1156 |
| 632 | Ga0373933_0290300 | 3300035724 | Unclassified | 1058 |
| 633 | Ga0373933_0322874 | 3300035724 | Unclassified | 1001 |
| 634 | Ga0373947_0000097 | 3300035725 | Bacteria | 44466 |
| 635 | Ga0373947_0024086 | 3300035725 | Bacteria | 3544 |
| 636 | Ga0373947_0040784 | 3300035725 | Bacteria | 2766 |
| 637 | Ga0373947_0373771 | 3300035725 | Bacteria | 959 |
| 638 | Ga0373937_0000464 | 3300036401 | Bacteria | 37475 |
| 639 | Ga0373937_0159790 | 3300036401 | Bacteria | 2113 |
| 640 | Ga0373937_0336571 | 3300036401 | Unclassified | 1429 |
| 641 | Ga0373937_0417414 | 3300036401 | Bacteria | 1273 |
| 642 | Ga0373937_0457897 | 3300036401 | Bacteria | 1212 |
| 643 | Ga0373937_0480426 | 3300036401 | Unclassified | 1180 |
| 644 | Ga0373925_0000427 | 3300037068 | Bacteria | 42637 |
| 645 | Ga0373925_0027882 | 3300037068 | Bacteria | 4134 |
| 646 | Ga0395899_0444841 | 3300037312 | Bacteria | 850 |
| 647 | Ga0395900_0240177 | 3300037418 | Bacteria | 1818 |
| 648 | Ga0395900_0450583 | 3300037418 | Unclassified | 1243 |
| 649 | Ga0395898_0094532 | 3300037466 | Unclassified | 2873 |
| 650 | Ga0436364_0162446 | 3300037853 | Unclassified | 2067 |
| 651 | Ga0436364_0233196 | 3300037853 | Bacteria | 16640 |
| 652 | Ga0436364_0251422 | 3300037853 | Unclassified | 701 |
| 653 | Ga0436364_0608146 | 3300037853 | Bacteria | 1288 |
| 654 | Ga0436364_0817813 | 3300037853 | Bacteria | 708 |
| 655 | Ga0436364_0827592 | 3300037853 | Bacteria | 811 |
| 656 | Ga0436364_0879886 | 3300037853 | Unclassified | 574 |
| 657 | Ga0436364_1373841 | 3300037853 | Bacteria | 2770 |
| 658 | Ga0436364_1390494 | 3300037853 | Bacteria | 983 |
| 659 | Ga0436364_1479394 | 3300037853 | Unclassified | 4660 |
| 660 | Ga0436365_0652661 | 3300039437 | Unclassified | 1333 |
| 661 | Ga0436365_1008595 | 3300039437 | Bacteria | 702 |
| 662 | Ga0436365_1299219 | 3300039437 | Bacteria | 3174 |
| 663 | Ga0436363_0005674 | 3300039450 | Unclassified | 694 |
| 664 | Ga0436363_0383478 | 3300039450 | Unclassified | 999 |
| 665 | Ga0436362_0317059 | 3300039453 | Unclassified | 618 |
| 666 | Ga0436362_1022535 | 3300039453 | Unclassified | 601 |
| 667 | Ga0439431_0068150 | 3300041997 | Unclassified | 945 |
| 668 | Ga0439457_087358 | 3300042014 | Unclassified | 720 |
| 669 | Ga0466969_0157108 | 3300044656 | Bacteria | 1046 |
| 670 | Ga0466966_0268020 | 3300044684 | Unclassified | 1028 |
| 671 | Ga0466963_0026632 | 3300044694 | Unclassified | 3699 |
| 672 | Ga0466963_0570821 | 3300044694 | Bacteria | 799 |
| 673 | Ga0466963_0770928 | 3300044694 | Unclassified | 678 |
| 674 | Ga0466959_0196947 | 3300045049 | Bacteria | 1404 |
| 675 | Ga0466959_0673190 | 3300045049 | Unclassified | 694 |
| 676 | Ga0466959_0817412 | 3300045049 | Unclassified | 623 |
| 677 | Ga0451576_0280911 | 3300045051 | Unclassified | 1741 |
| 678 | Ga0466967_0005911 | 3300045976 | Bacteria | 8578 |
| 679 | Ga0466967_0446624 | 3300045976 | Bacteria | 1263 |
| 680 | Ga0495592_0251569 | 3300046454 | Unclassified | 1168 |
| 681 | Ga0495651_0099629 | 3300046462 | Bacteria | 2167 |
| 682 | Ga0495651_0164331 | 3300046462 | Unclassified | 1587 |
| 683 | Ga0495653_0211685 | 3300046463 | Bacteria | 1309 |
| 684 | Ga0495580_0071514 | 3300046472 | Bacteria | 2424 |
| 685 | Ga0495580_0082515 | 3300046472 | Bacteria | 2240 |
| 686 | Ga0495580_0266786 | 3300046472 | Bacteria | 1170 |
| 687 | Ga0495580_0424923 | 3300046472 | Bacteria | 893 |
| 688 | Ga0495580_0813436 | 3300046472 | Bacteria | 605 |
| 689 | Ga0495582_0055932 | 3300046473 | Unclassified | 2175 |
| 690 | Ga0495582_0168220 | 3300046473 | Bacteria | 1247 |
| 691 | Ga0495639_0092299 | 3300046475 | Bacteria | 1422 |
| 692 | Ga0495664_0775371 | 3300046477 | Unclassified | 564 |
| 693 | Ga0495594_0098237 | 3300046499 | Unclassified | 1646 |
| 694 | Ga0495594_0536184 | 3300046499 | Unclassified | 664 |
| 695 | Ga0495608_0078132 | 3300046511 | Bacteria | 2154 |
| 696 | Ga0495628_0105079 | 3300046516 | Unclassified | 2176 |
| 697 | Ga0495630_0036133 | 3300046517 | Unclassified | 3693 |
| 698 | Ga0495630_0060909 | 3300046517 | Unclassified | 2834 |
| 699 | Ga0495632_0122295 | 3300046519 | Bacteria | 1216 |
| 700 | Ga0495643_0002622 | 3300046522 | Bacteria | 13984 |
| 701 | Ga0495652_0427966 | 3300046529 | Unclassified | 931 |
| 702 | Ga0495652_0658969 | 3300046529 | Bacteria | 708 |
| 703 | Ga0495665_0040945 | 3300046531 | Bacteria | 2466 |
| 704 | Ga0495586_0022204 | 3300046535 | Unclassified | 3386 |
| 705 | Ga0495586_0608452 | 3300046535 | Unclassified | 631 |
| 706 | Ga0495645_0230709 | 3300046543 | Bacteria | 1240 |
| 707 | Ga0495635_0685230 | 3300046663 | Bacteria | 665 |
| 708 | Ga0495588_0265214 | 3300046674 | Bacteria | 905 |
| 709 | Ga0495657_0718088 | 3300046675 | Unclassified | 574 |
| 710 | Ga0495623_0108432 | 3300046679 | Unclassified | 1685 |
| 711 | Ga0495623_0192314 | 3300046679 | Bacteria | 1178 |
| 712 | Ga0495613_0002002 | 3300046689 | Bacteria | 15472 |
