F481337
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 799 | 331 | 1598 | 103 |
Family's Representative Sequence
| Representative Sequence | 3300035410|Ga0373924_0210363|Ga0373924_0210363_84_461 |
| Length | 125 |
| Sequence | LPGRSEPAPGYDPDVRELDPTSFDEAIATGPVVVDFWAPWCRPCVAVVPILEELEAGAGGRVAFAKLNVDEHPEISGRYEVLSIPTVILFADGEVQQRVVGIRPRDHFERAFEAWLSGSGPSRSA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 27 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 35 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 40 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 42 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 43 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 44 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 46 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 47 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 48 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 49 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 50 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 51 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 52 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 53 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 58 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 59 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 60 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 61 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 62 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 63 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 83 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 86 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 87 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 88 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 89 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 130 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 131 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 132 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 133 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 134 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 135 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 136 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 137 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 138 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 139 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 140 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 141 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 142 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 143 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 144 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 145 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 146 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 147 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 148 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 149 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 150 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 151 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 152 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 153 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 154 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 155 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 156 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 157 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 158 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 159 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 160 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 161 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 162 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 163 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 164 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 165 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 166 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 167 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 168 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 169 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 170 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 171 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 172 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 173 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 174 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 175 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 176 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 177 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 178 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 179 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 180 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 181 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 182 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 183 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 184 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 185 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 186 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 187 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 188 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 189 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 190 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 191 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 192 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 193 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 194 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 195 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 196 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 197 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 198 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 199 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 200 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 201 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 202 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 203 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 204 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 205 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 206 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 207 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 208 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 209 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 210 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 268 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 269 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 270 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 271 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 272 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 273 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 274 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 275 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 276 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 277 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 278 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 279 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 280 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 281 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 282 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 283 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 290 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 305 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 314 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 317 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 319 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 324 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 325 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 327 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 328 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 329 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 331 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.37 |
| Metatranscriptomes | 0.63 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.25 |
| Nodule | 0 |
| Rhizoplane | 7.51 |
| Rhizosphere | 91.99 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0373924_0210363 | 3300035410 | Bacteria | 859 |
| 2 | Ga0070658_10153890 | 3300005327 | Bacteria | 1927 |
| 3 | Ga0070658_10590203 | 3300005327 | Bacteria | 962 |
| 4 | Ga0070676_11220913 | 3300005328 | Bacteria | 572 |
| 5 | Ga0070683_100231551 | 3300005329 | Bacteria | 1756 |
| 6 | Ga0070683_100408784 | 3300005329 | Bacteria | 1295 |
| 7 | Ga0070683_100950575 | 3300005329 | Bacteria | 825 |
| 8 | Ga0070690_101052825 | 3300005330 | Bacteria | 643 |
| 9 | Ga0068869_100157437 | 3300005334 | Bacteria | 1766 |
| 10 | Ga0070680_100050398 | 3300005336 | Bacteria | 3396 |
| 11 | Ga0070680_100233870 | 3300005336 | Bacteria | 1552 |
| 12 | Ga0070680_100294091 | 3300005336 | Bacteria | 1377 |
| 13 | Ga0070680_100951333 | 3300005336 | Bacteria | 741 |
| 14 | Ga0070682_100062620 | 3300005337 | Bacteria | 2356 |
| 15 | Ga0070682_100131946 | 3300005337 | Bacteria | 1692 |
| 16 | Ga0070682_101575783 | 3300005337 | Bacteria | 567 |
| 17 | Ga0070660_100140158 | 3300005339 | Bacteria | 1940 |
| 18 | Ga0070687_100129659 | 3300005343 | Bacteria | 1454 |
| 19 | Ga0070687_101295903 | 3300005343 | Bacteria | 541 |
| 20 | Ga0070661_100320529 | 3300005344 | Bacteria | 1210 |
| 21 | Ga0070675_100077114 | 3300005354 | Bacteria | 2773 |
| 22 | Ga0070671_100432711 | 3300005355 | Bacteria | 1127 |
| 23 | Ga0070674_101656650 | 3300005356 | Bacteria | 578 |
| 24 | Ga0070659_100103347 | 3300005366 | Bacteria | 2295 |
| 25 | Ga0070709_10003121 | 3300005434 | Bacteria | 8891 |
| 26 | Ga0070709_10327710 | 3300005434 | Bacteria | 1126 |
| 27 | Ga0070714_100011685 | 3300005435 | Bacteria | 6972 |
| 28 | Ga0070714_100043750 | 3300005435 | Bacteria | 3789 |
| 29 | Ga0070714_100049748 | 3300005435 | Bacteria | 3568 |
| 30 | Ga0070714_100074075 | 3300005435 | Bacteria | 2951 |
| 31 | Ga0070714_100093033 | 3300005435 | Bacteria | 2643 |
| 32 | Ga0070714_100211075 | 3300005435 | Bacteria | 1779 |
| 33 | Ga0070714_100266053 | 3300005435 | Bacteria | 1589 |
| 34 | Ga0070714_100268905 | 3300005435 | Bacteria | 1580 |
| 35 | Ga0070714_100414013 | 3300005435 | Bacteria | 1276 |
| 36 | Ga0070714_100471883 | 3300005435 | Bacteria | 1194 |
| 37 | Ga0070714_100539749 | 3300005435 | Bacteria | 1115 |
