F481494

General Info

Members Datasets Scaffolds Average Seq Length
803 318 1606 127

Family's Representative Sequence

Representative Sequence 3300005456|Ga0070678_101841782|Ga0070678_1018417821
Length 133
Sequence MAPQSPRLSKLELRIMDALWTRGSALAIREIQEAFPEKDRPAYTTIQTTVYRMEEKHALRRVRKIGNAHLFEPLVTRDSARGNLIDDILSVFGGRTQPMMAHLVETGRLTMSDVREAEKLLNELEEKKGGSKP

Samples

Sample ID Description Type Environment
1 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
68 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
98 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
111 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
112 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
113 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
176 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
180 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
181 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
182 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
183 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
184 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
185 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
186 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
187 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
188 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
189 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
190 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
191 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
192 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
193 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
194 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
195 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
196 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
197 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
198 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
199 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
200 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
201 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
202 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
203 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
204 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
205 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
206 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
207 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
208 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
209 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
210 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
211 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
212 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
213 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
214 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
215 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
216 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
217 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
218 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
219 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
220 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
221 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
222 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
223 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
224 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
225 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
226 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
227 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
228 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
229 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
230 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
231 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
232 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
233 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
234 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
235 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
236 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
237 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
238 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
239 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
240 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
241 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
242 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
243 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
244 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
245 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
246 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
247 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
248 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
249 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
250 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
251 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
252 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
253 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
254 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
255 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
256 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
257 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
258 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
259 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
260 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
261 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
262 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
263 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
264 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
265 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
266 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
267 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
268 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
269 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
270 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
271 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
272 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
273 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
274 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
276 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
277 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
282 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
284 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
286 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
288 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
289 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
290 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
291 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
292 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
293 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
294 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
295 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
296 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
297 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
298 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
299 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
300 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
301 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
303 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
304 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
305 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
306 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
307 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
308 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
309 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
310 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
311 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
312 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
313 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
314 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
315 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
316 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
317 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
318 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.5
Metatranscriptomes 0.5
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.87
Nodule 0
Rhizoplane 2.86
Rhizosphere 93.52
Stem 0
Stem Tuber 0
Unclassified 40.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070678_101841782 3300005456 Bacteria 571
2 rootH2_10079227 3300003320 Bacteria 2137