| 713 | Ga0495624_0026449 | 3300046690 | Unclassified | 3803 |
| 714 | Ga0495581_0454845 | 3300047315 | Bacteria | 745 |
| 715 | Ga0495604_0523373 | 3300047317 | Unclassified | 767 |
| 716 | Ga0495636_0063029 | 3300047318 | Unclassified | 1570 |
| 717 | Ga0495674_0003750 | 3300047319 | Bacteria | 14783 |
| 718 | Ga0495674_0476087 | 3300047319 | Unclassified | 1001 |
| 719 | Ga0495675_0622243 | 3300047444 | Bacteria | 610 |
| 720 | Ga0495684_0491716 | 3300047471 | Bacteria | 845 |
| 721 | Ga0495684_0501687 | 3300047471 | Bacteria | 834 |
| 722 | Ga0495686_0001240 | 3300047472 | Bacteria | 29081 |
| 723 | Ga0495593_0492202 | 3300047673 | Bacteria | 615 |
| 724 | Ga0495602_0091946 | 3300048088 | Unclassified | 2515 |
| 725 | Ga0495602_1103990 | 3300048088 | Unclassified | 520 |
| 726 | Ga0496100_0250458 | 3300048903 | Unclassified | 1310 |
| 727 | Ga0496100_0600101 | 3300048903 | Unclassified | 855 |
| 728 | Ga0496100_0953226 | 3300048903 | Unclassified | 675 |
| 729 | Ga0496101_0259159 | 3300048904 | Bacteria | 1356 |
| 730 | Ga0496102_0356918 | 3300048905 | Bacteria | 1376 |
| 731 | Ga0496103_0825767 | 3300048906 | Unclassified | 584 |
| 732 | Ga0496104_0063507 | 3300048907 | Unclassified | 3502 |
| 733 | Ga0496104_0267216 | 3300048907 | Unclassified | 1623 |
| 734 | Ga0496104_0351245 | 3300048907 | Bacteria | 1387 |
| 735 | Ga0496104_0472105 | 3300048907 | Bacteria | 1166 |
| 736 | Ga0496104_0645405 | 3300048907 | Unclassified | 968 |
| 737 | Ga0496104_1509101 | 3300048907 | Unclassified | 575 |
| 738 | Ga0496110_0023918 | 3300048913 | Bacteria | 5202 |
| 739 | Ga0496110_0058123 | 3300048913 | Unclassified | 3406 |
| 740 | Ga0496111_0002497 | 3300048914 | Bacteria | 11093 |
| 741 | Ga0496112_0003518 | 3300048915 | Bacteria | 12986 |
| 742 | Ga0496112_0009274 | 3300048915 | Bacteria | 8848 |
| 743 | Ga0496113_0002748 | 3300048916 | Bacteria | 10341 |
| 744 | Ga0496113_0724310 | 3300048916 | Unclassified | 793 |
| 745 | Ga0496114_1340059 | 3300048917 | Unclassified | 603 |
| 746 | Ga0496115_0015735 | 3300048918 | Bacteria | 5745 |
| 747 | Ga0496115_0063569 | 3300048918 | Bacteria | 2978 |
| 748 | Ga0496115_0201911 | 3300048918 | Bacteria | 1642 |
| 749 | Ga0501291_016960 | 3300049514 | Bacteria | 1117 |
| 750 | Ga0501031_0008990 | 3300049568 | Bacteria | 6499 |
| 751 | Ga0501032_0001438 | 3300049569 | Bacteria | 18907 |
| 752 | Ga0501033_0048779 | 3300049570 | Unclassified | 3144 |
| 753 | Ga0501034_0075693 | 3300049571 | Unclassified | 3372 |
| 754 | Ga0501036_0000295 | 3300049572 | Bacteria | 34600 |
| 755 | Ga0501037_0003767 | 3300049573 | Bacteria | 11000 |
| 756 | Ga0501038_0001014 | 3300049574 | Bacteria | 25267 |
| 757 | Ga0501039_0014391 | 3300049575 | Bacteria | 6059 |
| 758 | Ga0501041_0807450 | 3300049577 | Unclassified | 602 |
| 759 | Ga0501042_0891512 | 3300049578 | Bacteria | 648 |
| 760 | Ga0501042_0959274 | 3300049578 | Unclassified | 623 |
| 761 | Ga0501043_0005471 | 3300049579 | Bacteria | 10262 |
| 762 | Ga0501046_0003170 | 3300049580 | Bacteria | 15183 |
| 763 | Ga0501047_0050040 | 3300049581 | Unclassified | 4034 |
| 764 | Ga0501048_0020743 | 3300049582 | Unclassified | 4816 |
| 765 | Ga0501067_0015245 | 3300049583 | Unclassified | 4255 |
| 766 | Ga0501068_0000872 | 3300049584 | Bacteria | 15717 |
| 767 | Ga0501069_0001336 | 3300049585 | Bacteria | 12078 |
| 768 | Ga0501070_0044344 | 3300049586 | Unclassified | 3701 |
| 769 | Ga0501072_0056098 | 3300049588 | Unclassified | 3104 |
| 770 | Ga0501073_0001754 | 3300049589 | Bacteria | 16104 |
| 771 | Ga0501074_0026056 | 3300049590 | Unclassified | 4240 |
| 772 | Ga0501076_0291742 | 3300049592 | Bacteria | 1336 |
| 773 | Ga0501077_0009505 | 3300049593 | Bacteria | 6044 |
| 774 | Ga0501234_106949 | 3300049707 | Bacteria | 513 |
| 775 | Ga0501079_0007356 | 3300049741 | Bacteria | 8325 |
| 776 | Ga0501080_0000017 | 3300049742 | Bacteria | 96079 |
| 777 | Ga0501083_0014238 | 3300049744 | Bacteria | 5563 |
| 778 | Ga0501083_0444006 | 3300049744 | Bacteria | 844 |
| 779 | Ga0501035_0091958 | 3300049822 | Unclassified | 2669 |
| 780 | Ga0501044_0021505 | 3300049823 | Bacteria | 6879 |
| 781 | nmdc:mga05p37_1676575_c1 | 3300050507 | Unclassified | 621 |
| 782 | nmdc:mga05p37_325005_c1 | 3300050507 | Bacteria | 1819 |
| 783 | nmdc:mga09592_504796_c1 | 3300050508 | Unclassified | 1041 |
| 784 | nmdc:mga0qj67_45937_c1 | 3300050509 | Bacteria | 3446 |
| 785 | nmdc:mga06r32_565694_c1 | 3300050510 | Bacteria | 1110 |
| 786 | nmdc:mga06r32_72659_c1 | 3300050510 | Bacteria | 2179 |
| 787 | nmdc:mga08y16_12292_c1 | 3300050511 | Bacteria | 9001 |
| 788 | nmdc:mga08y16_245744_c1 | 3300050511 | Bacteria | 1849 |
| 789 | nmdc:mga0n895_1447511_c1 | 3300050512 | Unclassified | 654 |
| 790 | nmdc:mga0n895_1514883_c1 | 3300050512 | Unclassified | 637 |
| 791 | nmdc:mga0n895_911429_c1 | 3300050512 | Unclassified | 864 |
| 792 | nmdc:mga08x19_200895_c1 | 3300050514 | Bacteria | 1366 |
| 793 | Ga0495612_0455232 | 3300053078 | Unclassified | 585 |