| 38 | Ga0070714_102018602 | 3300005435 | Bacteria | 562 |
| 39 | Ga0070713_100016357 | 3300005436 | Bacteria | 5577 |
| 40 | Ga0070713_100068559 | 3300005436 | Bacteria | 2989 |
| 41 | Ga0070713_100143026 | 3300005436 | Bacteria | 2120 |
| 42 | Ga0070713_100237263 | 3300005436 | Bacteria | 1659 |
| 43 | Ga0070713_100266072 | 3300005436 | Bacteria | 1568 |
| 44 | Ga0070713_100374392 | 3300005436 | Bacteria | 1325 |
| 45 | Ga0070713_101983851 | 3300005436 | Bacteria | 564 |
| 46 | Ga0070710_10023167 | 3300005437 | Bacteria | 3259 |
| 47 | Ga0070710_10060770 | 3300005437 | Bacteria | 2150 |
| 48 | Ga0070711_100026552 | 3300005439 | Bacteria | 3795 |
| 49 | Ga0070711_100029826 | 3300005439 | Bacteria | 3604 |
| 50 | Ga0070705_100058774 | 3300005440 | Bacteria | 2274 |
| 51 | Ga0070705_101809487 | 3300005440 | Bacteria | 518 |
| 52 | Ga0070700_100056258 | 3300005441 | Bacteria | 2465 |
| 53 | Ga0070708_100391878 | 3300005445 | Bacteria | 1310 |
| 54 | Ga0070708_100501545 | 3300005445 | Bacteria | 1145 |
| 55 | Ga0070708_100799557 | 3300005445 | Bacteria | 886 |
| 56 | Ga0070678_100204479 | 3300005456 | Bacteria | 1632 |
| 57 | Ga0070678_100290506 | 3300005456 | Bacteria | 1386 |
| 58 | Ga0070681_10013096 | 3300005458 | Bacteria | 8236 |
| 59 | Ga0070681_10053748 | 3300005458 | Unclassified | 4013 |
| 60 | Ga0070681_11417102 | 3300005458 | Bacteria | 619 |
| 61 | Ga0068867_100498838 | 3300005459 | Bacteria | 1046 |
| 62 | Ga0070706_100145982 | 3300005467 | Bacteria | 2209 |
| 63 | Ga0070706_100397779 | 3300005467 | Unclassified | 1282 |
| 64 | Ga0070706_100536788 | 3300005467 | Bacteria | 1088 |
| 65 | Ga0070707_100039227 | 3300005468 | Bacteria | 4526 |
| 66 | Ga0070707_100565877 | 3300005468 | Bacteria | 1099 |
| 67 | Ga0070707_101197884 | 3300005468 | Bacteria | 726 |
| 68 | Ga0070707_101235967 | 3300005468 | Bacteria | 713 |
| 69 | Ga0070698_100109046 | 3300005471 | Bacteria | 2735 |
| 70 | Ga0070698_100122806 | 3300005471 | Bacteria | 2555 |
| 71 | Ga0070698_100441519 | 3300005471 | Bacteria | 1236 |
| 72 | Ga0070698_100499197 | 3300005471 | Bacteria | 1155 |
| 73 | Ga0070698_101218771 | 3300005471 | Bacteria | 702 |
| 74 | Ga0070699_100058384 | 3300005518 | Bacteria | 3343 |
| 75 | Ga0070699_101023571 | 3300005518 | Unclassified | 757 |
| 76 | Ga0070679_100048616 | 3300005530 | Bacteria | 4225 |
| 77 | Ga0070679_100087122 | 3300005530 | Bacteria | 3110 |
| 78 | Ga0070679_100184891 | 3300005530 | Bacteria | 2055 |
| 79 | Ga0070679_100971483 | 3300005530 | Bacteria | 793 |
| 80 | Ga0070684_100873486 | 3300005535 | Bacteria | 842 |
| 81 | Ga0070697_100128080 | 3300005536 | Bacteria | 2127 |
| 82 | Ga0070697_100155602 | 3300005536 | Unclassified | 1929 |
| 83 | Ga0070697_100211556 | 3300005536 | Bacteria | 1651 |
| 84 | Ga0070697_100406766 | 3300005536 | Unclassified | 1181 |
| 85 | Ga0070697_100945919 | 3300005536 | Bacteria | 765 |
| 86 | Ga0068853_100835897 | 3300005539 | Bacteria | 883 |
| 87 | Ga0070672_100108901 | 3300005543 | Bacteria | 2256 |
| 88 | Ga0070672_100228107 | 3300005543 | Bacteria | 1564 |
| 89 | Ga0070686_100280843 | 3300005544 | Bacteria | 1228 |
| 90 | Ga0070693_100247683 | 3300005547 | Bacteria | 1180 |
| 91 | Ga0070693_100505807 | 3300005547 | Bacteria | 858 |
| 92 | Ga0070693_100673313 | 3300005547 | Bacteria | 755 |
| 93 | Ga0070704_100142645 | 3300005549 | Bacteria | 1872 |
| 94 | Ga0070704_100183410 | 3300005549 | Unclassified | 1676 |
| 95 | Ga0070704_100734446 | 3300005549 | Bacteria | 878 |
| 96 | Ga0070704_101318654 | 3300005549 | Bacteria | 661 |
| 97 | Ga0068855_100061202 | 3300005563 | Bacteria | 4399 |
| 98 | Ga0068855_100098043 | 3300005563 | Bacteria | 3377 |
| 99 | Ga0068855_101738741 | 3300005563 | Bacteria | 635 |
| 100 | Ga0068855_102444042 | 3300005563 | Bacteria | 521 |
| 101 | Ga0070664_100543689 | 3300005564 | Bacteria | 1074 |
| 102 | Ga0070664_101250032 | 3300005564 | Bacteria | 701 |
| 103 | Ga0068857_100296553 | 3300005577 | Bacteria | 1490 |
| 104 | Ga0068857_100613235 | 3300005577 | Bacteria | 1029 |
| 105 | Ga0068854_100013805 | 3300005578 | Bacteria | 5312 |
| 106 | Ga0068854_100326368 | 3300005578 | Bacteria | 1249 |
| 107 | Ga0068856_100327523 | 3300005614 | Bacteria | 1549 |
| 108 | Ga0068856_101172463 | 3300005614 | Bacteria | 785 |
| 109 | Ga0068856_102612429 | 3300005614 | Bacteria | 511 |
| 110 | Ga0070702_100155529 | 3300005615 | Bacteria | 1472 |
| 111 | Ga0070702_100581033 | 3300005615 | Bacteria | 837 |
| 112 | Ga0068852_100409831 | 3300005616 | Bacteria | 1335 |
| 113 | Ga0068852_100633041 | 3300005616 | Bacteria | 1076 |
| 114 | Ga0068870_11216407 | 3300005840 | Bacteria | 546 |
| 115 | Ga0068863_101763371 | 3300005841 | Bacteria | 629 |
| 116 | Ga0068858_100611971 | 3300005842 | Bacteria | 1057 |
| 117 | Ga0068860_101817184 | 3300005843 | Bacteria | 631 |
| 118 | Ga0068862_101934557 | 3300005844 | Unclassified | 600 |
| 119 | Ga0081455_10046568 | 3300005937 | Bacteria | 3761 |
| 120 | Ga0081540_1035793 | 3300005983 | Bacteria | 2657 |
| 121 | Ga0070717_10005225 | 3300006028 | Bacteria | 9459 |
| 122 | Ga0070717_10020482 | 3300006028 | Bacteria | 5202 |
| 123 | Ga0070717_10084473 | 3300006028 | Bacteria | 2670 |
| 124 | Ga0070717_10150694 | 3300006028 | Bacteria | 2012 |
| 125 | Ga0070717_10211844 | 3300006028 | Bacteria | 1700 |
| 126 | Ga0070717_10378870 | 3300006028 | Bacteria | 1268 |
| 127 | Ga0070717_11243026 | 3300006028 | Bacteria | 677 |
| 128 | Ga0070715_10000893 | 3300006163 | Bacteria | 8278 |
| 129 | Ga0070715_10786767 | 3300006163 | Bacteria | 576 |
| 130 | Ga0070716_100008868 | 3300006173 | Bacteria | 4998 |
| 131 | Ga0070716_100730163 | 3300006173 | Bacteria | 760 |
| 132 | Ga0070712_100003456 | 3300006175 | Bacteria | 9722 |
| 133 | Ga0070712_100068085 | 3300006175 | Bacteria | 2535 |
| 134 | Ga0070712_100192884 | 3300006175 | Bacteria | 1595 |
| 135 | Ga0070712_100454356 | 3300006175 | Bacteria | 1067 |
| 136 | Ga0070712_100616260 | 3300006175 | Bacteria | 920 |
| 137 | Ga0070712_101047826 | 3300006175 | Bacteria | 707 |
| 138 | Ga0070712_101180159 | 3300006175 | Bacteria | 666 |
| 139 | Ga0070712_102052888 | 3300006175 | Bacteria | 501 |
| 140 | Ga0075431_100127463 | 3300006847 | Bacteria | 2626 |
| 141 | Ga0075433_10104753 | 3300006852 | Bacteria | 2506 |
| 142 | Ga0075433_10126139 | 3300006852 | Bacteria | 2273 |
| 143 | Ga0075434_100006610 | 3300006871 | Bacteria | 10635 |
| 144 | Ga0075434_100021350 | 3300006871 | Bacteria | 6292 |
| 145 | Ga0068865_100101743 | 3300006881 | Bacteria | 2105 |
| 146 | Ga0075436_100044758 | 3300006914 | Bacteria | 3053 |
| 147 | Ga0075436_100736436 | 3300006914 | Bacteria | 732 |
| 148 | Ga0075435_100001263 | 3300007076 | Bacteria | 16223 |
| 149 | Ga0105240_10023634 | 3300009093 | Bacteria | 8119 |
| 150 | Ga0105240_10313772 | 3300009093 | Bacteria | 1789 |
| 151 | Ga0105240_11840776 | 3300009093 | Bacteria | 630 |
| 152 | Ga0111539_10788722 | 3300009094 | Bacteria | 1106 |
| 153 | Ga0105245_10110725 | 3300009098 | Bacteria | 2553 |
| 154 | Ga0105245_10172224 | 3300009098 | Bacteria | 2062 |
| 155 | Ga0105243_12532291 | 3300009148 | Bacteria | 552 |
| 156 | Ga0105242_10135334 | 3300009176 | Bacteria | 2132 |
| 157 | Ga0105242_10455908 | 3300009176 | Bacteria | 1206 |
| 158 | Ga0105248_10386445 | 3300009177 | Bacteria | 1576 |
| 159 | Ga0105248_10507893 | 3300009177 | Bacteria | 1359 |
| 160 | Ga0105238_10275172 | 3300009551 | Bacteria | 1664 |
| 161 | Ga0105249_10903624 | 3300009553 | Bacteria | 950 |
| 162 | Ga0105239_10174198 | 3300010375 | Bacteria | 2407 |
| 163 | Ga0157371_10026289 | 3300013102 | Bacteria | 4233 |
| 164 | Ga0157370_10042944 | 3300013104 | Bacteria | 4353 |
| 165 | Ga0157370_10915366 | 3300013104 | Bacteria | 795 |
| 166 | Ga0157369_10006178 | 3300013105 | Bacteria | 13900 |
| 167 | Ga0157369_10179693 | 3300013105 | Bacteria | 2227 |
| 168 | Ga0157374_10057906 | 3300013296 | Bacteria | 3620 |
| 169 | Ga0157374_10757344 | 3300013296 | Bacteria | 986 |
| 170 | Ga0157378_11531706 | 3300013297 | Bacteria | 712 |
| 171 | Ga0157378_11910136 | 3300013297 | Bacteria | 643 |
| 172 | Ga0163162_10257618 | 3300013306 | Bacteria | 1876 |
| 173 | Ga0157372_10170664 | 3300013307 | Bacteria | 2517 |
| 174 | Ga0157372_13149981 | 3300013307 | Bacteria | 526 |
| 175 | Ga0157375_13430425 | 3300013308 | Bacteria | 528 |
| 176 | Ga0163163_10470934 | 3300014325 | Bacteria | 1317 |
| 177 | Ga0163163_11008345 | 3300014325 | Bacteria | 896 |
| 178 | Ga0157380_12536145 | 3300014326 | Bacteria | 579 |
| 179 | Ga0182008_10074757 | 3300014497 | Bacteria | 1667 |
| 180 | Ga0182008_10081404 | 3300014497 | Bacteria | 1594 |
| 181 | Ga0182008_10944699 | 3300014497 | Bacteria | 510 |
| 182 | Ga0157377_10229310 | 3300014745 | Bacteria | 1193 |
| 183 | Ga0157377_10372879 | 3300014745 | Bacteria | 964 |
| 184 | Ga0157376_12250118 | 3300014969 | Bacteria | 584 |
| 185 | Ga0197907_10459506 | 3300020069 | Bacteria | 731 |
| 186 | Ga0206356_10876089 | 3300020070 | Bacteria | 1038 |
| 187 | Ga0206356_11576920 | 3300020070 | Bacteria | 1945 |
| 188 | Ga0206354_11590312 | 3300020081 | Bacteria | 879 |
| 189 | Ga0206353_11039148 | 3300020082 | Bacteria | 576 |
| 190 | Ga0207682_10606208 | 3300025893 | Bacteria | 516 |
| 191 | Ga0207692_10004842 | 3300025898 | Bacteria | 5357 |
| 192 | Ga0207692_10018561 | 3300025898 | Bacteria | 3125 |
| 193 | Ga0207688_10640899 | 3300025901 | Bacteria | 671 |
| 194 | Ga0207685_10084501 | 3300025905 | Bacteria | 1322 |
| 195 | Ga0207699_10158500 | 3300025906 | Bacteria | 1504 |
| 196 | Ga0207699_10182698 | 3300025906 | Bacteria | 1411 |
| 197 | Ga0207645_10286511 | 3300025907 | Bacteria | 1095 |
| 198 | Ga0207705_10223705 | 3300025909 | Bacteria | 1430 |
| 199 | Ga0207684_10161687 | 3300025910 | Bacteria | 1928 |
| 200 | Ga0207684_10458193 | 3300025910 | Bacteria | 1095 |
| 201 | Ga0207684_10765961 | 3300025910 | Unclassified | 817 |
| 202 | Ga0207707_10074281 | 3300025912 | Bacteria | 2965 |
| 203 | Ga0207707_10111211 | 3300025912 | Unclassified | 2395 |
| 204 | Ga0207695_10406424 | 3300025913 | Bacteria | 1246 |
| 205 | Ga0207695_10716717 | 3300025913 | Bacteria | 881 |
| 206 | Ga0207695_10768531 | 3300025913 | Bacteria | 844 |
| 207 | Ga0207693_10000282 | 3300025915 | Bacteria | 47278 |
| 208 | Ga0207693_10021691 | 3300025915 | Bacteria | 5105 |
| 209 | Ga0207693_10046432 | 3300025915 | Bacteria | 3411 |
| 210 | Ga0207693_10663327 | 3300025915 | Bacteria | 810 |
| 211 | Ga0207693_10760208 | 3300025915 | Bacteria | 748 |
| 212 | Ga0207663_10001508 | 3300025916 | Bacteria | 10873 |