3 Ga0065715_10156653 3300005293 Unclassified 1670
4 Ga0065707_10481809 3300005295 Unclassified 773
5 Ga0070658_10415623 3300005327 Bacteria 1156
6 Ga0070683_100028360 3300005329 Bacteria 5059
7 Ga0070683_100058048 3300005329 Bacteria 3596
8 Ga0070683_100089070 3300005329 Bacteria 2896
9 Ga0070683_100157346 3300005329 Unclassified 2155
10 Ga0070683_100826957 3300005329 Unclassified 888
11 Ga0070683_101115417 3300005329 Unclassified 758
12 Ga0070670_100001974 3300005331 Bacteria 16787
13 Ga0070670_100725167 3300005331 Unclassified 895
14 Ga0070677_10341692 3300005333 Unclassified 773
15 Ga0068869_100075132 3300005334 Unclassified 2510
16 Ga0068869_100569997 3300005334 Unclassified 953
17 Ga0070666_10883517 3300005335 Unclassified 660
18 Ga0070680_100052522 3300005336 Bacteria 3326
19 Ga0070680_100283138 3300005336 Bacteria 1405
20 Ga0070680_100657053 3300005336 Unclassified 901
21 Ga0070680_101554329 3300005336 Unclassified 573
22 Ga0070680_102013224 3300005336 Unclassified 500
23 Ga0068868_100047132 3300005338 Unclassified 3376
24 Ga0068868_100472206 3300005338 Unclassified 1094
25 Ga0068868_100485010 3300005338 Bacteria 1080
26 Ga0068868_101896785 3300005338 Bacteria 564
27 Ga0070660_100038380 3300005339 Bacteria 3636
28 Ga0070660_100382882 3300005339 Bacteria 1161
29 Ga0070660_101031095 3300005339 Unclassified 695
30 Ga0070660_101268016 3300005339 Unclassified 625
31 Ga0070660_101423609 3300005339 Unclassified 589
32 Ga0070689_100026720 3300005340 Unclassified 4347
33 Ga0070689_100115965 3300005340 Unclassified 2135
34 Ga0070689_100346858 3300005340 Bacteria 1244
35 Ga0070689_101602557 3300005340 Unclassified 591
36 Ga0070691_10707593 3300005341 Unclassified 605
37 Ga0070687_100039491 3300005343 Bacteria 2372
38 Ga0070661_100052920 3300005344 Bacteria 2971
39 Ga0070661_100062658 3300005344 Bacteria 2730
40 Ga0070661_100298551 3300005344 Bacteria 1253
41 Ga0070661_100849174 3300005344 Unclassified 751
42 Ga0070692_10055513 3300005345 Bacteria 2071
43 Ga0070692_10262243 3300005345 Unclassified 1039
44 Ga0070668_100163560 3300005347 Bacteria 1807
45 Ga0070668_101140493 3300005347 Unclassified 705
46 Ga0070669_100004850 3300005353 Bacteria 9711
47 Ga0070675_100000667 3300005354 Bacteria 23749
48 Ga0070675_100046847 3300005354 Bacteria 3542
49 Ga0070675_100086976 3300005354 Bacteria 2613
50 Ga0070675_100506472 3300005354 Bacteria 1088
51 Ga0070671_100101297 3300005355 Unclassified 2416
52 Ga0070671_100306495 3300005355 Bacteria 1352
53 Ga0070671_101670464 3300005355 Unclassified 565
54 Ga0070673_100028304 3300005364 Unclassified 4166
55 Ga0070688_100156070 3300005365 Unclassified 1564
56 Ga0070659_100014834 3300005366 Bacteria 5827
57 Ga0070659_100176502 3300005366 Bacteria 1752
58 Ga0070659_100266655 3300005366 Bacteria 1422
59 Ga0070667_100256076 3300005367 Unclassified 1566
60 Ga0070709_10018168 3300005434 Bacteria 4045
61 Ga0070709_10369097 3300005434 Bacteria 1064
62 Ga0070709_10407605 3300005434 Bacteria 1016
63 Ga0070714_100019879 3300005435 Bacteria 5479
64 Ga0070714_100042565 3300005435 Unclassified 3838
65 Ga0070714_101181717 3300005435 Bacteria 746
66 Ga0070714_101294305 3300005435 Bacteria 711
67 Ga0070714_101423869 3300005435 Unclassified 677
68 Ga0070714_101938888 3300005435 Unclassified 575
69 Ga0070713_100000111 3300005436 Bacteria 53417
70 Ga0070713_100173925 3300005436 Bacteria 1930
71 Ga0070713_100214709 3300005436 Unclassified 1743
72 Ga0070713_100281795 3300005436 Unclassified 1525
73 Ga0070713_100305751 3300005436 Bacteria 1465
74 Ga0070713_100386872 3300005436 Bacteria 1304
75 Ga0070713_100470924 3300005436 Bacteria 1182
76 Ga0070713_100487472 3300005436 Unclassified 1162
77 Ga0070713_100523273 3300005436 Bacteria 1121
78 Ga0070713_100568856 3300005436 Unclassified 1074
79 Ga0070713_100714194 3300005436 Bacteria 957
80 Ga0070713_100717714 3300005436 Bacteria 955
81 Ga0070713_100740826 3300005436 Unclassified 940
82 Ga0070710_10160349 3300005437 Bacteria 1394
83 Ga0070710_10186586 3300005437 Bacteria 1302
84 Ga0070710_11534439 3300005437 Unclassified 501
85 Ga0070701_10013748 3300005438 Bacteria 3691
86 Ga0070701_10435271 3300005438 Unclassified 838
87 Ga0070701_11210545 3300005438 Unclassified 536
88 Ga0070711_100004402 3300005439 Bacteria 8310
89 Ga0070711_100007267 3300005439 Bacteria 6731
90 Ga0070711_100025000 3300005439 Bacteria 3904
91 Ga0070711_100034280 3300005439 Bacteria 3385
92 Ga0070711_100041896 3300005439 Unclassified 3093
93 Ga0070711_100227870 3300005439 Unclassified 1452
94 Ga0070711_100267652 3300005439 Unclassified 1347
95 Ga0070711_101310294 3300005439 Unclassified 629
96 Ga0070705_101556637 3300005440 Unclassified 555
97 Ga0070700_100714981 3300005441 Unclassified 798
98 Ga0070694_100181907 3300005444 Bacteria 1555
99 Ga0070694_100472860 3300005444 Bacteria 993
100 Ga0070708_101207493 3300005445 Bacteria 707
101 Ga0070663_100493218 3300005455 Unclassified 1016
102 Ga0070663_101624787 3300005455 Unclassified 577
103 Ga0070678_100162843 3300005456 Bacteria 1809
104 Ga0070678_100169403 3300005456 Unclassified 1777
105 Ga0070678_100716898 3300005456 Unclassified 902
106 Ga0070678_100923028 3300005456 Unclassified 799
107 Ga0070678_101330068 3300005456 Unclassified 669
108 Ga0070662_100263077 3300005457 Bacteria 1390
109 Ga0070662_100295034 3300005457 Bacteria 1315
110 Ga0070662_100375462 3300005457 Bacteria 1169
111 Ga0070662_100452043 3300005457 Unclassified 1066
112 Ga0070681_10000483 3300005458 Bacteria 32474
113 Ga0070681_10163397 3300005458 Unclassified 2150
114 Ga0070681_10377083 3300005458 Bacteria 1329
115 Ga0070681_10520590 3300005458 Unclassified 1103
116 Ga0070685_10687798 3300005466 Unclassified 745
117 Ga0070706_100123271 3300005467 Bacteria 2416
118 Ga0070707_100000757 3300005468 Bacteria 31825
119 Ga0070679_100007031 3300005530 Bacteria 10496
120 Ga0070679_100272001 3300005530 Bacteria 1648
121 Ga0070679_100370097 3300005530 Bacteria 1380
122 Ga0070679_100375819 3300005530 Unclassified 1368
123 Ga0070679_100611259 3300005530 Unclassified 1033
124 Ga0070679_101576964 3300005530 Bacteria 604
125 Ga0070684_100038250 3300005535 Unclassified 4120
126 Ga0070684_100208684 3300005535 Unclassified 1780
127 Ga0070684_100273274 3300005535 Bacteria 1547
128 Ga0070684_101903985 3300005535 Bacteria 561
129 Ga0070697_100020394 3300005536 Bacteria 5243
130 Ga0070697_101557635 3300005536 Bacteria 591
131 Ga0068853_100007353 3300005539 Bacteria 8811
132 Ga0068853_100067924 3300005539 Bacteria 3098
133 Ga0068853_100076099 3300005539 Bacteria 2930
134 Ga0068853_100110101 3300005539 Unclassified 2446
135 Ga0068853_100216613 3300005539 Bacteria 1747
136 Ga0070672_100016071 3300005543 Bacteria 5351
137 Ga0070695_100004444 3300005545 Bacteria 8236
138 Ga0070696_100979156 3300005546 Bacteria 705
139 Ga0070693_100448495 3300005547 Unclassified 905
140 Ga0070693_100480649 3300005547 Unclassified 877
141 Ga0070693_100698011 3300005547 Unclassified 743
142 Ga0070665_100003472 3300005548 Bacteria 16789
143 Ga0070665_100437461 3300005548 Bacteria 1317
144 Ga0070704_100036542 3300005549 Bacteria 3349
145 Ga0068855_100000656 3300005563 Bacteria 42261
146 Ga0068855_100011538 3300005563 Bacteria 10673
147 Ga0068855_100016579 3300005563 Bacteria 8860
148 Ga0068855_100032021 3300005563 Bacteria 6278
149 Ga0068855_100045002 3300005563 Bacteria 5221
150 Ga0068855_100059277 3300005563 Bacteria 4479
151 Ga0068855_100288059 3300005563 Bacteria 1821
152 Ga0068855_100568578 3300005563 Bacteria 1225
153 Ga0068855_100823710 3300005563 Unclassified 985
154 Ga0070664_100020783 3300005564 Bacteria 5408
155 Ga0070664_100029007 3300005564 Bacteria 4610
156 Ga0070664_100047277 3300005564 Unclassified 3635
157 Ga0070664_100059394 3300005564 Bacteria 3253
158 Ga0070664_100070616 3300005564 Unclassified 2991
159 Ga0070664_101604385 3300005564 Unclassified 616
160 Ga0068857_100028696 3300005577 Bacteria 4909
161 Ga0068857_100065622 3300005577 Unclassified 3229
162 Ga0068857_100734884 3300005577 Unclassified 939
163 Ga0068857_100772417 3300005577 Unclassified 916
164 Ga0068854_100931697 3300005578 Unclassified 765
165 Ga0068854_101168299 3300005578 Unclassified 688
166 Ga0068854_101891963 3300005578 Unclassified 548
167 Ga0068856_100001584 3300005614 Bacteria 23812
168 Ga0068856_100004446 3300005614 Bacteria 13959
169 Ga0068856_100007508 3300005614 Bacteria 10646
170 Ga0068856_100033422 3300005614 Bacteria 5036
171 Ga0068856_100056352 3300005614 Unclassified 3878
172 Ga0068856_100201518 3300005614 Bacteria 2004
173 Ga0068856_100379183 3300005614 Bacteria 1433
174 Ga0068856_100427373 3300005614 Bacteria 1345
175 Ga0068856_100641631 3300005614 Bacteria 1082