| 794 | Ga0500583_0038221 | 3300053092 | Bacteria | 2160 |
| 795 | Ga0500583_0061409 | 3300053092 | Unclassified | 1774 |
| 796 | Ga0500641_0132628 | 3300053096 | Unclassified | 1075 |
| 797 | Ga0500650_0271052 | 3300053098 | Bacteria | 757 |
| 798 | Ga0500595_034274 | 3300053119 | Bacteria | 1680 |
| 799 | Ga0500616_0000105 | 3300053153 | Bacteria | 157881 |
| 800 | Ga0500637_0148893 | 3300053178 | Bacteria | 1353 |
| 801 | Ga0501084_0012610 | 3300054114 | Bacteria | 7001 |
| 802 | Ga0501082_0028239 | 3300060353 | Unclassified | 4834 |
| 803 | Ga0501082_0242137 | 3300060353 | Unclassified | 1570 |
| 804 | Ga0070678_101841782 | |||
| 805 | rootH2_10079227 | |||
| 806 | Ga0065715_10156653 | |||
| 807 | Ga0065707_10481809 | |||
| 808 | Ga0070658_10415623 | |||
| 809 | Ga0070683_100028360 | |||
| 810 | Ga0070683_100058048 | |||
| 811 | Ga0070683_100089070 | |||
| 812 | Ga0070683_100157346 | |||
| 813 | Ga0070683_100826957 | |||
| 814 | Ga0070683_101115417 | |||
| 815 | Ga0070670_100001974 | |||
| 816 | Ga0070670_100725167 | |||
| 817 | Ga0070677_10341692 | |||
| 818 | Ga0068869_100075132 | |||
| 819 | Ga0068869_100569997 | |||
| 820 | Ga0070666_10883517 | |||
| 821 | Ga0070680_100052522 | |||
| 822 | Ga0070680_100283138 | |||
| 823 | Ga0070680_100657053 | |||
| 824 | Ga0070680_101554329 | |||
| 825 | Ga0070680_102013224 | |||
| 826 | Ga0068868_100047132 | |||
| 827 | Ga0068868_100472206 | |||
| 828 | Ga0068868_100485010 | |||
| 829 | Ga0068868_101896785 | |||
| 830 | Ga0070660_100038380 | |||
| 831 | Ga0070660_100382882 | |||
| 832 | Ga0070660_101031095 | |||
| 833 | Ga0070660_101268016 | |||
| 834 | Ga0070660_101423609 | |||
| 835 | Ga0070689_100026720 | |||
| 836 | Ga0070689_100115965 | |||
| 837 | Ga0070689_100346858 | |||
| 838 | Ga0070689_101602557 | |||
| 839 | Ga0070691_10707593 | |||
| 840 | Ga0070687_100039491 | |||
| 841 | Ga0070661_100052920 | |||
| 842 | Ga0070661_100062658 | |||
| 843 | Ga0070661_100298551 | |||
| 844 | Ga0070661_100849174 | |||
| 845 | Ga0070692_10055513 | |||
| 846 | Ga0070692_10262243 | |||
| 847 | Ga0070668_100163560 | |||
| 848 | Ga0070668_101140493 | |||
| 849 | Ga0070669_100004850 | |||
| 850 | Ga0070675_100000667 | |||
| 851 | Ga0070675_100046847 | |||
| 852 | Ga0070675_100086976 | |||
| 853 | Ga0070675_100506472 | |||
| 854 | Ga0070671_100101297 | |||
| 855 | Ga0070671_100306495 | |||
| 856 | Ga0070671_101670464 | |||
| 857 | Ga0070673_100028304 | |||
| 858 | Ga0070688_100156070 | |||
| 859 | Ga0070659_100014834 | |||
| 860 | Ga0070659_100176502 | |||
| 861 | Ga0070659_100266655 | |||
| 862 | Ga0070667_100256076 | |||
| 863 | Ga0070709_10018168 | |||
| 864 | Ga0070709_10369097 | |||
| 865 | Ga0070709_10407605 | |||
| 866 | Ga0070714_100019879 | |||
| 867 | Ga0070714_100042565 | |||
| 868 | Ga0070714_101181717 | |||
| 869 | Ga0070714_101294305 | |||
| 870 | Ga0070714_101423869 | |||
| 871 | Ga0070714_101938888 | |||
| 872 | Ga0070713_100000111 | |||
| 873 | Ga0070713_100173925 | |||
| 874 | Ga0070713_100214709 | |||
| 875 | Ga0070713_100281795 | |||
| 876 | Ga0070713_100305751 | |||
| 877 | Ga0070713_100386872 | |||
| 878 | Ga0070713_100470924 | |||
| 879 | Ga0070713_100487472 | |||
| 880 | Ga0070713_100523273 | |||
| 881 | Ga0070713_100568856 | |||
| 882 | Ga0070713_100714194 | |||
| 883 | Ga0070713_100717714 | |||
| 884 | Ga0070713_100740826 | |||
| 885 | Ga0070710_10160349 | |||
| 886 | Ga0070710_10186586 | |||
| 887 | Ga0070710_11534439 | |||
| 888 | Ga0070701_10013748 | |||
| 889 | Ga0070701_10435271 | |||
| 890 | Ga0070701_11210545 | |||
| 891 | Ga0070711_100004402 | |||
| 892 | Ga0070711_100007267 | |||
| 893 | Ga0070711_100025000 | |||
| 894 | Ga0070711_100034280 | |||
| 895 | Ga0070711_100041896 | |||
| 896 | Ga0070711_100227870 | |||
| 897 | Ga0070711_100267652 | |||
| 898 | Ga0070711_101310294 | |||
| 899 | Ga0070705_101556637 | |||
| 900 | Ga0070700_100714981 | |||
| 901 | Ga0070694_100181907 | |||
| 902 | Ga0070694_100472860 | |||
| 903 | Ga0070708_101207493 | |||
| 904 | Ga0070663_100493218 | |||
| 905 | Ga0070663_101624787 | |||
| 906 | Ga0070678_100162843 | |||
| 907 | Ga0070678_100169403 | |||
| 908 | Ga0070678_100716898 | |||
| 909 | Ga0070678_100923028 | |||
| 910 | Ga0070678_101330068 | |||
| 911 | Ga0070662_100263077 | |||
| 912 | Ga0070662_100295034 | |||
| 913 | Ga0070662_100375462 | |||
| 914 | Ga0070662_100452043 | |||
| 915 | Ga0070681_10000483 | |||
| 916 | Ga0070681_10163397 | |||
| 917 | Ga0070681_10377083 | |||
| 918 | Ga0070681_10520590 | |||
| 919 | Ga0070685_10687798 | |||
| 920 | Ga0070706_100123271 | |||
| 921 | Ga0070707_100000757 | |||
| 922 | Ga0070679_100007031 | |||
| 923 | Ga0070679_100272001 | |||
| 924 | Ga0070679_100370097 | |||
| 925 | Ga0070679_100375819 | |||
| 926 | Ga0070679_100611259 | |||
| 927 | Ga0070679_101576964 | |||
| 928 | Ga0070684_100038250 | |||
| 929 | Ga0070684_100208684 | |||
| 930 | Ga0070684_100273274 | |||