| 213 | Ga0207663_10127032 | 3300025916 | Bacteria | 1756 |
| 214 | Ga0207663_10380196 | 3300025916 | Bacteria | 1076 |
| 215 | Ga0207660_10046075 | 3300025917 | Bacteria | 3076 |
| 216 | Ga0207660_10246273 | 3300025917 | Bacteria | 1410 |
| 217 | Ga0207660_10285333 | 3300025917 | Bacteria | 1311 |
| 218 | Ga0207660_10510611 | 3300025917 | Bacteria | 976 |
| 219 | Ga0207662_10144700 | 3300025918 | Bacteria | 1508 |
| 220 | Ga0207657_10045730 | 3300025919 | Bacteria | 3839 |
| 221 | Ga0207657_10095584 | 3300025919 | Bacteria | 2472 |
| 222 | Ga0207652_10016535 | 3300025921 | Bacteria | 6025 |
| 223 | Ga0207652_10250477 | 3300025921 | Bacteria | 1597 |
| 224 | Ga0207652_10570038 | 3300025921 | Bacteria | 1017 |
| 225 | Ga0207652_10959836 | 3300025921 | Bacteria | 753 |
| 226 | Ga0207646_10001031 | 3300025922 | Bacteria | 35603 |
| 227 | Ga0207646_10265588 | 3300025922 | Unclassified | 1551 |
| 228 | Ga0207646_10625563 | 3300025922 | Bacteria | 965 |
| 229 | Ga0207646_11112918 | 3300025922 | Bacteria | 695 |
| 230 | Ga0207681_11188303 | 3300025923 | Bacteria | 641 |
| 231 | Ga0207659_10138843 | 3300025926 | Bacteria | 1884 |
| 232 | Ga0207687_10043708 | 3300025927 | Bacteria | 3088 |
| 233 | Ga0207687_10181346 | 3300025927 | Bacteria | 1632 |
| 234 | Ga0207700_10024533 | 3300025928 | Bacteria | 4175 |
| 235 | Ga0207700_10030363 | 3300025928 | Bacteria | 3827 |
| 236 | Ga0207700_10080967 | 3300025928 | Bacteria | 2534 |
| 237 | Ga0207700_10596111 | 3300025928 | Bacteria | 983 |
| 238 | Ga0207700_11580641 | 3300025928 | Bacteria | 581 |
| 239 | Ga0207664_10002945 | 3300025929 | Bacteria | 11314 |
| 240 | Ga0207664_10004602 | 3300025929 | Bacteria | 9348 |
| 241 | Ga0207664_10012732 | 3300025929 | Bacteria | 6021 |
| 242 | Ga0207664_10048183 | 3300025929 | Bacteria | 3350 |
| 243 | Ga0207664_10081819 | 3300025929 | Bacteria | 2629 |
| 244 | Ga0207664_10131576 | 3300025929 | Bacteria | 2106 |
| 245 | Ga0207664_10182329 | 3300025929 | Bacteria | 1803 |
| 246 | Ga0207664_10286928 | 3300025929 | Bacteria | 1445 |
| 247 | Ga0207664_10426553 | 3300025929 | Bacteria | 1182 |
| 248 | Ga0207664_10724648 | 3300025929 | Bacteria | 894 |
| 249 | Ga0207664_11260560 | 3300025929 | Bacteria | 658 |
| 250 | Ga0207644_10368904 | 3300025931 | Bacteria | 1169 |
| 251 | Ga0207690_11110052 | 3300025932 | Bacteria | 659 |
| 252 | Ga0207669_10311507 | 3300025937 | Bacteria | 1201 |
| 253 | Ga0207669_11611189 | 3300025937 | Bacteria | 554 |
| 254 | Ga0207704_10111764 | 3300025938 | Bacteria | 1849 |
| 255 | Ga0207704_10456030 | 3300025938 | Bacteria | 1021 |
| 256 | Ga0207665_10000835 | 3300025939 | Bacteria | 20809 |
| 257 | Ga0207665_10406962 | 3300025939 | Bacteria | 1037 |
| 258 | Ga0207665_10427578 | 3300025939 | Bacteria | 1013 |
| 259 | Ga0207691_10617334 | 3300025940 | Bacteria | 917 |
| 260 | Ga0207691_11052203 | 3300025940 | Bacteria | 678 |
| 261 | Ga0207661_11102518 | 3300025944 | Bacteria | 731 |
| 262 | Ga0207661_11400189 | 3300025944 | Bacteria | 642 |
| 263 | Ga0207679_10130466 | 3300025945 | Bacteria | 2015 |
| 264 | Ga0207679_11908600 | 3300025945 | Bacteria | 542 |
| 265 | Ga0207667_10318436 | 3300025949 | Bacteria | 1588 |
| 266 | Ga0207640_10072757 | 3300025981 | Bacteria | 2320 |
| 267 | Ga0207640_10412556 | 3300025981 | Bacteria | 1103 |
| 268 | Ga0207677_10520633 | 3300026023 | Bacteria | 1031 |
| 269 | Ga0207703_10510275 | 3300026035 | Bacteria | 1130 |
| 270 | Ga0207708_10135907 | 3300026075 | Bacteria | 1925 |
| 271 | Ga0207702_10270949 | 3300026078 | Bacteria | 1601 |
| 272 | Ga0207641_10193817 | 3300026088 | Bacteria | 1869 |
| 273 | Ga0207648_10201714 | 3300026089 | Bacteria | 1764 |
| 274 | Ga0207648_10237624 | 3300026089 | Bacteria | 1622 |
| 275 | Ga0207683_10235259 | 3300026121 | Bacteria | 1671 |
| 276 | Ga0207683_10430470 | 3300026121 | Bacteria | 1216 |
| 277 | Ga0207683_11379995 | 3300026121 | Bacteria | 652 |
| 278 | Ga0207698_11160138 | 3300026142 | Bacteria | 786 |
| 279 | Ga0265337_1136030 | 3300028556 | Bacteria | 666 |
| 280 | Ga0265319_1001269 | 3300028563 | Bacteria | 15335 |
| 281 | Ga0265319_1065699 | 3300028563 | Bacteria | 1169 |
| 282 | Ga0265334_10013784 | 3300028573 | Bacteria | 3378 |
| 283 | Ga0265318_10006167 | 3300028577 | Bacteria | 5547 |
| 284 | Ga0265323_10244707 | 3300028653 | Bacteria | 559 |
| 285 | Ga0265322_10201671 | 3300028654 | Bacteria | 569 |
| 286 | Ga0265336_10042885 | 3300028666 | Bacteria | 1380 |
| 287 | Ga0265336_10084473 | 3300028666 | Unclassified | 947 |
| 288 | Ga0265336_10137190 | 3300028666 | Bacteria | 728 |
| 289 | Ga0265336_10177989 | 3300028666 | Bacteria | 632 |
| 290 | Ga0265336_10209967 | 3300028666 | Bacteria | 578 |
| 291 | Ga0265338_10000924 | 3300028800 | Bacteria | 49511 |
| 292 | Ga0265338_10003221 | 3300028800 | Bacteria | 23276 |
| 293 | Ga0265338_10011362 | 3300028800 | Bacteria | 10293 |
| 294 | Ga0265338_10012864 | 3300028800 | Bacteria | 9509 |
| 295 | Ga0265338_10240641 | 3300028800 | Bacteria | 1340 |
| 296 | Ga0265338_10919566 | 3300028800 | Bacteria | 595 |
| 297 | Ga0265330_10042497 | 3300031235 | Bacteria | 2014 |
| 298 | Ga0265330_10056685 | 3300031235 | Bacteria | 1710 |
| 299 | Ga0265332_10133855 | 3300031238 | Bacteria | 1039 |
| 300 | Ga0265320_10104895 | 3300031240 | Bacteria | 1299 |
| 301 | Ga0265325_10031289 | 3300031241 | Bacteria | 2849 |
| 302 | Ga0265325_10176108 | 3300031241 | Bacteria | 998 |
| 303 | Ga0265329_10048042 | 3300031242 | Bacteria | 1361 |
| 304 | Ga0265340_10056948 | 3300031247 | Bacteria | 1879 |
| 305 | Ga0265339_10004365 | 3300031249 | Bacteria | 9652 |
| 306 | Ga0265339_10176138 | 3300031249 | Bacteria | 1068 |
| 307 | Ga0265331_10023246 | 3300031250 | Bacteria | 3152 |
| 308 | Ga0265327_10030936 | 3300031251 | Bacteria | 3015 |
| 309 | Ga0265327_10058530 | 3300031251 | Bacteria | 1977 |
| 310 | Ga0265327_10074296 | 3300031251 | Bacteria | 1694 |
| 311 | Ga0265327_10094416 | 3300031251 | Bacteria | 1454 |
| 312 | Ga0265316_10005504 | 3300031344 | Bacteria | 12296 |
| 313 | Ga0265316_10011484 | 3300031344 | Bacteria | 7982 |
| 314 | Ga0307408_100797247 | 3300031548 | Bacteria | 857 |
| 315 | Ga0265313_10007349 | 3300031595 | Bacteria | 7549 |
| 316 | Ga0265313_10026510 | 3300031595 | Bacteria | 3051 |
| 317 | Ga0265314_10012767 | 3300031711 | Bacteria | 6828 |
| 318 | Ga0265342_10010010 | 3300031712 | Bacteria | 6621 |
| 319 | Ga0265342_10062322 | 3300031712 | Bacteria | 2195 |
| 320 | Ga0265342_10569274 | 3300031712 | Unclassified | 573 |
| 321 | Ga0307405_11586241 | 3300031731 | Unclassified | 577 |
| 322 | Ga0307410_10241218 | 3300031852 | Bacteria | 1401 |
| 323 | Ga0307407_10507161 | 3300031903 | Bacteria | 885 |
| 324 | Ga0307409_100021014 | 3300031995 | Bacteria | 4465 |
| 325 | Ga0307409_101129495 | 3300031995 | Bacteria | 805 |
| 326 | Ga0307409_101299490 | 3300031995 | Unclassified | 752 |
| 327 | Ga0307409_102317473 | 3300031995 | Bacteria | 566 |
| 328 | Ga0307416_100016168 | 3300032002 | Bacteria | 5177 |
| 329 | Ga0307416_101264691 | 3300032002 | Bacteria | 844 |
| 330 | Ga0307416_102249186 | 3300032002 | Bacteria | 646 |
| 331 | Ga0307416_102927818 | 3300032002 | Bacteria | 571 |
| 332 | Ga0307415_100290937 | 3300032126 | Unclassified | 1348 |
| 333 | Ga0307415_100552196 | 3300032126 | Bacteria | 1017 |
| 334 | Ga0373940_0197945 | 3300035088 | Bacteria | 659 |
| 335 | Ga0373944_0091754 | 3300035089 | Bacteria | 1016 |
| 336 | Ga0373951_0019725 | 3300035091 | Bacteria | 1539 |
| 337 | Ga0373932_0036578 | 3300035112 | Bacteria | 1395 |
| 338 | Ga0373936_0039423 | 3300035113 | Bacteria | 1890 |
| 339 | Ga0373936_0119945 | 3300035113 | Bacteria | 1123 |
| 340 | Ga0373941_0364333 | 3300035115 | Bacteria | 591 |
| 341 | Ga0373945_0015762 | 3300035116 | Bacteria | 2546 |
| 342 | Ga0373954_0190554 | 3300035118 | Bacteria | 1007 |
| 343 | Ga0373956_0058646 | 3300035119 | Bacteria | 1741 |
| 344 | Ga0373957_0047110 | 3300035120 | Bacteria | 1639 |
| 345 | Ga0373943_0001644 | 3300035170 | Bacteria | 10143 |
| 346 | Ga0373946_0050185 | 3300035171 | Bacteria | 1742 |
| 347 | Ga0373955_0176420 | 3300035172 | Bacteria | 1267 |
| 348 | Ga0373955_0391556 | 3300035172 | Bacteria | 844 |
| 349 | Ga0373942_0080207 | 3300035207 | Bacteria | 968 |
| 350 | Ga0373942_0108539 | 3300035207 | Bacteria | 856 |
| 351 | Ga0373962_0093235 | 3300035242 | Bacteria | 930 |
| 352 | Ga0373924_0035860 | 3300035410 | Bacteria | 2013 |
| 353 | Ga0373924_0074048 | 3300035410 | Bacteria | 1440 |
| 354 | Ga0373935_0149606 | 3300035692 | Bacteria | 1583 |
| 355 | Ga0373935_0367801 | 3300035692 | Bacteria | 1028 |
| 356 | Ga0373927_0013531 | 3300035695 | Bacteria | 5420 |
| 357 | Ga0373947_0000371 | 3300035725 | Bacteria | 25349 |
| 358 | Ga0373947_0351662 | 3300035725 | Bacteria | 989 |
| 359 | Ga0373937_0147973 | 3300036401 | Bacteria | 2199 |
| 360 | Ga0373937_0863286 | 3300036401 | Bacteria | 853 |
| 361 | Ga0373937_1199671 | 3300036401 | Bacteria | 707 |
| 362 | Ga0373925_0001462 | 3300037068 | Bacteria | 20386 |
| 363 | Ga0395899_0978590 | 3300037312 | Unclassified | 511 |
| 364 | Ga0395900_0002559 | 3300037418 | Bacteria | 19942 |
| 365 | Ga0395900_0169269 | 3300037418 | Bacteria | 2225 |
| 366 | Ga0395900_0228011 | 3300037418 | Bacteria | 1875 |
| 367 | Ga0395900_1768922 | 3300037418 | Bacteria | 529 |
| 368 | Ga0395898_0069532 | 3300037466 | Bacteria | 3406 |
| 369 | Ga0395898_0719082 | 3300037466 | Bacteria | 940 |
| 370 | Ga0395898_0961852 | 3300037466 | Bacteria | 791 |
| 371 | Ga0395905_0012299 | 3300037471 | Bacteria | 8239 |
| 372 | Ga0395905_0101994 | 3300037471 | Bacteria | 2694 |
| 373 | Ga0395905_0619471 | 3300037471 | Bacteria | 984 |
| 374 | Ga0395905_1854176 | 3300037471 | Unclassified | 509 |
| 375 | Ga0395901_0006074 | 3300038443 | Bacteria | 12239 |
| 376 | Ga0395901_0058232 | 3300038443 | Bacteria | 4019 |
| 377 | Ga0395901_1604991 | 3300038443 | Bacteria | 604 |
| 378 | Ga0395901_2044601 | 3300038443 | Bacteria | 519 |
| 379 | Ga0436365_1612270 | 3300039437 | Bacteria | 701 |
| 380 | Ga0439439_0166075 | 3300041406 | Bacteria | 631 |
| 381 | Ga0451789_0555230 | 3300041443 | Bacteria | 643 |
| 382 | Ga0451853_0111819 | 3300041512 | Bacteria | 571 |
| 383 | Ga0439431_0065144 | 3300041997 | Bacteria | 964 |
| 384 | Ga0439431_0224332 | 3300041997 | Bacteria | 552 |
| 385 | Ga0439445_0006771 | 3300042004 | Bacteria | 2641 |
| 386 | Ga0439452_066628 | 3300042010 | Bacteria | 799 |
| 387 | Ga0450920_008453 | 3300042122 | Bacteria | 1881 |
| 388 | Ga0450910_049446 | 3300042147 | Bacteria | 693 |
| 389 | Ga0439446_0001436 | 3300042156 | Bacteria | 5424 |