176 Ga0070702_100589518 3300005615 Unclassified 831
177 Ga0070702_101644875 3300005615 Unclassified 532
178 Ga0068852_100007795 3300005616 Bacteria 7841
179 Ga0068852_100017100 3300005616 Bacteria 5681
180 Ga0068852_100476979 3300005616 Bacteria 1239
181 Ga0068852_101326881 3300005616 Unclassified 741
182 Ga0068859_100143351 3300005617 Bacteria 2462
183 Ga0068859_100817058 3300005617 Bacteria 1019
184 Ga0068859_101155331 3300005617 Unclassified 852
185 Ga0068859_101233052 3300005617 Unclassified 824
186 Ga0068859_101388673 3300005617 Bacteria 774
187 Ga0068859_101881201 3300005617 Unclassified 661
188 Ga0068864_100095302 3300005618 Bacteria 2632
189 Ga0068864_100202027 3300005618 Bacteria 1826
190 Ga0068864_100225666 3300005618 Bacteria 1730
191 Ga0068864_102023237 3300005618 Unclassified 582
192 Ga0068861_100010665 3300005719 Bacteria 6382
193 Ga0068861_100206536 3300005719 Bacteria 1652
194 Ga0068861_100256018 3300005719 Unclassified 1496
195 Ga0068861_101254800 3300005719 Unclassified 719
196 Ga0068861_101344659 3300005719 Bacteria 696
197 Ga0068861_101381641 3300005719 Bacteria 687
198 Ga0068863_100018504 3300005841 Bacteria 6668
199 Ga0068863_100816882 3300005841 Bacteria 930
200 Ga0068863_101002778 3300005841 Bacteria 838
201 Ga0068858_100011509 3300005842 Bacteria 8349
202 Ga0068858_100195524 3300005842 Unclassified 1911
203 Ga0068858_100407993 3300005842 Bacteria 1306
204 Ga0068858_100617779 3300005842 Unclassified 1052
205 Ga0068860_100046476 3300005843 Unclassified 4139
206 Ga0068860_100165724 3300005843 Bacteria 2133
207 Ga0068860_100325359 3300005843 Unclassified 1509
208 Ga0068860_100443605 3300005843 Unclassified 1290
209 Ga0068862_100060715 3300005844 Bacteria 3248
210 Ga0068862_100175826 3300005844 Unclassified 1919
211 Ga0068862_101867752 3300005844 Unclassified 610
212 Ga0068862_102520710 3300005844 Bacteria 526
213 Ga0068862_102692763 3300005844 Unclassified 509
214 Ga0070717_10091844 3300006028 Bacteria 2564
215 Ga0070717_10110083 3300006028 Bacteria 2349
216 Ga0070717_10483942 3300006028 Bacteria 1117
217 Ga0070717_10557383 3300006028 Unclassified 1038
218 Ga0070717_10592919 3300006028 Unclassified 1005
219 Ga0070717_11553720 3300006028 Unclassified 600
220 Ga0070717_11626357 3300006028 Unclassified 585
221 Ga0070715_10531063 3300006163 Bacteria 679
222 Ga0070716_100004320 3300006173 Bacteria 6776
223 Ga0070716_100072123 3300006173 Bacteria 2032
224 Ga0070716_100214372 3300006173 Bacteria 1289
225 Ga0070716_100347624 3300006173 Unclassified 1048
226 Ga0070716_100687564 3300006173 Unclassified 780
227 Ga0070712_100000453 3300006175 Bacteria 23518
228 Ga0070712_100013375 3300006175 Bacteria 5243
229 Ga0070712_100190098 3300006175 Bacteria 1606
230 Ga0070712_100312058 3300006175 Bacteria 1276
231 Ga0070712_100378210 3300006175 Unclassified 1165
232 Ga0070712_100493642 3300006175 Unclassified 1025
233 Ga0097621_100000631 3300006237 Bacteria 24844
234 Ga0097621_100002425 3300006237 Bacteria 12770
235 Ga0097621_100137367 3300006237 Bacteria 2086
236 Ga0097621_100525132 3300006237 Bacteria 1075
237 Ga0097621_100565251 3300006237 Bacteria 1036
238 Ga0097621_100987139 3300006237 Unclassified 787
239 Ga0097621_102004011 3300006237 Unclassified 553
240 Ga0097621_102323345 3300006237 Unclassified 513
241 Ga0068871_100000220 3300006358 Bacteria 40091
242 Ga0068871_100001703 3300006358 Bacteria 14775
243 Ga0068871_100470409 3300006358 Unclassified 1129
244 Ga0068871_100791223 3300006358 Bacteria 874
245 Ga0068871_101149792 3300006358 Bacteria 727
246 Ga0068871_102321797 3300006358 Unclassified 511
247 Ga0075428_100092852 3300006844 Bacteria 3290
248 Ga0075430_100750758 3300006846 Unclassified 804
249 Ga0075431_100065736 3300006847 Unclassified 3744
250 Ga0075431_100489472 3300006847 Unclassified 1222
251 Ga0075433_10850775 3300006852 Bacteria 796
252 Ga0075434_100427130 3300006871 Bacteria 1346
253 Ga0075434_101052616 3300006871 Unclassified 827
254 Ga0075434_101488549 3300006871 Unclassified 686
255 Ga0075429_100183874 3300006880 Unclassified 1831
256 Ga0068865_100000829 3300006881 Bacteria 17439
257 Ga0068865_100114322 3300006881 Unclassified 1996
258 Ga0068865_100125386 3300006881 Bacteria 1916
259 Ga0068865_101287241 3300006881 Unclassified 650
260 Ga0097620_100143355 3300006931 Bacteria 2462
261 Ga0097620_100816971 3300006931 Bacteria 1019
262 Ga0097620_101155678 3300006931 Unclassified 852
263 Ga0097620_101233077 3300006931 Unclassified 824
264 Ga0097620_101388750 3300006931 Bacteria 774
265 Ga0097620_101880929 3300006931 Unclassified 661
266 Ga0099794_10460654 3300007265 Unclassified 667
267 Ga0105240_10013042 3300009093 Bacteria 11439
268 Ga0105240_10031145 3300009093 Bacteria 6921
269 Ga0105240_10049604 3300009093 Bacteria 5297
270 Ga0105240_10116458 3300009093 Bacteria 3224
271 Ga0105240_10215641 3300009093 Bacteria 2240
272 Ga0105240_10286716 3300009093 Unclassified 1889
273 Ga0105240_10290097 3300009093 Unclassified 1876
274 Ga0105240_10494428 3300009093 Bacteria 1361
275 Ga0105240_10621394 3300009093 Bacteria 1187
276 Ga0105240_10893629 3300009093 Bacteria 956
277 Ga0105240_11309943 3300009093 Bacteria 764
278 Ga0111539_10055492 3300009094 Bacteria 4709
279 Ga0111539_12457837 3300009094 Unclassified 604
280 Ga0105245_10196162 3300009098 Unclassified 1937
281 Ga0105245_11401497 3300009098 Bacteria 749
282 Ga0105245_11493141 3300009098 Unclassified 727
283 Ga0105247_10255149 3300009101 Unclassified 1200
284 Ga0114129_10345236 3300009147 Bacteria 1973
285 Ga0105243_10259847 3300009148 Bacteria 1554
286 Ga0105243_10707904 3300009148 Bacteria 982
287 Ga0105243_12143092 3300009148 Unclassified 595
288 Ga0105241_10169457 3300009174 Bacteria 1802
289 Ga0105241_10224910 3300009174 Unclassified 1579
290 Ga0105241_10572860 3300009174 Bacteria 1017
291 Ga0105241_11943464 3300009174 Bacteria 578
292 Ga0105241_12465492 3300009174 Unclassified 520
293 Ga0105242_10024190 3300009176 Bacteria 4794
294 Ga0105242_10173426 3300009176 Bacteria 1897
295 Ga0105242_10251577 3300009176 Archaea 1593
296 Ga0105248_10003212 3300009177 Bacteria 18120
297 Ga0105248_10762375 3300009177 Archaea 1092
298 Ga0105248_11551704 3300009177 Bacteria 750
299 Ga0105237_10323442 3300009545 Bacteria 1546
300 Ga0105237_10694527 3300009545 Bacteria 1024
301 Ga0105237_10854338 3300009545 Bacteria 917
302 Ga0105237_11544029 3300009545 Unclassified 671
303 Ga0105238_10152608 3300009551 Bacteria 2285
304 Ga0105238_10179126 3300009551 Bacteria 2096
305 Ga0105238_10333625 3300009551 Bacteria 1504
306 Ga0105238_10857718 3300009551 Bacteria 925
307 Ga0105238_11945453 3300009551 Unclassified 621
308 Ga0105238_12192428 3300009551 Unclassified 587
309 Ga0105249_10287716 3300009553 Bacteria 1644
310 Ga0105249_10357055 3300009553 Bacteria 1482
311 Ga0105249_10666084 3300009553 Bacteria 1099
312 Ga0105249_10835591 3300009553 Bacteria 986
313 Ga0105249_12187079 3300009553 Unclassified 626
314 Ga0099796_10398516 3300010159 Unclassified 603
315 Ga0105239_10178344 3300010375 Bacteria 2376
316 Ga0105239_10231719 3300010375 Bacteria 2072
317 Ga0105239_10422045 3300010375 Bacteria 1511
318 Ga0105239_11214300 3300010375 Unclassified 869
319 Ga0105246_11488955 3300011119 Bacteria 635
320 Ga0105246_11825769 3300011119 Unclassified 581
321 Ga0157371_10328358 3300013102 Bacteria 1111
322 Ga0157371_11104433 3300013102 Bacteria 608
323 Ga0157370_10022542 3300013104 Bacteria 6266
324 Ga0157370_10348062 3300013104 Bacteria 1366
325 Ga0157369_10023142 3300013105 Bacteria 6922
326 Ga0157369_10048525 3300013105 Bacteria 4607
327 Ga0157369_10155062 3300013105 Unclassified 2419
328 Ga0157369_10155085 3300013105 Unclassified 2419
329 Ga0157369_10380551 3300013105 Bacteria 1465
330 Ga0157369_10549642 3300013105 Bacteria 1193
331 Ga0157369_10681901 3300013105 Bacteria 1059
332 Ga0157369_11930182 3300013105 Unclassified 599
333 Ga0157374_10000164 3300013296 Bacteria 61685
334 Ga0157374_10052083 3300013296 Bacteria 3811
335 Ga0157374_10926477 3300013296 Unclassified 889
336 Ga0157374_11390471 3300013296 Bacteria 724
337 Ga0157374_11663999 3300013296 Unclassified 663
338 Ga0157378_10000204 3300013297 Bacteria 57882
339 Ga0157372_10001933 3300013307 Bacteria 22482
340 Ga0157372_10174613 3300013307 Unclassified 2487
341 Ga0157372_10185665 3300013307 Bacteria 2408
342 Ga0157372_10190871 3300013307 Bacteria 2373
343 Ga0157372_10205931 3300013307 Bacteria 2279
344 Ga0157372_10239030 3300013307 Unclassified 2107
345 Ga0157372_10270929 3300013307 Bacteria 1973
346 Ga0157375_10383973 3300013308 Unclassified 1571
347 Ga0163163_10024431 3300014325 Bacteria 5751
348 Ga0163163_10617745 3300014325 Bacteria 1147
349 Ga0163163_10826310 3300014325 Bacteria 990