| 931 | Ga0070684_101903985 | |||
| 932 | Ga0070697_100020394 | |||
| 933 | Ga0070697_101557635 | |||
| 934 | Ga0068853_100007353 | |||
| 935 | Ga0068853_100067924 | |||
| 936 | Ga0068853_100076099 | |||
| 937 | Ga0068853_100110101 | |||
| 938 | Ga0068853_100216613 | |||
| 939 | Ga0070672_100016071 | |||
| 940 | Ga0070695_100004444 | |||
| 941 | Ga0070696_100979156 | |||
| 942 | Ga0070693_100448495 | |||
| 943 | Ga0070693_100480649 | |||
| 944 | Ga0070693_100698011 | |||
| 945 | Ga0070665_100003472 | |||
| 946 | Ga0070665_100437461 | |||
| 947 | Ga0070704_100036542 | |||
| 948 | Ga0068855_100000656 | |||
| 949 | Ga0068855_100011538 | |||
| 950 | Ga0068855_100016579 | |||
| 951 | Ga0068855_100032021 | |||
| 952 | Ga0068855_100045002 | |||
| 953 | Ga0068855_100059277 | |||
| 954 | Ga0068855_100288059 | |||
| 955 | Ga0068855_100568578 | |||
| 956 | Ga0068855_100823710 | |||
| 957 | Ga0070664_100020783 | |||
| 958 | Ga0070664_100029007 | |||
| 959 | Ga0070664_100047277 | |||
| 960 | Ga0070664_100059394 | |||
| 961 | Ga0070664_100070616 | |||
| 962 | Ga0070664_101604385 | |||
| 963 | Ga0068857_100028696 | |||
| 964 | Ga0068857_100065622 | |||
| 965 | Ga0068857_100734884 | |||
| 966 | Ga0068857_100772417 | |||
| 967 | Ga0068854_100931697 | |||
| 968 | Ga0068854_101168299 | |||
| 969 | Ga0068854_101891963 | |||
| 970 | Ga0068856_100001584 | |||
| 971 | Ga0068856_100004446 | |||
| 972 | Ga0068856_100007508 | |||
| 973 | Ga0068856_100033422 | |||
| 974 | Ga0068856_100056352 | |||
| 975 | Ga0068856_100201518 | |||
| 976 | Ga0068856_100379183 | |||
| 977 | Ga0068856_100427373 | |||
| 978 | Ga0068856_100641631 | |||
| 979 | Ga0070702_100589518 | |||
| 980 | Ga0070702_101644875 | |||
| 981 | Ga0068852_100007795 | |||
| 982 | Ga0068852_100017100 | |||
| 983 | Ga0068852_100476979 | |||
| 984 | Ga0068852_101326881 | |||
| 985 | Ga0068859_100143351 | |||
| 986 | Ga0068859_100817058 | |||
| 987 | Ga0068859_101155331 | |||
| 988 | Ga0068859_101233052 | |||
| 989 | Ga0068859_101388673 | |||
| 990 | Ga0068859_101881201 | |||
| 991 | Ga0068864_100095302 | |||
| 992 | Ga0068864_100202027 | |||
| 993 | Ga0068864_100225666 | |||
| 994 | Ga0068864_102023237 | |||
| 995 | Ga0068861_100010665 | |||
| 996 | Ga0068861_100206536 | |||
| 997 | Ga0068861_100256018 | |||
| 998 | Ga0068861_101254800 | |||
| 999 | Ga0068861_101344659 | |||
| 1000 | Ga0068861_101381641 | |||
| 1001 | Ga0068863_100018504 | |||
| 1002 | Ga0068863_100816882 | |||
| 1003 | Ga0068863_101002778 | |||
| 1004 | Ga0068858_100011509 | |||
| 1005 | Ga0068858_100195524 | |||
| 1006 | Ga0068858_100407993 | |||
| 1007 | Ga0068858_100617779 | |||
| 1008 | Ga0068860_100046476 | |||
| 1009 | Ga0068860_100165724 | |||
| 1010 | Ga0068860_100325359 | |||
| 1011 | Ga0068860_100443605 | |||
| 1012 | Ga0068862_100060715 | |||
| 1013 | Ga0068862_100175826 | |||
| 1014 | Ga0068862_101867752 | |||
| 1015 | Ga0068862_102520710 | |||
| 1016 | Ga0068862_102692763 | |||
| 1017 | Ga0070717_10091844 | |||
| 1018 | Ga0070717_10110083 | |||
| 1019 | Ga0070717_10483942 | |||
| 1020 | Ga0070717_10557383 | |||
| 1021 | Ga0070717_10592919 | |||
| 1022 | Ga0070717_11553720 | |||
| 1023 | Ga0070717_11626357 | |||
| 1024 | Ga0070715_10531063 | |||
| 1025 | Ga0070716_100004320 | |||
| 1026 | Ga0070716_100072123 | |||
| 1027 | Ga0070716_100214372 | |||
| 1028 | Ga0070716_100347624 | |||
| 1029 | Ga0070716_100687564 | |||
| 1030 | Ga0070712_100000453 | |||
| 1031 | Ga0070712_100013375 | |||
| 1032 | Ga0070712_100190098 | |||
| 1033 | Ga0070712_100312058 | |||
| 1034 | Ga0070712_100378210 | |||
| 1035 | Ga0070712_100493642 | |||
| 1036 | Ga0097621_100000631 | |||
| 1037 | Ga0097621_100002425 | |||
| 1038 | Ga0097621_100137367 | |||
| 1039 | Ga0097621_100525132 | |||
| 1040 | Ga0097621_100565251 | |||
| 1041 | Ga0097621_100987139 | |||
| 1042 | Ga0097621_102004011 | |||
| 1043 | Ga0097621_102323345 | |||
| 1044 | Ga0068871_100000220 | |||
| 1045 | Ga0068871_100001703 | |||
| 1046 | Ga0068871_100470409 | |||
| 1047 | Ga0068871_100791223 | |||
| 1048 | Ga0068871_101149792 | |||
| 1049 | Ga0068871_102321797 | |||
| 1050 | Ga0075428_100092852 | |||
| 1051 | Ga0075430_100750758 | |||
| 1052 | Ga0075431_100065736 | |||
| 1053 | Ga0075431_100489472 | |||
| 1054 | Ga0075433_10850775 | |||
| 1055 | Ga0075434_100427130 | |||
| 1056 | Ga0075434_101052616 | |||
| 1057 | Ga0075434_101488549 | |||
| 1058 | Ga0075429_100183874 | |||
| 1059 | Ga0068865_100000829 | |||
| 1060 | Ga0068865_100114322 | |||
| 1061 | Ga0068865_100125386 | |||
| 1062 | Ga0068865_101287241 | |||
| 1063 | Ga0097620_100143355 | |||
| 1064 | Ga0097620_100816971 | |||
| 1065 | Ga0097620_101155678 | |||
| 1066 | Ga0097620_101233077 | |||
| 1067 | Ga0097620_101388750 | |||
| 1068 | Ga0097620_101880929 | |||
| 1069 | Ga0099794_10460654 | |||
| 1070 | Ga0105240_10013042 | |||
| 1071 | Ga0105240_10031145 | |||
| 1072 | Ga0105240_10049604 | |||
| 1073 | Ga0105240_10116458 | |||
| 1074 | Ga0105240_10215641 | |||