| 390 | Ga0439434_0048921 | 3300042435 | Bacteria | 1308 |
| 391 | Ga0439459_0068308 | 3300042438 | Bacteria | 817 |
| 392 | Ga0450918_024451 | 3300042531 | Bacteria | 1057 |
| 393 | Ga0466969_0018054 | 3300044656 | Bacteria | 3680 |
| 394 | Ga0466969_0041963 | 3300044656 | Bacteria | 2286 |
| 395 | Ga0466969_0127422 | 3300044656 | Bacteria | 1182 |
| 396 | Ga0466965_0010523 | 3300044683 | Bacteria | 4321 |
| 397 | Ga0466965_0136059 | 3300044683 | Bacteria | 1277 |
| 398 | Ga0466965_0191699 | 3300044683 | Bacteria | 1081 |
| 399 | Ga0466966_0013680 | 3300044684 | Bacteria | 5369 |
| 400 | Ga0466966_0127606 | 3300044684 | Bacteria | 1559 |
| 401 | Ga0466961_0011516 | 3300044693 | Bacteria | 5656 |
| 402 | Ga0466961_0032038 | 3300044693 | Bacteria | 3378 |
| 403 | Ga0466961_0077789 | 3300044693 | Bacteria | 2101 |
| 404 | Ga0466961_0138795 | 3300044693 | Bacteria | 1523 |
| 405 | Ga0466961_0145964 | 3300044693 | Bacteria | 1479 |
| 406 | Ga0466963_0000102 | 3300044694 | Bacteria | 30465 |
| 407 | Ga0466963_0015728 | 3300044694 | Bacteria | 4694 |
| 408 | Ga0466963_0023100 | 3300044694 | Bacteria | 3943 |
| 409 | Ga0466963_0027378 | 3300044694 | Bacteria | 3649 |
| 410 | Ga0466963_0030190 | 3300044694 | Bacteria | 3495 |
| 411 | Ga0466963_0046479 | 3300044694 | Bacteria | 2862 |
| 412 | Ga0466963_0074171 | 3300044694 | Bacteria | 2294 |
| 413 | Ga0466963_0075936 | 3300044694 | Bacteria | 2268 |
| 414 | Ga0466963_0250256 | 3300044694 | Bacteria | 1243 |
| 415 | Ga0466963_0313057 | 3300044694 | Bacteria | 1105 |
| 416 | Ga0466963_0323514 | 3300044694 | Bacteria | 1085 |
| 417 | Ga0466963_0372260 | 3300044694 | Bacteria | 1007 |
| 418 | Ga0466963_0601450 | 3300044694 | Bacteria | 777 |
| 419 | Ga0466963_1101755 | 3300044694 | Bacteria | 558 |
| 420 | Ga0466964_0030092 | 3300044706 | Bacteria | 2147 |
| 421 | Ga0466964_0048698 | 3300044706 | Bacteria | 1733 |
| 422 | Ga0466964_0106867 | 3300044706 | Bacteria | 1242 |
| 423 | Ga0466964_0515229 | 3300044706 | Bacteria | 644 |
| 424 | Ga0453684_1408560 | 3300044712 | Bacteria | 723 |
| 425 | Ga0466971_0003709 | 3300044719 | Bacteria | 6533 |
| 426 | Ga0466971_0012690 | 3300044719 | Bacteria | 3695 |
| 427 | Ga0466971_0016144 | 3300044719 | Bacteria | 3289 |
| 428 | Ga0466971_0050393 | 3300044719 | Bacteria | 1873 |
| 429 | Ga0466971_0064097 | 3300044719 | Bacteria | 1664 |
| 430 | Ga0466971_0140820 | 3300044719 | Bacteria | 1123 |
| 431 | Ga0466971_0595801 | 3300044719 | Bacteria | 551 |
| 432 | Ga0466968_0004990 | 3300044735 | Bacteria | 4972 |
| 433 | Ga0466968_0010554 | 3300044735 | Bacteria | 3584 |
| 434 | Ga0466968_0017320 | 3300044735 | Bacteria | 2878 |
| 435 | Ga0466968_0024768 | 3300044735 | Bacteria | 2454 |
| 436 | Ga0466968_0123827 | 3300044735 | Bacteria | 1172 |
| 437 | Ga0466968_0184601 | 3300044735 | Bacteria | 971 |
| 438 | Ga0466968_0285452 | 3300044735 | Bacteria | 791 |
| 439 | Ga0466968_0389761 | 3300044735 | Bacteria | 682 |
| 440 | Ga0466970_0009945 | 3300044765 | Bacteria | 4816 |
| 441 | Ga0466970_0223381 | 3300044765 | Bacteria | 1051 |
| 442 | Ga0466957_0006707 | 3300044842 | Bacteria | 6509 |
| 443 | Ga0466957_0010804 | 3300044842 | Bacteria | 5250 |
| 444 | Ga0466957_0054289 | 3300044842 | Bacteria | 2445 |
| 445 | Ga0466957_0074998 | 3300044842 | Bacteria | 2098 |
| 446 | Ga0466957_0101005 | 3300044842 | Bacteria | 1818 |
| 447 | Ga0466957_0506281 | 3300044842 | Bacteria | 838 |
| 448 | Ga0466957_0705185 | 3300044842 | Bacteria | 712 |
| 449 | Ga0466960_0041161 | 3300044901 | Bacteria | 2188 |
| 450 | Ga0466960_0109198 | 3300044901 | Bacteria | 1435 |
| 451 | Ga0466960_0117468 | 3300044901 | Bacteria | 1389 |
| 452 | Ga0466959_0026170 | 3300045049 | Bacteria | 4325 |
| 453 | Ga0466959_0041359 | 3300045049 | Bacteria | 3402 |
| 454 | Ga0466959_0069344 | 3300045049 | Bacteria | 2554 |
| 455 | Ga0466959_0133402 | 3300045049 | Bacteria | 1759 |
| 456 | Ga0466959_0153456 | 3300045049 | Bacteria | 1622 |
| 457 | Ga0466959_0280125 | 3300045049 | Bacteria | 1144 |
| 458 | Ga0466959_0676018 | 3300045049 | Bacteria | 692 |
| 459 | Ga0466958_0002621 | 3300045836 | Bacteria | 9096 |
| 460 | Ga0466958_0005793 | 3300045836 | Bacteria | 6681 |
| 461 | Ga0466958_0015119 | 3300045836 | Bacteria | 4416 |
| 462 | Ga0466958_0035631 | 3300045836 | Bacteria | 2973 |
| 463 | Ga0466958_0057045 | 3300045836 | Bacteria | 2373 |
| 464 | Ga0466958_0072066 | 3300045836 | Bacteria | 2115 |
| 465 | Ga0466958_0140083 | 3300045836 | Bacteria | 1522 |
| 466 | Ga0466958_0158289 | 3300045836 | Bacteria | 1430 |
| 467 | Ga0466958_0399834 | 3300045836 | Bacteria | 887 |
| 468 | Ga0466958_0793636 | 3300045836 | Bacteria | 617 |
| 469 | Ga0466958_1025071 | 3300045836 | Bacteria | 538 |
| 470 | Ga0466967_0000094 | 3300045976 | Bacteria | 31562 |
| 471 | Ga0466967_0010173 | 3300045976 | Bacteria | 7036 |
| 472 | Ga0466967_0016470 | 3300045976 | Bacteria | 5831 |
| 473 | Ga0466967_0043805 | 3300045976 | Bacteria | 3877 |
| 474 | Ga0466967_0051504 | 3300045976 | Bacteria | 3608 |
| 475 | Ga0466967_0064843 | 3300045976 | Bacteria | 3250 |
| 476 | Ga0466967_0067412 | 3300045976 | Bacteria | 3192 |
| 477 | Ga0466967_0089740 | 3300045976 | Bacteria | 2791 |
| 478 | Ga0466967_0092079 | 3300045976 | Bacteria | 2756 |
| 479 | Ga0466967_0104896 | 3300045976 | Bacteria | 2589 |
| 480 | Ga0466967_0110568 | 3300045976 | Bacteria | 2524 |
| 481 | Ga0466967_0139312 | 3300045976 | Bacteria | 2258 |
| 482 | Ga0466967_0162347 | 3300045976 | Bacteria | 2098 |
| 483 | Ga0466967_0289074 | 3300045976 | Bacteria | 1574 |
| 484 | Ga0466967_0325482 | 3300045976 | Bacteria | 1483 |
| 485 | Ga0466967_0509718 | 3300045976 | Bacteria | 1181 |
| 486 | Ga0466967_0585883 | 3300045976 | Bacteria | 1100 |
| 487 | Ga0466967_0984547 | 3300045976 | Bacteria | 839 |
| 488 | Ga0466967_1035656 | 3300045976 | Bacteria | 817 |
| 489 | Ga0466967_1412900 | 3300045976 | Bacteria | 693 |
| 490 | Ga0466967_2135624 | 3300045976 | Bacteria | 556 |
| 491 | Ga0466967_2316644 | 3300045976 | Unclassified | 532 |
| 492 | Ga0495592_0082399 | 3300046454 | Bacteria | 2325 |
| 493 | Ga0495592_0564014 | 3300046454 | Bacteria | 698 |
| 494 | Ga0495603_0028096 | 3300046455 | Bacteria | 3393 |
| 495 | Ga0495603_0655433 | 3300046455 | Bacteria | 601 |
| 496 | Ga0495629_0006635 | 3300046459 | Bacteria | 8564 |
| 497 | Ga0495629_0012289 | 3300046459 | Bacteria | 6200 |
| 498 | Ga0495629_0470999 | 3300046459 | Bacteria | 849 |
| 499 | Ga0495629_0489724 | 3300046459 | Bacteria | 830 |
| 500 | Ga0495629_0840612 | 3300046459 | Bacteria | 604 |
| 501 | Ga0495629_0856575 | 3300046459 | Bacteria | 597 |
| 502 | Ga0495641_0003825 | 3300046461 | Bacteria | 10999 |
| 503 | Ga0495641_0017282 | 3300046461 | Bacteria | 3763 |
| 504 | Ga0495641_0114797 | 3300046461 | Bacteria | 1201 |
| 505 | Ga0495651_0060816 | 3300046462 | Bacteria | 2892 |
| 506 | Ga0495653_0061685 | 3300046463 | Bacteria | 2836 |
| 507 | Ga0495653_0071013 | 3300046463 | Bacteria | 2604 |
| 508 | Ga0495653_0073098 | 3300046463 | Bacteria | 2559 |
| 509 | Ga0495653_0119924 | 3300046463 | Bacteria | 1876 |
| 510 | Ga0495653_0290309 | 3300046463 | Bacteria | 1070 |
| 511 | Ga0495580_0004702 | 3300046472 | Bacteria | 11446 |
| 512 | Ga0495582_0003743 | 3300046473 | Bacteria | 8570 |
| 513 | Ga0495582_0649370 | 3300046473 | Bacteria | 610 |
| 514 | Ga0495605_0281319 | 3300046474 | Bacteria | 707 |
| 515 | Ga0495639_0000481 | 3300046475 | Bacteria | 19003 |
| 516 | Ga0495662_0072960 | 3300046476 | Bacteria | 1664 |
| 517 | Ga0495662_0110954 | 3300046476 | Bacteria | 1344 |
| 518 | Ga0495662_0264764 | 3300046476 | Bacteria | 846 |
| 519 | Ga0495664_0005759 | 3300046477 | Bacteria | 6821 |
| 520 | Ga0495664_0054483 | 3300046477 | Bacteria | 2378 |
| 521 | Ga0495584_0380686 | 3300046491 | Bacteria | 717 |
| 522 | Ga0495585_0255678 | 3300046492 | Bacteria | 873 |
| 523 | Ga0495594_0568668 | 3300046499 | Bacteria | 643 |
| 524 | Ga0495608_0049046 | 3300046511 | Bacteria | 2804 |
| 525 | Ga0495608_0061490 | 3300046511 | Bacteria | 2469 |
| 526 | Ga0495608_0841917 | 3300046511 | Bacteria | 539 |
| 527 | Ga0495608_0847671 | 3300046511 | Bacteria | 537 |
| 528 | Ga0495616_0087231 | 3300046513 | Bacteria | 1483 |
| 529 | Ga0495618_0002744 | 3300046514 | Bacteria | 11198 |
| 530 | Ga0495618_0062192 | 3300046514 | Bacteria | 2368 |
| 531 | Ga0495618_0499746 | 3300046514 | Bacteria | 733 |
| 532 | Ga0495618_0872930 | 3300046514 | Bacteria | 520 |
| 533 | Ga0495628_0249297 | 3300046516 | Bacteria | 1326 |
| 534 | Ga0495630_0000995 | 3300046517 | Bacteria | 19714 |
| 535 | Ga0495630_0015140 | 3300046517 | Bacteria | 5628 |
| 536 | Ga0495630_1153820 | 3300046517 | Bacteria | 586 |
| 537 | Ga0495630_1201637 | 3300046517 | Bacteria | 573 |
| 538 | Ga0495631_0117512 | 3300046518 | Bacteria | 1143 |
| 539 | Ga0495644_0170002 | 3300046523 | Unclassified | 837 |
| 540 | Ga0495666_0000549 | 3300046526 | Bacteria | 16728 |
| 541 | Ga0495652_0032149 | 3300046529 | Bacteria | 4590 |
| 542 | Ga0495652_0054710 | 3300046529 | Bacteria | 3397 |
| 543 | Ga0495652_0394093 | 3300046529 | Bacteria | 982 |
| 544 | Ga0495652_0498668 | 3300046529 | Bacteria | 844 |
| 545 | Ga0495652_0588896 | 3300046529 | Bacteria | 760 |
| 546 | Ga0495665_0001265 | 3300046531 | Bacteria | 13460 |
| 547 | Ga0495665_0289840 | 3300046531 | Bacteria | 839 |
| 548 | Ga0495640_0007169 | 3300046533 | Bacteria | 8779 |
| 549 | Ga0495640_0016482 | 3300046533 | Bacteria | 5527 |
| 550 | Ga0495640_0083890 | 3300046533 | Bacteria | 2114 |
| 551 | Ga0495640_0297697 | 3300046533 | Bacteria | 1002 |
| 552 | Ga0495586_0024820 | 3300046535 | Bacteria | 3205 |
| 553 | Ga0495586_0124465 | 3300046535 | Bacteria | 1441 |
| 554 | Ga0495586_0192319 | 3300046535 | Bacteria | 1156 |
| 555 | Ga0495587_0053676 | 3300046536 | Bacteria | 2376 |
| 556 | Ga0495598_0176672 | 3300046537 | Bacteria | 760 |
| 557 | Ga0495621_0303968 | 3300046539 | Bacteria | 662 |
| 558 | Ga0495645_0021825 | 3300046543 | Bacteria | 4628 |
| 559 | Ga0495645_0155854 | 3300046543 | Bacteria | 1582 |
| 560 | Ga0495667_0051461 | 3300046559 | Bacteria | 2717 |
| 561 | Ga0495667_0099341 | 3300046559 | Bacteria | 1884 |
| 562 | Ga0495656_0028346 | 3300046615 | Bacteria | 2246 |
| 563 | Ga0495656_0475186 | 3300046615 | Bacteria | 661 |
| 564 | Ga0495668_0568945 | 3300046616 | Unclassified | 626 |
| 565 | Ga0495634_0004671 | 3300046642 | Bacteria | 10657 |
| 566 | Ga0495634_0029685 | 3300046642 | Bacteria | 3784 |
| 567 | Ga0495634_0048737 | 3300046642 | Bacteria | 2851 |