350 Ga0157380_10079027 3300014326 Bacteria 2685
351 Ga0157380_10267308 3300014326 Archaea 1557
352 Ga0157380_13411529 3300014326 Unclassified 508
353 Ga0157377_10136715 3300014745 Bacteria 1502
354 Ga0157377_10704276 3300014745 Unclassified 734
355 Ga0157379_11046881 3300014968 Unclassified 780
356 Ga0157376_10012147 3300014969 Bacteria 6380
357 Ga0157376_10016016 3300014969 Bacteria 5681
358 Ga0157376_10098749 3300014969 Bacteria 2546
359 Ga0157376_11399259 3300014969 Bacteria 731
360 Ga0163161_10994179 3300017792 Unclassified 716
361 Ga0213874_10212965 3300021377 Unclassified 699
362 Ga0213874_10267724 3300021377 Bacteria 634
363 Ga0213876_10541261 3300021384 Unclassified 620
364 Ga0213875_10039476 3300021388 Bacteria 2224
365 Ga0213875_10221263 3300021388 Unclassified 892
366 Ga0213875_10472288 3300021388 Unclassified 601
367 Ga0207697_10055968 3300025315 Bacteria 1636
368 Ga0207682_10324794 3300025893 Bacteria 723
369 Ga0207692_10584763 3300025898 Bacteria 716
370 Ga0207710_10026941 3300025900 Unclassified 2486
371 Ga0207710_10506949 3300025900 Unclassified 626
372 Ga0207688_10278842 3300025901 Unclassified 1018
373 Ga0207647_10290039 3300025904 Unclassified 933
374 Ga0207647_10537927 3300025904 Unclassified 649
375 Ga0207643_11039460 3300025908 Bacteria 529
376 Ga0207684_10185483 3300025910 Unclassified 1794
377 Ga0207684_10428512 3300025910 Bacteria 1136
378 Ga0207654_10277751 3300025911 Unclassified 1132
379 Ga0207707_10009160 3300025912 Bacteria 8599
380 Ga0207707_10131297 3300025912 Unclassified 2191
381 Ga0207707_10414934 3300025912 Unclassified 1155
382 Ga0207695_10041165 3300025913 Bacteria 4946
383 Ga0207695_10043394 3300025913 Bacteria 4793
384 Ga0207695_10047068 3300025913 Bacteria 4567
385 Ga0207695_10099409 3300025913 Unclassified 2907
386 Ga0207695_10123594 3300025913 Bacteria 2553
387 Ga0207695_10158530 3300025913 Bacteria 2196
388 Ga0207695_10484571 3300025913 Bacteria 1119
389 Ga0207671_10189501 3300025914 Bacteria 1603
390 Ga0207671_10342153 3300025914 Bacteria 1185
391 Ga0207693_10000066 3300025915 Bacteria 91088
392 Ga0207693_10009445 3300025915 Bacteria 7949
393 Ga0207693_10024268 3300025915 Bacteria 4813
394 Ga0207693_10494419 3300025915 Unclassified 955
395 Ga0207693_10559018 3300025915 Bacteria 892
396 Ga0207693_11086554 3300025915 Unclassified 608
397 Ga0207663_10001476 3300025916 Bacteria 10954
398 Ga0207663_10010788 3300025916 Bacteria 4878
399 Ga0207663_10216141 3300025916 Unclassified 1392
400 Ga0207663_10827901 3300025916 Bacteria 738
401 Ga0207660_10047171 3300025917 Bacteria 3044
402 Ga0207660_10213766 3300025917 Bacteria 1511
403 Ga0207660_10586230 3300025917 Unclassified 908
404 Ga0207662_10108963 3300025918 Unclassified 1725
405 Ga0207657_10038749 3300025919 Unclassified 4239
406 Ga0207657_10046059 3300025919 Bacteria 3821
407 Ga0207649_10012342 3300025920 Bacteria 4737
408 Ga0207649_10054464 3300025920 Bacteria 2490
409 Ga0207649_10108585 3300025920 Unclassified 1850
410 Ga0207652_10024267 3300025921 Bacteria 5030
411 Ga0207652_10050603 3300025921 Unclassified 3560
412 Ga0207652_10305213 3300025921 Bacteria 1437
413 Ga0207652_10371446 3300025921 Bacteria 1291
414 Ga0207652_10550602 3300025921 Unclassified 1037
415 Ga0207652_10695388 3300025921 Unclassified 907
416 Ga0207652_11070505 3300025921 Unclassified 706
417 Ga0207646_10000478 3300025922 Bacteria 53489
418 Ga0207681_10013605 3300025923 Bacteria 5038
419 Ga0207694_10001705 3300025924 Bacteria 18380
420 Ga0207694_10200187 3300025924 Bacteria 1625
421 Ga0207694_11128229 3300025924 Unclassified 664
422 Ga0207694_11228384 3300025924 Unclassified 634
423 Ga0207650_10043165 3300025925 Bacteria 3309
424 Ga0207650_10683656 3300025925 Unclassified 866
425 Ga0207659_10000222 3300025926 Bacteria 34395
426 Ga0207659_10391101 3300025926 Unclassified 1161
427 Ga0207659_10466974 3300025926 Bacteria 1065
428 Ga0207659_10536155 3300025926 Unclassified 994
429 Ga0207687_10345374 3300025927 Bacteria 1211
430 Ga0207687_10577708 3300025927 Bacteria 945
431 Ga0207687_11035049 3300025927 Unclassified 704
432 Ga0207700_10000328 3300025928 Bacteria 27960
433 Ga0207700_10207889 3300025928 Unclassified 1653
434 Ga0207700_10223768 3300025928 Unclassified 1597
435 Ga0207700_10434206 3300025928 Bacteria 1155
436 Ga0207700_11585662 3300025928 Unclassified 579
437 Ga0207664_10001074 3300025929 Bacteria 18222
438 Ga0207664_10210841 3300025929 Bacteria 1681
439 Ga0207644_10234891 3300025931 Bacteria 1458
440 Ga0207644_10244618 3300025931 Bacteria 1429
441 Ga0207644_10845353 3300025931 Unclassified 766
442 Ga0207690_10010126 3300025932 Bacteria 5599
443 Ga0207706_10295546 3300025933 Bacteria 1412
444 Ga0207706_10385347 3300025933 Bacteria 1216
445 Ga0207706_10466981 3300025933 Unclassified 1091
446 Ga0207706_10986458 3300025933 Unclassified 708
447 Ga0207686_10262760 3300025934 Bacteria 1266
448 Ga0207686_10490619 3300025934 Bacteria 951
449 Ga0207686_11672372 3300025934 Unclassified 526
450 Ga0207709_10612246 3300025935 Bacteria 863
451 Ga0207709_10951146 3300025935 Bacteria 700
452 Ga0207670_10149053 3300025936 Unclassified 1734
453 Ga0207670_10170589 3300025936 Unclassified 1631
454 Ga0207670_10189116 3300025936 Bacteria 1557
455 Ga0207669_10288353 3300025937 Unclassified 1242
456 Ga0207704_11394945 3300025938 Bacteria 600
457 Ga0207665_10062770 3300025939 Bacteria 2521
458 Ga0207665_10067110 3300025939 Unclassified 2442
459 Ga0207665_10170238 3300025939 Unclassified 1572
460 Ga0207665_10414943 3300025939 Bacteria 1027
461 Ga0207665_10610423 3300025939 Unclassified 852
462 Ga0207665_10808044 3300025939 Unclassified 741
463 Ga0207691_10259413 3300025940 Unclassified 1498
464 Ga0207711_10080710 3300025941 Bacteria 2842
465 Ga0207711_10215978 3300025941 Bacteria 1753
466 Ga0207711_11220050 3300025941 Unclassified 694
467 Ga0207711_11270918 3300025941 Unclassified 678
468 Ga0207689_10522598 3300025942 Unclassified 995
469 Ga0207661_10025003 3300025944 Unclassified 4534
470 Ga0207661_10055880 3300025944 Bacteria 3168
471 Ga0207661_10161574 3300025944 Bacteria 1944
472 Ga0207661_10802221 3300025944 Unclassified 867
473 Ga0207661_10973998 3300025944 Unclassified 781
474 Ga0207661_11586648 3300025944 Bacteria 599
475 Ga0207679_10086849 3300025945 Bacteria 2407
476 Ga0207679_10217000 3300025945 Bacteria 1607
477 Ga0207679_10370859 3300025945 Bacteria 1253
478 Ga0207679_10378048 3300025945 Bacteria 1241
479 Ga0207679_10478554 3300025945 Bacteria 1108
480 Ga0207679_10818139 3300025945 Unclassified 850
481 Ga0207667_10002423 3300025949 Bacteria 23377
482 Ga0207667_10009378 3300025949 Bacteria 11533
483 Ga0207667_10022637 3300025949 Bacteria 6934
484 Ga0207667_10028547 3300025949 Bacteria 6059
485 Ga0207667_10094788 3300025949 Bacteria 3081
486 Ga0207667_10250918 3300025949 Bacteria 1810
487 Ga0207667_10738292 3300025949 Unclassified 985
488 Ga0207651_10106096 3300025960 Unclassified 2097
489 Ga0207651_10773259 3300025960 Unclassified 850
490 Ga0207651_10793587 3300025960 Unclassified 839
491 Ga0207712_10208356 3300025961 Bacteria 1555
492 Ga0207712_10481125 3300025961 Bacteria 1058
493 Ga0207712_10838960 3300025961 Unclassified 809
494 Ga0207668_10463076 3300025972 Bacteria 1084
495 Ga0207668_10816670 3300025972 Unclassified 826
496 Ga0207640_10068176 3300025981 Bacteria 2383
497 Ga0207640_10188272 3300025981 Unclassified 1553
498 Ga0207640_11137997 3300025981 Unclassified 692
499 Ga0207658_11930007 3300025986 Bacteria 538
500 Ga0207677_10441825 3300026023 Bacteria 1113
501 Ga0207677_10531266 3300026023 Unclassified 1022
502 Ga0207677_10734755 3300026023 Unclassified 878
503 Ga0207677_11749965 3300026023 Bacteria 577
504 Ga0207703_10010958 3300026035 Bacteria 7066
505 Ga0207703_10142045 3300026035 Unclassified 2084
506 Ga0207703_10378432 3300026035 Bacteria 1309
507 Ga0207703_10572747 3300026035 Unclassified 1066
508 Ga0207703_10850367 3300026035 Bacteria 872
509 Ga0207703_12418160 3300026035 Unclassified 501
510 Ga0207639_10058244 3300026041 Bacteria 2971
511 Ga0207639_10075664 3300026041 Bacteria 2648
512 Ga0207639_10077603 3300026041 Bacteria 2619
513 Ga0207639_10376842 3300026041 Bacteria 1273
514 Ga0207639_11660621 3300026041 Unclassified 599
515 Ga0207678_10676333 3300026067 Unclassified 908
516 Ga0207678_10825350 3300026067 Bacteria 819
517 Ga0207708_10396248 3300026075 Bacteria 1141
518 Ga0207702_10001476 3300026078 Bacteria 23337
519 Ga0207702_10004134 3300026078 Bacteria 13009
520 Ga0207702_10024301 3300026078 Bacteria 5027
521 Ga0207702_10052310 3300026078 Bacteria 3455
522 Ga0207702_10065951 3300026078 Bacteria 3102
523 Ga0207702_10086737 3300026078 Bacteria 2730
524 Ga0207702_10112418 3300026078 Bacteria 2424