| 1075 | Ga0105240_10286716 | |||
| 1076 | Ga0105240_10290097 | |||
| 1077 | Ga0105240_10494428 | |||
| 1078 | Ga0105240_10621394 | |||
| 1079 | Ga0105240_10893629 | |||
| 1080 | Ga0105240_11309943 | |||
| 1081 | Ga0111539_10055492 | |||
| 1082 | Ga0111539_12457837 | |||
| 1083 | Ga0105245_10196162 | |||
| 1084 | Ga0105245_11401497 | |||
| 1085 | Ga0105245_11493141 | |||
| 1086 | Ga0105247_10255149 | |||
| 1087 | Ga0114129_10345236 | |||
| 1088 | Ga0105243_10259847 | |||
| 1089 | Ga0105243_10707904 | |||
| 1090 | Ga0105243_12143092 | |||
| 1091 | Ga0105241_10169457 | |||
| 1092 | Ga0105241_10224910 | |||
| 1093 | Ga0105241_10572860 | |||
| 1094 | Ga0105241_11943464 | |||
| 1095 | Ga0105241_12465492 | |||
| 1096 | Ga0105242_10024190 | |||
| 1097 | Ga0105242_10173426 | |||
| 1098 | Ga0105242_10251577 | |||
| 1099 | Ga0105248_10003212 | |||
| 1100 | Ga0105248_10762375 | |||
| 1101 | Ga0105248_11551704 | |||
| 1102 | Ga0105237_10323442 | |||
| 1103 | Ga0105237_10694527 | |||
| 1104 | Ga0105237_10854338 | |||
| 1105 | Ga0105237_11544029 | |||
| 1106 | Ga0105238_10152608 | |||
| 1107 | Ga0105238_10179126 | |||
| 1108 | Ga0105238_10333625 | |||
| 1109 | Ga0105238_10857718 | |||
| 1110 | Ga0105238_11945453 | |||
| 1111 | Ga0105238_12192428 | |||
| 1112 | Ga0105249_10287716 | |||
| 1113 | Ga0105249_10357055 | |||
| 1114 | Ga0105249_10666084 | |||
| 1115 | Ga0105249_10835591 | |||
| 1116 | Ga0105249_12187079 | |||
| 1117 | Ga0099796_10398516 | |||
| 1118 | Ga0105239_10178344 | |||
| 1119 | Ga0105239_10231719 | |||
| 1120 | Ga0105239_10422045 | |||
| 1121 | Ga0105239_11214300 | |||
| 1122 | Ga0105246_11488955 | |||
| 1123 | Ga0105246_11825769 | |||
| 1124 | Ga0157371_10328358 | |||
| 1125 | Ga0157371_11104433 | |||
| 1126 | Ga0157370_10022542 | |||
| 1127 | Ga0157370_10348062 | |||
| 1128 | Ga0157369_10023142 | |||
| 1129 | Ga0157369_10048525 | |||
| 1130 | Ga0157369_10155062 | |||
| 1131 | Ga0157369_10155085 | |||
| 1132 | Ga0157369_10380551 | |||
| 1133 | Ga0157369_10549642 | |||
| 1134 | Ga0157369_10681901 | |||
| 1135 | Ga0157369_11930182 | |||
| 1136 | Ga0157374_10000164 | |||
| 1137 | Ga0157374_10052083 | |||
| 1138 | Ga0157374_10926477 | |||
| 1139 | Ga0157374_11390471 | |||
| 1140 | Ga0157374_11663999 | |||
| 1141 | Ga0157378_10000204 | |||
| 1142 | Ga0157372_10001933 | |||
| 1143 | Ga0157372_10174613 | |||
| 1144 | Ga0157372_10185665 | |||
| 1145 | Ga0157372_10190871 | |||
| 1146 | Ga0157372_10205931 | |||
| 1147 | Ga0157372_10239030 | |||
| 1148 | Ga0157372_10270929 | |||
| 1149 | Ga0157375_10383973 | |||
| 1150 | Ga0163163_10024431 | |||
| 1151 | Ga0163163_10617745 | |||
| 1152 | Ga0163163_10826310 | |||
| 1153 | Ga0157380_10079027 | |||
| 1154 | Ga0157380_10267308 | |||
| 1155 | Ga0157380_13411529 | |||
| 1156 | Ga0157377_10136715 | |||
| 1157 | Ga0157377_10704276 | |||
| 1158 | Ga0157379_11046881 | |||
| 1159 | Ga0157376_10012147 | |||
| 1160 | Ga0157376_10016016 | |||
| 1161 | Ga0157376_10098749 | |||
| 1162 | Ga0157376_11399259 | |||
| 1163 | Ga0163161_10994179 | |||
| 1164 | Ga0213874_10212965 | |||
| 1165 | Ga0213874_10267724 | |||
| 1166 | Ga0213876_10541261 | |||
| 1167 | Ga0213875_10039476 | |||
| 1168 | Ga0213875_10221263 | |||
| 1169 | Ga0213875_10472288 | |||
| 1170 | Ga0207697_10055968 | |||
| 1171 | Ga0207682_10324794 | |||
| 1172 | Ga0207692_10584763 | |||
| 1173 | Ga0207710_10026941 | |||
| 1174 | Ga0207710_10506949 | |||
| 1175 | Ga0207688_10278842 | |||
| 1176 | Ga0207647_10290039 | |||
| 1177 | Ga0207647_10537927 | |||
| 1178 | Ga0207643_11039460 | |||
| 1179 | Ga0207684_10185483 | |||
| 1180 | Ga0207684_10428512 | |||
| 1181 | Ga0207654_10277751 | |||
| 1182 | Ga0207707_10009160 | |||
| 1183 | Ga0207707_10131297 | |||
| 1184 | Ga0207707_10414934 | |||
| 1185 | Ga0207695_10041165 | |||
| 1186 | Ga0207695_10043394 | |||
| 1187 | Ga0207695_10047068 | |||
| 1188 | Ga0207695_10099409 | |||
| 1189 | Ga0207695_10123594 | |||
| 1190 | Ga0207695_10158530 | |||
| 1191 | Ga0207695_10484571 | |||
| 1192 | Ga0207671_10189501 | |||
| 1193 | Ga0207671_10342153 | |||
| 1194 | Ga0207693_10000066 | |||
| 1195 | Ga0207693_10009445 | |||
| 1196 | Ga0207693_10024268 | |||
| 1197 | Ga0207693_10494419 | |||
| 1198 | Ga0207693_10559018 | |||
| 1199 | Ga0207693_11086554 | |||
| 1200 | Ga0207663_10001476 | |||
| 1201 | Ga0207663_10010788 | |||
| 1202 | Ga0207663_10216141 | |||
| 1203 | Ga0207663_10827901 | |||
| 1204 | Ga0207660_10047171 | |||
| 1205 | Ga0207660_10213766 | |||
| 1206 | Ga0207660_10586230 | |||
| 1207 | Ga0207662_10108963 | |||
| 1208 | Ga0207657_10038749 | |||
| 1209 | Ga0207657_10046059 | |||
| 1210 | Ga0207649_10012342 | |||
| 1211 | Ga0207649_10054464 | |||
| 1212 | Ga0207649_10108585 | |||
| 1213 | Ga0207652_10024267 | |||
| 1214 | Ga0207652_10050603 | |||
| 1215 | Ga0207652_10305213 | |||
| 1216 | Ga0207652_10371446 | |||
| 1217 | Ga0207652_10550602 | |||
| 1218 | Ga0207652_10695388 | |||
| 1219 | Ga0207652_11070505 | |||