| 568 | Ga0495634_0107029 | 3300046642 | Bacteria | 1801 |
| 569 | Ga0495634_0108820 | 3300046642 | Bacteria | 1784 |
| 570 | Ga0495634_0689012 | 3300046642 | Bacteria | 588 |
| 571 | Ga0495635_0021973 | 3300046663 | Bacteria | 4446 |
| 572 | Ga0495635_0045699 | 3300046663 | Bacteria | 3021 |
| 573 | Ga0495635_0300882 | 3300046663 | Bacteria | 1075 |
| 574 | Ga0495657_0044955 | 3300046675 | Bacteria | 2999 |
| 575 | Ga0495657_0214405 | 3300046675 | Bacteria | 1169 |
| 576 | Ga0495599_0041853 | 3300046678 | Bacteria | 2875 |
| 577 | Ga0495599_0071664 | 3300046678 | Bacteria | 2163 |
| 578 | Ga0495646_0071900 | 3300046680 | Bacteria | 2035 |
| 579 | Ga0495647_0000686 | 3300046681 | Bacteria | 10111 |
| 580 | Ga0495647_0247300 | 3300046681 | Bacteria | 793 |
| 581 | Ga0495647_0480350 | 3300046681 | Bacteria | 577 |
| 582 | Ga0495658_0047475 | 3300046683 | Bacteria | 2418 |
| 583 | Ga0495658_0305700 | 3300046683 | Bacteria | 1006 |
| 584 | Ga0495658_0545356 | 3300046683 | Bacteria | 742 |
| 585 | Ga0495658_0738341 | 3300046683 | Bacteria | 631 |
| 586 | Ga0495613_0009460 | 3300046689 | Bacteria | 7228 |
| 587 | Ga0495613_0032934 | 3300046689 | Bacteria | 3850 |
| 588 | Ga0495613_0198374 | 3300046689 | Bacteria | 1416 |
| 589 | Ga0495613_0364097 | 3300046689 | Bacteria | 991 |
| 590 | Ga0495613_0519008 | 3300046689 | Bacteria | 800 |
| 591 | Ga0495613_0655879 | 3300046689 | Bacteria | 694 |
| 592 | Ga0495624_0001215 | 3300046690 | Bacteria | 20309 |
| 593 | Ga0495624_0050021 | 3300046690 | Bacteria | 2649 |
| 594 | Ga0495624_0078118 | 3300046690 | Bacteria | 2053 |
| 595 | Ga0495624_0293961 | 3300046690 | Bacteria | 980 |
| 596 | Ga0495670_0197718 | 3300046691 | Bacteria | 1064 |
| 597 | Ga0495670_0658617 | 3300046691 | Unclassified | 571 |
| 598 | Ga0495670_0734647 | 3300046691 | Unclassified | 538 |
| 599 | Ga0495589_0039947 | 3300046794 | Bacteria | 2344 |
| 600 | Ga0495589_0132216 | 3300046794 | Bacteria | 1198 |
| 601 | Ga0495600_0107283 | 3300046809 | Bacteria | 1819 |
| 602 | Ga0495600_0222314 | 3300046809 | Bacteria | 1207 |
| 603 | Ga0495600_0267098 | 3300046809 | Bacteria | 1086 |
| 604 | Ga0495581_0002248 | 3300047315 | Bacteria | 10863 |
| 605 | Ga0495581_0017310 | 3300047315 | Bacteria | 4186 |
| 606 | Ga0495604_0072873 | 3300047317 | Bacteria | 2594 |
| 607 | Ga0495674_0025974 | 3300047319 | Bacteria | 5360 |
| 608 | Ga0495674_0032620 | 3300047319 | Bacteria | 4723 |
| 609 | Ga0495674_0184882 | 3300047319 | Bacteria | 1734 |
| 610 | Ga0495674_0459695 | 3300047319 | Bacteria | 1022 |
| 611 | Ga0495674_0492307 | 3300047319 | Bacteria | 981 |
| 612 | Ga0495676_0072273 | 3300047321 | Bacteria | 2649 |
| 613 | Ga0495676_0126366 | 3300047321 | Bacteria | 1853 |
| 614 | Ga0495676_0389243 | 3300047321 | Bacteria | 927 |
| 615 | Ga0495676_0402900 | 3300047321 | Bacteria | 907 |
| 616 | Ga0495676_0490146 | 3300047321 | Bacteria | 807 |
| 617 | Ga0495676_0498758 | 3300047321 | Bacteria | 799 |
| 618 | Ga0495680_0070217 | 3300047322 | Bacteria | 2671 |
| 619 | Ga0495680_0117888 | 3300047322 | Bacteria | 1962 |
| 620 | Ga0495680_0236349 | 3300047322 | Bacteria | 1299 |
| 621 | Ga0495680_0390600 | 3300047322 | Bacteria | 962 |
| 622 | Ga0495680_0473171 | 3300047322 | Bacteria | 854 |
| 623 | Ga0495680_0682122 | 3300047322 | Unclassified | 680 |
| 624 | Ga0495675_0348220 | 3300047444 | Bacteria | 872 |
| 625 | Ga0495677_0179731 | 3300047445 | Bacteria | 820 |
| 626 | Ga0495684_0010059 | 3300047471 | Bacteria | 7311 |
| 627 | Ga0495684_0050966 | 3300047471 | Bacteria | 3159 |
| 628 | Ga0495684_0145208 | 3300047471 | Bacteria | 1777 |
| 629 | Ga0495593_0002282 | 3300047673 | Bacteria | 11499 |
| 630 | Ga0495602_0219900 | 3300048088 | Bacteria | 1435 |
| 631 | Ga0495614_0003952 | 3300048089 | Bacteria | 6653 |
| 632 | Ga0495614_0315932 | 3300048089 | Bacteria | 724 |
| 633 | Ga0496100_0016429 | 3300048903 | Bacteria | 4347 |
| 634 | Ga0496100_0340167 | 3300048903 | Bacteria | 1131 |
| 635 | Ga0496100_0497071 | 3300048903 | Bacteria | 939 |
| 636 | Ga0496101_0009481 | 3300048904 | Bacteria | 6398 |
| 637 | Ga0496101_0145807 | 3300048904 | Bacteria | 1808 |
| 638 | Ga0496101_0379038 | 3300048904 | Bacteria | 1113 |
| 639 | Ga0496101_0789020 | 3300048904 | Bacteria | 749 |
| 640 | Ga0496102_0012440 | 3300048905 | Bacteria | 7363 |
| 641 | Ga0496102_1454403 | 3300048905 | Bacteria | 604 |
| 642 | Ga0496103_0019582 | 3300048906 | Bacteria | 4063 |
| 643 | Ga0496104_0013132 | 3300048907 | Bacteria | 7465 |
| 644 | Ga0496104_0081675 | 3300048907 | Bacteria | 3082 |
| 645 | Ga0496104_0093991 | 3300048907 | Bacteria | 2868 |
| 646 | Ga0496104_0187291 | 3300048907 | Bacteria | 1980 |
| 647 | Ga0496104_0424172 | 3300048907 | Bacteria | 1242 |
| 648 | Ga0496104_0766863 | 3300048907 | Bacteria | 871 |
| 649 | Ga0496105_0010628 | 3300048908 | Bacteria | 7241 |
| 650 | Ga0496105_0012369 | 3300048908 | Bacteria | 6756 |
| 651 | Ga0496105_0017229 | 3300048908 | Bacteria | 5787 |
| 652 | Ga0496106_0002999 | 3300048909 | Bacteria | 12571 |
| 653 | Ga0496106_1119451 | 3300048909 | Bacteria | 616 |
| 654 | Ga0496107_0008691 | 3300048910 | Bacteria | 7034 |
| 655 | Ga0496107_0187509 | 3300048910 | Bacteria | 1536 |
| 656 | Ga0496107_0269826 | 3300048910 | Bacteria | 1266 |
| 657 | Ga0496108_0010043 | 3300048911 | Bacteria | 7677 |
| 658 | Ga0496108_0018921 | 3300048911 | Bacteria | 5648 |
| 659 | Ga0496108_0035085 | 3300048911 | Bacteria | 4168 |
| 660 | Ga0496108_1753202 | 3300048911 | Bacteria | 510 |
| 661 | Ga0496109_0003892 | 3300048912 | Bacteria | 12470 |
| 662 | Ga0496109_0107010 | 3300048912 | Bacteria | 2597 |
| 663 | Ga0496109_0154733 | 3300048912 | Bacteria | 2147 |
| 664 | Ga0496109_0258433 | 3300048912 | Bacteria | 1640 |
| 665 | Ga0496109_0548119 | 3300048912 | Bacteria | 1091 |
| 666 | Ga0496109_1695441 | 3300048912 | Bacteria | 566 |
| 667 | Ga0496110_0027322 | 3300048913 | Bacteria | 4891 |
| 668 | Ga0496110_0735511 | 3300048913 | Bacteria | 889 |
| 669 | Ga0496111_0021897 | 3300048914 | Bacteria | 4468 |
| 670 | Ga0496111_0070787 | 3300048914 | Bacteria | 2538 |
| 671 | Ga0496112_0053955 | 3300048915 | Bacteria | 3949 |
| 672 | Ga0496112_0104963 | 3300048915 | Bacteria | 2795 |
| 673 | Ga0496112_0162644 | 3300048915 | Bacteria | 2198 |
| 674 | Ga0496112_0205839 | 3300048915 | Bacteria | 1926 |
| 675 | Ga0496112_0345750 | 3300048915 | Bacteria | 1430 |
| 676 | Ga0496112_0768020 | 3300048915 | Bacteria | 889 |
| 677 | Ga0496112_1568354 | 3300048915 | Bacteria | 572 |
| 678 | Ga0496113_0005587 | 3300048916 | Bacteria | 7860 |
| 679 | Ga0496113_0050546 | 3300048916 | Bacteria | 3100 |
| 680 | Ga0496113_0119163 | 3300048916 | Bacteria | 2062 |
| 681 | Ga0496114_0018197 | 3300048917 | Bacteria | 5677 |
| 682 | Ga0496114_0033298 | 3300048917 | Bacteria | 4245 |
| 683 | Ga0496114_0209586 | 3300048917 | Bacteria | 1709 |
| 684 | Ga0496114_0382599 | 3300048917 | Bacteria | 1246 |
| 685 | Ga0496114_0592070 | 3300048917 | Bacteria | 978 |
| 686 | Ga0496114_0969890 | 3300048917 | Bacteria | 733 |
| 687 | Ga0496115_0013970 | 3300048918 | Bacteria | 6077 |
| 688 | Ga0496115_0122568 | 3300048918 | Bacteria | 2140 |
| 689 | Ga0496115_0221941 | 3300048918 | Bacteria | 1559 |
| 690 | Ga0496115_0231294 | 3300048918 | Bacteria | 1524 |
| 691 | Ga0496115_0650590 | 3300048918 | Bacteria | 833 |
| 692 | Ga0501031_0003180 | 3300049568 | Bacteria | 10539 |
| 693 | Ga0501031_0897554 | 3300049568 | Unclassified | 567 |
| 694 | Ga0501032_0434366 | 3300049569 | Bacteria | 842 |
| 695 | Ga0501033_0036040 | 3300049570 | Bacteria | 3708 |
| 696 | Ga0501033_0054626 | 3300049570 | Bacteria | 2954 |
| 697 | Ga0501036_0013015 | 3300049572 | Bacteria | 6907 |
| 698 | Ga0501036_0048253 | 3300049572 | Bacteria | 3605 |
| 699 | Ga0501037_1062298 | 3300049573 | Bacteria | 525 |
| 700 | Ga0501038_0086450 | 3300049574 | Bacteria | 2634 |
| 701 | Ga0501038_0129343 | 3300049574 | Bacteria | 2075 |
| 702 | Ga0501039_0000364 | 3300049575 | Bacteria | 32385 |
| 703 | Ga0501039_0005878 | 3300049575 | Bacteria | 9296 |
| 704 | Ga0501040_0017753 | 3300049576 | Bacteria | 4722 |
| 705 | Ga0501040_0045457 | 3300049576 | Bacteria | 2995 |
| 706 | Ga0501041_0001318 | 3300049577 | Bacteria | 13657 |
| 707 | Ga0501041_0653588 | 3300049577 | Bacteria | 672 |
| 708 | Ga0501042_0002072 | 3300049578 | Bacteria | 12167 |
| 709 | Ga0501042_0067713 | 3300049578 | Bacteria | 2552 |
| 710 | Ga0501042_0315112 | 3300049578 | Bacteria | 1130 |
| 711 | Ga0501043_0506813 | 3300049579 | Bacteria | 901 |
| 712 | Ga0501046_0003462 | 3300049580 | Bacteria | 14484 |
| 713 | Ga0501046_0095851 | 3300049580 | Bacteria | 2279 |
| 714 | Ga0501047_1186580 | 3300049581 | Bacteria | 577 |
| 715 | Ga0501048_0096423 | 3300049582 | Bacteria | 2086 |
| 716 | Ga0501048_0124254 | 3300049582 | Bacteria | 1824 |
| 717 | Ga0501067_0076657 | 3300049583 | Bacteria | 1852 |
| 718 | Ga0501067_0370523 | 3300049583 | Bacteria | 798 |
| 719 | Ga0501068_0052586 | 3300049584 | Bacteria | 2465 |
| 720 | Ga0501068_0075468 | 3300049584 | Bacteria | 2062 |
| 721 | Ga0501069_0115577 | 3300049585 | Bacteria | 1530 |
| 722 | Ga0501069_0293675 | 3300049585 | Bacteria | 952 |
| 723 | Ga0501069_0655481 | 3300049585 | Bacteria | 632 |
| 724 | Ga0501070_0050693 | 3300049586 | Bacteria | 3445 |
| 725 | Ga0501070_0057627 | 3300049586 | Bacteria | 3221 |
| 726 | Ga0501071_0000033 | 3300049587 | Bacteria | 45630 |
| 727 | Ga0501071_0074427 | 3300049587 | Bacteria | 2478 |
| 728 | Ga0501071_1330684 | 3300049587 | Bacteria | 555 |
| 729 | Ga0501072_0025229 | 3300049588 | Bacteria | 4629 |
| 730 | Ga0501072_0214357 | 3300049588 | Bacteria | 1534 |
| 731 | Ga0501074_0006335 | 3300049590 | Bacteria | 8547 |
| 732 | Ga0501074_0028922 | 3300049590 | Bacteria | 4014 |
| 733 | Ga0501075_0007969 | 3300049591 | Bacteria | 7360 |
| 734 | Ga0501075_0054418 | 3300049591 | Bacteria | 3010 |
| 735 | Ga0501076_0021171 | 3300049592 | Bacteria | 4984 |
| 736 | Ga0501077_0016057 | 3300049593 | Bacteria | 4717 |
| 737 | Ga0501077_0018021 | 3300049593 | Bacteria | 4463 |
| 738 | Ga0501077_0568241 | 3300049593 | Bacteria | 728 |
| 739 | Ga0501079_0000130 | 3300049741 | Bacteria | 40553 |
| 740 | Ga0501079_0115812 | 3300049741 | Bacteria | 2083 |
| 741 | Ga0501080_0005135 | 3300049742 | Bacteria | 11661 |
| 742 | Ga0501080_0090738 | 3300049742 | Bacteria | 2838 |
| 743 | Ga0501081_0001035 | 3300049743 | Bacteria | 16639 |
| 744 | Ga0501081_0006137 | 3300049743 | Bacteria | 7787 |
| 745 | Ga0501081_0032647 | 3300049743 | Bacteria | 3533 |
| 746 | Ga0501081_0530775 | 3300049743 | Bacteria | 878 |