525 Ga0207702_10197887 3300026078 Bacteria 1861
526 Ga0207641_10020600 3300026088 Bacteria 5418
527 Ga0207648_10487218 3300026089 Unclassified 1127
528 Ga0207648_11337522 3300026089 Bacteria 673
529 Ga0207676_10011800 3300026095 Bacteria 6251
530 Ga0207676_10083942 3300026095 Bacteria 2595
531 Ga0207676_10208010 3300026095 Bacteria 1734
532 Ga0207676_10781542 3300026095 Bacteria 930
533 Ga0207676_11977683 3300026095 Unclassified 582
534 Ga0207674_10028475 3300026116 Bacteria 5897
535 Ga0207674_10144149 3300026116 Bacteria 2341
536 Ga0207674_10160478 3300026116 Unclassified 2203
537 Ga0207674_10265981 3300026116 Bacteria 1662
538 Ga0207674_10279334 3300026116 Unclassified 1618
539 Ga0207674_10851452 3300026116 Bacteria 879
540 Ga0207674_11678244 3300026116 Bacteria 604
541 Ga0207675_100017206 3300026118 Bacteria 6752
542 Ga0207675_100189527 3300026118 Bacteria 1972
543 Ga0207675_100835211 3300026118 Bacteria 936
544 Ga0207675_100879820 3300026118 Unclassified 911
545 Ga0207675_101265618 3300026118 Unclassified 758
546 Ga0207675_101639312 3300026118 Bacteria 663
547 Ga0207683_10528972 3300026121 Unclassified 1090
548 Ga0207683_10531237 3300026121 Bacteria 1087
549 Ga0207683_10561193 3300026121 Bacteria 1056
550 Ga0207683_11139670 3300026121 Unclassified 723
551 Ga0207683_11457909 3300026121 Bacteria 632
552 Ga0207698_10204743 3300026142 Bacteria 1770
553 Ga0207698_10413105 3300026142 Bacteria 1293
554 Ga0207698_10416000 3300026142 Unclassified 1289
555 Ga0207698_11043156 3300026142 Bacteria 829
556 Ga0207698_11721841 3300026142 Bacteria 642
557 Ga0207698_11986445 3300026142 Unclassified 596
558 Ga0209995_1057959 3300027471 Unclassified 659
559 Ga0209974_10093591 3300027876 Bacteria 1044
560 Ga0207428_10009430 3300027907 Bacteria 8748
561 Ga0207428_10209245 3300027907 Unclassified 1466
562 Ga0268266_10127652 3300028379 Bacteria 2271
563 Ga0268265_10255766 3300028380 Unclassified 1554
564 Ga0268265_11676605 3300028380 Bacteria 641
565 Ga0268264_10085251 3300028381 Unclassified 2711
566 Ga0268264_10380106 3300028381 Unclassified 1352
567 Ga0268264_11337493 3300028381 Bacteria 727
568 Ga0265338_10189180 3300028800 Bacteria 1562
569 Ga0265338_10240264 3300028800 Unclassified 1342
570 Ga0265762_1013858 3300030760 Bacteria 1451
571 Ga0265760_10010213 3300031090 Bacteria 2677
572 Ga0265760_10057562 3300031090 Unclassified 1177
573 Ga0265760_10233094 3300031090 Unclassified 632
574 Ga0265327_10007562 3300031251 Bacteria 8351
575 Ga0265327_10243940 3300031251 Bacteria 802
576 Ga0307408_100213778 3300031548 Unclassified 1569
577 Ga0265314_10001418 3300031711 Bacteria 26869
578 Ga0265314_10027696 3300031711 Bacteria 4241
579 Ga0307405_10047481 3300031731 Bacteria 2644
580 Ga0307405_10132992 3300031731 Bacteria 1722
581 Ga0307413_11267812 3300031824 Unclassified 643
582 Ga0307413_11731234 3300031824 Bacteria 558
583 Ga0307406_10551256 3300031901 Bacteria 943
584 Ga0307407_10098268 3300031903 Bacteria 1811
585 Ga0307407_10143820 3300031903 Bacteria 1542
586 Ga0307412_10280475 3300031911 Bacteria 1308
587 Ga0307409_100076733 3300031995 Bacteria 2681
588 Ga0307409_100312942 3300031995 Bacteria 1466
589 Ga0307409_100387529 3300031995 Bacteria 1331
590 Ga0307416_100026773 3300032002 Bacteria 4256
591 Ga0307416_101777929 3300032002 Unclassified 720
592 Ga0307416_101869938 3300032002 Unclassified 704
593 Ga0307414_10871945 3300032004 Bacteria 824
594 Ga0307411_10120911 3300032005 Bacteria 1894
595 Ga0307411_10305231 3300032005 Unclassified 1278
596 Ga0307411_10623402 3300032005 Unclassified 930
597 Ga0307415_100065126 3300032126 Unclassified 2538
598 Ga0307415_101554251 3300032126 Unclassified 634
599 Ga0373926_0005084 3300035083 Unclassified 4317
600 Ga0373934_0029918 3300035086 Bacteria 2129
601 Ga0373923_0038378 3300035111 Bacteria 1963
602 Ga0373936_0221976 3300035113 Bacteria 838
603 Ga0373936_0327226 3300035113 Unclassified 695
604 Ga0373945_0000350 3300035116 Bacteria 13201
605 Ga0373945_0198767 3300035116 Bacteria 831
606 Ga0373954_0049731 3300035118 Bacteria 1966
607 Ga0373956_0030667 3300035119 Unclassified 2352
608 Ga0373956_0380379 3300035119 Unclassified 673
609 Ga0373957_0039156 3300035120 Bacteria 1777
610 Ga0373957_0091312 3300035120 Bacteria 1211
611 Ga0373943_0005619 3300035170 Bacteria 5626
612 Ga0373943_0006192 3300035170 Bacteria 5371
613 Ga0373946_0177790 3300035171 Unclassified 1008
614 Ga0373946_0208673 3300035171 Bacteria 938
615 Ga0373955_0086044 3300035172 Bacteria 1785
616 Ga0373955_0204391 3300035172 Bacteria 1176
617 Ga0373955_0560060 3300035172 Bacteria 699
618 Ga0373961_0124236 3300035241 Bacteria 858
619 Ga0373924_0000782 3300035410 Bacteria 9892
620 Ga0373924_0022822 3300035410 Unclassified 2449
621 Ga0373924_0055791 3300035410 Unclassified 1644
622 Ga0373931_0077679 3300035691 Bacteria 1825
623 Ga0373931_1101121 3300035691 Unclassified 541
624 Ga0373935_0000453 3300035692 Bacteria 21241
625 Ga0373935_0138620 3300035692 Unclassified 1641
626 Ga0373927_0000102 3300035695 Bacteria 64428
627 Ga0373927_0000304 3300035695 Bacteria 38764
628 Ga0373927_0027094 3300035695 Bacteria 3744
629 Ga0373933_0028484 3300035724 Bacteria 3223
630 Ga0373933_0218023 3300035724 Bacteria 1224
631 Ga0373933_0243653 3300035724 Bacteria 1156
632 Ga0373933_0290300 3300035724 Unclassified 1058
633 Ga0373933_0322874 3300035724 Unclassified 1001
634 Ga0373947_0000097 3300035725 Bacteria 44466
635 Ga0373947_0024086 3300035725 Bacteria 3544
636 Ga0373947_0040784 3300035725 Bacteria 2766
637 Ga0373947_0373771 3300035725 Bacteria 959
638 Ga0373937_0000464 3300036401 Bacteria 37475
639 Ga0373937_0159790 3300036401 Bacteria 2113
640 Ga0373937_0336571 3300036401 Unclassified 1429
641 Ga0373937_0417414 3300036401 Bacteria 1273
642 Ga0373937_0457897 3300036401 Bacteria 1212
643 Ga0373937_0480426 3300036401 Unclassified 1180
644 Ga0373925_0000427 3300037068 Bacteria 42637
645 Ga0373925_0027882 3300037068 Bacteria 4134
646 Ga0395899_0444841 3300037312 Bacteria 850
647 Ga0395900_0240177 3300037418 Bacteria 1818
648 Ga0395900_0450583 3300037418 Unclassified 1243
649 Ga0395898_0094532 3300037466 Unclassified 2873
650 Ga0436364_0162446 3300037853 Unclassified 2067
651 Ga0436364_0233196 3300037853 Bacteria 16640
652 Ga0436364_0251422 3300037853 Unclassified 701
653 Ga0436364_0608146 3300037853 Bacteria 1288
654 Ga0436364_0817813 3300037853 Bacteria 708
655 Ga0436364_0827592 3300037853 Bacteria 811
656 Ga0436364_0879886 3300037853 Unclassified 574
657 Ga0436364_1373841 3300037853 Bacteria 2770
658 Ga0436364_1390494 3300037853 Bacteria 983
659 Ga0436364_1479394 3300037853 Unclassified 4660
660 Ga0436365_0652661 3300039437 Unclassified 1333
661 Ga0436365_1008595 3300039437 Bacteria 702
662 Ga0436365_1299219 3300039437 Bacteria 3174
663 Ga0436363_0005674 3300039450 Unclassified 694
664 Ga0436363_0383478 3300039450 Unclassified 999
665 Ga0436362_0317059 3300039453 Unclassified 618
666 Ga0436362_1022535 3300039453 Unclassified 601
667 Ga0439431_0068150 3300041997 Unclassified 945
668 Ga0439457_087358 3300042014 Unclassified 720
669 Ga0466969_0157108 3300044656 Bacteria 1046
670 Ga0466966_0268020 3300044684 Unclassified 1028
671 Ga0466963_0026632 3300044694 Unclassified 3699
672 Ga0466963_0570821 3300044694 Bacteria 799
673 Ga0466963_0770928 3300044694 Unclassified 678
674 Ga0466959_0196947 3300045049 Bacteria 1404
675 Ga0466959_0673190 3300045049 Unclassified 694
676 Ga0466959_0817412 3300045049 Unclassified 623
677 Ga0451576_0280911 3300045051 Unclassified 1741
678 Ga0466967_0005911 3300045976 Bacteria 8578
679 Ga0466967_0446624 3300045976 Bacteria 1263
680 Ga0495592_0251569 3300046454 Unclassified 1168
681 Ga0495651_0099629 3300046462 Bacteria 2167
682 Ga0495651_0164331 3300046462 Unclassified 1587
683 Ga0495653_0211685 3300046463 Bacteria 1309
684 Ga0495580_0071514 3300046472 Bacteria 2424
685 Ga0495580_0082515 3300046472 Bacteria 2240
686 Ga0495580_0266786 3300046472 Bacteria 1170
687 Ga0495580_0424923 3300046472 Bacteria 893
688 Ga0495580_0813436 3300046472 Bacteria 605
689 Ga0495582_0055932 3300046473 Unclassified 2175
690 Ga0495582_0168220 3300046473 Bacteria 1247
691 Ga0495639_0092299 3300046475 Bacteria 1422
692 Ga0495664_0775371 3300046477 Unclassified 564
693 Ga0495594_0098237 3300046499 Unclassified 1646
694 Ga0495594_0536184 3300046499 Unclassified 664
695 Ga0495608_0078132 3300046511 Bacteria 2154
696 Ga0495628_0105079 3300046516 Unclassified 2176
697 Ga0495630_0036133 3300046517 Unclassified 3693
698 Ga0495630_0060909 3300046517 Unclassified 2834
699 Ga0495632_0122295 3300046519 Bacteria 1216
700 Ga0495643_0002622 3300046522 Bacteria 13984
701 Ga0495652_0427966 3300046529 Unclassified 931