| 1220 | Ga0207646_10000478 | |||
| 1221 | Ga0207681_10013605 | |||
| 1222 | Ga0207694_10001705 | |||
| 1223 | Ga0207694_10200187 | |||
| 1224 | Ga0207694_11128229 | |||
| 1225 | Ga0207694_11228384 | |||
| 1226 | Ga0207650_10043165 | |||
| 1227 | Ga0207650_10683656 | |||
| 1228 | Ga0207659_10000222 | |||
| 1229 | Ga0207659_10391101 | |||
| 1230 | Ga0207659_10466974 | |||
| 1231 | Ga0207659_10536155 | |||
| 1232 | Ga0207687_10345374 | |||
| 1233 | Ga0207687_10577708 | |||
| 1234 | Ga0207687_11035049 | |||
| 1235 | Ga0207700_10000328 | |||
| 1236 | Ga0207700_10207889 | |||
| 1237 | Ga0207700_10223768 | |||
| 1238 | Ga0207700_10434206 | |||
| 1239 | Ga0207700_11585662 | |||
| 1240 | Ga0207664_10001074 | |||
| 1241 | Ga0207664_10210841 | |||
| 1242 | Ga0207644_10234891 | |||
| 1243 | Ga0207644_10244618 | |||
| 1244 | Ga0207644_10845353 | |||
| 1245 | Ga0207690_10010126 | |||
| 1246 | Ga0207706_10295546 | |||
| 1247 | Ga0207706_10385347 | |||
| 1248 | Ga0207706_10466981 | |||
| 1249 | Ga0207706_10986458 | |||
| 1250 | Ga0207686_10262760 | |||
| 1251 | Ga0207686_10490619 | |||
| 1252 | Ga0207686_11672372 | |||
| 1253 | Ga0207709_10612246 | |||
| 1254 | Ga0207709_10951146 | |||
| 1255 | Ga0207670_10149053 | |||
| 1256 | Ga0207670_10170589 | |||
| 1257 | Ga0207670_10189116 | |||
| 1258 | Ga0207669_10288353 | |||
| 1259 | Ga0207704_11394945 | |||
| 1260 | Ga0207665_10062770 | |||
| 1261 | Ga0207665_10067110 | |||
| 1262 | Ga0207665_10170238 | |||
| 1263 | Ga0207665_10414943 | |||
| 1264 | Ga0207665_10610423 | |||
| 1265 | Ga0207665_10808044 | |||
| 1266 | Ga0207691_10259413 | |||
| 1267 | Ga0207711_10080710 | |||
| 1268 | Ga0207711_10215978 | |||
| 1269 | Ga0207711_11220050 | |||
| 1270 | Ga0207711_11270918 | |||
| 1271 | Ga0207689_10522598 | |||
| 1272 | Ga0207661_10025003 | |||
| 1273 | Ga0207661_10055880 | |||
| 1274 | Ga0207661_10161574 | |||
| 1275 | Ga0207661_10802221 | |||
| 1276 | Ga0207661_10973998 | |||
| 1277 | Ga0207661_11586648 | |||
| 1278 | Ga0207679_10086849 | |||
| 1279 | Ga0207679_10217000 | |||
| 1280 | Ga0207679_10370859 | |||
| 1281 | Ga0207679_10378048 | |||
| 1282 | Ga0207679_10478554 | |||
| 1283 | Ga0207679_10818139 | |||
| 1284 | Ga0207667_10002423 | |||
| 1285 | Ga0207667_10009378 | |||
| 1286 | Ga0207667_10022637 | |||
| 1287 | Ga0207667_10028547 | |||
| 1288 | Ga0207667_10094788 | |||
| 1289 | Ga0207667_10250918 | |||
| 1290 | Ga0207667_10738292 | |||
| 1291 | Ga0207651_10106096 | |||
| 1292 | Ga0207651_10773259 | |||
| 1293 | Ga0207651_10793587 | |||
| 1294 | Ga0207712_10208356 | |||
| 1295 | Ga0207712_10481125 | |||
| 1296 | Ga0207712_10838960 | |||
| 1297 | Ga0207668_10463076 | |||
| 1298 | Ga0207668_10816670 | |||
| 1299 | Ga0207640_10068176 | |||
| 1300 | Ga0207640_10188272 | |||
| 1301 | Ga0207640_11137997 | |||
| 1302 | Ga0207658_11930007 | |||
| 1303 | Ga0207677_10441825 | |||
| 1304 | Ga0207677_10531266 | |||
| 1305 | Ga0207677_10734755 | |||
| 1306 | Ga0207677_11749965 | |||
| 1307 | Ga0207703_10010958 | |||
| 1308 | Ga0207703_10142045 | |||
| 1309 | Ga0207703_10378432 | |||
| 1310 | Ga0207703_10572747 | |||
| 1311 | Ga0207703_10850367 | |||
| 1312 | Ga0207703_12418160 | |||
| 1313 | Ga0207639_10058244 | |||
| 1314 | Ga0207639_10075664 | |||
| 1315 | Ga0207639_10077603 | |||
| 1316 | Ga0207639_10376842 | |||
| 1317 | Ga0207639_11660621 | |||
| 1318 | Ga0207678_10676333 | |||
| 1319 | Ga0207678_10825350 | |||
| 1320 | Ga0207708_10396248 | |||
| 1321 | Ga0207702_10001476 | |||
| 1322 | Ga0207702_10004134 | |||
| 1323 | Ga0207702_10024301 | |||
| 1324 | Ga0207702_10052310 | |||
| 1325 | Ga0207702_10065951 | |||
| 1326 | Ga0207702_10086737 | |||
| 1327 | Ga0207702_10112418 | |||
| 1328 | Ga0207702_10197887 | |||
| 1329 | Ga0207641_10020600 | |||
| 1330 | Ga0207648_10487218 | |||
| 1331 | Ga0207648_11337522 | |||
| 1332 | Ga0207676_10011800 | |||
| 1333 | Ga0207676_10083942 | |||
| 1334 | Ga0207676_10208010 | |||
| 1335 | Ga0207676_10781542 | |||
| 1336 | Ga0207676_11977683 | |||
| 1337 | Ga0207674_10028475 | |||
| 1338 | Ga0207674_10144149 | |||
| 1339 | Ga0207674_10160478 | |||
| 1340 | Ga0207674_10265981 | |||
| 1341 | Ga0207674_10279334 | |||
| 1342 | Ga0207674_10851452 | |||
| 1343 | Ga0207674_11678244 | |||
| 1344 | Ga0207675_100017206 | |||
| 1345 | Ga0207675_100189527 | |||
| 1346 | Ga0207675_100835211 | |||
| 1347 | Ga0207675_100879820 | |||
| 1348 | Ga0207675_101265618 | |||
| 1349 | Ga0207675_101639312 | |||
| 1350 | Ga0207683_10528972 | |||
| 1351 | Ga0207683_10531237 | |||
| 1352 | Ga0207683_10561193 | |||
| 1353 | Ga0207683_11139670 | |||
| 1354 | Ga0207683_11457909 | |||
| 1355 | Ga0207698_10204743 | |||
| 1356 | Ga0207698_10413105 | |||
| 1357 | Ga0207698_10416000 | |||
| 1358 | Ga0207698_11043156 | |||
| 1359 | Ga0207698_11721841 | |||
| 1360 | Ga0207698_11986445 | |||
| 1361 | Ga0209995_1057959 | |||
| 1362 | Ga0209974_10093591 | |||
| 1363 | Ga0207428_10009430 | |||
| 1364 | Ga0207428_10209245 | |||