| 747 | Ga0501083_0048535 | 3300049744 | Bacteria | 2865 |
| 748 | Ga0501083_0055644 | 3300049744 | Bacteria | 2652 |
| 749 | Ga0501035_0269067 | 3300049822 | Bacteria | 1443 |
| 750 | Ga0501044_0101169 | 3300049823 | Bacteria | 2900 |
| 751 | Ga0501044_0300931 | 3300049823 | Bacteria | 1533 |
| 752 | Ga0501045_0000191 | 3300049824 | Bacteria | 34468 |
| 753 | nmdc:mga08y16_1574903_c1 | 3300050511 | Bacteria | 615 |
| 754 | nmdc:mga08y16_722796_c1 | 3300050511 | Bacteria | 994 |
| 755 | nmdc:mga0n895_14480_c1 | 3300050512 | Bacteria | 7165 |
| 756 | nmdc:mga0n895_27788_c1 | 3300050512 | Bacteria | 5377 |
| 757 | nmdc:mga0rr50_31953_c1 | 3300050513 | Bacteria | 3744 |
| 758 | nmdc:mga0rr50_524464_c1 | 3300050513 | Bacteria | 1008 |
| 759 | nmdc:mga08x19_418696_c1 | 3300050514 | Bacteria | 941 |
| 760 | nmdc:mga08x19_676954_c1 | 3300050514 | Bacteria | 732 |
| 761 | nmdc:mga0a205_71834_c1 | 3300050515 | Bacteria | 3342 |
| 762 | nmdc:mga0a205_94809_c1 | 3300050515 | Bacteria | 2883 |
| 763 | Ga0495601_0002963 | 3300053077 | Bacteria | 9657 |
| 764 | Ga0495601_0030509 | 3300053077 | Bacteria | 3347 |
| 765 | Ga0495601_0074646 | 3300053077 | Bacteria | 2169 |
| 766 | Ga0495601_0092972 | 3300053077 | Bacteria | 1942 |
| 767 | Ga0495601_1059845 | 3300053077 | Bacteria | 508 |
| 768 | Ga0495612_0007536 | 3300053078 | Bacteria | 4448 |
| 769 | Ga0495612_0067822 | 3300053078 | Bacteria | 1484 |
| 770 | Ga0495612_0084346 | 3300053078 | Bacteria | 1338 |
| 771 | Ga0495612_0504613 | 3300053078 | Bacteria | 555 |
| 772 | Ga0495595_0088098 | 3300053084 | Bacteria | 1486 |
| 773 | Ga0495619_0012071 | 3300053085 | Bacteria | 5443 |
| 774 | Ga0495619_0031354 | 3300053085 | Bacteria | 3445 |
| 775 | Ga0495619_0032727 | 3300053085 | Bacteria | 3374 |
| 776 | Ga0495619_0311851 | 3300053085 | Bacteria | 1089 |
| 777 | Ga0495619_0461415 | 3300053085 | Bacteria | 875 |
| 778 | Ga0500566_0042826 | 3300053094 | Bacteria | 2610 |
| 779 | Ga0500614_148774 | 3300053123 | Bacteria | 704 |
| 780 | Ga0501084_0013710 | 3300054114 | Bacteria | 6709 |
| 781 | Ga0501084_0061917 | 3300054114 | Bacteria | 3133 |
| 782 | Ga0501084_0292001 | 3300054114 | Bacteria | 1377 |
| 783 | Ga0590074_052902 | 3300059423 | Bacteria | 745 |
| 784 | Ga0590075_010989 | 3300059424 | Bacteria | 2184 |
| 785 | Ga0590075_041984 | 3300059424 | Bacteria | 1169 |
| 786 | Ga0590075_044316 | 3300059424 | Bacteria | 1139 |
| 787 | Ga0590077_087654 | 3300059426 | Bacteria | 720 |
| 788 | Ga0501082_0013535 | 3300060353 | Bacteria | 7009 |
| 789 | Ga0501082_0062438 | 3300060353 | Bacteria | 3207 |
| 790 | Ga0501082_0085427 | 3300060353 | Bacteria | 2722 |
| 791 | Ga0466962_0000666 | 3300061719 | Bacteria | 15245 |
| 792 | Ga0466962_0002358 | 3300061719 | Bacteria | 8961 |
| 793 | Ga0466962_0065164 | 3300061719 | Bacteria | 1740 |
| 794 | Ga0466962_0070488 | 3300061719 | Bacteria | 1670 |
| 795 | Ga0466962_0214239 | 3300061719 | Bacteria | 942 |
| 796 | Ga0530510_0006298 | 3300061734 | Bacteria | 8258 |
| 797 | Ga0530510_0026443 | 3300061734 | Bacteria | 4154 |
| 798 | Ga0530510_0087726 | 3300061734 | Bacteria | 2267 |
| 799 | Ga0530510_1342441 | 3300061734 | Bacteria | 548 |
| 800 | Ga0373924_0210363 | |||
| 801 | Ga0070658_10153890 | |||
| 802 | Ga0070658_10590203 | |||
| 803 | Ga0070676_11220913 | |||
| 804 | Ga0070683_100231551 | |||
| 805 | Ga0070683_100408784 | |||
| 806 | Ga0070683_100950575 | |||
| 807 | Ga0070690_101052825 | |||
| 808 | Ga0068869_100157437 | |||
| 809 | Ga0070680_100050398 | |||
| 810 | Ga0070680_100233870 | |||
| 811 | Ga0070680_100294091 | |||
| 812 | Ga0070680_100951333 | |||
| 813 | Ga0070682_100062620 | |||
| 814 | Ga0070682_100131946 | |||
| 815 | Ga0070682_101575783 | |||
| 816 | Ga0070660_100140158 | |||
| 817 | Ga0070687_100129659 | |||
| 818 | Ga0070687_101295903 | |||
| 819 | Ga0070661_100320529 | |||
| 820 | Ga0070675_100077114 | |||
| 821 | Ga0070671_100432711 | |||
| 822 | Ga0070674_101656650 | |||
| 823 | Ga0070659_100103347 | |||
| 824 | Ga0070709_10003121 | |||
| 825 | Ga0070709_10327710 | |||
| 826 | Ga0070714_100011685 | |||
| 827 | Ga0070714_100043750 | |||
| 828 | Ga0070714_100049748 | |||
| 829 | Ga0070714_100074075 | |||
| 830 | Ga0070714_100093033 | |||
| 831 | Ga0070714_100211075 | |||
| 832 | Ga0070714_100266053 | |||
| 833 | Ga0070714_100268905 | |||
| 834 | Ga0070714_100414013 | |||
| 835 | Ga0070714_100471883 | |||
| 836 | Ga0070714_100539749 | |||
| 837 | Ga0070714_102018602 | |||
| 838 | Ga0070713_100016357 | |||
| 839 | Ga0070713_100068559 | |||
| 840 | Ga0070713_100143026 | |||
| 841 | Ga0070713_100237263 | |||
| 842 | Ga0070713_100266072 | |||
| 843 | Ga0070713_100374392 | |||
| 844 | Ga0070713_101983851 | |||
| 845 | Ga0070710_10023167 | |||
| 846 | Ga0070710_10060770 | |||
| 847 | Ga0070711_100026552 | |||
| 848 | Ga0070711_100029826 | |||
| 849 | Ga0070705_100058774 | |||
| 850 | Ga0070705_101809487 | |||
| 851 | Ga0070700_100056258 | |||
| 852 | Ga0070708_100391878 | |||
| 853 | Ga0070708_100501545 | |||
| 854 | Ga0070708_100799557 | |||
| 855 | Ga0070678_100204479 | |||
| 856 | Ga0070678_100290506 | |||
| 857 | Ga0070681_10013096 | |||
| 858 | Ga0070681_10053748 | |||
| 859 | Ga0070681_11417102 | |||
| 860 | Ga0068867_100498838 | |||
| 861 | Ga0070706_100145982 | |||
| 862 | Ga0070706_100397779 | |||
| 863 | Ga0070706_100536788 | |||
| 864 | Ga0070707_100039227 | |||
| 865 | Ga0070707_100565877 | |||
| 866 | Ga0070707_101197884 | |||
| 867 | Ga0070707_101235967 | |||
| 868 | Ga0070698_100109046 | |||
| 869 | Ga0070698_100122806 | |||
| 870 | Ga0070698_100441519 | |||
| 871 | Ga0070698_100499197 | |||
| 872 | Ga0070698_101218771 | |||
| 873 | Ga0070699_100058384 | |||
| 874 | Ga0070699_101023571 | |||
| 875 | Ga0070679_100048616 | |||
| 876 | Ga0070679_100087122 | |||
| 877 | Ga0070679_100184891 | |||
| 878 | Ga0070679_100971483 | |||
| 879 | Ga0070684_100873486 | |||
| 880 | Ga0070697_100128080 | |||
| 881 | Ga0070697_100155602 | |||
| 882 | Ga0070697_100211556 | |||
| 883 | Ga0070697_100406766 | |||
| 884 | Ga0070697_100945919 | |||
| 885 | Ga0068853_100835897 | |||
| 886 | Ga0070672_100108901 | |||
| 887 | Ga0070672_100228107 | |||
| 888 | Ga0070686_100280843 | |||
| 889 | Ga0070693_100247683 | |||
| 890 | Ga0070693_100505807 | |||
| 891 | Ga0070693_100673313 | |||
| 892 | Ga0070704_100142645 | |||
| 893 | Ga0070704_100183410 | |||
| 894 | Ga0070704_100734446 | |||
| 895 | Ga0070704_101318654 | |||
| 896 | Ga0068855_100061202 | |||
| 897 | Ga0068855_100098043 | |||
| 898 | Ga0068855_101738741 | |||
| 899 | Ga0068855_102444042 | |||
| 900 | Ga0070664_100543689 | |||
| 901 | Ga0070664_101250032 | |||
| 902 | Ga0068857_100296553 | |||
| 903 | Ga0068857_100613235 | |||
| 904 | Ga0068854_100013805 | |||
| 905 | Ga0068854_100326368 | |||
| 906 | Ga0068856_100327523 | |||
| 907 | Ga0068856_101172463 | |||
| 908 | Ga0068856_102612429 | |||
| 909 | Ga0070702_100155529 | |||
| 910 | Ga0070702_100581033 | |||
| 911 | Ga0068852_100409831 | |||
| 912 | Ga0068852_100633041 | |||
| 913 | Ga0068870_11216407 | |||
| 914 | Ga0068863_101763371 | |||
| 915 | Ga0068858_100611971 | |||
| 916 | Ga0068860_101817184 | |||
| 917 | Ga0068862_101934557 | |||
| 918 | Ga0081455_10046568 | |||
| 919 | Ga0081540_1035793 | |||
| 920 | Ga0070717_10005225 | |||
| 921 | Ga0070717_10020482 | |||
| 922 | Ga0070717_10084473 | |||
| 923 | Ga0070717_10150694 | |||
| 924 | Ga0070717_10211844 | |||
| 925 | Ga0070717_10378870 | |||
| 926 | Ga0070717_11243026 | |||
| 927 | Ga0070715_10000893 | |||
| 928 | Ga0070715_10786767 | |||
| 929 | Ga0070716_100008868 | |||
| 930 | Ga0070716_100730163 | |||
| 931 | Ga0070712_100003456 | |||
| 932 | Ga0070712_100068085 | |||
| 933 | Ga0070712_100192884 | |||
| 934 | Ga0070712_100454356 | |||
| 935 | Ga0070712_100616260 | |||
| 936 | Ga0070712_101047826 | |||
| 937 | Ga0070712_101180159 | |||
| 938 | Ga0070712_102052888 | |||
| 939 | Ga0075431_100127463 | |||
| 940 | Ga0075433_10104753 | |||
| 941 | Ga0075433_10126139 | |||
| 942 | Ga0075434_100006610 | |||
| 943 | Ga0075434_100021350 | |||
| 944 | Ga0068865_100101743 | |||
| 945 | Ga0075436_100044758 | |||
| 946 | Ga0075436_100736436 | |||
| 947 | Ga0075435_100001263 | |||
| 948 | Ga0105240_10023634 | |||
| 949 | Ga0105240_10313772 | |||
| 950 | Ga0105240_11840776 | |||
| 951 | Ga0111539_10788722 | |||
| 952 | Ga0105245_10110725 | |||
| 953 | Ga0105245_10172224 | |||
| 954 | Ga0105243_12532291 | |||
| 955 | Ga0105242_10135334 | |||
| 956 | Ga0105242_10455908 | |||
| 957 | Ga0105248_10386445 | |||
| 958 | Ga0105248_10507893 | |||
| 959 | Ga0105238_10275172 | |||
| 960 | Ga0105249_10903624 | |||
| 961 | Ga0105239_10174198 | |||
| 962 | Ga0157371_10026289 | |||
| 963 | Ga0157370_10042944 | |||
| 964 | Ga0157370_10915366 | |||
| 965 | Ga0157369_10006178 | |||
| 966 | Ga0157369_10179693 | |||
| 967 | Ga0157374_10057906 | |||
| 968 | Ga0157374_10757344 | |||
| 969 | Ga0157378_11531706 | |||
| 970 | Ga0157378_11910136 | |||
| 971 | Ga0163162_10257618 | |||
| 972 | Ga0157372_10170664 | |||
| 973 | Ga0157372_13149981 | |||
| 974 | Ga0157375_13430425 | |||
| 975 | Ga0163163_10470934 | |||
| 976 | Ga0163163_11008345 | |||
| 977 | Ga0157380_12536145 | |||
| 978 | Ga0182008_10074757 | |||
| 979 | Ga0182008_10081404 | |||
| 980 | Ga0182008_10944699 | |||
| 981 | Ga0157377_10229310 | |||
| 982 | Ga0157377_10372879 | |||
| 983 | Ga0157376_12250118 | |||
| 984 | Ga0197907_10459506 | |||
| 985 | Ga0206356_10876089 | |||
| 986 | Ga0206356_11576920 | |||
| 987 | Ga0206354_11590312 | |||
| 988 | Ga0206353_11039148 | |||
| 989 | Ga0207682_10606208 | |||
| 990 | Ga0207692_10004842 | |||
| 991 | Ga0207692_10018561 | |||
| 992 | Ga0207688_10640899 | |||
| 993 | Ga0207685_10084501 | |||
| 994 | Ga0207699_10158500 | |||
| 995 | Ga0207699_10182698 | |||
| 996 | Ga0207645_10286511 | |||
| 997 | Ga0207705_10223705 | |||
| 998 | Ga0207684_10161687 | |||
| 999 | Ga0207684_10458193 | |||
| 1000 | Ga0207684_10765961 | |||
| 1001 | Ga0207707_10074281 | |||
| 1002 | Ga0207707_10111211 | |||
| 1003 | Ga0207695_10406424 | |||
| 1004 | Ga0207695_10716717 | |||
| 1005 | Ga0207695_10768531 | |||
| 1006 | Ga0207693_10000282 | |||
| 1007 | Ga0207693_10021691 | |||
| 1008 | Ga0207693_10046432 | |||
| 1009 | Ga0207693_10663327 | |||
| 1010 | Ga0207693_10760208 | |||
| 1011 | Ga0207663_10001508 | |||
| 1012 | Ga0207663_10127032 | |||
| 1013 | Ga0207663_10380196 | |||
| 1014 | Ga0207660_10046075 | |||
| 1015 | Ga0207660_10246273 | |||
| 1016 | Ga0207660_10285333 | |||
| 1017 | Ga0207660_10510611 | |||