702 Ga0495652_0658969 3300046529 Bacteria 708
703 Ga0495665_0040945 3300046531 Bacteria 2466
704 Ga0495586_0022204 3300046535 Unclassified 3386
705 Ga0495586_0608452 3300046535 Unclassified 631
706 Ga0495645_0230709 3300046543 Bacteria 1240
707 Ga0495635_0685230 3300046663 Bacteria 665
708 Ga0495588_0265214 3300046674 Bacteria 905
709 Ga0495657_0718088 3300046675 Unclassified 574
710 Ga0495623_0108432 3300046679 Unclassified 1685
711 Ga0495623_0192314 3300046679 Bacteria 1178
712 Ga0495613_0002002 3300046689 Bacteria 15472
713 Ga0495624_0026449 3300046690 Unclassified 3803
714 Ga0495581_0454845 3300047315 Bacteria 745
715 Ga0495604_0523373 3300047317 Unclassified 767
716 Ga0495636_0063029 3300047318 Unclassified 1570
717 Ga0495674_0003750 3300047319 Bacteria 14783
718 Ga0495674_0476087 3300047319 Unclassified 1001
719 Ga0495675_0622243 3300047444 Bacteria 610
720 Ga0495684_0491716 3300047471 Bacteria 845
721 Ga0495684_0501687 3300047471 Bacteria 834
722 Ga0495686_0001240 3300047472 Bacteria 29081
723 Ga0495593_0492202 3300047673 Bacteria 615
724 Ga0495602_0091946 3300048088 Unclassified 2515
725 Ga0495602_1103990 3300048088 Unclassified 520
726 Ga0496100_0250458 3300048903 Unclassified 1310
727 Ga0496100_0600101 3300048903 Unclassified 855
728 Ga0496100_0953226 3300048903 Unclassified 675
729 Ga0496101_0259159 3300048904 Bacteria 1356
730 Ga0496102_0356918 3300048905 Bacteria 1376
731 Ga0496103_0825767 3300048906 Unclassified 584
732 Ga0496104_0063507 3300048907 Unclassified 3502
733 Ga0496104_0267216 3300048907 Unclassified 1623
734 Ga0496104_0351245 3300048907 Bacteria 1387
735 Ga0496104_0472105 3300048907 Bacteria 1166
736 Ga0496104_0645405 3300048907 Unclassified 968
737 Ga0496104_1509101 3300048907 Unclassified 575
738 Ga0496110_0023918 3300048913 Bacteria 5202
739 Ga0496110_0058123 3300048913 Unclassified 3406
740 Ga0496111_0002497 3300048914 Bacteria 11093
741 Ga0496112_0003518 3300048915 Bacteria 12986
742 Ga0496112_0009274 3300048915 Bacteria 8848
743 Ga0496113_0002748 3300048916 Bacteria 10341
744 Ga0496113_0724310 3300048916 Unclassified 793
745 Ga0496114_1340059 3300048917 Unclassified 603
746 Ga0496115_0015735 3300048918 Bacteria 5745
747 Ga0496115_0063569 3300048918 Bacteria 2978
748 Ga0496115_0201911 3300048918 Bacteria 1642
749 Ga0501291_016960 3300049514 Bacteria 1117
750 Ga0501031_0008990 3300049568 Bacteria 6499
751 Ga0501032_0001438 3300049569 Bacteria 18907
752 Ga0501033_0048779 3300049570 Unclassified 3144
753 Ga0501034_0075693 3300049571 Unclassified 3372
754 Ga0501036_0000295 3300049572 Bacteria 34600
755 Ga0501037_0003767 3300049573 Bacteria 11000
756 Ga0501038_0001014 3300049574 Bacteria 25267
757 Ga0501039_0014391 3300049575 Bacteria 6059
758 Ga0501041_0807450 3300049577 Unclassified 602
759 Ga0501042_0891512 3300049578 Bacteria 648
760 Ga0501042_0959274 3300049578 Unclassified 623
761 Ga0501043_0005471 3300049579 Bacteria 10262
762 Ga0501046_0003170 3300049580 Bacteria 15183
763 Ga0501047_0050040 3300049581 Unclassified 4034
764 Ga0501048_0020743 3300049582 Unclassified 4816
765 Ga0501067_0015245 3300049583 Unclassified 4255
766 Ga0501068_0000872 3300049584 Bacteria 15717
767 Ga0501069_0001336 3300049585 Bacteria 12078
768 Ga0501070_0044344 3300049586 Unclassified 3701
769 Ga0501072_0056098 3300049588 Unclassified 3104
770 Ga0501073_0001754 3300049589 Bacteria 16104
771 Ga0501074_0026056 3300049590 Unclassified 4240
772 Ga0501076_0291742 3300049592 Bacteria 1336
773 Ga0501077_0009505 3300049593 Bacteria 6044
774 Ga0501234_106949 3300049707 Bacteria 513
775 Ga0501079_0007356 3300049741 Bacteria 8325
776 Ga0501080_0000017 3300049742 Bacteria 96079
777 Ga0501083_0014238 3300049744 Bacteria 5563
778 Ga0501083_0444006 3300049744 Bacteria 844
779 Ga0501035_0091958 3300049822 Unclassified 2669
780 Ga0501044_0021505 3300049823 Bacteria 6879
781 nmdc:mga05p37_1676575_c1 3300050507 Unclassified 621
782 nmdc:mga05p37_325005_c1 3300050507 Bacteria 1819
783 nmdc:mga09592_504796_c1 3300050508 Unclassified 1041
784 nmdc:mga0qj67_45937_c1 3300050509 Bacteria 3446
785 nmdc:mga06r32_565694_c1 3300050510 Bacteria 1110
786 nmdc:mga06r32_72659_c1 3300050510 Bacteria 2179
787 nmdc:mga08y16_12292_c1 3300050511 Bacteria 9001
788 nmdc:mga08y16_245744_c1 3300050511 Bacteria 1849
789 nmdc:mga0n895_1447511_c1 3300050512 Unclassified 654
790 nmdc:mga0n895_1514883_c1 3300050512 Unclassified 637
791 nmdc:mga0n895_911429_c1 3300050512 Unclassified 864
792 nmdc:mga08x19_200895_c1 3300050514 Bacteria 1366
793 Ga0495612_0455232 3300053078 Unclassified 585
794 Ga0500583_0038221 3300053092 Bacteria 2160
795 Ga0500583_0061409 3300053092 Unclassified 1774
796 Ga0500641_0132628 3300053096 Unclassified 1075
797 Ga0500650_0271052 3300053098 Bacteria 757
798 Ga0500595_034274 3300053119 Bacteria 1680
799 Ga0500616_0000105 3300053153 Bacteria 157881
800 Ga0500637_0148893 3300053178 Bacteria 1353
801 Ga0501084_0012610 3300054114 Bacteria 7001
802 Ga0501082_0028239 3300060353 Unclassified 4834
803 Ga0501082_0242137 3300060353 Unclassified 1570
804 Ga0070678_101841782
805 rootH2_10079227
806 Ga0065715_10156653
807 Ga0065707_10481809
808 Ga0070658_10415623
809 Ga0070683_100028360
810 Ga0070683_100058048
811 Ga0070683_100089070
812 Ga0070683_100157346
813 Ga0070683_100826957
814 Ga0070683_101115417
815 Ga0070670_100001974
816 Ga0070670_100725167
817 Ga0070677_10341692
818 Ga0068869_100075132
819 Ga0068869_100569997
820 Ga0070666_10883517
821 Ga0070680_100052522
822 Ga0070680_100283138
823 Ga0070680_100657053
824 Ga0070680_101554329
825 Ga0070680_102013224
826 Ga0068868_100047132
827 Ga0068868_100472206
828 Ga0068868_100485010
829 Ga0068868_101896785
830 Ga0070660_100038380
831 Ga0070660_100382882
832 Ga0070660_101031095
833 Ga0070660_101268016
834 Ga0070660_101423609
835 Ga0070689_100026720
836 Ga0070689_100115965
837 Ga0070689_100346858
838 Ga0070689_101602557
839 Ga0070691_10707593
840 Ga0070687_100039491
841 Ga0070661_100052920
842 Ga0070661_100062658
843 Ga0070661_100298551
844 Ga0070661_100849174
845 Ga0070692_10055513
846 Ga0070692_10262243
847 Ga0070668_100163560
848 Ga0070668_101140493
849 Ga0070669_100004850
850 Ga0070675_100000667
851 Ga0070675_100046847
852 Ga0070675_100086976
853 Ga0070675_100506472
854 Ga0070671_100101297
855 Ga0070671_100306495
856 Ga0070671_101670464
857 Ga0070673_100028304
858 Ga0070688_100156070
859 Ga0070659_100014834
860 Ga0070659_100176502
861 Ga0070659_100266655
862 Ga0070667_100256076
863 Ga0070709_10018168
864 Ga0070709_10369097
865 Ga0070709_10407605
866 Ga0070714_100019879
867 Ga0070714_100042565
868 Ga0070714_101181717
869 Ga0070714_101294305
870 Ga0070714_101423869
871 Ga0070714_101938888
872 Ga0070713_100000111
873 Ga0070713_100173925
874 Ga0070713_100214709
875 Ga0070713_100281795
876 Ga0070713_100305751
877 Ga0070713_100386872
878 Ga0070713_100470924
879 Ga0070713_100487472
880 Ga0070713_100523273
881 Ga0070713_100568856
882 Ga0070713_100714194
883 Ga0070713_100717714
884 Ga0070713_100740826
885 Ga0070710_10160349
886 Ga0070710_10186586
887 Ga0070710_11534439
888 Ga0070701_10013748
889 Ga0070701_10435271
890 Ga0070701_11210545
891 Ga0070711_100004402
892 Ga0070711_100007267
893 Ga0070711_100025000
894 Ga0070711_100034280
895 Ga0070711_100041896
896 Ga0070711_100227870
897 Ga0070711_100267652
898 Ga0070711_101310294
899 Ga0070705_101556637
900 Ga0070700_100714981
901 Ga0070694_100181907
902 Ga0070694_100472860
903 Ga0070708_101207493
904 Ga0070663_100493218
905 Ga0070663_101624787
906 Ga0070678_100162843
907 Ga0070678_100169403
908 Ga0070678_100716898
909 Ga0070678_100923028
910 Ga0070678_101330068
911 Ga0070662_100263077
912 Ga0070662_100295034
913 Ga0070662_100375462
914 Ga0070662_100452043
915 Ga0070681_10000483
916 Ga0070681_10163397
917 Ga0070681_10377083
918 Ga0070681_10520590
919 Ga0070685_10687798
920 Ga0070706_100123271
921 Ga0070707_100000757
922 Ga0070679_100007031
923 Ga0070679_100272001
924 Ga0070679_100370097
925 Ga0070679_100375819
926 Ga0070679_100611259
927 Ga0070679_101576964
928 Ga0070684_100038250
929 Ga0070684_100208684
930 Ga0070684_100273274
931 Ga0070684_101903985
932 Ga0070697_100020394
933 Ga0070697_101557635
934 Ga0068853_100007353
935 Ga0068853_100067924
936 Ga0068853_100076099
937 Ga0068853_100110101
938 Ga0068853_100216613
939 Ga0070672_100016071
940 Ga0070695_100004444
941 Ga0070696_100979156
942 Ga0070693_100448495
943 Ga0070693_100480649
944 Ga0070693_100698011
945 Ga0070665_100003472
946 Ga0070665_100437461
947 Ga0070704_100036542
948 Ga0068855_100000656
949 Ga0068855_100011538
950 Ga0068855_100016579
951 Ga0068855_100032021
952 Ga0068855_100045002
953 Ga0068855_100059277
954 Ga0068855_100288059