| 1365 | Ga0268266_10127652 | |||
| 1366 | Ga0268265_10255766 | |||
| 1367 | Ga0268265_11676605 | |||
| 1368 | Ga0268264_10085251 | |||
| 1369 | Ga0268264_10380106 | |||
| 1370 | Ga0268264_11337493 | |||
| 1371 | Ga0265338_10189180 | |||
| 1372 | Ga0265338_10240264 | |||
| 1373 | Ga0265762_1013858 | |||
| 1374 | Ga0265760_10010213 | |||
| 1375 | Ga0265760_10057562 | |||
| 1376 | Ga0265760_10233094 | |||
| 1377 | Ga0265327_10007562 | |||
| 1378 | Ga0265327_10243940 | |||
| 1379 | Ga0307408_100213778 | |||
| 1380 | Ga0265314_10001418 | |||
| 1381 | Ga0265314_10027696 | |||
| 1382 | Ga0307405_10047481 | |||
| 1383 | Ga0307405_10132992 | |||
| 1384 | Ga0307413_11267812 | |||
| 1385 | Ga0307413_11731234 | |||
| 1386 | Ga0307406_10551256 | |||
| 1387 | Ga0307407_10098268 | |||
| 1388 | Ga0307407_10143820 | |||
| 1389 | Ga0307412_10280475 | |||
| 1390 | Ga0307409_100076733 | |||
| 1391 | Ga0307409_100312942 | |||
| 1392 | Ga0307409_100387529 | |||
| 1393 | Ga0307416_100026773 | |||
| 1394 | Ga0307416_101777929 | |||
| 1395 | Ga0307416_101869938 | |||
| 1396 | Ga0307414_10871945 | |||
| 1397 | Ga0307411_10120911 | |||
| 1398 | Ga0307411_10305231 | |||
| 1399 | Ga0307411_10623402 | |||
| 1400 | Ga0307415_100065126 | |||
| 1401 | Ga0307415_101554251 | |||
| 1402 | Ga0373926_0005084 | |||
| 1403 | Ga0373934_0029918 | |||
| 1404 | Ga0373923_0038378 | |||
| 1405 | Ga0373936_0221976 | |||
| 1406 | Ga0373936_0327226 | |||
| 1407 | Ga0373945_0000350 | |||
| 1408 | Ga0373945_0198767 | |||
| 1409 | Ga0373954_0049731 | |||
| 1410 | Ga0373956_0030667 | |||
| 1411 | Ga0373956_0380379 | |||
| 1412 | Ga0373957_0039156 | |||
| 1413 | Ga0373957_0091312 | |||
| 1414 | Ga0373943_0005619 | |||
| 1415 | Ga0373943_0006192 | |||
| 1416 | Ga0373946_0177790 | |||
| 1417 | Ga0373946_0208673 | |||
| 1418 | Ga0373955_0086044 | |||
| 1419 | Ga0373955_0204391 | |||
| 1420 | Ga0373955_0560060 | |||
| 1421 | Ga0373961_0124236 | |||
| 1422 | Ga0373924_0000782 | |||
| 1423 | Ga0373924_0022822 | |||
| 1424 | Ga0373924_0055791 | |||
| 1425 | Ga0373931_0077679 | |||
| 1426 | Ga0373931_1101121 | |||
| 1427 | Ga0373935_0000453 | |||
| 1428 | Ga0373935_0138620 | |||
| 1429 | Ga0373927_0000102 | |||
| 1430 | Ga0373927_0000304 | |||
| 1431 | Ga0373927_0027094 | |||
| 1432 | Ga0373933_0028484 | |||
| 1433 | Ga0373933_0218023 | |||
| 1434 | Ga0373933_0243653 | |||
| 1435 | Ga0373933_0290300 | |||
| 1436 | Ga0373933_0322874 | |||
| 1437 | Ga0373947_0000097 | |||
| 1438 | Ga0373947_0024086 | |||
| 1439 | Ga0373947_0040784 | |||
| 1440 | Ga0373947_0373771 | |||
| 1441 | Ga0373937_0000464 | |||
| 1442 | Ga0373937_0159790 | |||
| 1443 | Ga0373937_0336571 | |||
| 1444 | Ga0373937_0417414 | |||
| 1445 | Ga0373937_0457897 | |||
| 1446 | Ga0373937_0480426 | |||
| 1447 | Ga0373925_0000427 | |||
| 1448 | Ga0373925_0027882 | |||
| 1449 | Ga0395899_0444841 | |||
| 1450 | Ga0395900_0240177 | |||
| 1451 | Ga0395900_0450583 | |||
| 1452 | Ga0395898_0094532 | |||
| 1453 | Ga0436364_0162446 | |||
| 1454 | Ga0436364_0233196 | |||
| 1455 | Ga0436364_0251422 | |||
| 1456 | Ga0436364_0608146 | |||
| 1457 | Ga0436364_0817813 | |||
| 1458 | Ga0436364_0827592 | |||
| 1459 | Ga0436364_0879886 | |||
| 1460 | Ga0436364_1373841 | |||
| 1461 | Ga0436364_1390494 | |||
| 1462 | Ga0436364_1479394 | |||
| 1463 | Ga0436365_0652661 | |||
| 1464 | Ga0436365_1008595 | |||
| 1465 | Ga0436365_1299219 | |||
| 1466 | Ga0436363_0005674 | |||
| 1467 | Ga0436363_0383478 | |||
| 1468 | Ga0436362_0317059 | |||
| 1469 | Ga0436362_1022535 | |||
| 1470 | Ga0439431_0068150 | |||
| 1471 | Ga0439457_087358 | |||
| 1472 | Ga0466969_0157108 | |||
| 1473 | Ga0466966_0268020 | |||
| 1474 | Ga0466963_0026632 | |||
| 1475 | Ga0466963_0570821 | |||
| 1476 | Ga0466963_0770928 | |||
| 1477 | Ga0466959_0196947 | |||
| 1478 | Ga0466959_0673190 | |||
| 1479 | Ga0466959_0817412 | |||
| 1480 | Ga0451576_0280911 | |||
| 1481 | Ga0466967_0005911 | |||
| 1482 | Ga0466967_0446624 | |||
| 1483 | Ga0495592_0251569 | |||
| 1484 | Ga0495651_0099629 | |||
| 1485 | Ga0495651_0164331 | |||
| 1486 | Ga0495653_0211685 | |||
| 1487 | Ga0495580_0071514 | |||
| 1488 | Ga0495580_0082515 | |||
| 1489 | Ga0495580_0266786 | |||
| 1490 | Ga0495580_0424923 | |||
| 1491 | Ga0495580_0813436 | |||
| 1492 | Ga0495582_0055932 | |||
| 1493 | Ga0495582_0168220 | |||
| 1494 | Ga0495639_0092299 | |||
| 1495 | Ga0495664_0775371 | |||
| 1496 | Ga0495594_0098237 | |||
| 1497 | Ga0495594_0536184 | |||
| 1498 | Ga0495608_0078132 | |||
| 1499 | Ga0495628_0105079 | |||
| 1500 | Ga0495630_0036133 | |||
| 1501 | Ga0495630_0060909 | |||
| 1502 | Ga0495632_0122295 | |||
| 1503 | Ga0495643_0002622 | |||
| 1504 | Ga0495652_0427966 | |||
| 1505 | Ga0495652_0658969 | |||
| 1506 | Ga0495665_0040945 | |||
| 1507 | Ga0495586_0022204 | |||
| 1508 | Ga0495586_0608452 | |||
| 1509 | Ga0495645_0230709 | |||
| 1510 | Ga0495635_0685230 | |||
| 1511 | Ga0495588_0265214 | |||
| 1512 | Ga0495657_0718088 | |||