| 1018 | Ga0207662_10144700 | |||
| 1019 | Ga0207657_10045730 | |||
| 1020 | Ga0207657_10095584 | |||
| 1021 | Ga0207652_10016535 | |||
| 1022 | Ga0207652_10250477 | |||
| 1023 | Ga0207652_10570038 | |||
| 1024 | Ga0207652_10959836 | |||
| 1025 | Ga0207646_10001031 | |||
| 1026 | Ga0207646_10265588 | |||
| 1027 | Ga0207646_10625563 | |||
| 1028 | Ga0207646_11112918 | |||
| 1029 | Ga0207681_11188303 | |||
| 1030 | Ga0207659_10138843 | |||
| 1031 | Ga0207687_10043708 | |||
| 1032 | Ga0207687_10181346 | |||
| 1033 | Ga0207700_10024533 | |||
| 1034 | Ga0207700_10030363 | |||
| 1035 | Ga0207700_10080967 | |||
| 1036 | Ga0207700_10596111 | |||
| 1037 | Ga0207700_11580641 | |||
| 1038 | Ga0207664_10002945 | |||
| 1039 | Ga0207664_10004602 | |||
| 1040 | Ga0207664_10012732 | |||
| 1041 | Ga0207664_10048183 | |||
| 1042 | Ga0207664_10081819 | |||
| 1043 | Ga0207664_10131576 | |||
| 1044 | Ga0207664_10182329 | |||
| 1045 | Ga0207664_10286928 | |||
| 1046 | Ga0207664_10426553 | |||
| 1047 | Ga0207664_10724648 | |||
| 1048 | Ga0207664_11260560 | |||
| 1049 | Ga0207644_10368904 | |||
| 1050 | Ga0207690_11110052 | |||
| 1051 | Ga0207669_10311507 | |||
| 1052 | Ga0207669_11611189 | |||
| 1053 | Ga0207704_10111764 | |||
| 1054 | Ga0207704_10456030 | |||
| 1055 | Ga0207665_10000835 | |||
| 1056 | Ga0207665_10406962 | |||
| 1057 | Ga0207665_10427578 | |||
| 1058 | Ga0207691_10617334 | |||
| 1059 | Ga0207691_11052203 | |||
| 1060 | Ga0207661_11102518 | |||
| 1061 | Ga0207661_11400189 | |||
| 1062 | Ga0207679_10130466 | |||
| 1063 | Ga0207679_11908600 | |||
| 1064 | Ga0207667_10318436 | |||
| 1065 | Ga0207640_10072757 | |||
| 1066 | Ga0207640_10412556 | |||
| 1067 | Ga0207677_10520633 | |||
| 1068 | Ga0207703_10510275 | |||
| 1069 | Ga0207708_10135907 | |||
| 1070 | Ga0207702_10270949 | |||
| 1071 | Ga0207641_10193817 | |||
| 1072 | Ga0207648_10201714 | |||
| 1073 | Ga0207648_10237624 | |||
| 1074 | Ga0207683_10235259 | |||
| 1075 | Ga0207683_10430470 | |||
| 1076 | Ga0207683_11379995 | |||
| 1077 | Ga0207698_11160138 | |||
| 1078 | Ga0265337_1136030 | |||
| 1079 | Ga0265319_1001269 | |||
| 1080 | Ga0265319_1065699 | |||
| 1081 | Ga0265334_10013784 | |||
| 1082 | Ga0265318_10006167 | |||
| 1083 | Ga0265323_10244707 | |||
| 1084 | Ga0265322_10201671 | |||
| 1085 | Ga0265336_10042885 | |||
| 1086 | Ga0265336_10084473 | |||
| 1087 | Ga0265336_10137190 | |||
| 1088 | Ga0265336_10177989 | |||
| 1089 | Ga0265336_10209967 | |||
| 1090 | Ga0265338_10000924 | |||
| 1091 | Ga0265338_10003221 | |||
| 1092 | Ga0265338_10011362 | |||
| 1093 | Ga0265338_10012864 | |||
| 1094 | Ga0265338_10240641 | |||
| 1095 | Ga0265338_10919566 | |||
| 1096 | Ga0265330_10042497 | |||
| 1097 | Ga0265330_10056685 | |||
| 1098 | Ga0265332_10133855 | |||
| 1099 | Ga0265320_10104895 | |||
| 1100 | Ga0265325_10031289 | |||
| 1101 | Ga0265325_10176108 | |||
| 1102 | Ga0265329_10048042 | |||
| 1103 | Ga0265340_10056948 | |||
| 1104 | Ga0265339_10004365 | |||
| 1105 | Ga0265339_10176138 | |||
| 1106 | Ga0265331_10023246 | |||
| 1107 | Ga0265327_10030936 | |||
| 1108 | Ga0265327_10058530 | |||
| 1109 | Ga0265327_10074296 | |||
| 1110 | Ga0265327_10094416 | |||
| 1111 | Ga0265316_10005504 | |||
| 1112 | Ga0265316_10011484 | |||
| 1113 | Ga0307408_100797247 | |||
| 1114 | Ga0265313_10007349 | |||
| 1115 | Ga0265313_10026510 | |||
| 1116 | Ga0265314_10012767 | |||
| 1117 | Ga0265342_10010010 | |||
| 1118 | Ga0265342_10062322 | |||
| 1119 | Ga0265342_10569274 | |||
| 1120 | Ga0307405_11586241 | |||
| 1121 | Ga0307410_10241218 | |||
| 1122 | Ga0307407_10507161 | |||
| 1123 | Ga0307409_100021014 | |||
| 1124 | Ga0307409_101129495 | |||
| 1125 | Ga0307409_101299490 | |||
| 1126 | Ga0307409_102317473 | |||
| 1127 | Ga0307416_100016168 | |||
| 1128 | Ga0307416_101264691 | |||
| 1129 | Ga0307416_102249186 | |||
| 1130 | Ga0307416_102927818 | |||
| 1131 | Ga0307415_100290937 | |||
| 1132 | Ga0307415_100552196 | |||
| 1133 | Ga0373940_0197945 | |||
| 1134 | Ga0373944_0091754 | |||
| 1135 | Ga0373951_0019725 | |||
| 1136 | Ga0373932_0036578 | |||
| 1137 | Ga0373936_0039423 | |||
| 1138 | Ga0373936_0119945 | |||
| 1139 | Ga0373941_0364333 | |||
| 1140 | Ga0373945_0015762 | |||
| 1141 | Ga0373954_0190554 | |||
| 1142 | Ga0373956_0058646 | |||
| 1143 | Ga0373957_0047110 | |||
| 1144 | Ga0373943_0001644 | |||
| 1145 | Ga0373946_0050185 | |||
| 1146 | Ga0373955_0176420 | |||
| 1147 | Ga0373955_0391556 | |||
| 1148 | Ga0373942_0080207 | |||
| 1149 | Ga0373942_0108539 | |||
| 1150 | Ga0373962_0093235 | |||
| 1151 | Ga0373924_0035860 | |||
| 1152 | Ga0373924_0074048 | |||
| 1153 | Ga0373935_0149606 | |||
| 1154 | Ga0373935_0367801 | |||
| 1155 | Ga0373927_0013531 | |||
| 1156 | Ga0373947_0000371 | |||
| 1157 | Ga0373947_0351662 | |||
| 1158 | Ga0373937_0147973 | |||
| 1159 | Ga0373937_0863286 | |||
| 1160 | Ga0373937_1199671 | |||
| 1161 | Ga0373925_0001462 | |||
| 1162 | Ga0395899_0978590 | |||
| 1163 | Ga0395900_0002559 | |||
| 1164 | Ga0395900_0169269 | |||
| 1165 | Ga0395900_0228011 | |||
| 1166 | Ga0395900_1768922 | |||
| 1167 | Ga0395898_0069532 | |||
| 1168 | Ga0395898_0719082 | |||
| 1169 | Ga0395898_0961852 | |||
| 1170 | Ga0395905_0012299 | |||
| 1171 | Ga0395905_0101994 | |||
| 1172 | Ga0395905_0619471 | |||
| 1173 | Ga0395905_1854176 | |||
| 1174 | Ga0395901_0006074 | |||
| 1175 | Ga0395901_0058232 | |||
| 1176 | Ga0395901_1604991 | |||
| 1177 | Ga0395901_2044601 | |||
| 1178 | Ga0436365_1612270 | |||
| 1179 | Ga0439439_0166075 | |||
| 1180 | Ga0451789_0555230 | |||
| 1181 | Ga0451853_0111819 | |||
| 1182 | Ga0439431_0065144 | |||
| 1183 | Ga0439431_0224332 | |||
| 1184 | Ga0439445_0006771 | |||
| 1185 | Ga0439452_066628 | |||
| 1186 | Ga0450920_008453 | |||
| 1187 | Ga0450910_049446 | |||
| 1188 | Ga0439446_0001436 | |||
| 1189 | Ga0439434_0048921 | |||
| 1190 | Ga0439459_0068308 | |||
| 1191 | Ga0450918_024451 | |||
| 1192 | Ga0466969_0018054 | |||
| 1193 | Ga0466969_0041963 | |||
| 1194 | Ga0466969_0127422 | |||
| 1195 | Ga0466965_0010523 | |||
| 1196 | Ga0466965_0136059 | |||
| 1197 | Ga0466965_0191699 | |||
| 1198 | Ga0466966_0013680 | |||
| 1199 | Ga0466966_0127606 | |||
| 1200 | Ga0466961_0011516 | |||
| 1201 | Ga0466961_0032038 | |||
| 1202 | Ga0466961_0077789 | |||
| 1203 | Ga0466961_0138795 | |||
| 1204 | Ga0466961_0145964 | |||
| 1205 | Ga0466963_0000102 | |||
| 1206 | Ga0466963_0015728 | |||
| 1207 | Ga0466963_0023100 | |||
| 1208 | Ga0466963_0027378 | |||
| 1209 | Ga0466963_0030190 | |||
| 1210 | Ga0466963_0046479 | |||
| 1211 | Ga0466963_0074171 | |||
| 1212 | Ga0466963_0075936 | |||
| 1213 | Ga0466963_0250256 | |||
| 1214 | Ga0466963_0313057 | |||
| 1215 | Ga0466963_0323514 | |||
| 1216 | Ga0466963_0372260 | |||
| 1217 | Ga0466963_0601450 | |||
| 1218 | Ga0466963_1101755 | |||
| 1219 | Ga0466964_0030092 | |||
| 1220 | Ga0466964_0048698 | |||
| 1221 | Ga0466964_0106867 | |||
| 1222 | Ga0466964_0515229 | |||
| 1223 | Ga0453684_1408560 | |||
| 1224 | Ga0466971_0003709 | |||
| 1225 | Ga0466971_0012690 | |||
| 1226 | Ga0466971_0016144 | |||
| 1227 | Ga0466971_0050393 | |||
| 1228 | Ga0466971_0064097 | |||
| 1229 | Ga0466971_0140820 | |||
| 1230 | Ga0466971_0595801 | |||
| 1231 | Ga0466968_0004990 | |||
| 1232 | Ga0466968_0010554 | |||
| 1233 | Ga0466968_0017320 | |||
| 1234 | Ga0466968_0024768 | |||
| 1235 | Ga0466968_0123827 | |||
| 1236 | Ga0466968_0184601 | |||
| 1237 | Ga0466968_0285452 | |||
| 1238 | Ga0466968_0389761 | |||
| 1239 | Ga0466970_0009945 | |||
| 1240 | Ga0466970_0223381 | |||
| 1241 | Ga0466957_0006707 | |||
| 1242 | Ga0466957_0010804 | |||
| 1243 | Ga0466957_0054289 | |||
| 1244 | Ga0466957_0074998 | |||
| 1245 | Ga0466957_0101005 | |||
| 1246 | Ga0466957_0506281 | |||
| 1247 | Ga0466957_0705185 | |||
| 1248 | Ga0466960_0041161 | |||
| 1249 | Ga0466960_0109198 | |||
| 1250 | Ga0466960_0117468 | |||
| 1251 | Ga0466959_0026170 | |||
| 1252 | Ga0466959_0041359 | |||
| 1253 | Ga0466959_0069344 | |||
| 1254 | Ga0466959_0133402 | |||
| 1255 | Ga0466959_0153456 | |||
| 1256 | Ga0466959_0280125 | |||
| 1257 | Ga0466959_0676018 | |||
| 1258 | Ga0466958_0002621 | |||
| 1259 | Ga0466958_0005793 | |||
| 1260 | Ga0466958_0015119 | |||
| 1261 | Ga0466958_0035631 | |||
| 1262 | Ga0466958_0057045 | |||
| 1263 | Ga0466958_0072066 | |||
| 1264 | Ga0466958_0140083 | |||
| 1265 | Ga0466958_0158289 | |||
| 1266 | Ga0466958_0399834 | |||
| 1267 | Ga0466958_0793636 | |||
| 1268 | Ga0466958_1025071 | |||
| 1269 | Ga0466967_0000094 | |||
| 1270 | Ga0466967_0010173 | |||
| 1271 | Ga0466967_0016470 | |||
| 1272 | Ga0466967_0043805 | |||
| 1273 | Ga0466967_0051504 | |||
| 1274 | Ga0466967_0064843 | |||
| 1275 | Ga0466967_0067412 | |||
| 1276 | Ga0466967_0089740 | |||
| 1277 | Ga0466967_0092079 | |||
| 1278 | Ga0466967_0104896 | |||
| 1279 | Ga0466967_0110568 | |||
| 1280 | Ga0466967_0139312 | |||
| 1281 | Ga0466967_0162347 | |||
| 1282 | Ga0466967_0289074 | |||
| 1283 | Ga0466967_0325482 | |||
| 1284 | Ga0466967_0509718 | |||
| 1285 | Ga0466967_0585883 | |||
| 1286 | Ga0466967_0984547 | |||
| 1287 | Ga0466967_1035656 | |||
| 1288 | Ga0466967_1412900 | |||
| 1289 | Ga0466967_2135624 | |||
| 1290 | Ga0466967_2316644 | |||
| 1291 | Ga0495592_0082399 | |||
| 1292 | Ga0495592_0564014 | |||
| 1293 | Ga0495603_0028096 | |||
| 1294 | Ga0495603_0655433 | |||
| 1295 | Ga0495629_0006635 | |||
| 1296 | Ga0495629_0012289 | |||
| 1297 | Ga0495629_0470999 | |||
| 1298 | Ga0495629_0489724 | |||
| 1299 | Ga0495629_0840612 | |||
| 1300 | Ga0495629_0856575 | |||
| 1301 | Ga0495641_0003825 | |||
| 1302 | Ga0495641_0017282 | |||
| 1303 | Ga0495641_0114797 | |||
| 1304 | Ga0495651_0060816 | |||
| 1305 | Ga0495653_0061685 | |||
| 1306 | Ga0495653_0071013 | |||
| 1307 | Ga0495653_0073098 | |||
| 1308 | Ga0495653_0119924 | |||
| 1309 | Ga0495653_0290309 | |||
| 1310 | Ga0495580_0004702 | |||
| 1311 | Ga0495582_0003743 | |||
| 1312 | Ga0495582_0649370 | |||
| 1313 | Ga0495605_0281319 | |||
| 1314 | Ga0495639_0000481 | |||
| 1315 | Ga0495662_0072960 | |||
| 1316 | Ga0495662_0110954 | |||
| 1317 | Ga0495662_0264764 | |||
| 1318 | Ga0495664_0005759 | |||
| 1319 | Ga0495664_0054483 | |||
| 1320 | Ga0495584_0380686 | |||
| 1321 | Ga0495585_0255678 | |||
| 1322 | Ga0495594_0568668 | |||
| 1323 | Ga0495608_0049046 | |||
| 1324 | Ga0495608_0061490 | |||
| 1325 | Ga0495608_0841917 | |||
| 1326 | Ga0495608_0847671 | |||
| 1327 | Ga0495616_0087231 | |||
| 1328 | Ga0495618_0002744 | |||
| 1329 | Ga0495618_0062192 | |||
| 1330 | Ga0495618_0499746 | |||
| 1331 | Ga0495618_0872930 | |||