955 Ga0068855_100568578
956 Ga0068855_100823710
957 Ga0070664_100020783
958 Ga0070664_100029007
959 Ga0070664_100047277
960 Ga0070664_100059394
961 Ga0070664_100070616
962 Ga0070664_101604385
963 Ga0068857_100028696
964 Ga0068857_100065622
965 Ga0068857_100734884
966 Ga0068857_100772417
967 Ga0068854_100931697
968 Ga0068854_101168299
969 Ga0068854_101891963
970 Ga0068856_100001584
971 Ga0068856_100004446
972 Ga0068856_100007508
973 Ga0068856_100033422
974 Ga0068856_100056352
975 Ga0068856_100201518
976 Ga0068856_100379183
977 Ga0068856_100427373
978 Ga0068856_100641631
979 Ga0070702_100589518
980 Ga0070702_101644875
981 Ga0068852_100007795
982 Ga0068852_100017100
983 Ga0068852_100476979
984 Ga0068852_101326881
985 Ga0068859_100143351
986 Ga0068859_100817058
987 Ga0068859_101155331
988 Ga0068859_101233052
989 Ga0068859_101388673
990 Ga0068859_101881201
991 Ga0068864_100095302
992 Ga0068864_100202027
993 Ga0068864_100225666
994 Ga0068864_102023237
995 Ga0068861_100010665
996 Ga0068861_100206536
997 Ga0068861_100256018
998 Ga0068861_101254800
999 Ga0068861_101344659
1000 Ga0068861_101381641
1001 Ga0068863_100018504
1002 Ga0068863_100816882
1003 Ga0068863_101002778
1004 Ga0068858_100011509
1005 Ga0068858_100195524
1006 Ga0068858_100407993
1007 Ga0068858_100617779
1008 Ga0068860_100046476
1009 Ga0068860_100165724
1010 Ga0068860_100325359
1011 Ga0068860_100443605
1012 Ga0068862_100060715
1013 Ga0068862_100175826
1014 Ga0068862_101867752
1015 Ga0068862_102520710
1016 Ga0068862_102692763
1017 Ga0070717_10091844
1018 Ga0070717_10110083
1019 Ga0070717_10483942
1020 Ga0070717_10557383
1021 Ga0070717_10592919
1022 Ga0070717_11553720
1023 Ga0070717_11626357
1024 Ga0070715_10531063
1025 Ga0070716_100004320
1026 Ga0070716_100072123
1027 Ga0070716_100214372
1028 Ga0070716_100347624
1029 Ga0070716_100687564
1030 Ga0070712_100000453
1031 Ga0070712_100013375
1032 Ga0070712_100190098
1033 Ga0070712_100312058
1034 Ga0070712_100378210
1035 Ga0070712_100493642
1036 Ga0097621_100000631
1037 Ga0097621_100002425
1038 Ga0097621_100137367
1039 Ga0097621_100525132
1040 Ga0097621_100565251
1041 Ga0097621_100987139
1042 Ga0097621_102004011
1043 Ga0097621_102323345
1044 Ga0068871_100000220
1045 Ga0068871_100001703
1046 Ga0068871_100470409
1047 Ga0068871_100791223
1048 Ga0068871_101149792
1049 Ga0068871_102321797
1050 Ga0075428_100092852
1051 Ga0075430_100750758
1052 Ga0075431_100065736
1053 Ga0075431_100489472
1054 Ga0075433_10850775
1055 Ga0075434_100427130
1056 Ga0075434_101052616
1057 Ga0075434_101488549
1058 Ga0075429_100183874
1059 Ga0068865_100000829
1060 Ga0068865_100114322
1061 Ga0068865_100125386
1062 Ga0068865_101287241
1063 Ga0097620_100143355
1064 Ga0097620_100816971
1065 Ga0097620_101155678
1066 Ga0097620_101233077
1067 Ga0097620_101388750
1068 Ga0097620_101880929
1069 Ga0099794_10460654
1070 Ga0105240_10013042
1071 Ga0105240_10031145
1072 Ga0105240_10049604
1073 Ga0105240_10116458
1074 Ga0105240_10215641
1075 Ga0105240_10286716
1076 Ga0105240_10290097
1077 Ga0105240_10494428
1078 Ga0105240_10621394
1079 Ga0105240_10893629
1080 Ga0105240_11309943
1081 Ga0111539_10055492
1082 Ga0111539_12457837
1083 Ga0105245_10196162
1084 Ga0105245_11401497
1085 Ga0105245_11493141
1086 Ga0105247_10255149
1087 Ga0114129_10345236
1088 Ga0105243_10259847
1089 Ga0105243_10707904
1090 Ga0105243_12143092
1091 Ga0105241_10169457
1092 Ga0105241_10224910
1093 Ga0105241_10572860
1094 Ga0105241_11943464
1095 Ga0105241_12465492
1096 Ga0105242_10024190
1097 Ga0105242_10173426
1098 Ga0105242_10251577
1099 Ga0105248_10003212
1100 Ga0105248_10762375
1101 Ga0105248_11551704
1102 Ga0105237_10323442
1103 Ga0105237_10694527
1104 Ga0105237_10854338
1105 Ga0105237_11544029
1106 Ga0105238_10152608
1107 Ga0105238_10179126
1108 Ga0105238_10333625
1109 Ga0105238_10857718
1110 Ga0105238_11945453
1111 Ga0105238_12192428
1112 Ga0105249_10287716
1113 Ga0105249_10357055
1114 Ga0105249_10666084
1115 Ga0105249_10835591
1116 Ga0105249_12187079
1117 Ga0099796_10398516
1118 Ga0105239_10178344
1119 Ga0105239_10231719
1120 Ga0105239_10422045
1121 Ga0105239_11214300
1122 Ga0105246_11488955
1123 Ga0105246_11825769
1124 Ga0157371_10328358
1125 Ga0157371_11104433
1126 Ga0157370_10022542
1127 Ga0157370_10348062
1128 Ga0157369_10023142
1129 Ga0157369_10048525
1130 Ga0157369_10155062
1131 Ga0157369_10155085
1132 Ga0157369_10380551
1133 Ga0157369_10549642
1134 Ga0157369_10681901
1135 Ga0157369_11930182
1136 Ga0157374_10000164
1137 Ga0157374_10052083
1138 Ga0157374_10926477
1139 Ga0157374_11390471
1140 Ga0157374_11663999
1141 Ga0157378_10000204
1142 Ga0157372_10001933
1143 Ga0157372_10174613
1144 Ga0157372_10185665
1145 Ga0157372_10190871
1146 Ga0157372_10205931
1147 Ga0157372_10239030
1148 Ga0157372_10270929
1149 Ga0157375_10383973
1150 Ga0163163_10024431
1151 Ga0163163_10617745
1152 Ga0163163_10826310
1153 Ga0157380_10079027
1154 Ga0157380_10267308
1155 Ga0157380_13411529
1156 Ga0157377_10136715
1157 Ga0157377_10704276
1158 Ga0157379_11046881
1159 Ga0157376_10012147
1160 Ga0157376_10016016
1161 Ga0157376_10098749
1162 Ga0157376_11399259
1163 Ga0163161_10994179
1164 Ga0213874_10212965
1165 Ga0213874_10267724
1166 Ga0213876_10541261
1167 Ga0213875_10039476
1168 Ga0213875_10221263
1169 Ga0213875_10472288
1170 Ga0207697_10055968
1171 Ga0207682_10324794
1172 Ga0207692_10584763
1173 Ga0207710_10026941
1174 Ga0207710_10506949
1175 Ga0207688_10278842
1176 Ga0207647_10290039
1177 Ga0207647_10537927
1178 Ga0207643_11039460
1179 Ga0207684_10185483
1180 Ga0207684_10428512
1181 Ga0207654_10277751
1182 Ga0207707_10009160
1183 Ga0207707_10131297
1184 Ga0207707_10414934
1185 Ga0207695_10041165
1186 Ga0207695_10043394
1187 Ga0207695_10047068
1188 Ga0207695_10099409
1189 Ga0207695_10123594
1190 Ga0207695_10158530
1191 Ga0207695_10484571
1192 Ga0207671_10189501
1193 Ga0207671_10342153
1194 Ga0207693_10000066
1195 Ga0207693_10009445
1196 Ga0207693_10024268
1197 Ga0207693_10494419
1198 Ga0207693_10559018
1199 Ga0207693_11086554
1200 Ga0207663_10001476
1201 Ga0207663_10010788
1202 Ga0207663_10216141
1203 Ga0207663_10827901
1204 Ga0207660_10047171
1205 Ga0207660_10213766
1206 Ga0207660_10586230
1207 Ga0207662_10108963
1208 Ga0207657_10038749
1209 Ga0207657_10046059
1210 Ga0207649_10012342
1211 Ga0207649_10054464
1212 Ga0207649_10108585
1213 Ga0207652_10024267
1214 Ga0207652_10050603
1215 Ga0207652_10305213
1216 Ga0207652_10371446
1217 Ga0207652_10550602
1218 Ga0207652_10695388
1219 Ga0207652_11070505
1220 Ga0207646_10000478
1221 Ga0207681_10013605
1222 Ga0207694_10001705
1223 Ga0207694_10200187
1224 Ga0207694_11128229
1225 Ga0207694_11228384
1226 Ga0207650_10043165
1227 Ga0207650_10683656
1228 Ga0207659_10000222
1229 Ga0207659_10391101
1230 Ga0207659_10466974
1231 Ga0207659_10536155
1232 Ga0207687_10345374
1233 Ga0207687_10577708
1234 Ga0207687_11035049
1235 Ga0207700_10000328
1236 Ga0207700_10207889
1237 Ga0207700_10223768
1238 Ga0207700_10434206
1239 Ga0207700_11585662
1240 Ga0207664_10001074
1241 Ga0207664_10210841
1242 Ga0207644_10234891
1243 Ga0207644_10244618
1244 Ga0207644_10845353
1245 Ga0207690_10010126
1246 Ga0207706_10295546
1247 Ga0207706_10385347
1248 Ga0207706_10466981
1249 Ga0207706_10986458
1250 Ga0207686_10262760
1251 Ga0207686_10490619
1252 Ga0207686_11672372
1253 Ga0207709_10612246
1254 Ga0207709_10951146
1255 Ga0207670_10149053
1256 Ga0207670_10170589
1257 Ga0207670_10189116
1258 Ga0207669_10288353
1259 Ga0207704_11394945
1260 Ga0207665_10062770
1261 Ga0207665_10067110
1262 Ga0207665_10170238
1263 Ga0207665_10414943
1264 Ga0207665_10610423
1265 Ga0207665_10808044
1266 Ga0207691_10259413
1267 Ga0207711_10080710
1268 Ga0207711_10215978
1269 Ga0207711_11220050
1270 Ga0207711_11270918
1271 Ga0207689_10522598
1272 Ga0207661_10025003
1273 Ga0207661_10055880
1274 Ga0207661_10161574
1275 Ga0207661_10802221
1276 Ga0207661_10973998
1277 Ga0207661_11586648
1278 Ga0207679_10086849
1279 Ga0207679_10217000
1280 Ga0207679_10370859
1281 Ga0207679_10378048
1282 Ga0207679_10478554
1283 Ga0207679_10818139
1284 Ga0207667_10002423
1285 Ga0207667_10009378
1286 Ga0207667_10022637
1287 Ga0207667_10028547
1288 Ga0207667_10094788
1289 Ga0207667_10250918
1290 Ga0207667_10738292
1291 Ga0207651_10106096
1292 Ga0207651_10773259
1293 Ga0207651_10793587
1294 Ga0207712_10208356
1295 Ga0207712_10481125
1296 Ga0207712_10838960
1297 Ga0207668_10463076
1298 Ga0207668_10816670
1299 Ga0207640_10068176
1300 Ga0207640_10188272
1301 Ga0207640_11137997
1302 Ga0207658_11930007
1303 Ga0207677_10441825
1304 Ga0207677_10531266
1305 Ga0207677_10734755
1306 Ga0207677_11749965
1307 Ga0207703_10010958
1308 Ga0207703_10142045
1309 Ga0207703_10378432
1310 Ga0207703_10572747
1311 Ga0207703_10850367