| 1513 | Ga0495623_0108432 | |||
| 1514 | Ga0495623_0192314 | |||
| 1515 | Ga0495613_0002002 | |||
| 1516 | Ga0495624_0026449 | |||
| 1517 | Ga0495581_0454845 | |||
| 1518 | Ga0495604_0523373 | |||
| 1519 | Ga0495636_0063029 | |||
| 1520 | Ga0495674_0003750 | |||
| 1521 | Ga0495674_0476087 | |||
| 1522 | Ga0495675_0622243 | |||
| 1523 | Ga0495684_0491716 | |||
| 1524 | Ga0495684_0501687 | |||
| 1525 | Ga0495686_0001240 | |||
| 1526 | Ga0495593_0492202 | |||
| 1527 | Ga0495602_0091946 | |||
| 1528 | Ga0495602_1103990 | |||
| 1529 | Ga0496100_0250458 | |||
| 1530 | Ga0496100_0600101 | |||
| 1531 | Ga0496100_0953226 | |||
| 1532 | Ga0496101_0259159 | |||
| 1533 | Ga0496102_0356918 | |||
| 1534 | Ga0496103_0825767 | |||
| 1535 | Ga0496104_0063507 | |||
| 1536 | Ga0496104_0267216 | |||
| 1537 | Ga0496104_0351245 | |||
| 1538 | Ga0496104_0472105 | |||
| 1539 | Ga0496104_0645405 | |||
| 1540 | Ga0496104_1509101 | |||
| 1541 | Ga0496110_0023918 | |||
| 1542 | Ga0496110_0058123 | |||
| 1543 | Ga0496111_0002497 | |||
| 1544 | Ga0496112_0003518 | |||
| 1545 | Ga0496112_0009274 | |||
| 1546 | Ga0496113_0002748 | |||
| 1547 | Ga0496113_0724310 | |||
| 1548 | Ga0496114_1340059 | |||
| 1549 | Ga0496115_0015735 | |||
| 1550 | Ga0496115_0063569 | |||
| 1551 | Ga0496115_0201911 | |||
| 1552 | Ga0501291_016960 | |||
| 1553 | Ga0501031_0008990 | |||
| 1554 | Ga0501032_0001438 | |||
| 1555 | Ga0501033_0048779 | |||
| 1556 | Ga0501034_0075693 | |||
| 1557 | Ga0501036_0000295 | |||
| 1558 | Ga0501037_0003767 | |||
| 1559 | Ga0501038_0001014 | |||
| 1560 | Ga0501039_0014391 | |||
| 1561 | Ga0501041_0807450 | |||
| 1562 | Ga0501042_0891512 | |||
| 1563 | Ga0501042_0959274 | |||
| 1564 | Ga0501043_0005471 | |||
| 1565 | Ga0501046_0003170 | |||
| 1566 | Ga0501047_0050040 | |||
| 1567 | Ga0501048_0020743 | |||
| 1568 | Ga0501067_0015245 | |||
| 1569 | Ga0501068_0000872 | |||
| 1570 | Ga0501069_0001336 | |||
| 1571 | Ga0501070_0044344 | |||
| 1572 | Ga0501072_0056098 | |||
| 1573 | Ga0501073_0001754 | |||
| 1574 | Ga0501074_0026056 | |||
| 1575 | Ga0501076_0291742 | |||
| 1576 | Ga0501077_0009505 | |||
| 1577 | Ga0501234_106949 | |||
| 1578 | Ga0501079_0007356 | |||
| 1579 | Ga0501080_0000017 | |||
| 1580 | Ga0501083_0014238 | |||
| 1581 | Ga0501083_0444006 | |||
| 1582 | Ga0501035_0091958 | |||
| 1583 | Ga0501044_0021505 | |||
| 1584 | nmdc:mga05p37_1676575_c1 | |||
| 1585 | nmdc:mga05p37_325005_c1 | |||
| 1586 | nmdc:mga09592_504796_c1 | |||
| 1587 | nmdc:mga0qj67_45937_c1 | |||
| 1588 | nmdc:mga06r32_565694_c1 | |||
| 1589 | nmdc:mga06r32_72659_c1 | |||
| 1590 | nmdc:mga08y16_12292_c1 | |||
| 1591 | nmdc:mga08y16_245744_c1 | |||
| 1592 | nmdc:mga0n895_1447511_c1 | |||
| 1593 | nmdc:mga0n895_1514883_c1 | |||
| 1594 | nmdc:mga0n895_911429_c1 | |||
| 1595 | nmdc:mga08x19_200895_c1 | |||
| 1596 | Ga0495612_0455232 | |||
| 1597 | Ga0500583_0038221 | |||
| 1598 | Ga0500583_0061409 | |||
| 1599 | Ga0500641_0132628 | |||
| 1600 | Ga0500650_0271052 | |||
| 1601 | Ga0500595_034274 | |||
| 1602 | Ga0500616_0000105 | |||
| 1603 | Ga0500637_0148893 | |||
| 1604 | Ga0501084_0012610 | |||
| 1605 | Ga0501082_0028239 | |||
| 1606 | Ga0501082_0242137 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4lb5-assembly1.cif.gz_B | crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) | 0.8859 | 2 | 59 |
| 3zec-assembly1.cif.gz_A | fic protein from shewanella oneidensis (e73g mutant) in complex with amppnp | 0.8765 | 3 | 57 |
| 8bsi-assembly1.cif.gz_Sc | giardia ribosome chimeric hybrid-like gdp+pi bound state (b1) | 0.8657 | 8 | 57 |
| 5sva-assembly1.cif.gz_h | mediator-rna polymerase ii pre-initiation complex | 0.8603 | 9 | 57 |
| 8brm-assembly1.cif.gz_Sc | giardia ribosome in post-t state, no e-site trna (a6) | 0.8522 | 8 | 59 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4lb5B00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8859 | 2 | 59 | 1.10.10.10 |
| 3f8nB01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8765 | 10 | 57 | 1.10.10.10 |
| af_Q57824_147_206_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8575 | 7 | 56 | 1.10.10.10 |
| af_Q4DPL3_4_78_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8483 | 6 | 59 | 1.10.10.10 |
| af_Q58184_329_408_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8468 | 7 | 58 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1V5XS53-F1-model_v4 | Zinc uptake regulation protein | 0.8724 | 8 | 61 |
GO:0000976
GO:0003700 GO:0008270 GO:0045892 GO:1900376 |
| AF-A0A2V9RB08-F1-model_v4 | CopY family transcriptional regulator | 0.8523 | 1 | 107 |
GO:0003677
GO:0045892 |
| AF-A0A1X7A957-F1-model_v4 | Methicillin resistance regulatory protein MecI | 0.8353 | 1 | 114 |
GO:0003677
GO:0045892 |
| AF-A0A2V9RB08-F1-model_v4 | CopY family transcriptional regulator | 0.8316 | 1 | 107 |
GO:0003677
GO:0045892 |
| AF-A0A6M8VJI4-F1-model_v4 | BlaI/MecI/CopY family transcriptional regulator | 0.8309 | 1 | 108 |
GO:0003677
GO:0045892 |