| 1332 | Ga0495628_0249297 | |||
| 1333 | Ga0495630_0000995 | |||
| 1334 | Ga0495630_0015140 | |||
| 1335 | Ga0495630_1153820 | |||
| 1336 | Ga0495630_1201637 | |||
| 1337 | Ga0495631_0117512 | |||
| 1338 | Ga0495644_0170002 | |||
| 1339 | Ga0495666_0000549 | |||
| 1340 | Ga0495652_0032149 | |||
| 1341 | Ga0495652_0054710 | |||
| 1342 | Ga0495652_0394093 | |||
| 1343 | Ga0495652_0498668 | |||
| 1344 | Ga0495652_0588896 | |||
| 1345 | Ga0495665_0001265 | |||
| 1346 | Ga0495665_0289840 | |||
| 1347 | Ga0495640_0007169 | |||
| 1348 | Ga0495640_0016482 | |||
| 1349 | Ga0495640_0083890 | |||
| 1350 | Ga0495640_0297697 | |||
| 1351 | Ga0495586_0024820 | |||
| 1352 | Ga0495586_0124465 | |||
| 1353 | Ga0495586_0192319 | |||
| 1354 | Ga0495587_0053676 | |||
| 1355 | Ga0495598_0176672 | |||
| 1356 | Ga0495621_0303968 | |||
| 1357 | Ga0495645_0021825 | |||
| 1358 | Ga0495645_0155854 | |||
| 1359 | Ga0495667_0051461 | |||
| 1360 | Ga0495667_0099341 | |||
| 1361 | Ga0495656_0028346 | |||
| 1362 | Ga0495656_0475186 | |||
| 1363 | Ga0495668_0568945 | |||
| 1364 | Ga0495634_0004671 | |||
| 1365 | Ga0495634_0029685 | |||
| 1366 | Ga0495634_0048737 | |||
| 1367 | Ga0495634_0107029 | |||
| 1368 | Ga0495634_0108820 | |||
| 1369 | Ga0495634_0689012 | |||
| 1370 | Ga0495635_0021973 | |||
| 1371 | Ga0495635_0045699 | |||
| 1372 | Ga0495635_0300882 | |||
| 1373 | Ga0495657_0044955 | |||
| 1374 | Ga0495657_0214405 | |||
| 1375 | Ga0495599_0041853 | |||
| 1376 | Ga0495599_0071664 | |||
| 1377 | Ga0495646_0071900 | |||
| 1378 | Ga0495647_0000686 | |||
| 1379 | Ga0495647_0247300 | |||
| 1380 | Ga0495647_0480350 | |||
| 1381 | Ga0495658_0047475 | |||
| 1382 | Ga0495658_0305700 | |||
| 1383 | Ga0495658_0545356 | |||
| 1384 | Ga0495658_0738341 | |||
| 1385 | Ga0495613_0009460 | |||
| 1386 | Ga0495613_0032934 | |||
| 1387 | Ga0495613_0198374 | |||
| 1388 | Ga0495613_0364097 | |||
| 1389 | Ga0495613_0519008 | |||
| 1390 | Ga0495613_0655879 | |||
| 1391 | Ga0495624_0001215 | |||
| 1392 | Ga0495624_0050021 | |||
| 1393 | Ga0495624_0078118 | |||
| 1394 | Ga0495624_0293961 | |||
| 1395 | Ga0495670_0197718 | |||
| 1396 | Ga0495670_0658617 | |||
| 1397 | Ga0495670_0734647 | |||
| 1398 | Ga0495589_0039947 | |||
| 1399 | Ga0495589_0132216 | |||
| 1400 | Ga0495600_0107283 | |||
| 1401 | Ga0495600_0222314 | |||
| 1402 | Ga0495600_0267098 | |||
| 1403 | Ga0495581_0002248 | |||
| 1404 | Ga0495581_0017310 | |||
| 1405 | Ga0495604_0072873 | |||
| 1406 | Ga0495674_0025974 | |||
| 1407 | Ga0495674_0032620 | |||
| 1408 | Ga0495674_0184882 | |||
| 1409 | Ga0495674_0459695 | |||
| 1410 | Ga0495674_0492307 | |||
| 1411 | Ga0495676_0072273 | |||
| 1412 | Ga0495676_0126366 | |||
| 1413 | Ga0495676_0389243 | |||
| 1414 | Ga0495676_0402900 | |||
| 1415 | Ga0495676_0490146 | |||
| 1416 | Ga0495676_0498758 | |||
| 1417 | Ga0495680_0070217 | |||
| 1418 | Ga0495680_0117888 | |||
| 1419 | Ga0495680_0236349 | |||
| 1420 | Ga0495680_0390600 | |||
| 1421 | Ga0495680_0473171 | |||
| 1422 | Ga0495680_0682122 | |||
| 1423 | Ga0495675_0348220 | |||
| 1424 | Ga0495677_0179731 | |||
| 1425 | Ga0495684_0010059 | |||
| 1426 | Ga0495684_0050966 | |||
| 1427 | Ga0495684_0145208 | |||
| 1428 | Ga0495593_0002282 | |||
| 1429 | Ga0495602_0219900 | |||
| 1430 | Ga0495614_0003952 | |||
| 1431 | Ga0495614_0315932 | |||
| 1432 | Ga0496100_0016429 | |||
| 1433 | Ga0496100_0340167 | |||
| 1434 | Ga0496100_0497071 | |||
| 1435 | Ga0496101_0009481 | |||
| 1436 | Ga0496101_0145807 | |||
| 1437 | Ga0496101_0379038 | |||
| 1438 | Ga0496101_0789020 | |||
| 1439 | Ga0496102_0012440 | |||
| 1440 | Ga0496102_1454403 | |||
| 1441 | Ga0496103_0019582 | |||
| 1442 | Ga0496104_0013132 | |||
| 1443 | Ga0496104_0081675 | |||
| 1444 | Ga0496104_0093991 | |||
| 1445 | Ga0496104_0187291 | |||
| 1446 | Ga0496104_0424172 | |||
| 1447 | Ga0496104_0766863 | |||
| 1448 | Ga0496105_0010628 | |||
| 1449 | Ga0496105_0012369 | |||
| 1450 | Ga0496105_0017229 | |||
| 1451 | Ga0496106_0002999 | |||
| 1452 | Ga0496106_1119451 | |||
| 1453 | Ga0496107_0008691 | |||
| 1454 | Ga0496107_0187509 | |||
| 1455 | Ga0496107_0269826 | |||
| 1456 | Ga0496108_0010043 | |||
| 1457 | Ga0496108_0018921 | |||
| 1458 | Ga0496108_0035085 | |||
| 1459 | Ga0496108_1753202 | |||
| 1460 | Ga0496109_0003892 | |||
| 1461 | Ga0496109_0107010 | |||
| 1462 | Ga0496109_0154733 | |||
| 1463 | Ga0496109_0258433 | |||
| 1464 | Ga0496109_0548119 | |||
| 1465 | Ga0496109_1695441 | |||
| 1466 | Ga0496110_0027322 | |||
| 1467 | Ga0496110_0735511 | |||
| 1468 | Ga0496111_0021897 | |||
| 1469 | Ga0496111_0070787 | |||
| 1470 | Ga0496112_0053955 | |||
| 1471 | Ga0496112_0104963 | |||
| 1472 | Ga0496112_0162644 | |||
| 1473 | Ga0496112_0205839 | |||
| 1474 | Ga0496112_0345750 | |||
| 1475 | Ga0496112_0768020 | |||
| 1476 | Ga0496112_1568354 | |||
| 1477 | Ga0496113_0005587 | |||
| 1478 | Ga0496113_0050546 | |||
| 1479 | Ga0496113_0119163 | |||
| 1480 | Ga0496114_0018197 | |||
| 1481 | Ga0496114_0033298 | |||
| 1482 | Ga0496114_0209586 | |||
| 1483 | Ga0496114_0382599 | |||
| 1484 | Ga0496114_0592070 | |||
| 1485 | Ga0496114_0969890 | |||
| 1486 | Ga0496115_0013970 | |||
| 1487 | Ga0496115_0122568 | |||
| 1488 | Ga0496115_0221941 | |||
| 1489 | Ga0496115_0231294 | |||
| 1490 | Ga0496115_0650590 | |||
| 1491 | Ga0501031_0003180 | |||
| 1492 | Ga0501031_0897554 | |||
| 1493 | Ga0501032_0434366 | |||
| 1494 | Ga0501033_0036040 | |||
| 1495 | Ga0501033_0054626 | |||
| 1496 | Ga0501036_0013015 | |||
| 1497 | Ga0501036_0048253 | |||
| 1498 | Ga0501037_1062298 | |||
| 1499 | Ga0501038_0086450 | |||
| 1500 | Ga0501038_0129343 | |||
| 1501 | Ga0501039_0000364 | |||
| 1502 | Ga0501039_0005878 | |||
| 1503 | Ga0501040_0017753 | |||
| 1504 | Ga0501040_0045457 | |||
| 1505 | Ga0501041_0001318 | |||
| 1506 | Ga0501041_0653588 | |||
| 1507 | Ga0501042_0002072 | |||
| 1508 | Ga0501042_0067713 | |||
| 1509 | Ga0501042_0315112 | |||
| 1510 | Ga0501043_0506813 | |||
| 1511 | Ga0501046_0003462 | |||
| 1512 | Ga0501046_0095851 | |||
| 1513 | Ga0501047_1186580 | |||
| 1514 | Ga0501048_0096423 | |||
| 1515 | Ga0501048_0124254 | |||
| 1516 | Ga0501067_0076657 | |||
| 1517 | Ga0501067_0370523 | |||
| 1518 | Ga0501068_0052586 | |||
| 1519 | Ga0501068_0075468 | |||
| 1520 | Ga0501069_0115577 | |||
| 1521 | Ga0501069_0293675 | |||
| 1522 | Ga0501069_0655481 | |||
| 1523 | Ga0501070_0050693 | |||
| 1524 | Ga0501070_0057627 | |||
| 1525 | Ga0501071_0000033 | |||
| 1526 | Ga0501071_0074427 | |||
| 1527 | Ga0501071_1330684 | |||
| 1528 | Ga0501072_0025229 | |||
| 1529 | Ga0501072_0214357 | |||
| 1530 | Ga0501074_0006335 | |||
| 1531 | Ga0501074_0028922 | |||
| 1532 | Ga0501075_0007969 | |||
| 1533 | Ga0501075_0054418 | |||
| 1534 | Ga0501076_0021171 | |||
| 1535 | Ga0501077_0016057 | |||
| 1536 | Ga0501077_0018021 | |||
| 1537 | Ga0501077_0568241 | |||
| 1538 | Ga0501079_0000130 | |||
| 1539 | Ga0501079_0115812 | |||
| 1540 | Ga0501080_0005135 | |||
| 1541 | Ga0501080_0090738 | |||
| 1542 | Ga0501081_0001035 | |||
| 1543 | Ga0501081_0006137 | |||
| 1544 | Ga0501081_0032647 | |||
| 1545 | Ga0501081_0530775 | |||
| 1546 | Ga0501083_0048535 | |||
| 1547 | Ga0501083_0055644 | |||
| 1548 | Ga0501035_0269067 | |||
| 1549 | Ga0501044_0101169 | |||
| 1550 | Ga0501044_0300931 | |||
| 1551 | Ga0501045_0000191 | |||
| 1552 | nmdc:mga08y16_1574903_c1 | |||
| 1553 | nmdc:mga08y16_722796_c1 | |||
| 1554 | nmdc:mga0n895_14480_c1 | |||
| 1555 | nmdc:mga0n895_27788_c1 | |||
| 1556 | nmdc:mga0rr50_31953_c1 | |||
| 1557 | nmdc:mga0rr50_524464_c1 | |||
| 1558 | nmdc:mga08x19_418696_c1 | |||
| 1559 | nmdc:mga08x19_676954_c1 | |||
| 1560 | nmdc:mga0a205_71834_c1 | |||
| 1561 | nmdc:mga0a205_94809_c1 | |||
| 1562 | Ga0495601_0002963 | |||
| 1563 | Ga0495601_0030509 | |||
| 1564 | Ga0495601_0074646 | |||
| 1565 | Ga0495601_0092972 | |||
| 1566 | Ga0495601_1059845 | |||
| 1567 | Ga0495612_0007536 | |||
| 1568 | Ga0495612_0067822 | |||
| 1569 | Ga0495612_0084346 | |||
| 1570 | Ga0495612_0504613 | |||
| 1571 | Ga0495595_0088098 | |||
| 1572 | Ga0495619_0012071 | |||
| 1573 | Ga0495619_0031354 | |||
| 1574 | Ga0495619_0032727 | |||
| 1575 | Ga0495619_0311851 | |||
| 1576 | Ga0495619_0461415 | |||
| 1577 | Ga0500566_0042826 | |||
| 1578 | Ga0500614_148774 | |||
| 1579 | Ga0501084_0013710 | |||
| 1580 | Ga0501084_0061917 | |||
| 1581 | Ga0501084_0292001 | |||
| 1582 | Ga0590074_052902 | |||
| 1583 | Ga0590075_010989 | |||
| 1584 | Ga0590075_041984 | |||
| 1585 | Ga0590075_044316 | |||
| 1586 | Ga0590077_087654 | |||
| 1587 | Ga0501082_0013535 | |||
| 1588 | Ga0501082_0062438 | |||
| 1589 | Ga0501082_0085427 | |||
| 1590 | Ga0466962_0000666 | |||
| 1591 | Ga0466962_0002358 | |||
| 1592 | Ga0466962_0065164 | |||
| 1593 | Ga0466962_0070488 | |||
| 1594 | Ga0466962_0214239 | |||
| 1595 | Ga0530510_0006298 | |||
| 1596 | Ga0530510_0026443 | |||
| 1597 | Ga0530510_0087726 | |||
| 1598 | Ga0530510_1342441 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5hr1-assembly7.cif.gz_G | crystal structure of thioredoxin l107a mutant | 0.9747 | 26 | 100 |
| 1nw2-assembly2.cif.gz_F | the crystal structure of the mutant r82e of thioredoxin from alicyclobacillus acidocaldarius | 0.9684 | 1 | 103 |
| 4xhm-assembly2.cif.gz_B | archaeoglobus fulgidus thioredoxin 3 m60h | 0.9678 | 2 | 103 |
| 2yn1-assembly2.cif.gz_B | crystal structure of ancestral thioredoxin relative to last gamma- proteobacteria common ancestor (lgpca) from the precambrian period | 0.9669 | 1 | 105 |
| 1v98-assembly2.cif.gz_B-3 | crystal structure analysis of thioredoxin from thermus thermophilus | 0.9666 | 20 | 103 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5hr1G00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9747 | 26 | 100 | 3.40.30.10 |
| 1v98B00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9666 | 20 | 103 | 3.40.30.10 |
| af_Q8LD49_56_177_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.964 | 1 | 103 | 3.40.30.10 |
| 1thxA00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.955 | 3 | 103 | 3.40.30.10 |
| 4ulxA00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9549 | 1 | 105 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A8A7QYL4-F1-model_v4 | deleted | 0.9756 | 1 | 103 |
|
| AF-A0A7C4PS51-F1-model_v4 | Thioredoxin | 0.9753 | 3 | 103 |
GO:0005737
GO:0015035 |
| AF-V4Q9E1-F1-model_v4 | Thioredoxin | 0.9739 | 2 | 103 |
GO:0005829
GO:0015035 GO:0045454 |
| AF-A0A1I3R3P2-F1-model_v4 | Thioredoxin | 0.9731 | 3 | 103 |
GO:0005829
GO:0015035 GO:0045454 |
| AF-A0A1Q7W231-F1-model_v4 | Thioredoxin | 0.9725 | 1 | 103 |
GO:0005829
GO:0015035 GO:0045454 |