1312 Ga0207703_12418160
1313 Ga0207639_10058244
1314 Ga0207639_10075664
1315 Ga0207639_10077603
1316 Ga0207639_10376842
1317 Ga0207639_11660621
1318 Ga0207678_10676333
1319 Ga0207678_10825350
1320 Ga0207708_10396248
1321 Ga0207702_10001476
1322 Ga0207702_10004134
1323 Ga0207702_10024301
1324 Ga0207702_10052310
1325 Ga0207702_10065951
1326 Ga0207702_10086737
1327 Ga0207702_10112418
1328 Ga0207702_10197887
1329 Ga0207641_10020600
1330 Ga0207648_10487218
1331 Ga0207648_11337522
1332 Ga0207676_10011800
1333 Ga0207676_10083942
1334 Ga0207676_10208010
1335 Ga0207676_10781542
1336 Ga0207676_11977683
1337 Ga0207674_10028475
1338 Ga0207674_10144149
1339 Ga0207674_10160478
1340 Ga0207674_10265981
1341 Ga0207674_10279334
1342 Ga0207674_10851452
1343 Ga0207674_11678244
1344 Ga0207675_100017206
1345 Ga0207675_100189527
1346 Ga0207675_100835211
1347 Ga0207675_100879820
1348 Ga0207675_101265618
1349 Ga0207675_101639312
1350 Ga0207683_10528972
1351 Ga0207683_10531237
1352 Ga0207683_10561193
1353 Ga0207683_11139670
1354 Ga0207683_11457909
1355 Ga0207698_10204743
1356 Ga0207698_10413105
1357 Ga0207698_10416000
1358 Ga0207698_11043156
1359 Ga0207698_11721841
1360 Ga0207698_11986445
1361 Ga0209995_1057959
1362 Ga0209974_10093591
1363 Ga0207428_10009430
1364 Ga0207428_10209245
1365 Ga0268266_10127652
1366 Ga0268265_10255766
1367 Ga0268265_11676605
1368 Ga0268264_10085251
1369 Ga0268264_10380106
1370 Ga0268264_11337493
1371 Ga0265338_10189180
1372 Ga0265338_10240264
1373 Ga0265762_1013858
1374 Ga0265760_10010213
1375 Ga0265760_10057562
1376 Ga0265760_10233094
1377 Ga0265327_10007562
1378 Ga0265327_10243940
1379 Ga0307408_100213778
1380 Ga0265314_10001418
1381 Ga0265314_10027696
1382 Ga0307405_10047481
1383 Ga0307405_10132992
1384 Ga0307413_11267812
1385 Ga0307413_11731234
1386 Ga0307406_10551256
1387 Ga0307407_10098268
1388 Ga0307407_10143820
1389 Ga0307412_10280475
1390 Ga0307409_100076733
1391 Ga0307409_100312942
1392 Ga0307409_100387529
1393 Ga0307416_100026773
1394 Ga0307416_101777929
1395 Ga0307416_101869938
1396 Ga0307414_10871945
1397 Ga0307411_10120911
1398 Ga0307411_10305231
1399 Ga0307411_10623402
1400 Ga0307415_100065126
1401 Ga0307415_101554251
1402 Ga0373926_0005084
1403 Ga0373934_0029918
1404 Ga0373923_0038378
1405 Ga0373936_0221976
1406 Ga0373936_0327226
1407 Ga0373945_0000350
1408 Ga0373945_0198767
1409 Ga0373954_0049731
1410 Ga0373956_0030667
1411 Ga0373956_0380379
1412 Ga0373957_0039156
1413 Ga0373957_0091312
1414 Ga0373943_0005619
1415 Ga0373943_0006192
1416 Ga0373946_0177790
1417 Ga0373946_0208673
1418 Ga0373955_0086044
1419 Ga0373955_0204391
1420 Ga0373955_0560060
1421 Ga0373961_0124236
1422 Ga0373924_0000782
1423 Ga0373924_0022822
1424 Ga0373924_0055791
1425 Ga0373931_0077679
1426 Ga0373931_1101121
1427 Ga0373935_0000453
1428 Ga0373935_0138620
1429 Ga0373927_0000102
1430 Ga0373927_0000304
1431 Ga0373927_0027094
1432 Ga0373933_0028484
1433 Ga0373933_0218023
1434 Ga0373933_0243653
1435 Ga0373933_0290300
1436 Ga0373933_0322874
1437 Ga0373947_0000097
1438 Ga0373947_0024086
1439 Ga0373947_0040784
1440 Ga0373947_0373771
1441 Ga0373937_0000464
1442 Ga0373937_0159790
1443 Ga0373937_0336571
1444 Ga0373937_0417414
1445 Ga0373937_0457897
1446 Ga0373937_0480426
1447 Ga0373925_0000427
1448 Ga0373925_0027882
1449 Ga0395899_0444841
1450 Ga0395900_0240177
1451 Ga0395900_0450583
1452 Ga0395898_0094532
1453 Ga0436364_0162446
1454 Ga0436364_0233196
1455 Ga0436364_0251422
1456 Ga0436364_0608146
1457 Ga0436364_0817813
1458 Ga0436364_0827592
1459 Ga0436364_0879886
1460 Ga0436364_1373841
1461 Ga0436364_1390494
1462 Ga0436364_1479394
1463 Ga0436365_0652661
1464 Ga0436365_1008595
1465 Ga0436365_1299219
1466 Ga0436363_0005674
1467 Ga0436363_0383478
1468 Ga0436362_0317059
1469 Ga0436362_1022535
1470 Ga0439431_0068150
1471 Ga0439457_087358
1472 Ga0466969_0157108
1473 Ga0466966_0268020
1474 Ga0466963_0026632
1475 Ga0466963_0570821
1476 Ga0466963_0770928
1477 Ga0466959_0196947
1478 Ga0466959_0673190
1479 Ga0466959_0817412
1480 Ga0451576_0280911
1481 Ga0466967_0005911
1482 Ga0466967_0446624
1483 Ga0495592_0251569
1484 Ga0495651_0099629
1485 Ga0495651_0164331
1486 Ga0495653_0211685
1487 Ga0495580_0071514
1488 Ga0495580_0082515
1489 Ga0495580_0266786
1490 Ga0495580_0424923
1491 Ga0495580_0813436
1492 Ga0495582_0055932
1493 Ga0495582_0168220
1494 Ga0495639_0092299
1495 Ga0495664_0775371
1496 Ga0495594_0098237
1497 Ga0495594_0536184
1498 Ga0495608_0078132
1499 Ga0495628_0105079
1500 Ga0495630_0036133
1501 Ga0495630_0060909
1502 Ga0495632_0122295
1503 Ga0495643_0002622
1504 Ga0495652_0427966
1505 Ga0495652_0658969
1506 Ga0495665_0040945
1507 Ga0495586_0022204
1508 Ga0495586_0608452
1509 Ga0495645_0230709
1510 Ga0495635_0685230
1511 Ga0495588_0265214
1512 Ga0495657_0718088
1513 Ga0495623_0108432
1514 Ga0495623_0192314
1515 Ga0495613_0002002
1516 Ga0495624_0026449
1517 Ga0495581_0454845
1518 Ga0495604_0523373
1519 Ga0495636_0063029
1520 Ga0495674_0003750
1521 Ga0495674_0476087
1522 Ga0495675_0622243
1523 Ga0495684_0491716
1524 Ga0495684_0501687
1525 Ga0495686_0001240
1526 Ga0495593_0492202
1527 Ga0495602_0091946
1528 Ga0495602_1103990
1529 Ga0496100_0250458
1530 Ga0496100_0600101
1531 Ga0496100_0953226
1532 Ga0496101_0259159
1533 Ga0496102_0356918
1534 Ga0496103_0825767
1535 Ga0496104_0063507
1536 Ga0496104_0267216
1537 Ga0496104_0351245
1538 Ga0496104_0472105
1539 Ga0496104_0645405
1540 Ga0496104_1509101
1541 Ga0496110_0023918
1542 Ga0496110_0058123
1543 Ga0496111_0002497
1544 Ga0496112_0003518
1545 Ga0496112_0009274
1546 Ga0496113_0002748
1547 Ga0496113_0724310
1548 Ga0496114_1340059
1549 Ga0496115_0015735
1550 Ga0496115_0063569
1551 Ga0496115_0201911
1552 Ga0501291_016960
1553 Ga0501031_0008990
1554 Ga0501032_0001438
1555 Ga0501033_0048779
1556 Ga0501034_0075693
1557 Ga0501036_0000295
1558 Ga0501037_0003767
1559 Ga0501038_0001014
1560 Ga0501039_0014391
1561 Ga0501041_0807450
1562 Ga0501042_0891512
1563 Ga0501042_0959274
1564 Ga0501043_0005471
1565 Ga0501046_0003170
1566 Ga0501047_0050040
1567 Ga0501048_0020743
1568 Ga0501067_0015245
1569 Ga0501068_0000872
1570 Ga0501069_0001336
1571 Ga0501070_0044344
1572 Ga0501072_0056098
1573 Ga0501073_0001754
1574 Ga0501074_0026056
1575 Ga0501076_0291742
1576 Ga0501077_0009505
1577 Ga0501234_106949
1578 Ga0501079_0007356
1579 Ga0501080_0000017
1580 Ga0501083_0014238
1581 Ga0501083_0444006
1582 Ga0501035_0091958
1583 Ga0501044_0021505
1584 nmdc:mga05p37_1676575_c1
1585 nmdc:mga05p37_325005_c1
1586 nmdc:mga09592_504796_c1
1587 nmdc:mga0qj67_45937_c1
1588 nmdc:mga06r32_565694_c1
1589 nmdc:mga06r32_72659_c1
1590 nmdc:mga08y16_12292_c1
1591 nmdc:mga08y16_245744_c1
1592 nmdc:mga0n895_1447511_c1
1593 nmdc:mga0n895_1514883_c1
1594 nmdc:mga0n895_911429_c1
1595 nmdc:mga08x19_200895_c1
1596 Ga0495612_0455232
1597 Ga0500583_0038221
1598 Ga0500583_0061409
1599 Ga0500641_0132628
1600 Ga0500650_0271052
1601 Ga0500595_034274
1602 Ga0500616_0000105
1603 Ga0500637_0148893
1604 Ga0501084_0012610
1605 Ga0501082_0028239
1606 Ga0501082_0242137

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03965

Penicillinase_R

Penicillinase repressor

8

123

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lb5-assembly1.cif.gz_B crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.8859 2 59
3zec-assembly1.cif.gz_A fic protein from shewanella oneidensis (e73g mutant) in complex with amppnp 0.8765 3 57
8bsi-assembly1.cif.gz_Sc giardia ribosome chimeric hybrid-like gdp+pi bound state (b1) 0.8657 8 57
5sva-assembly1.cif.gz_h mediator-rna polymerase ii pre-initiation complex 0.8603 9 57
8brm-assembly1.cif.gz_Sc giardia ribosome in post-t state, no e-site trna (a6) 0.8522 8 59
ID Description Score Start End Superfamily
4lb5B00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8859 2 59 1.10.10.10
3f8nB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8765 10 57 1.10.10.10
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8575 7 56 1.10.10.10
af_Q4DPL3_4_78_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8483 6 59 1.10.10.10
af_Q58184_329_408_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8468 7 58 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A1V5XS53-F1-model_v4 Zinc uptake regulation protein 0.8724 8 61 GO:0000976
GO:0003700
GO:0008270
GO:0045892
GO:1900376
AF-A0A2V9RB08-F1-model_v4 CopY family transcriptional regulator 0.8523 1 107 GO:0003677
GO:0045892
AF-A0A1X7A957-F1-model_v4 Methicillin resistance regulatory protein MecI 0.8353 1 114 GO:0003677
GO:0045892
AF-A0A2V9RB08-F1-model_v4 CopY family transcriptional regulator 0.8316 1 107 GO:0003677
GO:0045892
AF-A0A6M8VJI4-F1-model_v4 BlaI/MecI/CopY family transcriptional regulator 0.8309 1 108 GO:0003677
GO:0045892

Map